3BMNA

Structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor (compound ax3)
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
267
structure length
250
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords Pteridine reductase
total genus 90
structure length 250
sequence length 267
ec nomenclature
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3bmnA00
4RZIA 5C5IA 1LSSA 2NSDA 3U5TA 1GZ6A 4TVOA 3SC6A 4OXNA 1VKOA 1A9YA 4KMSA 4D0RA 2HQ1A 2UAGA 4CUJA 4JK3A 1YDEA 3WQRA 4FB5A 4DIFA 4P4LA 4TRMA 3WWYA 3OJFA 1OC4A 2Z1MA 1RM5A 2VYNA 4KUGA 3WGOA 4CMHA 4CLXA 3L4SO 1NQ5A 3RJ9A 3HN2A 3ROQA 3PHHA 2PD4A 2O3JA 3NGLA 1WDMA 2O4CA 2XXJA 5B4UA 4J1QA 4GMFA 3IL2A 1T24A 1W73A 4PRLA 4K6FA 2Q4BA 4JP3A 3WB9A 3MJVA 3CTMA 2PY6A 3BTUA 1F14A 3NDIA 3HSKA 1EVIA 1Z74A 3DR3A 2VHWA 4GLLA 1UP6A 4WEOA 4XRGA 1LEHA 4UEOA 3DAPA 1B8UA 1LA2A 2FSVA 3WGQA 1LLCA 5JLAA 3PEFA 4IS2A 1P1HA 4B4WA 4DVJA 3GZNB 4O5OA 2FWMX 5HA5A 4ALIA 5JPIA 1I3NA 3GRPA 4YWJA 4Y67A 2O3TA 2Y1OA 1U5CA 3I6IA 4GI2A 5IG2A 1HL3A 3TSCA 3DL2A 5L51A 4IMRA 4IGFA 2PH5A 4E2WA 2A4KA 2WWRA 4GX0A 4I9NA 3WS7A 1NFRA 4RVGA 1PSDA 2HUNA 3JQ8B 1SOVA 1U4SA 2FZEA 3B1FA 4CLOA 3RQSA 3TDKA 4CMKA 1SC6A 1DC3A 3A4VA 3GVHA 1Q2XA 1HYEA 4ALJA 2Y99A 3TF5A 1E5LA 5FFFA 5G4LA 2AQIA 1Y8RB 3MTGA 2BH9A 4DIOA 1EUDA 2VHXA 2DFDA 1EEHA 2VUUA 2WYVA 4AJNA 4L8VA 2IYOA 4N54A 2JHFA 2HMSA 1DIRA 4NJOA 3WIEA 1IPEA 2V6GA 4Z9FA 1MGOA 5JAIA 1OC2A 4WCDA 4XR4A 4C4OA 3QIVA 5TSDA 1SEVA 3ZWMA 2WM3A 2NVUB 4YB8A 1P3DA 5C37A 2DQ4A 3KTDA 3QVSA 4JBIA 2GZ3A 4DXHA 4ALKA 1PGPA 1GDHA 5A06A 3KEOA 5IAAA 2ZQYA 2OXIA 4GX2A 4MPDA 1UXJA 1T2FA 3BTVA 3ADPA 4R5HA 3DWFA 2QRKA 3FF4A 1SAYA 2HJSA 1BMDA 1GQQA 2OOSA 4DYDA 2X0NA 5BSEA 2I3AA 1Q7BA 3KSUA 4NPCA 4HX5A 4RVUA 4UVHA 2CDCA 1XU7A 4CMGA 4QO7A 2Y66A 4QFCA 3L4BA 5G0TA 1X1TA 4CM9A 3M1AA 3L9WA 4WCFC 4CMEC 1PWZA 2EJWA 4PG5A 2P68A 1FDTA 1X15A 2IZ0A 2V6BA 1HWYA 4MP3A 3QHAA 4JP2A 5L7YA 5CEFA 4K1LA 1NQTA 4LRSB 3ROKA 2C07A 2FR1A 3V1TC 1T1RA 4D46A 1F8FA 1GD1O 3DZHA 5G2OA 1KC1A 4J0EA 4Z3DA 4HP8A 4CQMB 3BMCA 5BNFA 3ZWPA 3P19A 3L6DA 4EI2A 1Y8RA 1IOLA 1H2HA 1LNQA 4DUPA 2B36A 4GSLA 1BGVA 5TJHA 3EDMA 4GPD1 1GYPA 2AG8A 3MEQA 3Q1LA 4J4TA 4OQYA 3UF0A 3ZNOA 4BMSA 2B35A 2O50A 4YTEA 4ZICA 3PI7A 3OA0A 5F1KA 4CM4B 4XD2A 2P2SA 2FP4A 3H7AA 3GF4A 3GPDG 5TT0A 3QSGA 4Q3NA 1SZJG 4YAGA 1CDOA 2GASA 2O3SA 5T67A 3CMCO 3QP9A 4D3SA 4KWIA 1P1KA 2PZMA 4AJOA 2OP0A 4A27A 4C7JA 1LDEA 1R4NA 3CPSA 5ITVA 2QRJA 4IZIA 1TA4A 4GKBA 4OJNA 3JYPA 4S3MA 3G3EA 1YJ8A 2ZTVA 1K3TA 2CZCA 5JY6A 5A3JA 1JTVA 2PH3A 1IHXA 1MXFA 4H3VA 2DTXA 1PX0A 4A5OA 1ZEMA 1MG0A 4UAGA 5F5NA 3T4XA 4FW8A 3W4KA 3DBRA 1PR9A 3ZWYA 2PD6A 3GK3A 2NUAA 2DAPA 1N1GA 4M1QA 3WJ7A 3FNEA 2V65A 3VDQA 4B79A 1EQ2A 3VDRA 4U7WA 2BGKA 2D3TA 1KEPA 4W7HA 4JBGA 3C1OA 2ZB8A 1NFFA 1RKXA 4J1TA 3F1KA 1B3RA 1YBVA 3NTOA 4DYVA 2W2KB 2FR8A 3IC5A 3MOIA 5HS6A 3S8MA 3JQ6A 3GDFA 5AXDA 2B5WA 3K5PA 1XDWA 4BOYA 4WJZA 1QSGA 5ITWA 1ENOA 3IOYA 1A72A 5T57A 2BFAA 2FRDA 2X0RA 4MOWA 3O03A 1HSOA 1LRLA 4H16A 1AXEA 2QYTA 1JA9A 2G5CA 1E5QA 3L6OO 3JQEA 4R68A 2JD0A 4TVBA 4R51A 3FNHA 1E3IA 4U8GA 5DN9A 1O5IA 1CWUA 4K9DA 4MJLA 3UICA 1JN0A 1JAYA 2O3QA 2X0JA 2Z5LA 1CERA 4XX0A 3ULKA 4MIYA 4RO0A 5EINA 1K5HA 4EUFA 2JD2A 3E1KA 1UR5A 1ENYA 1DXYA 2VHVA 3Q11A 1R16A 4E5NA 1HE2A 4XYEA 3ZWAA 3Q2IA 2X6TA 3VPFA 1W6UA 3I9MA 2QQ5A 1PL6A 5GZ6A 2OMEA 5DCYA 2W8ZA 4OH1A 1MUUA 4OXKA 1P1IA 3LZ6A 3G1TA 4J43A 3BMQB 3DXFA 3U0BA 2YDYA 3ZHZA 1E7QA 3DZJA 5COBA 2EP7A 4HFNA 2O2YA 3VHRA 2IYPA 1FMCA 1KVRA 1XELA 3F5SA 3WBFA 4F46A 2Q46A 5MDHA 2VQ3A 4IY1A 2ZATA 2ZYGA 3AY3A 5G0VA 2CF5A 2QRLA 1WZEA 4UUNA 3FTNA 4N7RA 4YJGB 2PFGA 1PJBA 1ZZEA 1R4MB 3ZHYA 3WXBA 3OIFA 1ZEJA 1LUAA 3HFSA 4CJXA 1HE3A 3WIDA 4DLLA 4DC0A 4DLAA 4Y6SA 4D3FA 4NBTA 1ADGA 1BHSA 1WVGA 4R16A 5CG2A 5C7OO 1K89A 1TLTA 2E37A 1ENZA 1NVTA 3R0IA 2C29D 2HLPA 4YPOA 2VT3A 3QY9A 4D3DA 4D41A 4MKXA 3WFJA 2IXAA 3K9QO 1ZXLA 5JC8A 5JDCA 1ORRA 1HDRA 4CLDA 1I0ZA 2G76A 4J4BA 1SBYA 1OBFO 2PGJA 3O9ZA 4U6SA 5K0ZA 2FMUA 4I5GA 4B3JA 4YRAA 3OQ6A 1O8CA 1ZBQA 2I9PA 3WYEA 4CLRA 2BF7A 3FWZA 1H6AA 5EN4A 2OZPA 2X7HA 4FGSA 5CDTA 4WECA 3P2OA 2J3KA 3DMYA 3JQCA 2FSSA 1T4DA 1KIFA 2ZIZA 3HDHA 3KB6A 2XXBA 4B8ZA 1A5ZA 1G1AA 5LDGA 1PWXA 2BKAA 2O3RA 1OI7A 1NYTA 2GLXA 3WWZA 2CY0A 1ISHA 3D3EA 1Z75A 3E18A 4G2NA 2OGUA 4I8XA 3UW3A 3W6ZA 4DIBA 4G5HA 3DBVO 1F8GA 2HK8A 3DMTC 4YQYA 2DBRA 3GY0A 1P44A 3NJ8A 4PLPA 4QECA 1RM3A 3VZPA 4DL9A 4CV2A 1T2CA 1CIVA 3VPHA 4LMPA 1NNUA 3OFSA 4IQ0A 4BNLA 4NBRA 5F5LA 3WMXA 4MVJD 4AICA 3JQAD 3I6QA 1K6XA 4FS3A 3EZYA 3AOGA 4PLVA 1T26A 4MP6A 3GEGA 4Q3EA 1O9BA 3AM5A 5DP2A 1I01A 5K6AA 2Q2WA 5I7FA 2VUSA 4UVDA 1LLQA 3ZWCA 3AI2A 1UAGA 4YR9A 1AUPA 3FR7A 5G0WA 5A9TA 1I10A 3RBZA 4CM1A 1MV8A 4IQ8A 1CQJA 1BDMA 1I36A 5L4SA 5ILOA 1LC0A 4OXYA 3F47A 3NTRA 4XZ3A 4RPHA 3AU9A 3NDRA 1NFQA 4YQZA 3KOUA 1R4NB 1Q0QA 4CMEA 5IDYA 3E82A 3TL3A 1P45A 3JYOA 4FIZA 3ZWWA 3WR5A 2D4AA 1P77A 4YEDA 2V7PA 3DO5A 5G4KA 3VTZA 3WNVA 4NK5A 5BSHA 1PQUA 4CQLB 1PR3A 2V6MA 3RIHA 2B4TO 4BB6A 3ZNQA 4YT8A 4OYRA 1B8VA 5ENVA 3RJ5A 4WLEA 1B16A 1LBEA 2C82A 4UULA 4BVAA 4RCVA 3LC1O 3WSVA 6ADHA 2HMVA 2BFMA 3D7LA 3CUKA 1WMAA 2JKVA 4BO1A 2W2KA 1F12A 2XF8A 3LF1A 4F6LA 2YV1A 3HDQA 1CQIA 2FHSA 1YL5A 3C85A 4NK4A 3U3XA 1MC5A 2G17A 3ZV5A 4RGBA 3KM0A 4YRBA 3RKUA 4UUMA 3VAZA 1WPQA 4B3IA 1LRJA 4FFRA 2PA3A 1FXSA 4FCCA 3OEYA 4EEZA 1XHLA 1Z6ZA 4RL6A 3WICA 1YQXA 2D1YA 4OQZA 4GGOA 4JXKA 1A27A 4ZQEA 1KS9A 1P33A 2DBQA 1ONNA 3W8DA 2VWHA 1K6JA 1WP4A 3VPSA 3CEAA 4KOAA 3RUHA 4OIMA 1ENPA 4E6PA 4KTTE 1HEUA 4BKRA 3E03A 4BB5A 2D2IA 2VOEA 3KUXA 3GEDA 3AWDA 1HRDA 3TFOA 3KLMX 5T64A 1KETA 3DBLB 3ONFA 3E6AA 3RFXA 3IQDB 2OO5A 4B4OA 2Q1SA 5ENDA 2XOXA 4A26A 2V6FA 4WUVA 5BNTA 4BKOA 4B7UA 1LTHR 1UDBA 3C8MA 4OOFA 4RV9A 4XDYA 5KOIA 4HWKA 4BMNA 2UDPA 1SOWA 1GL3A 3INRA 5DOVA 4TKLA 3MOGA 3V8BA 3H5RA 2CF6A 4XYBA 1H9AA 2DBVO 3WFIA 2WYUA 4L0QA 3PWZA 3ZHXA 3GDOA 1LQTA 3LC2O 5A4DA 3G0OA 3GA0A 2H6EA 4Q3CA 4DPKA 4CLHA 2VWPA 1YS4A 4ZQBA 2EW2A 4DQVA 3WTBA 1VRWA 4HNGA 1T2AA 2VZ0A 4D42A 1A4IA 5A3VA 3D3WA 1R4MA 3OJ0A 5H83A 1KC3A 2YUTA 2VZ9A 3ZU4A 5IZCA 3I9NA 4BNGA 3MTJA 1QV7A 1JKIA 1WAMA 1PZGA 2EERA 3FBTA 1YONA 4E0BA 1IULA 2YZ7A 1LDMA 4ND4A 1QYWA 1XCBA 1QKIA 5TLSA 5KTKA 1YBMA 4KQXA 1CEQA 5BSFA 3D1LA 4BNWA 3WYCA 4YA6A 4PG8A 4XGKA 2YFQA 4FBGA 2JFGA 1F0YA 3N58A 3U4IA 3LQFA 3NT5A 2CUKA 1N7HA 1XWFA 4JJIA 1Y6JA 4TMFA 1T4BA 4CQMA 5DBIA 2QW8A 1GU7A 2DU8A 3CSDA 4ALMA 3VH3A 4E5MA 1ZH8A 3DTYA 1JKFA 4KUEA 5A05A 3U4CA 5K9ZA 3LT2A 5A5EA 2WEKA 3ASVA 1EE2A 4Y8VA 1D7OA 3BMOA 1YL7A 4ONEA 3HUDA 3VPGA 1EVZA 3DBHA 2OL4A 4ND1A 1EUCA 2EF1A 4TRRA 3AUUA 2AEMA 1I3MA 5EMHA 1VL0A 3GAFA 1QYCA 1B0AA 2I3GA 3QVOA 2JFFA 4J2HA 4IZHA 2Q45A 4A73A 3EK2A 5IFLA 1HETA 5B12A 5JDCC 4PLTA 3TZQA 3WYBA 4UVGA 1QMGA 1PJ2A 1U3UA 2J3HA 3GN1A 1MLDA 5CDSA 3P7MA 1BW9B 1DLIA 4YT2A 1PGOA 3GFBA 3QWIA 3Q3CA 4R69A 2H9IA 1MG5A 3H9JA 3I5MA 1MX3A 4EUEA 3TZHA 3QLJA 1UDAA 1R0LA 5B37A 1HDZA 1MFZA 1HDOA 2VNSA 4AJKA 4LK3A 5IDQA 3I9LA 3TJRA 1E1KA 3M1LA 1LX6A 5IZCC 4JQCA 1LLUA 4CMJA 3FPCA 2C5EA 3OQ1A 1YB4A 1SEPA 2CMDA 2C7VA 2HDHA 3GGPA 1UDCA 1HKUA 4PG6A 1NP3A 3PRJA 4NDNE 3AI3A 4E31A 2Q1TA 3IJRA 3RKRA 4BO2A 2EGGA 3PYMA 4J7UA 4U5QA 2O23A 2NV6A 3GAZA 4YT4A 5CAEA 5EESA 1GEGA 1LC3A 1N7GA 1P74A 1L7EA 1XR3A 3R1IA 5DF1A 4LCJA 3VVBA 5I8WA 5THQA 3BMOB 1AXGA 3DOJA 4GL4A 3RAJA 1SMKA 2A9FA 3Q9NA 3HB5X 4J7CA 2X9GA 4TZKA 1PJ4A 2EV9A 2VTDA 2DUWA 4WLUA 2OP1A 3QWBA 4L4RA 4J91A 1QG6A 4NBWA 3RC7A 4BIIA 4R1NA 3QWAA 3A06A 1GQ2A 1Q0HA 1WLYA 4P4NA 4EJ6A 1E1LA 4GBJA 1NAIA 1NWHA 1EE9A 3PWSA 4NBVA 3KVOA 3B70A 4E30A 3IJPA 3MCVA 2IODA 3I4FA 1DRVA 4E12A 4AL4A 1GAEO 2G0TA 3ZU5A 4GAEA 4J49A 2RH4A 3AOEC 2LDXA 1BSVA 1HF3A 4EYEA 2VT2A 2XPCA 5HRUA 2YQ5A 1NVGA 3FR8A 3JQAB 3L07A 1V3TA 3K8ZA 1U2DA 2J6IA 3W1VA 3UAGA 2QIOA 1KY5A 1LDBA 1ZK0A 1HLDA 3F1LA 4I1IA 5TT1A 2W4QA 2J3JA 3DZGA 3PXXA 1MXHA 3EYWA 5KJFA 3SLKA 5JAQA 3BTSA 3JCZA 4IDEA 2CDBA 1T2EA 3UOGA 3V1YA 4GKVA 4HY3A 4PVCA 4IJWA 2D8AA 3D64A 1BDBA 1HDYA 3DZKA 2PGDA 1VLLA 2R6JA 2GR9A 3EC7A 5L45A 1FF9A 7ADHA 3VVCA 3ITDA 2DTEA 4AJLA 1BG6A 1HYHA 4HXYA 4IS3A 4YCAA 2VWQA 1U8FO 1V0JA 5EL0A 3UH1A 1LSJA 3G17A 4YDRA 3HG7A 1KOLA 3X2FA 4EJMA 4ZD6A 4FR5A 4BNMA 1EDZA 2YHIA 4HFJA 1KYQA 5FEUA 1ULUA 4MKRA 3PDUA 2OORA 1O89A 2GERA 4HUJA 4J1NA 4X54A 3RUCA 1E3JA 2AQ8A 4URFA 2GZ1A 3EVTA 4Z0PA 3TPCA 5ICMA 1I33A 5IXYA 1BRMA 2QZ9A 4R9SA 3A1NA 1AGNA 3UCEA 3LDHA 2PZJA 1EUZA 5ILGA 1CF2O 4ESOA 4BNXA 3HE3A 1Y5MA 1HSZA 2GF2A 3OM9A 2PR2A 2GDZA 2X86A 3ANLA 1G0OA 4UEJA 3R3JA 3GZNA 3EZLA 2P4QA 3PP8A 2EIHA 3ZH2A 2C0CA 2TMGA 4RDIA 3JQDA 1C3VA 5TGDA 2UYYA 4YXFA 1TT5A 1E7SA 4RF4A 8LDHA 5JO0A 4ZQHA 2H63A 4D43A 4D79A 1ZIDA 4B4VA 3OIGA 1LSOA 3D4NA 3JQ8A 4I9HA 5IDXA 2D59A 1SB9A 2VYVD 2Q1UA 2YYYA 3V1UA 3AUSA 5L53A 1LDYA 4CV3A 5JYDA 4TKMA 4IJKA 2X9VA 3VKUA 5CG1A 5JSFA 5CDUA 1XEAA 2EKLA 1BXKA 1XIVA 3F3SA 4LISA 4U0JA 5JO9A 5JCJA 1BXGA 4ZN6A 1XYGA 3TOXA 4CR8A 3G49A 1DFIA 4EITA 2YW9A 4IXWA 5KJCA 4L4XA 4ND5A 4XYMA 3F6YA 2CDAA 1HDGO 3E9MA 5F1OA 2HKIA 4EZBA 1Z7BA 4XQ9A 3UUWA 1Y9EA 4DLBA 5I9LA 3K31A 4WLNA 3H8VA 3ZV6A 4DA9A 5LDHA 3DB2A 4IDDA 4CLOB 3ZI0A 5L3ZA 3STHA 3O8QB 2AE2A 2E49A 3KO8A 5GY7A 1B3BA 2O4UX 2WYWA 1FJHA 3BHMA 3NKLA 2EWMA 1HZJA 4WOJA 2JCXA 1U1IA 3ENNA 3IMFA 4ZU3A 4AJHA 3NT2A 4JIGA 3FTPA 4OL9A 2AEFA 3TRIA 3ZHBA 2HSDA 3F4LA 4R1TA 4D0SA 1E77A 3JQ9C 4XRRA 3OEWA 4E2XA 3O38A 1PZFA 1VSUA 3IS3A 4ALLA 1U3WA 1P0CA 3WSWA 4RVFA 3DBHB 4O63O 3Q2KA 4IGEA 4K26A 3DDNA 3DFUA 2VHZA 1QV6A 2NVUA 4F3YA 1HXHA 2YV2A 3JQGB 3CXRA 2ZK7A 5KVCA 2YFHA 4Y6RA 4YVFA 4E5YA 2NNLD 4NJMB 4BNJA 4BNTA 1Z45A 3EMKA 3RVDA 4BO4A 3LT0A 5JXWA 2GN6A 4OKIA 4E21A 2HJRA 4OSOA 2DUUA 1NM5A 3WG9A 4OSPA 1YB1A 4CR6A 2AQKA 2AMFA 2P5UA 4CV1A 4C7KA 4CM9D 3H9EO 3GG9A 4WNCA 1DSSG 1EZ4A 3PTZA 1FK8A 3P2YA 5I8ZA 4CUKA 1NR1A 3H9QA 5JMWA 3QQPA 1E3EA 3OIDA 4DBVO 3V2UA 3VPXA 2HAEA 1P1RA 4W7IA 1JW9B 1E1NA 1I2CA 2RHRA 1O94A 3WGTA 2ZB3A 3ITKA 4FPXA 1C1DB 1YXMA 2FPPA 3CIFA 2QYSA 4CMBA 3UFXA 3ZCXA 1UP7A 2EJVA 3O8QA 2JCYA 3ANMA 3QRWA 3INTA 4HADA 4F6CA 1D1TA 1GZ4A 1E3WB 1U7TA 1ULSA 2EW8A 2VRCA 1D3AA 3CINA 3BMCB 3PHGA 1X7HA 2ZQZA 2VYND 2Z95A 2NVWA 3DBLA 4BNVA 4NHEA 4WPGA 1NAHA 4PLZA 1XU9A 1GYRA 4CLRB 3JD2A 1ADCA 4DMLA 1PQPA 3HHPA 2Q49A 2JAHA 2GCGA 3H6KA 4B8WA 3LSYA 4D45A 3T7EA 1QLHA 4CMCA 1C0IA 2W98A 4WEQA 5H81A 1QYDA 3OP4A 3P5SA 1P9LA 5TF4A 1RJWA 1UJMA 2VNAA 5GZ3A 1P1JA 4MDHA 3C24A 3I9JA 4MIEA 4WGGA 4BKQA 3LT1A 1U4OA 3FWNA 3JQGA 3NT4A 1IZ9A 1PGQA 1ADBA 2JL1A 2NU6A 1IPFA 2HMWA 4DQXA 4FFLA 3OJEA 1RM0A 2GGSA 1DRUA 4XKJA 5I7SA 3TNLA 3B1JA 1MC4A 3VC7A 1UUFA 1ZMTA 4M49A 4ROSA 2QHXA 2VN8A 3D4PA 3OA2A 4AFNA 1P31A 1NPTO 2C2YA 1UZMA 3QWHA 4M86A 4H7PA 5JE8A 2SCUA 5CDYA 1XKQA 4DWVA 2P9GA 3DZFA 1E6UA 1B26A 4FSHA 4D44A 4NBUA 4R9RA 1DB3A 2UVDA 3HNPA 4W4TA 4Y98A 3KEQA 2WSBA 4R54A 3ABIA 4O0LA 3WLFA 4E33A 4MVJP 3W8EA 4PGFA 1GCUA 1A9ZA 1ZW1A 2QX7A 4HKTA 3HB4X 3ZZNA 1BWSA 1VJ0A 1Y81A 3BA1A 3PZRA 5I7VA 3DEYX 1EFLA 5DNAA 4GVXA 1XGKA 5F3RA 1XSEA 1VPDA 2ET6A 2RH8A 1R12A 2YY7A 1K6IA 3UVEA 1PJSA 3OICA 3RC2A 3I4CA 1DJNA 1SNYA 4TWRA 4CM5A 5A1TA 3L9XA 1HDCA 3CZMA 2X9NA 3EY4A 1QYXA 2P9EA 3X2EA 3WGZA 2J5QA 2AE1A 3CZRA 4YAKA 2EP5A 3GHYA 1TT5B 1K0UA 4L73A 3C3XA 2VZ8A 2OFPA 4E3ZA 4NFSA 3KYDB 4CR7A 1QP8A 2D5CA 4HBGA 3BZUA 5DT9A 3INGA 2JD1A 1SB8A 1IB6A 1DC5A 4PG7A 1D4FA 3AOEA 2J8ZA 1RWBA 3OETA 1O0SA 1PQWA 2Y1EA 4BNFA 1PL7A 1AE1A 2HRBA 3R3SA 4RPKA 2BFPA 5HWSA 5KJEA 1FDWA 2RHCA 1WDKA 1JVBA 3RBXA 3BHJA 4AJ4A 3ZGYA 3PGXA 3PFFA 1ISMA 4CUZA 2ZTLA 3WOHA 1DAOA 4GMGA 3FBGA 1WMBA 4TRNA 4LGVA 1XA0A 4J4HA 1N1EA 3U49A 1VI2A 4GX5A 5A9SB 4E2ZA 2AW5A 5DULA 2ZYAA 5U9CA 1R37A 1Z82A 3QA9A 4BNZA 2WE8A 3VTFA 2PWZA 4W99A 3U4DA 2D0IA 3NUGA 1KVQA 1H93A 3KSDO 1DC4A 3PJDA 4R1SA 4CM4A 4ND3A 1DHTA 1ZCJA 2R2GA 4PRKA 4WLVA 3UN1A 4DGSA 3FSRA 3S2FA 3K2EA 1N9GB 1O95A 1P0FA 1HE5A 2Y05A 1FDSA 3D0OA 4RJTA 2BD0A 4J9VA 9LDBA 1J49A 1NR7A 4RORA 5ICSA 1YVEI 3LLSA 3UXYA 4GLOA 1U7HA 5FI5A 1AHIA 3KYDA 5BSGA 1I30A 1JWAB 4JX8A 1JQBA 4OKNA 5KIAA 1E92A 4BNIA 3F5QA 4JN6B 1H94A 1ONOA 4IUYA 2NU9A 4QUKA 3ETEA 4B7CA 2P4HX 1PZHA 4YAJA 4NNJA 5EQFA 4CL8A 4YJDA 4IDAA 3I9KA 1L7DA 1Y9AA 1GYQA 3K30A 3OJOA 5U1PA 4XB2A 5JMPA 5T8KC 3AY7A 1NASA 4II2A 3JSAA 5IN4A 4ZHSA 2DKNA 2HMTA 5C7IO 3JTMA 1RM4A 3MJTA 2I67A 1FDUA 2NWQA 3H3JA 2O7SA 4P22A 1UXGA 1DDOA 4K28A 3S2IA 3C1AA 4J6FA 2A94A 1CJCA 1E7WA 1I3KA 3GNSA 5A9SA 4BS9A 4GWGA 3L6EA 1XQ6A 2HK9A 3D4OA 3DC2A 4PIVA 4Z6KA 2BGMA 2GPTA 2Q99A 3MWEB 4N5MA 5T8KA 1PU2A 4BO8A 4XJTA 4RVSA 3LU1A 4BO3A 3H3FA 4GQAA 4OMUA 5L9AA 2Y1DA 3GR6A 2RBEA 1LSUA 1LU9A 4J9UE 4A2CA 1EFKA 1PJQA 4J3FA 4Q3AA 4CM7A 1NTOA 3RC9A 1T25A 2F00A 4FGWA 4WK6A 1EVYA 2PKQP 3WQSB 5CDGA 1PGJA 1ZFNA 3C7CB 3E9NA 1U3VA 3HN7A 3VH1A 3ZWNA 5GZ1A 1WNTA 2WD8A 3OJLA 3TZCA 4PVDA 3O4RA 2JHGA 2GN8A 1PZEA 2NVBA 4N5NA 4Z0TA 3JQFA 4BKUA 1ZO8A 3RI3A 3K73O 3H2SA 1ZKMA 2UUPA 1JAXA 2HRZA 2P9CA 2ZJ0A 3CE6A 3BMQA 1GY8A 1GZ3A 5TRTA 1ISJA 1TXGA 4B7XA 1QORA 4BGEA 1DOHA 4PLWA 5CEJA 5C7LO 2X1HA 1I24A 3NEPX 2B69A 2C2XA 4QT0A 3BMNB 1RYEA 1SCUA 3H9GA 4MVJI 4AJ2A 5T5QA 1DPGA 2EKQA 1B15A 4GSKA 4J2OA 4L4SA 1YO6A 4D7AA 3RC1A 3FCOA 4NG5A 4U6QA 2F1KA 5JW6A 1C0PA 1PIWA 3M6IA 2QG4A 3UHAA 3IKTA 4Q39A 3IDSA 4A0SA 4CPDA 4I5EA 5DOZA 1J0XO 4QFDA 1NWCA 1NX6A 4P38A 1M67A 2Z1NA 3LC7O 3ASUA 5JY1A 3HDYA 4FFNA 5JFOA 4JJFA 4CLEA 1GFSA 1AN9A 1ZMOA 4ILKA 5TS3A 4MIOA 1J4AA 1D8AA 1ZUD1 1E3SA 2J5KA 4DRYA 1UZLA 1Y1PA 2YJZA 3AUTA 3PIDA 3QVWA 4IJUA 3ZWOA 3PLNA 3MJSA 4E5KA 4ZQGA 1HLPA 3WX0A 3D3WB 3LVFO 1R66A 4ALNA 1NPYA 1GADO 4WOKA 3HWRA 4MINA 3AUAA 4OM8A 3DMTA 4W6ZA 1U3TA 4MVJM 4E5PA 1DLJA 5IZ4A 1LDGA 2E4AA 3ZW9A 3DBRB 1DBVO 5FF9A 4XQCA 1LQUA 5BR7A 4FOOA 1LJ8A 4YRDA 4BHTA 2FZWA 2HU2A 3QE3A 1HT0A 3VOSA 4KZPA 1PJTA 1M6WA 3T7CA 1M6HA 5K6AC 3JYQA 2GNAA 3QV1A 1ZK2A 3R6DA 1UP4A 4Z9YA 5F21A 1KBZA 3RROA 3QVTA 2POQX 1DIBA 5ADHA 1GPJA 4BO7A 4CM3A 1E7MA 4RLSA 1V9LA 3ONDA 4QQRA 2X8LA 4DMMA 1YJQA 3EUWA 4DBZA 2PKQO 1ZSNA 1UXHA 1X7DA 3WTCA 4BO5A 4XGIA 3B1KA 3JQ7B 4ZRMA 1GCOA 2R00C 2VHYA 3BXXA 4LRTB 1X7GA 5HM8A 3GLQA 4OOEA 2GO1A 2EEZA 2C54A 1BTOA 2G82A 4TQGA 3WLEA 4QX6A 2VTEA 1M66A 4DQUA 3N7UA 5AXBA 1GEEA 3GVIA 1ZSYA 2Y1FA 4BGVA 2YHIB 1R0KA 1YH3A 1ISGA 2EGHA 2DBZA 3DQPA 3PGJA 4IDFA 1K2WA 4UVEA 1UXKA 4E13A 5AOVA 4IJVA 3VH2A 2NADA 2EKPA 3I3OA 3SJ7A 4BUCA 4E4YA 4N18A 1ZK3A 1OMOA 2CNBA 5G4KB 4JJGA 1N8KA 4AVYA 3PIIA 1NXQA 4KUHA 1M2WA 2B4QA 2OHXA 4CQLA 5JCXA 3V5NA 2ILTA 4PLCA 4CL3A 3C7AA 2P91A 1PL8A 3WGGA 5I7EA 4NIMA 5JYEA 1DIGA 3KLPX 3A14A 1XLTA 5JDIC 1S6YA 4QXMA 5KKCA 2FPGA 1KEWA 3BIOA 4DREA 4CM8B 1E7YA 3GVPA 5I9NA 2Y93A 2DT5A 4BQRA 4J7XA 4LVUA 4Z0HO 2Y0DA 2OBNA 3IAHA 1NBOA 3GZ4A 4IDCA 3AW9A 4UVIA 3A28A 3SX2A 3RASA 1R6DA 3RUFA 4INAA 5JNLA 4MO2A 5EERA 5G0UA 1A4UA 3PJFA 4WKGA 1IHYA 3NTQA 1UXIA 4NMHA 4XYGA 7MDHA 1BXGB 1H5QA 2PZKA 4LSMA 2O3UA 4ID9A 3JQFC 3ETDA 4YBZA 5KJ1A 2IE0A 3JQBC 1YQDA 1OFGA 4I5DA 3K6JA 2RAFA 3AY6A 5EQDA 3QW2A 4NU6A 3WBBA 1BVUA 2AQHA 2I6TA 1N5DA 3AM3A 4ND2A 3IUSA 3GVXA 1GUZA 3FD8A 2RCYA 2Y0EA 3FPLA 3SC4A 3GQVA 5IJZA 3PFWO 3ROPA 1CETA 4JCOA 1ZVMA 3S55A 2DVMA 3MJCA 3ZDFA 2UUOA 3I1JA 4R3WA 4B3HA 4L75A 4EJ0A 5A04A 1W8DA 4J1SA 3H5AA 3W6UA 4RLHA 3ZV3A 4HFRA 4LMRA 2PK3A 3NYWA 4IMPA 3NAQA 5JAMA 4P8RA 4PLFA 4LSWA 2QZZA 3I52A 3FHLA 3DHEA 5KVVA 1VJ1A 3WGHA 4U0KA 3WGYA 2DM6A 3O26A 4Y6PA 3JV7A 3JQAA 4MVJA 1X14A 3BMNA 1PS9A 4BV8A 3DOCA 3GUYA 1H6DA 2PD3A 1NHWA 4FFMA 2NLOA 4NJMA 2WDZA 3GH3A 4FC7A 4EUHA 3ANNA 1ONPA 2PLAA 2W2LD 4BNNA 1NVMB 3KV3O 2FPIA 2IRWA 4BO0A 3TN7A 4MVJF 4XGNA 1U28A 1IZ0A 1VJTA 1LRKA 2DFVA 3TQHA 4NI5A 3ROMA 2JCVA 1B14A 3G79A 1ZJZA 2W2LA 2CSUA 3DZBA 4ZRNA 1ZNQO 4I5FA 3Q6IA 1HYGA 3AJRA 4E32A 1I2ZA 2DPHA 2X5OA 3ZU3A 4CMIB 3COSA 1VSVA 3M2TA 1N2SA 1YDWA 5A9RA 3RFTA 3PJEA 4PLYA 2CFCA 1YBAA 4Q9NA 5FI3A 3ORFA 4J16A 1A7AA 9LDTA 1R15A 4CV0A 2X5KO 4R3NA 3KZVA 5C3MA 2FOIA 3V2GA 3V2HA 1E3LA 1TI7A 3W4JA 2UV8A 3L0DA 1KVUA 1LI4A 1LLDA 1UAYA 1H9BA 1YGYA 3LT4A 4M8SA 3FNFA 5U4QA 3IP1A 5LCXA 3PDJA 4EBFA 3B20A 2GD1O 5AXCA 4M89A 3I9OA 1MFPA 4BO6A 5JS6A 4CQMD 1PJ3A 3UCXA 5LC1A 4PLGA 1YKFA 1N9GA 1V35A 3NRCA 1WWKA 1PGNA 2CVOA 1I32A 1Y7TA 1DIHA 4JNKA 4BNKA 3GFGA 4YT5A 2X23A 4MVJH 1OZAA 2HMUA 3B6ZA 3JD1A 2LDBA 1LDNA 3S2EA 4R4JA 1PS8A 3AU8A 3OHSX 2AHRA 2X0IA 2ZJ1A 1TB4A 3L77A 2H5LA 2X58A 3JYNA 4PLHA 2B4RO 4PFJA 4UREA 5TIIA 4WE3A 2X22A 3RSHA 2Q3EA 4RF5A 4BGIA 3PLRA 4XEHA 1IY8A 1VKNA 5IDWA 1CRWG 3DAGA 4YJFA 3ETGA 4ZJUA 1BXZA 1MP0A 3DOOA 2GYYA 2PGLA 3JQ7A 4WCFA 3FNGA 4TSKA 3U9LA 1CYDA 5IN5A 2BRUA 3GMDA 3PZBA 1FDVA 3MJEA 3Q0EA 4YJHB 2ZKLA 4NR0A 1U9JA 3BTOA 3OMLA 3N74A 3NX4A 4XA8A 5L40A 3LK7A 1YQGA 2IXBA 4GVLA 5KNLA 4YJGA 3JQBA 3ICCA 2ZB4A 4QTZA 3H4VA 1H2BA 4KQWA 4BNUA 2JFHA 1JWBB 3KBOA 4L9RA 4XIYA 4CMAA 3DZIA 3IIEA 4MVJG 2DLDA 1H0KA 5ER6A 5THKA 1TEHA 4IBOA 3PYXA 3TWOA 1EMDA 1RYDA 2NQ8A 2GUGA 3KRTA 1J5PA 5EPOA 2BELA 3PHIA 4A10A 1ZK4A 5COAA 3WQQA 1A71A 4MP8A 4FQ8A 2B5VA 3FN4A 1BVRA 5CFZA 4NQZA 4CM8A 3RBVA 1QXSA 3HZZA 4XQGA 4M55A 2AXQA 2I76A 2I65A 3M2PA 5KVQA 1DHRA 2DPGA 3DHYA 2YQ4A 1VM6A 3PHLA 5FYDA 3TZ6A 1N92A 2P5YA 3A9WA 1KEUA 1MA0A 4RQUA 3SJUA 5KCZA 5A5FA 3GRKA 3PPIA 3OH8A 3U4HA 1ZK1A 2O48X 3PHJA 4PZEA 4FFPA 2ZYDA 1I3LA 3DFZA 2BI7A 2X4GA 4EGFA 4YAEA 2BGLA 3F46A 5TNXA 3U62A 4BMVA 5HS4A 4FJ2A 1E1MA 1O6ZA 4EDFA 1GTMA 1ZJYA 4NH4A 3VH4A 1DIAA 2A92A 3OBBA 3PYLA 3E5MA 3PWKA 1VL6A 1Y8QA 1JDJA 4MVJE 1PS0A 2WE7A 5L7TA 5BQFA 5KVSA 3EVNA 4J0FA 2ZCVA 4NFYA 4EW6A 1EVJA 4LN1A 4AJ1A 2BLLA 4BNYA 5B4VA 3IKVA 1OAAA 5ER9A 3VZSA 3GPIA 1X13A 4PZCA 2GN4A 1EDOA 2YHUA 5HTOA 2IZZA 5TC4A 1E3WA 1Q7CA 1Q7GA 3WNQA 4FN4A 4FDAA 2IEBA 3K92A 4AG3A 4ZGWA 1H6CA 2R00A 3S2GA 3GMSA 1G0NA 2PTGA 5TX7A 5J23A 4IDGA 1DAPA 4F45A 4BL5A 1U5AA 2OUIA 4ZA2A 4A7PA 4G81A 5TJ9A 3PQDA 1HTBA 4AJEA 1YOVB 3F4BA 5L7WA 4H15A 5CP8A 3AK4A 2NQTA 5MGBA 3UKOA 1NHGA 5DCWA 3ZNNA 1UZNA 4FD3A 1MB4A 4TZTA 4DC1A 4CM6A 1C14A 3WJAA 4FC6A 2ZB7A 4UUPA 2E82A 5BNIA 3DONA 4R5MA 5BT9A 3RUIA 1TVEA 4BQPA 3WGIA 4EEXA 2Y68A 1F17A 2I66A 3E8XA 1IUKA 3HDJA 3KYCB 4S1VA 5DZSA 3DTTA 1J6UA 2E48A 4OO3A 3ZWXA 3ZW8A 4IIVA 2Y1GA 4IDBA 4IINA 4LCEA 3G1UA 1V3VA 5DBGA 3I23A 3RD5A 1QLJA 3GT0A 3E5RA 3GUCA 4L76A 5EJ2A 3BHIA 5T6BA 2J3IA 4K6CA 4TRJA 4XB1A 2C7GA 5L4LA 2CVQA 1IYZA 1F06A 4R41A 4Q3DA 5FWNA 4KTVE 1VE9A 3Q9UA 3W8FA 2NTJA 4WLFA 3H9UA 4O1MA 4II3A 1U8XX 1I2BA 3FI9A 1YRLA 3RU7A 3ST7A 2J5RA 1E7RA 1I8TA 3U09A 2WJPA 3JD4A 4UUOA 4PN3A 3RCBA 3DHNA 1P1FA 4QO8A 4XJSA 2Q50A 1EK5A 3ZU2A 5I9MA 1G6KA 2EG9A 1VL8A 3KETA 3VZQA 1NPDA 3H5NA 1KERA 1XQ1A 1YB5A 1QRRA 2EHDA 4JBHA 4M87A 3ZWBA 3E48A 4I9UA 4IIUA 2VYVA 4YACA 1QR6A 4HFMA 2PV7A 3GVCA 4OHUA 5EIOA 4Z3KA 4B4UA 5DCUA 1YOVA 3ZV4A 4KP7A 2FY8A 2X5JO 3NDJA 3JYLA 4ITUA 3UCFA 3GEMA 2JAPA 3E9QA 3AI1A 4L74A 4XDZA 1DFGA 5A02A 1S7CA 4OAQA 5CEEA 4XCVA 4Z9XA 6LDHA 1JVSA 2FN7A 5CPFA 4HV4A 1AHHA 3SLGA 2CD9A 1ZSVA 2B83A 1W4ZA 1Q1NA 3K96A 2GSDA 1ID1A 4N5LA 3LYLA 4KDFA 4AJJA 3ZNPA 5AVOA 5COQA 3TFQA 2VRBA 3HJAA 3ICPA 3QWFA 2VRCD 3D5QA 1C0KA 4RZHA 4KDEA 2Y67A 1JKJA 4GH5A 1IL0A 4IM7A 1DEHA 5B1YA 3LLVA 3PK0A 1B7GO 3NJ4A 5JC1A 4UEKA 4ZVVA 2VCYA 2NU7A 4GX1A 2IEDA 4YJHA 4P4GA 2OBYA 3I83A 4JLWA 2C5AA 3GNQA 4FOSA 5B4TA 2WMDA 3H65A 1PEDA 1X1EA 1GQYA 3AFNA 1WZIA 4LW8A 3ON5A 5DDIP 2GZ2A 3CKYA 1YWGO 3HQ4O 5IF3A 1UH5A 1U2GA 1EBUA 4PCVA 2HCTA 3LF2A 4WLOA 1SO8A 4DPMA 3AFMA 2I99A 1JU9A 5HBRA 3VKVA 5L4NA 1DC6A 3KSZO 3KXDA 3HADA 3PJGA 4BV9A 2XAAA 1LXCA 4AJIA 2HK7A 3GHHA 1W0CA 3OQBA 4TROA 4Y9DA 4BNHA 1KVTA 1VC2A 3GGOA 5AQ1A 5JBIA 2YV3A 4DTIA 3S1LA 2CVZA 1C1XA 5F1PA 5TQVA 3MJ4A 1NQOA 2NM0A 2E6UX 3GOHA 4IPTA 3ONEA 1ISIA 1PJCA 5AXAA 2EXXA 2IZ1A 4RF2A 3NV9A 2H1SA 1M76A 4FJ1A 1EK6A 4BO9A 1RPNA 3EAGA 4RVHA 5AYVA 3ENKA 1DFHA 4M54A 3W4IA 3DAFA 3GG2A 3HFGA 1X0XA 5JDIA 1BW9A 3BAZA 2O2SA 2Q2VA 1E0DA 3RFVA 3F9IA 4IXTA 3OF2A 3OSUA 4LVCA 1WXDA 3GDGA 2A35A 4GGPA 1QYVA 3MZ0A 5KKAA 4J90A 3WDSA 1V6AA 4PG4A 3CMMA 1NQAO 1A7KA 2ZTUA 1YL6A 2AEJA 5A03A 1GUFA 5L95A 3TOZA 3OECA 4O6VA 4JROA 3EGOA 4XYLA 4YYZA 1JLLA 1OOEA 4A03A 4FJ0A 1WDLA 1HE4A 2VWGA 2BHLA 1DRWA 2BFOA 3RUEA 1HZZA 4XQEA 3TL2A 3GGGA 5JCJD 2W90A 4Q3BA 3RUDA 1ADFA 2JJYA 3PQEA 1T1SA 3IP3A 2ZTMA 2VOJA 2DTDA 2HO5A 3PVZA 2NU8A 2WD7A 1ML3A 1PTJA 2B0JA 2YDXA 4R01A 1B2LA 8ADHA 3K2BA 1I5RA 4XR9A 4RPLA 1KEVA 1Z7EA 4W9NC 4CMIA 3SBOA 4O59O 3BYZA 4XWYA 3C7DB 1GV1A 1Y8QB 3L4BC 4YAIA 1C1XB 1Y5RA 2AA3A 2Q2QA 3H2ZA 3QJ5A 4RDHA 5CHEA 1ZXBA 4QSMA 1EQUA 4QEDA 3CH6A 4RPJA 4I08A 2AG5A 2TMDA 1E6EA 2PZLA 2DC1A 1X0VA 1D1SA 2B37A 3KYBA 5GMOA 4XIJA 4HNHA 3ZN2A 1ISFA 2WTBA 1R0SA 4RVDA 5JAZA 1T2DA 4G65A 4CODB 3MWDB 1IE3A 3FRJA 3T4EA 3EHEA 1YE3A 4W9NA 3C1TA 1DO8A 2D5AA 3KYCA 4RF3A 4R1UA 1KY4A 2C20A 3ZWVA 1GR0A 1H6BA 1B8PA 3GNTA 3IUPA 3VZRA 4JGBA 1L1FA 2PNFA 4DPLA 4AJPA 2NTNA 1TT7A 3ADOA 2VUTA 3GC6A 5H82A 2GN9A 3SEFA 4WNIA 4RQTA 1XG5A 2PKRA 2NACA 3AM4A 2RIRA 3RWBA 1E6WA 3NGXA 2Y0CA 2Q1WA 5KWEA 1WW8A 4RPGA 4W82A 3EW7A 3JD0A 3SVTA 4NU5A 5KJ6A 3D5TA 2BI8A 3JQ9A 2G1UA 1DJQA 2FR0A 3JD3A 4FFOA 4NZ9A 3WMWA 3RU9A 1HDXA 3TZKA 5DBFA 4ZQFA 1Q0LA 2Q4EA 1M75A 1GV0A 2IDZA 2O7QA 4OGWA 2BMAA 3RUAA 1V8BA 1Z73A 3PQFA 4YJFB 2Y1CA 3QVXA 4MKZA 2WD7B 4BKPA 5IXSA 1GPDG 1C0LA 3GN2A 4WCFB 4E2YA 2C59A 5CPBA 4KWHA 2ZCUA 1ARZA 1V3UA 4PZDA 1GUYA 1KVSA 1EBFA 4BGUA 4NFHA 1PJLA 1SPXA 4WASA 5DP1A 5G0SA 3SXPA 4IQGA 2GRAA 3KHUA 4GWKA 2I5PO 2NTVA 5ES3A 3UGKA 1C1DA
chains in the Genus database with same CATH superfamily
4KLZA 2WFZA 2Z3ZA 4N9WA 5B1DA 2NSDA 1JLRA 221PA 1G17A 1ZN8A 2BEJA 3AFGA 3T61A 2BISA 3CF6R 1SIBE 2E1PA 4QG3A 1NU8A 3HHEA 1D7AA 3K5WA 4KE6A 2IIPA 5ED0A 3U3KA 2UAGA 4XUCA 1YDEA 1YV9A 1XKTA 2IOFA 1Q11A 4QOHA 1W94A 1AO0A 2NSHA 2R11A 5JQGB 1QRTA 4LYAA 3LKBA 3ZH9B 3VQTA 4KUGA 4CMHA 4KQGA 5K6TA 2CV0A 2V0CA 5DI3A 2G80A 2H4ZA 2ISSD 3I04A 3K8YA 6CHYA 6YASA 2P2ZA 4YRQA 1PSZA 3HCDA 3A8TA 1KMQA 3EUAA 3NGLA 4LBYA 2XXJA 4Y1GA 3CLTC 1T24A 4NATA 5B2ZA 2EBWA 1FB5A 4X44A 3IDFA 2PWYA 3QI2A 1E2BA 2PY6A 2R8XA 3BTUA 1W0JD 3UHOA 4B6SA 1TMKA 1NC1A 2WY2D 3HSKA 2IITA 1Z74A 4M1ZA 3C7KA 2YCLA 1OBOA 3ONWA 1DUVG 5K5EA 2XYQA 3IBYA 3QE4A 4OQLA 3SC3A 3UKDA 4B5LA 3ZIAD 2QTRA 3BMXA 4H18A 2WK1A 2O57A 4ACBA 1OV4A 1W19A 3HKDA 2VP0A 1IU9A 1L4BA 1VHQA 2W37A 3DAPA 4GZMA 1DELA 1LA2A 4HC4A 4X7MA 3SS8A 1LLCA 3IBCA 1QYRA 5JLAA 3PEFA 2FDRA 1P1HA 1DBRA 4IS2A 4J75A 1UJ2A 2FEKA 3R9KA 4PHGA 2BM1A 4LFAB 4B3RB 4DVJA 3AHCA 1WA5A 5KHOC 1I3NA 1XEXB 3IUYA 4P35A 3ZXIA 1SZCA 1USWA 1M7HA 4TLBA 1YRQA 3CNOA 4LNAA 3DL2A 5L51A 3OFJA 2YWDA 1L5WA 4BNNA 3AFIA 4H7JA 3INYA 4E2WA 4ERNA 2WWRA 2Q07A 4L3VA 4RD6A 4BVEA 1R8XA 3PIRA 1GN9A 2YXEA 2AF3C 1J8DA 2FZEA 3KPYA 4L1KA 4UC0A 4WT7A 5AP9A 5EHIA 4RZUA 1QJ4A 2H7VA 5I8PA 3HNOA 4RM2A 4CMKA 3RVQA 3A4VA 3QXSA 4KO2S 1CR0A 2GEKA 2OSBA 4XUEA 1QGYA 1Y4SA 4AXBA 1HYEA 1TGYA 3RRFA 4A6DA 5FFFA 3TF5A 4OHXA 2NZ8A 4TWIA 5G4LA 3QTLA 2R96A 2AQIA 3PFIA 4MW9A 1N2XA 2BIFA 4DIOA 5F7OA 3ZHVA 1KYWA 2WYVA 3OZSA 4OP1A 2VUUA 2BVNA 4EKIA 3HCRA 3PUWA 4E5SA 1DINA 2XVYA 4N54A 5IT5A 2JHFA 1J21A 2HMSA 2I8AA 3ETHA 3N0XA 1NSYA 4OXXA 5EJIA 4YX9A 3QLUC 3D7RA 1W36C 4O33A 2O5EA 3N2NA 4O4JF 1UC9A 4FZJA 1XLTC 3A4NA 5TSDA 1KDYA 4XDHA 4NU0A 4URWR 5B3JC 1L7XA 1KMCA 2WM3A 3U7EB 1I0LA 2X14A 5F3DA 1H0RA 1CS0B 2JASA 5L3SB 2WAOA 1P3DA 2ADOA 5E1DA 3QVSA 2G9RA 3ADDA 4U7TB 4QHYA 4ALKA 5JI2E 4ZO6A 1GDHA 3LOUA 3K70B 4QTXA 2ZQYA 4GX2A 3A26A 1CY1A 1UXJA 2C95A 2C1EA 1AS3A 1W5SA 3B3FA 3FF4A 2DX7A 2HJSA 3QVGB 4NFLA 4U7HA 3U9SA 5AI5A 3FB1A 5HUJA 2XKKA 5BSEA 4J0JA 5BN4B 1GU0A 2I3AA 1W93A 4WZZA 1Z35A 2DWUA 4K87A 1OWOA 1YIOA 4PNHA 2HA0A 2B7CA 3RG2A 4B6OA 5DN6D 1S1MA 1SUWA 4HPXB 3QEKA 2RJNA 4MAAA 1Q21A 2KE5A 4JXJA 2GAOA 2D06A 3EVEA 4F5DA 3ZD7A 3ZEIA 2ATVA 3L4BA 4TUYF 1X1TA 5DKFA 2WHQA 4H31A 2WBLC 2K2QB 5JXGA 4UQOA 2EJWA 4I6GA 4NCNA 1HUQA 3LY7A 1FFXA 4MP3A 5L7YA 1DWUA 1EJ0A 3RIMA 3C6MA 2D1TA 3DF9A 3U4GA 4ZZ3A 4GDMA 4L7VA 4IOKA 5KUTA 2VAVA 4J0EA 1B23P 3KVYA 3FZGA 2AG6A 3VNSA 4HP8A 1N0IA 2C8VA 3BMCA 4KNVA 3W5JA 4CQMB 3BULA 3L6DA 4UQPA 1RWXA 4OI1A 3RHTA 3AR6A 1Y8RA 1H2HA 1LNQA 4D4HA 4WH0A 4TL8A 3OCVA 3G0DA 3CLTD 2VIIA 1BGVA 3JWJA 4GSLA 5IYZF 3WNDA 3AL0C 1WO8A 1H1LA 2RGDA 3M6FA 4GPD1 3Q1LA 4OQYA 2VF2A 2O50A 4YTEA 1NNI1 3JATB 4XIFA 3FMIA 4AW9A 3E58A 4F0JA 3DP9A 1POWA 2NG1A 4XD2A 5A4KA 1P4HA 2RC5A 1R0CA 1FPMA 2YZNA 3GF4A 3H7AA 3PB3A 2QZJA 1Z16A 5TT0A 4YAGA 2H5JA 3LM8A 2ORWA 1SCNE 1M5RA 1GHTA 2GASA 3MTDA 3ONNA 4K9MA 2FMKA 3SIXA 1P1KA 2PZMA 2HW8A 3FYUB 2B6NA 4A27A 3LDGA 3CPSA 4PSDA 1XCOA 2PEZA 2OZKA 4IZIA 3W6NA 4JHLA 2G8NA 3UPDA 2ICAA 3F2IA 3HJRA 4OJNA 5EZYF 1EVLA 4OAPA 2ZE7A 3Q7RA 1JTVA 2I6FA 2JFBA 4M60A 5CFOA 1YZUA 2LGJA 1XEWY 2A0UA 1ZMRA 2DTXA 3TTXA 4ZI3A 4A5OA 2NO0A 5HYVA 4TV8B 1MG0A 3EX7C 1PZXA 2GM9A 3W4KA 2WIBA 3TM5A 3ZWYA 3HJHA 3W90A 1S8OA 4ES6A 1JQ3A 4F2GA 1KO8A 5KQSA 2P30A 4ENSA 4XDGA 1L6IA 7REQA 2FG6C 2J7KA 1KO5A 3U4AA 4M53A 3CYFA 1QC5B 2Q4OA 4M1SA 2D3TA 2W8BA 4W7HA 2ZB8A 3H2KA 4MI9A 2Z2IA 1B3RA 1XRJA 4X9XA 3LCVB 1QIDA 1JEOA 1NSTA 3P9QA 2FR8A 2IXDA 2PCJA 2VDWA 4FXOA 4DJAA 5FXMA 3F7TA 5HS6A 3TD2A 4KBYA 5EEGA 3TEMA 4MUYA 1C4KA 3S8MA 3VU3A 4Y9RA 2AD5A 2WV7A 5AXDA 1KYZA 5EQJB 3TDNA 5LNK1 4UDOA 3K5PA 3IDOA 1L8QA 1K66A 1VE6A 5FOTA 1T1IA 1ENOA 4A36A 1VBMA 4RJJA 4BLSA 5JR3A 3UBTA 1OBVA 2I2WA 2BFAA 2GH1A 2JLAA 3NHJA 3O03A 2XCRB 1LRLA 1E2FA 2FWJA 3PQ3A 1DV1A 4JJ4A 5LU8A 1AXEA 1GGEA 2X8AA 1LK7A 3DUWA 2AB0A 3L8EA 2JW5A 4WZBA 2FSFA 1J56A 4TTIA 4R8MA 2VJDA 2B8WA 3FNHA 2EP8A 2ZRMA 2ZI5A 3IMGA 4K9DA 2FUKA 4R6WA 5AI4A 5EJ9A 1ZL0A 5DTMA 4PQFA 1MW9X 4GVPA 2VTVA 4E15A 5MFZA 3SHOA 4ZVUA 4D8WA 2V54A 1ZIXA 2BN4A 1PT8A 2R25B 5EINA 4HS4A 3E7DA 2BRUC 5ALGA 1JBQA 5B2FA 1UR5A 5HNKA 2B1IA 3C4JA 1G8JA 3Q11A 4BNDA 1HE2A 4XYEA 2Q3JA 3A3PA 3VPFA 4AN0A 2ODPA 3PNKA 1ZVKA 1PL6A 1EJ6A 5DCYA 2X5NA 3TZLA 1MUUA 1URPA 4ITVA 1P1IA 4ZOAA 1VSBA 3IUNA 2BGGA 4UTPA 3L7DA 3PC3A 1ODLA 2DHQA 2IPNA 3ORHA 3BMQB 4J43A 2F3TA 3KOWA 3ONVA 4MCHA 5IJ9B 3DHWC 3ILSA 5HCIA 3D6VA 3T7IA 3SR0A 3ZHZA 2XW6A 1NN0A 4C22A 4N6GA 3SHWA 1SHUX 7GPBA 1XELA 1BAPA 3SSMA 3F5SA 5EKXA 1RE1A 3I3SR 3WBFA 5JWOA 1XXHB 3N6RA 4F46A 4C6HA 2ZWAA 5JQWA 1USKA 4IY1A 1IK4A 2CF5A 3SM3A 2QRLA 4DBLC 3DDSA 4A0FA 3GGDA 3FTNA 1SHJA 1UEIA 1Y89A 4IIFA 4LZNA 1KEZA 1R50A 3I76A 2QJOA 3R9XA 2ST1A 1Y34E 3LUPA 1JMKC 1P9NA 2CXTA 1FFDA 2GNOA 1ZEJA 3IUMA 3LIIA 3MWJA 1LUAA 3CR7A 4HNSA 1JTFA 4YRGA 3OZTA 1JIXA 2BKVA 3TB6A 1TL7C 4TUYB 3AZQA 4U4AA 4NBTA 1T13A 1ADGA 1BHSA 4R16A 4HYYA 1GZVA 2WFLB 3IODA 1X39A 3QH4A 1TLTA 4E22A 1UPUA 1ENZA 2GHQA 2R87A 4AO8A 1NVTA 4G9GA 5FBHA 3N7AA 4ND7A 1M0SA 4D41A 5DHQA 3P8ZA 5EP3A 1FBNA 4P53A 2DH6A 1NNLA 3GAAA 5BVGB 3S99A 1SBNE 3WMFA 3ICQB 2NUTB 1GQRA 4L4ZA 1I0ZA 4FXPA 4J4BA 2JLVA 1JR6A 5JAUA 3HCFA 1Y5IA 3CRRA 1RPZA 1VPWA 5JSKA 2BFFA 2G3YA 5BSWA 4ZARA 3O3CA 5IKPA 4AQ7A 1WPXA 1FJ2A 1V5GA 1U0BB 1D2EA 3MBIA 4Y1FA 1NBHA 1O8CA 1ZBQA 2VQSA 3TEFA 3HJFA 5DM0A 3FWZA 1JHYA 4IOMA 4Q03A 3VVMA 2OZPA 2GTHA 4CXMA 3GXBA 4K8OA 3KQNA 1DKUA 3A05A 3JQCA 3U40A 3N8KA 1FP2A 1FYDA 4V0QA 4O8CA 1WUTA 2QSZA 5HJ5A 5CUQA 2ZIZA 3X1WA 3KB6A 1RTTA 1EJ2A 1LQ2A 3BSSA 5GAJA 5HUQA 2FG5A 1A5ZA 2NT3A 1Q0UA 4GOMD 3SFZA 1V95A 3T1VA 3SAJA 3AG6A 2DQKA 3VU8A 2GLXA 3EQ7A 3WWZA 1B0ZA 4R1MA 4I8XA 2BMVA 4G2NA 4HZGA 5A4AA 3M9WA 5AICA 4DIBA 4G5HA 1RKBA 3L7JA 4QDTA 5T6MA 4YQYA 2VEOA 3PNOA 2DBRA 1SD5A 3NJ8A 3HNRA 4PLPA 1UK9A 1RM3A 1R9GA 4QYTA 3VZPA 1LWOA 1FQJA 1PKEA 1FXUA 1WOYA 5K4HA 1Z22A 2HSZA 3ENQA 4ZPJA 3QVGA 4IQ0A 3VPHA 4BNLA 4NBRA 4EI7A 5C5DA 3I6QA 3EZYA 2GESA 3NJRA 2HWUA 3AOGA 4RSMA 1OWPA 2O2GA 5LMCA 1IG3A 1VE1A 1O9BA 4JVMA 2A5DA 4JCCA 3KB8A 1C9KA 5DP2A 4LDRA 1E2DA 2C31A 4KN8A 5J5CA 5I7FA 1IY2A 3KT8A 5AKJA 1TEZA 5BW8A 3G0CA 1OE0A 3SKYA 5IKEA 4M8NE 3A4TA 3X1YA 5JJIA 1IRIA 2UZ1B 4LRWA 2IYVA 1IN8A 4YR9A 2OILA 2XJ9A 2ZSKA 3C8UA 5A9TA 1RYBA 2PGNA 5H4GA 2EWWA 1A7UA 1OLSB 4HQ6A 1E9RA 1BDMA 2QB5A 4YGXB 5L4SA 5HK8A 3UB2A 1LC0A 3R5KA 5GONF 4AF8A 2B5OA 3UJ8A 1Y0BA 1B42A 2JDIA 4GUDA 1R4NB 2H4HA 2Q3MA 3LUHA 1R5JA 4LDNA 4MCIA 2YZMA 3PA6A 3RWOA 2PL3A 4CMEA 1AS2A 3E82A 3ANSA 4XOUA 4UBLA 4ZDKA 2FCRA 3NKFA 3OZBA 3BD7A 2OCDA 3KWJA 3TLKA 2QVLA 4ZYZA 4UDNA 1QH1B 3LS2A 1AKTA 1QFSA 4FDUA 4HDMB 1WABA 5BSHA 1PQUA 1OLUB 2GB4A 3BRQA 2QV0A 5JH7A 3QELA 3LCUA 1CSEE 3N7TA 3PL1A 5F5XA 5A4MS 1RHRA 3EG9A 3GT4A 3PTLA 4MB6A 1B8VA 2GZAA 4HDKA 1OFTA 3SX0A 3K8QA 2R6FA 2XSZD 3QKSA 3SK0A 5HKKD 2C82A 2ACWA 3CIOA 5C4MA 4UMFA 2CYBA 4FR0A 4BFSA 3OWHA 3SQOA 3ACCA 3A1FA 4LZZA 3I8SA 4BEBA 1TK9A 2JKVA 2VH2A 3FYUA 3TLBA 3S28A 3ZGNA 4F6LA 1JBKA 3LF1A 4M9QA 3V4LA 3DS8A 4M0MA 1CQIA 2WJVA 5D2CA 2V03A 4CKEA 3C3PA 4D57A 1Y8CA 3U3XA 3GFPA 1JSCA 4HAIA 5H70A 4JP5A 3ZV5A 1D04A 3KM0A 4X71A 5A6SB 3RKUA 4FGKA 3VAZA 1Z07A 1Z8FA 3MSXA 4HJRA 2YRXA 2XUDA 4G97A 4EB6B 3DE0X 1GLNA 1L7OA 5DE3A 3VO9A 1FL9A 1T5TA 1XHLA 2P9QA 4HSGA 1NC3A 3BL6A 3MMNA 4NXMB 4CEIB 3ZHSA 4KR2A 2DR3A 3NIGB 2D1YA 1E20A 2VP5A 4GGOA 5EJGA 3NXKA 1Z0UA 3NORA 1JJFA 1HBJA 4ZQEA 3V1LA 1KS9A 4DJJA 4PO3X 1WTCA 4KDRA 1VLQA 4L6AA 4TTSA 5CGZA 4YCBA 1JR3E 3KG2A 5DHRA 3T9BA 3VI4B 2G83A 3B2QA 2VLBA 3VPSA 4KOAA 1DJPA 1T5DX 3RUHA 1FYVA 3MXOA 4PYRA 2OBBA 1RJDA 1T8UA 1YULA 4AXXA 1T6NA 1NXSA 3ZI7A 1P62B 2ZJ6A 3TLGA 4KTTE 5A2GA 2DHCA 4BB5A 3BORA 3Q6NA 4MRSA 2JH8A 5B3AA 3E7XA 4EM6A 3GEDA 4TT8A 3CUSA 4KGZA 2PZBA 3TVDA 4C05A 2L2QA 3ONFA 1B76A 3VNVA 3IQDB 1KYXA 1ZOOA 3DYBA 3LVBA 4A26A 2WHRA 3QLUA 1NRJB 1MR3F 1OHHA 2FWRA 3F7MA 5FUBA 4QSHA 3RYFB 5BNTA 3KQKA 2R6ZA 4XDYA 5KOIA 1IHDA 4HWKA 1SOWA 1V96A 5DOVA 4GZ6A 3MOGA 3UTCA 3DMPA 5LWHA 4WZBB 4MK4A 4UBMA 2DBVO 4L8YA 3ZKWA 4EVSA 1DKLA 1E3DA 3OZWA 1ULZA 4BASA 2VBCA 3L8DA 2A7XA 1CE8B 3GA0A 1RWNA 1Y6QA 1Y98A 4Q3CA 3SBDA 4DPKA 5HUHA 2F8TA 4LNUB 4E08A 4C4SA 2ZI7A 5FV4A 2ADFA 1SUDA 4DQVA 3EARA 1UKVY 4LKRA 4HNGA 3KQUA 1KAOA 1R0WA 4PS0A 1SKMA 5EFOA 2QPOA 3BXHA 4XM1A 3W7VA 3AWIA 4YUZA 1KKMA 2D13A 4IR7A 1NG9A 4OXQA 5IZCA 3ZU4A 1SC3A 1R27A 4FNOA 4PYIA 3IQZA 4OQXA 2B94A 2P2DA 3KOOA 1QV7A 1JKIA 2B0CA 1HQCA 3G2MA 521PA 4BNGA 4I1PA 2EERA 1I1HA 3FBTA 4QJIA 3UANA 1CDDA 4E0BA 1O5OA 2YZ7A 1ABFA 1CUDA 4V2IA 4WAUA 1YAJA 1EGVB 3MRVA 5KKNB 3VU0A 2XZDA 5C31A 4R9UC 4HN9A 3W77A 5TLSA 1AKMA 1YBMA 3EVGA 1CEQA 5BSFA 3P97A 4DN6A 4JI2B 3IURA 2JJ2A 3BD8A 1JL3A 4PG8A 5I7WA 4CDMA 4PAGA 4IVPA 4Z4QA 2OD7A 2V7UA 4ZQCB 2WIDA 1OREA 1N7HA 4B7AA 4RKRA 1Y6JA 1T4GA 4G1BA 5EIFA 3PUYA 4TMFA 1TVKB 5LP6C 4HAVA 4F7WA 1T4BA 3KE8A 4LDQA 2AMLA 4FEYA 4NAUA 5DBIA 2DU8A 5D3ZA 5CXQA 4B45A 3TUZC 4E5MA 4UTOA 3IVGA 1UJCA 3DDCA 1JKFA 3V9AA 2QI9C 5AK6A 2HT6A 3FOZA 3U4CA 2Q9BA 3LT2A 4WZBE 3T9DA 5I7RA 4XVQA 4N7JA 4DR7B 1TZJA 3C6BA 3O1LA 1Q0PA 1D7OA 3BMOA 3BRSA 2HLDD 4JI7B 1CUWA 3HUDA 2ACKA 3BB1A 3BIXA 3KHTA 3L8CA 5TGZA 3UBMA 2C96A 2BFDA 3VPGA 1MIOA 4PGHA 4P3YA 2EF1A 4PTZA 4ZT4A 4JI1B 3RAEC 3BM5A 5IVPA 3CZ4A 4RMNA 1TLLA 5D51S 4O1IA 3KXKA 3M6LA 3BXOA 4ZWNA 3B51X 3F2VA 1HA3A 4KRXA 3WYGA 4MQ5A 4IZHA 3IT2A 1PR5A 2BMEA 3EK2A 2HRCA 5HF8A 5B12A 2BJWA 3WYBA 1XZFA 3D6FA 1IWOA 1U3UA 1TCBA 1VE3A 3BXEA 2LKCA 2WWHA 3I09A 3LY9A 3NEJA 3VPCA 2HIHA 1MLDA 2XUJA 3MCZA 1DLIA 1PGOA 3DW3X 1JJBA 3QWIA 2V6JA 1YJCA 3Q3CA 1VCIA 4DHEA 1YRHA 1QCCA 2WZCA 1BVYF 1QONA 2OFFA 3H9JA 1MX3A 4ZGGA 5KC9A 3TZHA 1UDAA 1R0LA 1T9KA 1MFZA 2XYRA 1Q7RA 3OIWA 2GZRA 4GOJA 4KB5A 2RD2A 3QI7A 1Q92A 2AOUB 2C5GA 1G7CA 2HPVA 1LS1A 3I9LA 3IQHX 3P0HA 5A3RA 5IZCC 3I61A 1A2BA 2EARA 2R7MA 2WA1A 3BJMA 3I37X 5EGNA 3H18A 3QKRB 5JS2A 4CEJA 1AOXA 2BFEB 2X1LA 2H06A 5CLGA 3RLIA 3RBAA 3OQ1A 4Q4JB 1YB4A 1JLLB 4M22A 1CEYA 2CMDA 1UWVA 3EQ9A 2HDHA 3PXBA 1A04A 1JEQA 2BUCA 2FPPB 5BN5B 4E09A 1NBME 3AH8A 5CB4F 1NUPA 1QV9A 3GGPA 4OJYA 3TXYA 1CB7A 1VIYA 4LTNA 3BK1A 5DW0A 3SPXA 5AVZA 1NP3A 3SQMA 4BMCA 2IYAA 4ZZ2A 2EWVA 3WWCA 4OBXA 3RPEA 5FD8A 2G0NA 2ZBQA 4B6GA 5KQMA 3CO0S 3H9CA 2A9OA 3PYMA 4TXHA 3UMSA 2NV6A 3V4FA 3C3EA 3L18A 2LXNA 2OZLB 2P9YA 3NLLA 2YVQA 5CD1A 1GEGA 2Y6VA 1EINA 1LC3A 4LBZA 1EM8B 5LMNB 1N7GA 4O2LA 1A98A 3OTIA 5CNIA 5DF1A 3KSRA 1R64A 5EQTA 5THQA 3SZMA 2FKAA 3W5VA 5BW4A 1P6QA 1AX9A 1SMKA 4PR3A 1SCAA 4BE4A 4L08A 4BCCA 3HB5X 1T5OA 2UYQA 3IXMA 5AHWA 5JSHA 3COWA 3SFTA 4DDMA 5IF9A 1EAYA 1DP4A 1RYFA 1UADA 2Y9MB 4HNQA 4G41A 4MQUA 4HDCA 5T3YA 4AKTA 5BVHB 4DIMA 3K16A 1TQ4A 2QLJA 3U7GA 4WZ6A 4X1IB 4NBWA 3RC7A 3QWAA 3A06A 3CLUD 3FVVA 5HZKA 1Q0HA 5LP6F 1LBIA 4KU4A 4GBJA 4WBXC 2CJFA 4NBVA 3GUVA 3B70A 1XMVA 2QN3A 3T41A 1QH1A 4M7RA 1SA0B 2FRDC 2RDMA 3ZIDA 2JK1A 4AL4A 4E12A 4I7EA 5JH7B 4Y9UA 4JR0A 4J49A 2O19A 1PE0A 2LDXA 3ID6C 4OHZA 3ZVKA 4IW3B 4NKRA 2IV7A 2IZ6A 2WIAA 3DCIA 4KVAA 2HA7A 1RLUA 2XPCA 4TLLB 5HRUA 2YQ5A 4AX8A 4EECA 3JQAB 4W8GA 5F7ZA 1FSZA 2QPLA 4OHKA 4B75A 4NYIQ 1M34E 1OD6A 3UAGA 2QIOA 3OPYI 2GCIA 3DFFA 2RARA 2ZROA 2PRJA 5LJLA 2O8FA 1WCXA 3CRQA 4M46A 4MROA 3MTIA 1L5HB 3BSFA 3CRMA 1O77A 3EYWA 2QRNA 3FLMA 3GFSA 3IT1A 2E21A 1U2RA 4RY9A 2XVAA 4CFZA 1WUIS 4ZU6X 1UC5B 2JGAA 4B76A 3V1YA 2AK3A 4GKVA 4O4IF 1X87A 1KWGA 1T36B 4HY3A 1ODSA 5FFNA 2GM4A 3RG8A 5KWJA 1AKQA 3HJBA 3W9UA 2NXNA 3NQ41 4OKSA 3U7JA 1DRJA 1JQKA 3FWPA 4A0QA 3RS8A 5ADWA 2BEWB 2W2VA 1OSNA 3HJGA 3P2KA 4MYDA 3PDCA 4O2BF 4QLAA 3VVCA 3VO8A 4AJLA 4N9QA 4HXYA 2D5IA 2VYQA 3MT0A 1MT3A 4ZEOA 2CB9A 2DB3A 1VIAA 4NE9A 3UH1A 3ZCQA 3QX8A 5HIIA 2RGEA 3IV7A 1M8PA 4JOSA 4TXMA 3VO2A 5K4AA 1RP7A 2I4LA 4FR5A 4TMXA 4U9HS 4YFVA 5AI9A 4BNMA 1EDZA 2MR5A 2YHIA 1KYQA 2H8KA 4HFJA 5CXSA 2CL6X 2G88A 1N2BA 3PDUA 1E4EB 3OPXA 5J63A 2PGXA 1NY6A 3AR5A 4F84A 3ROTA 3WL8A 2HA2A 2FV8A 4A8JC 4J0DA 2QTVA 3W3AD 1E3JA 3G9TA 2ZTSA 4URFA 2CXSA 2Z6VA 5ICMA 3CG4A 2AJCA 2Q8NA 1BRMA 2ZITA 3K09C 3PU6A 3Q8WA 3A1NA 4R9SA 3UK0A 3L0PA 4R0MA 1QQBA 1HL7A 2BM8A 4LHSA 2BT4A 4YQEA 1K63A 1X86B 2C5FA 3NC1C 4DMHA 4ESOA 3HE3A 1Y5MA 3OZCA 4M9UA 2X0EA 3ENWA 4BZXA 4C7MA 2PR2A 1RJ9B 2AC4A 3RRZA 2O9JA 1G0OA 2B4KA 5EI5A 3R3JA 1DAHA 3QMMA 4RM3A 5KWVA 1DWQA 1UBUS 3N6XA 2CLCX 2B2CA 3EZLA 4HVAA 3STTA 1KK3A 4DOMA 1EFAA 1EX1A 3PP8A 2I1VB 1ZESA 3Q7IA 1W29A 2C58A 1K2VN 2XB6A 3AJ8A 1OA0A 1X8KA 1C3VA 3RIEA 1AVTA 2UYYA 5TGDA 4YXFA 5C53B 2NMVA 1CUJA 4RF4A 4D79A 3K70C 1KXJA 1SCUB 3FJ1A 1R4ZA 5KSZA 2YNMA 3H1GA 3JQ8A 2R60A 5GOTA 1K6EA 3NALA 4MYCA 2FFHA 3RVNA 1Z4LA 2D59A 3DEAA 5FUVA 1XXHE 1MEOA 1H4SA 2YYYA 1LDYA 1C30A 3VR5D 4O0MA 3H5LA 5AJXA 2CNNA 4IJKA 5HQTA 3RVRA 3VKUA 2D5BA 2W71A 1VKHA 1GGMA 3HRKA 2OBFA 4JUBA 1YBHA 4B1FA 4L16A 3F90A 3VA7A 3HKEB 1QE3A 1UWLA 2ZAMA 3A31A 2QE7D 2VNIA 3I0MA 4ZN6A 2A86A 2P2GA 2IOFK 5F3WB 3JRNA 1M74A 4DZZA 1AG9A 4EITA 1CNFA 4IXWA 4JFAA 4L4XA 3SSOA 2VDKB 3GJRA 5TEWA 2VDNB 3KX2A 4KYIB 5L4LA 3BD9A 4XQ9A 3UUWA 2QK4A 5EMJA 2YWGA 2VAPA 4G63A 4WLNA 5EMMA 3ZGLA 5HFJA 2NO1A 1G5HA 3W79A 5CB8A 1VDMA 2AE2A 3LI2A 1Y7HA 3O8QB 3KO8A 2JLQA 5GY7A 1B3BA 4CNQA 1XMJA 2KM1A 5CYOA 3PXUA 3BHMA 4PX5A 1PYGA 2ZIFA 4WOJA 4XM2A 1ORIA 3AZOA 4BTEA 2XECA 4C43A 4RA9B 3HJNA 3WFZA 2GVDC 4DY6A 1J0EA 2ETVA 5CNJA 3N0VA 2DFPA 3FTPA 3GFQA 1IN4A 1BS9A 4PINA 4Y2YA 2HSDA 5AI0A 1XA3A 4QXOA 2IV2X 5JWRA 1OXKB 1D8TA 3GT7A 5EKUA 4URVR 4E2XA 4LX0A 1YFKA 1PZFA 2ONKA 2DOKA 3QK7A 4KGDA 3C5VA 4RVFA 1P29A 1QK5A 3Q2KA 1ZMBA 3EDRA 4DVGA 4EMTA 3DDNA 3UJ9A 1TYAE 1YCGA 4DILA 3U44A 5DXFA 1ECBA 1VYHA 1HXHA 2NVUA 4MI1A 5ALLA 4F3YA 1S3GA 4O4IB 3JQGB 3GWGA 3A6LA 2GPWA 4DLPA 2YFHA 4YVFA 3ER9A 4GIBA 4B09A 1PUJA 4BNTA 5IVKA 2XXAA 3UMCA 1P75A 2GN6A 4OKIA 3IJ5A 2HJRA 3LW8A 4OSOA 2P5TB 3WG9A 1FFWA 1LJLA 3LBHA 4YLEA 2XBUA 4B3DA 2P77A 1WQ3A 1QZZA 2Q4RA 1KMHB 5BQXA 4I5IA 4I14A 2VF7A 5CK5A 3ZVLA 4DR6B 4UBJA 1RI1A 4G5SA 1S02A 4JQYA 4LJ4A 4BZPA 4IG4A 1YZTA 3E9YA 3N3AC 3OQHA 1P4GA 5KYXB 3QQPA 1M7BA 4AKSA 2YBEA 1SXJE 3V2UA 4DUZB 2OZEA 3GEIA 1QWOA 1ZI6A 2HAEA 2BSQA 1NRIA 4X3OA 2RHRA 1E1NA 1I2CA 4O2AF 1O94A 1O96B 4WUTA 3WKDA 1YXMA 1C5KA 1D6NA 2FPPA 4HYQA 5BN5A 5C8DA 1UP7A 1XPRA 2FF7A 4OQDA 2XB9A 3ZY6A 4OAOA 2JCYA 1EGHA 3T12A 3QRWA 4KEAA 2OUKA 2YWJA 1GZ4A 1M33A 1ULSA 1U7TA 3PUXA 1NW9B 1Z62A 1MJNA 3CINA 3K0HA 3R6GA 1X7HA 3DBLA 3WZ2A 4QM7A 1QRAA 4WMLA 1YF3A 2XI4A 1OX6A 1BOFA 3ETNA 1MOSA 1NAHA 1J99A 1OXXK 3DFKA 4PLZA 5GJVC 5IHXA 1DXHA 2JI9A 1XVLA 1ZNYA 2ORVA 3G8YA 3O95A 4YRRA 5K99A 1AZSC 2B7BA 4P92A 2XA1A 1F7UA 5IARA 4NYMR 2VF4X 4NOMA 3TMAA 4EHLA 1JFVA 3UW1A 5L3QB 3L4EA 4V03A 1EVKA 2F59A 1I9CA 3LSYA 4MX8A 4W1QA 1QMPA 4RFSA 5K0TA 2ZIAA 1C0IA 4FYXA 1A9XA 2J85A 3QENA 2WU3A 3P5SA 2W93A 3HCNA 1XYVA 2J6CA 2I6XA 3IAEA 2EZTA 1ECPA 2HF7A 3FFTA 3R5XA 1QNLA 2PMDA 3OAAA 1ZW6A 4MMZB 1CULC 4RD1A 4D4IA 4MIEA 4WGGA 1C41A 2Q8PA 3P4XA 2D1FA 5IKXA 1LJUA 1SXJB 3LT1A 3ZS9A 2JIMA 1YS9A 2I2CA 3NT4A 1E2IA 2A0WA 5IS2A 1J00A 2KW5A 4FOLA 4YRFA 3V8MA 3OURA 3ZGOA 1IPFA 5CCDA 3TI9A 2HD4A 2CV2A 4M36A 1DRUA 4PBRA 3QU7A 1XTJA 1PT7A 1E5TA 1H2EA 1V4BA 3TNLA 1PAUA 1UUFA 1NRWA 1UM8A 1XZBA 2ID8A 3CVJA 3GCZA 4M49A 4ZVSA 1YVRA 3H4MA 3OA2A 3OM0A 4DYHA 2R1VA 3G1WA 1MRZA 2XE6A 5K0FA 4TYMA 3I8XA 4IRMA 3CVUA 2XRMA 3HACA 4IKPA 1MV5A 2EG5A 4NEHB 2QUAA 5ECGC 2PR7A 3TYXA 3DZFA 1S8AA 2C99A 1MPXA 3GARA 1QQTA 1NOIA 5E4TA 1JYEA 4UTXA 3WLPA 4CCWA 4GKKB 3HMKA 3HNPA 4W4TA 5AFSA 4Y98A 3KEQA 2QLTA 4R54A 1C1DA 1M6VA 5HX7A 2DPYA 3CONA 5DSTA 3ZCTA 1A1VA 4R8VA 5BN3A 4RFLA 3ESZA 2XB8A 1ZW1A 3TIXB 3G0IA 3IP5A 4LF7B 4HKTA 3HB4X 5I7VA 1VJ0A 1JFFA 3DCNA 5EJMA 3DEYX 2NTYC 1EFLA 4IIJA 2V7BA 1FJGB 2UXDB 2MSKA 1CLEA 1VPDA 4QPDA 2ET6A 3O31A 1R12A 4PAWA 3TBFA 5AW2A 1K6IA 2Y0BA 2OBLA 5EZSA 2YXDA 3HPQA 4MWTA 3UVEA 1WW3A 2RG7A 2GN2A 3R74A 3L4JA 3OICA 1IMOA 3I4CA 1IZYA 2NAFA 3LRTA 1DJNA 1E2JA 4ZO8A 4CM5A 5A1TA 1HDCA 3CZMA 2P1ZA 4M7OA 2X9NA 3EY4A 3DYIA 1MT0A 2P9EA 3JARB 4PZLA 3OE7D 1KI3A 3X2EA 5GPBA 2O1WA 1RIIA 3CVOA 1R0RE 4D8TA 2ODBA 4AMGA 2UXCB 2JVIA 3H0EA 1YC2A 2H1VA 2ZUDA 3C3XA 2G28A 2OFPA 1KBQA 2AS0A 5I45A 5EPUA 2QTVB 3T38A 4PX2A 3TAHA 3HCOA 1NMYA 1LBTA 1QP8A 4MZXA 3QHPA 1IAVA 4HBGA 4LG1A 3BZUA 1QDEA 5K03A 2K4MA 5LQUA 2JD1A 5FLXA 1Y4DE 3A1WA 4JBLA 1NW6A 4LE2A 1P5JA 5C18A 1GL9B 1O1YA 2I2BA 3X1ZA 2Z30A 1JVNA 1TRHA 2WUWE 3LHFA 1PBNA 1QAOA 3OETA 4ZOCA 1PQWA 1G55A 5EIHA 1N5JA 2FZLA 3CXUA 4LUCA 3G0HA 1Z8HA 2QEQA 4AF7A 1C7RA 1PL7A 2HRBA 5IVIA 1WXIA 2FSHA 4JQZA 5BMVA 2Z08A 3GFTA 3V32A 1JI3A 3ANYB 2GXSA 3KK0A 3MMXA 2H4YA 1Y82A 3G8CA 3GJSA 3PKIA 5GV7A 3BHJA 5CX4A 3RBXA 1F2VA 2WJ3A 3JZFA 3ZGYA 3LY5A 1ISMA 4CUZA 2ZTLA 1KP2A 3D6MA 3L1KA 3WOHA 4GMGA 1H4QA 4GSYA 1HURA 1ZH4A 5C8YA 1XA0A 3PFKA 2BUAA 2EIXA 3P9NA 3E22A 4S2EA 3AQIA 1UMDA 1YKSA 4IV0A 5KTSA 5E7IA 2FUCA 3GZJA 1YJAA 1Z82A 2VDPB 3OUZA 4U8HA 5CX1B 4BNZA 3LGSA 5K3BA 4MUBA 1R88A 1NZJA 2ZT8A 3PNPA 2J9RA 4TLCA 2AKAB 3K1YA 4WN9A 5C7YA 4AKGA 3U4DA 1J5XA 1W88A 3NUGA 4K05A 1V26A 1G6HA 1TAGA 1PD1A 4DNXA 1DC4A 1JMYA 2BTEA 4B3GA 2QWXA 4DMFA 3F3MA 4ZVRA 1THMA 5A4IS 1KK2A 5A7HA 5AW0A 3BCHA 3UN1A 2SNIE 3N86A 1BA2A 5LXTF 3AHFA 2OAGA 4QYIA 4EY3A 2IOYA 3OFVA 3T3PB 4PF1A 4K2AA 1II0A 1WE2A 2CUZA 2Y05A 1FDSA 1P61B 5IBQA 5HEKA 4D1YA 5HQ3B 1RRCA 2ECFA 5H3CA 2F6RA 1NR7A 2ZB2A 5FOUA 2OO3A 1DQNA 1FP1D 2FG7C 3L1JA 4ME6A 4KGVA 3VDXA 3V8VA 4HR7A 1U7HA 2D3WA 3V7NA 4LSGA 3AEYA 3L7OA 4M0UA 2Q4DA 5FI5A 4R2HA 1WV1A 4BNIA 3ZDYB 2ZAGA 3BFVA 1JIVA 3KOYA 4F96A 4MUHA 5KSWB 3TQTA 2PAAA 1QTQA 1AM4D 1ILEA 1FVFA 2EFCB 3F0TA 1OVMA 1TQ8A 1A5TA 3ETEA 1KQNA 3EXHA 4J0HA 1IAQA 1K3UB 1PZHA 4KG7A 4PE5B 3RS9A 2SBTA 4YAJA 3MCTA 1KJYA 4DLZA 1W4LA 3IA7A 1GSIA 2QTMA 4IDAA 2TMYA 3I9KA 2XDQA 3O6VA 1TKRA 2P0YA 4G2TA 4UXIA 1L7DA 1U1EA 3SKXA 4C4YA 1VIDA 1Y9AA 4QULA 3B9PA 1UODA 3OJOA 4F6RA 4ENVA 3FPHA 3OKAA 4XB2A 1UBGA 5JMPA 3OHMA 2AX4A 4HDRA 5H3LA 5BPHA 2M1XA 1WUJS 4OXIA 2VSFA 4II2A 4EL0A 1QIMA 5IULC 2C9MA 2WUEA 4J3JA 1C2TA 4K9SA 1EFDN 3KD3A 3LMKA 3MJTA 1Z5NA 5TB5A 4JB0A 4KRYA 4HN4B 1JLKA 2NWQA 3QJYA 1ABBA 1UXGA 1DDOA 5DASA 2W48A 5M2QA 2VP2A 1JT2A 3H11A 1QQ6A 1E7WA 2A9VA 2KWIA 4LJ7A 2FPRA 1UMBB 3OWXA 2ZUTA 1EZ1A 4BS9A 1QGDA 4LF6B 4HYEA 1UT8A 3FMVA 4OH7A 1XQ6A 3DC2A 2ZJBA 3AEZA 4HWSA 3FLAA 6GPBA 1G8KA 4BZWA 2BGMA 4GO1A 2JFUA 2Q99A 4F9TA 4BO8A 3GRVA 4XPIB 4LDPA 3AILA 4XJTA 5HBGA 5T8KA 4B3FX 4EHKA 4DKJA 3Q6MA 4QJ4A 2F3PA 4FIDA 4J29A 1NJ5A 4EFLA 4OMUA 4WN3A 4YS6A 1LU9A 3K72B 1L7BA 4J9UE 1PJQA 1NY5A 1FQWA 2AFRA 2BE9A 3B6JA 4J3FA 5E2BA 5EA2A 4CM7A 3KLNA 5LP6A 5LUAA 1QWSA 2R7KA 1WSWA 2O1XA 4HNTA 4FDVA 5HZMA 4MAFA 3WQSB 1SVMA 5CDGA 1ZM9A 1ZFNA 3C7CB 1XZAA 3E9NA 1X92A 4EJ2A 4RA6A 3A1VA 4JB3A 3RRXA 3DLCA 1PFUA 4AO7A 1CKEA 3SBXA 2I62A 4HHEA 4IHJF 4FI3C 1HLGA 1ZO8A 1MB9A 2QVBA 3RI3A 4EHFA 3GLSA 3H2SA 1JAXA 1O3YA 1Z38A 2UUPA 1KH1A 3NFRA 3OTOB 1LW6E 1DWOA 4G89A 1RJEA 4RFSB 1Y1KE 5TRTA 3JY6A 4BGEA 1QORA 5DHPA 5DNDA 2AC2A 2KLBA 2NZJA 4M9ZA 2X1HA 1I24A 3LK6A 4HL6A 4WK0B 4Q9KA 2W43A 2X8JB 3NEPX 2B69A 2GAFA 4HJXA 3VAAA 3NH6A 1QGOA 1DBQA 1NVAA 4JLJA 3BMNB 4JJAA 1CIPA 1RYEA 3HCBA 2RI6A 1QIJA 2XAUA 3LFUA 3L43A 4HQKA 2HA3A 4AJ2A 4X7RA 3AXTA 3ILXA 1F1BA 3O47A 2WJIA 4JVSB 5IMBA 3KTAB 3MWYW 5FJIA 4BMXA 1B15A 3QM1A 1N2OA 4JP1A 4ZEVA 2VCHA 1KOJA 1L8XA 1RAAA 2YC4C 2Z5GA 3H97A 4IZOA 2WFAA 1QZUA 4QPCA 1Z4QA 2O0HA 4BX9A 5F4ZA 2H2IA 3W6OA 2ODAA 2ZIVB 2GPAA 3E1SA 3QOFA 2IUTA 1RBMA 2RIPA 3IR5A 2O7VA 4QUDA 1R0XA