3BMNA

Structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor (compound ax3)
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
267
structure length
250
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords Pteridine reductase
total genus 90
structure length 250
sequence length 267
ec nomenclature
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3bmnA00
5BSHA 2ZTLA 2VWQA 3OEYA 1B3BA 4AJHA 1I10A 3I9NA 4YXFA 3NJ4A 7MDHA 1KEPA 1SOVA 3PRJA 1GZ3A 1AXEA 2JFGA 3BMOA 2YDYA 3FCOA 1Y8QB 2IXBA 4L74A 4N5NA 5A06A 4ID9A 1F14A 5BNIA 4JJFA 4UUNA 3KYCB 3GAFA 1EE9A 4E5YA 5EL0A 1ZK4A 1YS4A 1QYXA 4IIVA 4G65A 3BMCA 3WYBA 4C4OA 1TB4A 3ZWCA 4FFNA 4GWKA 4H15A 4U7WA 1YONA 3JQDA 1EVZA 1H5QA 4JK3A 5G4KA 1PQWA 1YL5A 4Q3CA 1XQ1A 3E9QA 4E0BA 6LDHA 1T2DA 2W90A 3KLPX 3FR8A 1UZNA 3GAZA 4XDYA 1CEQA 4LISA 4KQWA 3AWDA 3H7AA 1PL8A 4CM3A 5G0TA 5L9AA 4YT2A 4IS3A 3COSA 3ZNOA 1XIVA 1GV1A 3JV7A 1XU9A 4B3IA 2JAPA 8ADHA 1P0FA 5K0ZA 2JKVA 2GZ3A 4L4XA 4IY1A 2OORA 3NYWA 2Y1DA 1VJ1A 4BNYA 1M76A 4IBOA 4W99A 1XCBA 4J4BA 3JYNA 4CMIA 1YQXA 3GEDA 3WBFA 1ZMOA 1OOEA 1ADFA 3B6ZA 4CL8A 4B7CA 4EJ0A 4BNUA 3I9OA 2X7HA 1DC6A 2I3GA 4CMCA 1YE3A 4Z9YA 3WS7A 5A5EA 2A35A 4IQ0A 2WSBA 2HRBA 3A4VA 4FFLA 3S55A 1DFIA 2J3KA 1P31A 2DBRA 4BGIA 4AJNA 3WQSB 2FSSA 3NX4A 4FSHA 4B79A 1PX0A 3NT2A 3UAGA 4RGBA 3WLEA 3U4DA 4FFRA 4OXKA 4E33A 4UUPA 3AM5A 3GZNB 4RZHA 1XDWA 3PWSA 3NDIA 1PJ2A 1JU9A 1BVUA 1V3VA 1I3NA 2ZCUA 3FNGA 1H2BA 3VDRA 1ZEMA 1UAGA 5DULA 4CUKA 2VT2A 3WICA 2DBVO 4XIJA 4UUOA 1BHSA 2EEZA 1N7HA 2BD0A 1A7KA 1PWZA 2OL4A 3ZWWA 2UAGA 3ENNA 2RHRA 1P74A 1R12A 2Y0DA 3D64A 4HNGA 5TT0A 3RI3A 3LU1A 3UFXA 3LC1O 3NUGA 3BMCB 3KEOA 2HMVA 3PHIA 3ROKA 4FC6A 4NBUA 4CM4A 3IKVA 1KVSA 3HDHA 3GUCA 1CERA 4A27A 2C7GA 3E48A 4YJGB 1BW9A 3CZMA 3ITKA 3ZN2A 1IZ9A 1ISHA 2FWMX 3E03A 3WNQA 4KUEA 4GL4A 4J1TA 2PK3A 1KVRA 1PGNA 1YDWA 4J1SA 3CXRA 4XRGA 3ABIA 1Z7EA 2HK7A 2NWQA 4KOAA 3DAFA 3NTQA 4C7KA 1ZH8A 1YBVA 3Q11A 3BTUA 4BVAA 3ZHXA 1X0XA 1NR7A 2AG8A 2NVWA 3GN1A 4AVYA 1H6DA 1OBFO 3T7CA 4DVJA 4E2YA 4P4NA 1NPDA 1I36A 1NWHA 1KVUA 3RKUA 2C5AA 4AJ4A 4DWVA 1KVTA 5H83A 2FR0A 2B37A 2FR8A 4YT8A 1ENYA 4NBVA 1SB8A 4FS3A 1HEUA 5CG2A 3EMKA 2E4AA 1QV7A 1X1TA 1R4MB 1WMAA 3ZWOA 3GUYA 3FD8A 3QHAA 4CODB 1CDOA 2OFPA 2HQ1A 4DA9A 3NDJA 5BSEA 5GZ1A 1B2LA 3VVCA 2NSDA 1U8FO 1Q1NA 3D4NA 4XJSA 3ZW9A 1A5ZA 3IDSA 3RC2A 2RAFA 3AY6A 4BNTA 2WE8A 1C0KA 1IUKA 1E7SA 2B4RO 4J49A 1HZZA 2Y0CA 5L95A 2D59A 4PLWA 3K6JA 3VH4A 2ZCVA 1UZMA 3GA0A 4MVJI 4CQLA 3LT0A 1GQQA 4J7UA 2BI8A 2YUTA 1VC2A 5B4UA 4D0SA 3T4EA 2YY7A 4MVJF 3D7LA 3QVXA 3BHMA 2Z1NA 4YPOA 2Q50A 1E7YA 3AI3A 1G6KA 1Y6JA 1LLUA 1DXYA 1LSUA 3DMTC 3QIVA 4ONEA 3UCFA 4CR7A 5CEJA 1ARZA 4M49A 1R0SA 2PZJA 4O6VA 4MINA 3GVCA 2H63A 4GX0A 2PLAA 4CLXA 1BRMA 2O3SA 1KEUA 1H93A 3OA0A 2GF2A 2QRKA 4WLNA 3RBZA 1A9ZA 3DC2A 1K3TA 1GZ4A 2GASA 4JJGA 4QT0A 5ER6A 4CLEA 1H6BA 2GN6A 1EMDA 4WJZA 3K96A 3CINA 1LJ8A 1ZK3A 1SOWA 3OP4A 3RC7A 3SXPA 4R1NA 4ALJA 2X8LA 2XOXA 2V7PA 3AM3A 2JHGA 1SNYA 1SPXA 4Z3DA 1DSSG 4CLRB 1HLPA 4F6LA 2WEKA 3CIFA 5KOIA 2PTGA 2FHSA 5EQDA 5L45A 1PJLA 1DC3A 4D3FA 1BVRA 1JKFA 1U3UA 5ICMA 3LF2A 1U2GA 4ZJUA 4RDIA 1LC0A 1GQYA 1LLCA 4W6ZA 4OGWA 4W7IA 2G0TA 5EERA 4NK5A 3H5RA 4PG6A 4IDGA 4M8SA 1J6UA 1EFLA 3U4HA 1WMBA 2AEFA 2OP0A 4NMHA 3LSYA 4GPD1 3I6QA 4LN1A 1F06A 4TRMA 4E2WA 5ITVA 2PNFA 3WGHA 4F3YA 1E92A 1U8XX 1DAPA 4I8XA 1I3LA 1D3AA 1ZJYA 4DGSA 3U49A 3NDRA 1SZJG 4NU6A 4CV1A 4E5KA 2BGKA 3CUKA 4GGOA 5JAMA 4QQRA 2ZB8A 3F46A 3GMDA 3BHJA 4JN6B 4QUKA 1XR3A 4UUMA 5L51A 2OZPA 3QP9A 3AU9A 4N5LA 5F3RA 1KOLA 3F4LA 4BNKA 1KC3A 4BB6A 2FPIA 1Z82A 5THKA 3L07A 1A7AA 2V6GA 1JKIA 1PL7A 3LC2O 1CWUA 4DLLA 1ULUA 2FSVA 1QV6A 3PP8A 3E6AA 3Q3CA 4PLCA 3KVOA 1LA2A 4XIYA 2C2XA 1HL3A 3V1YA 1ENZA 1TA4A 3GDOA 4D44A 3VKUA 4JXKA 5IZCC 3DZJA 1YQDA 3CMMA 4RORA 4Q39A 3ZU4A 4EUEA 1PEDA 1SEVA 2OOSA 3L4BC 1BWSA 1E6WA 3PTZA 1UAYA 4CJXA 3WGYA 1P1IA 1WP4A 3PPIA 3QV1A 4MVJE 5KCZA 1WVGA 4KWIA 4GMFA 4M87A 2WYUA 2LDXA 3RUIA 1E7WA 3DZFA 2HU2A 1DRVA 4DPKA 2VTDA 5I7EA 3AOEC 1DHRA 1MX3A 3HN7A 1T2AA 4JLWA 1FDSA 1JVBA 1S6YA 4Y6SA 4A10A 1LQTA 2WD8A 1NPTO 4AJKA 4Y8VA 4MVJP 1YB4A 2BFMA 4Z9XA 1I01A 4IMPA 3B1KA 4AJJA 3O8QA 5JC8A 3PDJA 1NVGA 3OSUA 2Y93A 2GPTA 4E5NA 2C54A 2Q1SA 1T1RA 4J4HA 4RVDA 3U62A 1M75A 4QECA 1E6UA 3DOCA 1NVMB 4XRRA 1N9GB 4KUGA 2VUSA 1UR5A 4LW8A 2X86A 3TPCA 4GKBA 1NAHA 4IJWA 4E31A 1HDGO 1QSGA 1OMOA 3WJAA 3Q2IA 1XYGA 1K6JA 4MKRA 1KYQA 4PCVA 5THQA 2R6JA 3U4CA 3LVFO 3RUDA 1GCOA 3OQ1A 1JQBA 3HFGA 3FNEA 4ILKA 4WNIA 2B83A 2DFDA 5B37A 3I4CA 5CPFA 3ZH2A 4E5MA 3JQBC 3W6ZA 4WCDA 4E3ZA 4E4YA 3ZU2A 1QYCA 2VHXA 3H3FA 4CMEC 1WWKA 2HK8A 3L9XA 1AXGA 1EFKA 1UH5A 5AVOA 1FMCA 1X7DA 3F1KA 2D0IA 3MJ4A 1UZLA 2I76A 4HFMA 4IJKA 1HZJA 2FP4A 5CDYA 2VWPA 3LF1A 3GEGA 4TVBA 1Z75A 3JYLA 2C20A 4QEDA 4YVFA 5JYEA 1M6WA 2CFCA 1J5PA 3F4BA 2YHIB 3H6KA 4R3WA 2Y1CA 3WNVA 4BNGA 2IZ1A 2X5OA 4P38A 4RVSA 1I24A 4WE3A 2EF1A 3A14A 1E3IA 3GVHA 4BNMA 1D4FA 2JL1A 3I9KA 4WEQA 1KVQA 4CMBA 1FJHA 4PVDA 1R4MA 3NV9A 2E49A 4NH4A 4QO7A 1E1LA 1P3DA 3MWEB 2IZZA 1O8CA 3HJAA 4NFHA 4JCOA 5GMOA 3JCZA 4B4WA 2BI7A 4ND2A 4D45A 3ZWVA 3NTOA 4HY3A 1N9GA 3EYWA 2J3HA 2J3JA 3QWBA 4FFPA 2CD9A 3OICA 5A04A 5G0VA 4OAQA 3GRKA 3ZWPA 2NNLD 3W8DA 4CMHA 4QO8A 4QFCA 3GZ4A 2JCVA 1DEHA 1I3KA 4IPTA 1D1TA 4AJOA 2UV8A 3C24A 4YT4A 1UDBA 4EW6A 1LSSA 5A02A 4DQUA 4YJFA 4CM9D 2DU8A 4LVCA 4M54A 5BQFA 4WCFB 5IAAA 4FN4A 1WNTA 1N92A 4XZ3A 5COQA 1UJMA 1SEPA 3LK7A 3VZQA 2NU7A 1WPQA 3PVZA 5HS6A 5JY6A 1P44A 5GZ6A 4WLEA 3IKTA 1FDVA 4WGGA 1B26A 3UGKA 2GZ1A 5HRUA 1JTVA 1R37A 3ZWNA 2J5KA 5IZ4A 2CDAA 5EINA 1K0UA 3JD0A 3BAZA 2QZZA 3Q9NA 4MKXA 4CUZA 2G82A 4LCEA 3GK3A 5ADHA 3TOZA 2EP7A 1F8GA 1CETA 3WTBA 4CM7A 3C7DB 1TT5A 5G0SA 3ZV3A 1YGYA 1UXJA 2X1HA 4MVJG 4CR6A 1LC3A 4IJUA 2V6BA 1OC4A 5KJEA 1EEHA 2B35A 1OFGA 4RPKA 4U5QA 1A72A 1DFHA 3W8EA 3NT5A 4GVLA 1LTHR 3VHRA 4AJEA 1CQIA 1QLHA 2G76A 2BH9A 2ZQZA 1DHTA 3KYBA 4ZHSA 5AXDA 2DLDA 2JFHA 2DQ4A 4BO6A 1LRJA 4NBWA 1LDYA 2WDZA 3OFSA 3R0IA 3HQ4O 2IEDA 1D1SA 1NHWA 3U3XA 4XGIA 4J1QA 2O2SA 3DMTA 4L73A 1ZW1A 3RIHA 1W6UA 3UCEA 3UVEA 3TDKA 2EJVA 4OSPA 4XYMA 2UVDA 5CP8A 3ZZNA 3OQBA 1DIAA 1LRKA 3WDSA 3GPDG 2FRDA 1GFSA 4R41A 4D46A 3IUPA 4ZRNA 4PLFA 3RUHA 4CLHA 1QYDA 1E1NA 3UN1A 1NTOA 2VYND 3RBVA 4RJTA 4TQGA 4K26A 3H9UA 2EERA 4IDEA 3PJGA 4I5GA 4JQCA 3BMNA 2HO5A 2HUNA 2GSDA 3PEFA 4HX5A 4UVGA 2PZMA 1LNQA 4KWHA 4LSWA 4Y6RA 5T57A 4KQXA 5DZSA 5JDCC 4F6CA 3H3JA 4ZQBA 1PJSA 3MZ0A 5ENDA 1UXIA 4XB2A 4J7XA 3HDJA 2C07A 1MFPA 1JW9B 3JQBA 4I1IA 4PZCA 1GL3A 2A4KA 2O3JA 4FOOA 2Y1GA 4ALKA 1U7TA 3HNPA 1Z74A 2NUAA 2TMDA 1ZXBA 3FPCA 3JQEA 4I08A 4JX8A 5ICSA 1HE5A 5KVQA 4W9NC 1H94A 5DF1A 4BNJA 4U6QA 5K6AC 5TLSA 3FR7A 5KJFA 4PLPA 1MC5A 4YR9A 4DIBA 3IS3A 2WE7A 3ADOA 4IS2A 3R3SA 3AJRA 2IEBA 5IF3A 4U0KA 3C1OA 1U3VA 3D3WB 4FCCA 4FDAA 4GMGA 3D4OA 4F45A 3LQFA 4UULA 4NK4A 1PWXA 2OHXA 2PZLA 3H9JA 4MVJA 4PLHA 3RWBA 4W4TA 1Y81A 5T8KC 3WYCA 4BNWA 5IXSA 3UW3A 5JDIA 3JQAD 3U0BA 1NQTA 4A26A 4CLDA 2IYOA 1R6DA 1HE2A 1V0JA 5F1KA 5A3JA 4XX0A 4YCAA 1HXHA 3HZZA 4L4RA 3VZSA 1GV0A 4PIVA 5L4LA 1JN0A 3H65A 3O26A 5TF4A 1Z45A 1B3RA 2Y05A 3VKVA 3G49A 2NQ8A 2YV2A 3H2SA 4WLFA 3GFGA 4NBRA 4NZ9A 1LRLA 3PYMA 3PI7A 3JQGB 5U9CA 2P68A 2HK9A 2YYYA 3MEQA 3WMWA 4RVFA 5JY1A 2HLPA 4ZU3A 5KTKA 1PZEA 3F5SA 1IULA 1RYDA 2F00A 5IZCA 2RH4A 4XWYA 4HFNA 3SC6A 2CVOA 2FPPA 2CDCA 4BB5A 2C82A 1B16A 3L6EA 5JO9A 3A9WA 3P5SA 2CNBA 3FNHA 3PDUA 1YJQA 1XWFA 3ST7A 3STHA 3GLQA 3OA2A 1N1EA 5G4KB 4PN3A 4B7XA 5BT9A 5KVCA 1DOHA 2IE0A 5TJ9A 3FRJA 1W8DA 4QX6A 4RV9A 1DJQA 2O3UA 2IODA 2AA3A 1ZMTA 2FOIA 4BKOA 2IDZA 4CLRA 1DRWA 2QIOA 2VWHA 3LT2A 4NQZA 2CDBA 1LX6A 3PLNA 1F17A 4DC1A 1ZJZA 5F1PA 3V5NA 1PJ3A 4IUYA 3X2FA 2YZ7A 7ADHA 3E1KA 4A73A 2PV7A 2PH3A 5JW6A 1U2DA 5B1YA 1IHXA 3RFTA 2NM0A 9LDBA 3DTTA 2HCTA 5B4VA 1JAYA 3DHNA 2FPGA 3IJRA 1ZSVA 1B8VA 4OKIA 4CMJA 1PZGA 3K31A 3OEWA 5COBA 1DC4A 1ISIA 4LMRA 4RF4A 3C3XA 1ZUD1 3H2ZA 5U1PA 3VPSA 1DFGA 5LCXA 3LT4A 1VL8A 4R68A 1JVSA 4IM7A 4D79A 3DBRA 4I5FA 2NU9A 4ZA2A 3DTYA 3O8QB 4XR4A 3DZIA 3ZHBA 4JBHA 4XD2A 4NIMA 3OETA 1MA0A 1ADBA 4ND3A 3ZWXA 3JD4A 2WD7B 1CF2O 1E1KA 1UXKA 2E82A 2PD3A 4UAGA 4RLHA 3W8FA 3ZWBA 2D4AA 4ZN6A 5CDSA 3GMSA 3RCBA 5JMPA 1IYZA 1UXHA 1NAIA 1BTOA 3KXDA 3DBHA 4BKPA 4MKZA 5IDYA 5C5IA 1I0ZA 3L4SO 2EP5A 5I8WA 4XQEA 2G17A 4OYRA 4UVHA 3TRIA 3ON5A 4B8WA 4B4UA 1V3TA 2GN4A 3CSDA 1EUCA 4RO0A 4WUVA 1HKUA 3O38A 3RQSA 2ZJ0A 5F1OA 5JAIA 1ZSYA 3KHUA 1I2ZA 1HETA 4TRJA 4D7AA 2NTJA 4FC7A 3VZRA 2C0CA 1XSEA 3PQEA 3TL3A 1KERA 3PWZA 1T2EA 1N5DA 4MVJD 3F9IA 3L9WA 3VDQA 4KMSA 4YT5A 4HUJA 4NR0A 5J23A 5DCWA 3FPLA 5KKCA 3SJ7A 2Q1UA 3WWZA 1DPGA 4OOEA 2QG4A 4YAJA 3S2FA 2X9VA 4WK6A 4CM8A 3TJRA 4J1NA 2UYYA 4BGUA 2B4QA 1JDJA 4BO3A 4HNHA 1FXSA 1VJ0A 5CAEA 1T2CA 2PH5A 5BSGA 2E37A 2IZ0A 3MTJA 5TQVA 1GQ2A 1NQAO 4CV0A 4FB5A 3IP1A 2YJZA 1K6IA 2BHLA 2NTVA 3HHPA 1QKIA 2IRWA 3K30A 3I52A 1CQJA 4YYZA 4MIYA 1RM3A 3GVIA 3FN4A 3LLVA 1C1XA 4CM9A 4NJOA 4RF3A 3D4PA 1H9BA 3G17A 2VNSA 4BQPA 1NXQA 4FFOA 4ZVVA 1P45A 2PGJA 2GUGA 2PGLA 4PLVA 3K5PA 1C1DB 3VH2A 1U4OA 1DIHA 1CIVA 1ADGA 3JQ7B 4PRLA 3MWDB 3VPHA 4TMFA 5HS4A 1ZK2A 3BHIA 4XCVA 3WGOA 3ASUA 2P9EA 4BUCA 1FDWA 1LXCA 5BR7A 4O1MA 2O2YA 3RU7A 2YFHA 2OO5A 2AQHA 1FF9A 2ZJ1A 4TZTA 3E9NA 2EIHA 2B5VA 5T8KA 9LDTA 6ADHA 2ZB7A 5I9MA 3AUTA 1VI2A 4BQRA 2CF6A 4L76A 3BIOA 4U8GA 3JQFA 4CLOB 3AM4A 2H1SA 5BNFA 1C0IA 3PYLA 4I9HA 5A9RA 3PJFA 3KSDO 1PS0A 2PD4A 3TN7A 3GEMA 1OAAA 1W4ZA 3H9QA 4H16A 4NJMA 2VRCA 2O3QA 4FJ1A 2Y0EA 4XEHA 3WGQA 1ZEJA 2LDBA 3WBBA 2QHXA 1C0LA 3L6OO 4FD3A 4NU5A 5ES3A 3AUSA 1LDMA 1FK8A 3LZ6A 1N8KA 3PGXA 1BXGB 1HDRA 1E3JA 1VM6A 4MDHA 1NFRA 1XA0A 1V9LA 5DT9A 1XLTA 1YWGO 3BZUA 2Q4BA 1LU9A 1NYTA 3WIDA 2HJSA 4J9UE 2AE1A 1E3WB 1XG5A 1YB5A 3NGLA 4XGNA 5U4QA 3WIEA 1NQ5A 3AY3A 2VN8A 3GF4A 3JYPA 4OIMA 3SEFA 1XELA 3JQ9A 4MP6A 3VC7A 3WTCA 1NP3A 2WD7A 2BELA 3KETA 3GC6A 2O7QA 3KLMX 4WOJA 4IDBA 4J4TA 1P1JA 3U4IA 4G2NA 1E0DA 3VH3A 4JBIA 3RUFA 4BO4A 1I3MA 3GPIA 2HSDA 3IMFA 4UVEA 4WOKA 5EQFA 3SX2A 5C7OO 5F21A 2EKQA 3E5MA 3I23A 4CV2A 1NBOA 4ITUA 1U1IA 3H5NA 2NU8A 3WJ7A 1ORRA 2CVZA 4INAA 5JPIA 3QA9A 4E2XA 2GNAA 1J49A 4EGFA 5HWSA 4K6FA 4U0JA 4FQ8A 2ET6A 4WLVA 1ID1A 1R66A 1Q7CA 4K1LA 2Y67A 2VT3A 3KEQA 4XQCA 5DOVA 5TT1A 1WAMA 1LUAA 4IGEA 1TT7A 2Q46A 5CHEA 2W2LA 3LT1A 4DPMA 4OXYA 1PJBA 3WXBA 3V2HA 3ONDA 2TMGA 4M55A 5A9SA 4R5HA 4RZIA 2VUTA 2V6MA 3EUWA 3VTFA 2GGSA 1SB9A 1K89A 2JD0A 3P19A 4NPCA 4WLUA 4FPXA 1WDKA 2DPGA 2PFGA 3DEYX 3GQVA 3GRPA 5JCJD 2XF8A 2EKPA 2A9FA 3AFMA 3E9MA 4EEXA 1TXGA 3GNQA 3CE6A 4K28A 3WFIA 3LYLA 4E21A 1PJ4A 4H7PA 3ORFA 2VYVA 3R1IA 4YAEA 5I9NA 1YKFA 4EITA 3K8ZA 1EBFA 4WEOA 1KEVA 3Q2KA 1JAXA 2P5YA 1C14A 1O0SA 5IJZA 1RJWA 4ND4A 1Y5MA 2AW5A 4OHUA 4J0EA 1ENOA 3IIEA 4YB8A 4BNZA 1VRWA 1ONPA 1YJ8A 5MDHA 1QG6A 2V6FA 3D0OA 4LRSB 4CM4B 5T5QA 1X0VA 3FTNA 4BNVA 1E7MA 2ILTA 3PFWO 1MV8A 3IP3A 2C5EA 2W2KB 2BGMA 2HMTA 1H6CA 4PLYA 1YH3A 3B20A 3NKLA 4DIOA 5FI3A 3JQCA 3Q1LA 4GKVA 4IXTA 1WW8A 2Y1OA 1E77A 2CUKA 5KIAA 1VL6A 4WASA 1D7OA 5JCJA 1C0PA 2Q4EA 1LDEA 2JD1A 1A71A 4CQMD 1GAEO 2H5LA 2P9CA 3JQFC 4TSKA 5B12A 4XYLA 1AGNA 1SAYA 1RPNA 3ZI0A 2GZ2A 5KJ1A 3WGZA 4I9NA 4B3JA 4J91A 1F0YA 4M89A 1EVJA 1B14A 3DXFA 5DCUA 2BFPA 4YAIA 2I65A 2AQ8A 3JQ8A 4EBFA 2JFFA 3V8BA 1BDMA 4WCFA 1VL0A 1JA9A 3VAZA 2HRZA 5ITWA 2QRJA 5A1TA 2DC1A 3ENKA 3JD3A 4RPGA 2QRLA 4BO0A 4JGBA 4BOYA 2E6UX 2HAEA 3JSAA 5K6AA 1ZK1A 2I5PO 4W9NA 4UEJA 4TROA 3AOEA 2ZTVA 4EUHA 4YRAA 2CSUA 4A2CA 4BMVA 5JYDA 3ROMA 1HDOA 5IN4A 3F6YA 4FFMA 1PS9A 2BF7A 3RBXA 1KBZA 3ZWYA 4QFDA 5I8ZA 1E7QA 5COAA 4K6CA 3S8MA 3FWNA 3TNLA 5B4TA 4PZDA 5AOVA 3S2GA 4GX5A 1ZIDA 3ZU3A 3HG7A 3S2IA 1PQUA 3ZWAA 1DC5A 4ALNA 4FGWA 4RF5A 4II3A 1FDTA 5T6BA 3KO8A 2DUUA 1X7HA 4O0LA 3DBRB 3I9JA 4IJVA 3ULKA 4IQ8A 4PLZA 1EE2A 3OJEA 4MIOA 4BHTA 4Q9NA 3GH3A 3HFSA 3MOGA 1YB1A 1HYHA 4M86A 2IYPA 2X9NA 3OBBA 2HKIA 3JQ6A 1U5AA 4AICA 1DRUA 4YEDA 4BO8A 1ONOA 3L77A 2VUUA 3E18A 1QP8A 1WZIA 4IMRA 1IE3A 2VHVA 2HJRA 1JWAB 4FBGA 4IDAA 3G0OA 3ICPA 1TLTA 4IDDA 5HA5A 4J43A 3INTA 4ND1A 4BO2A 1E7RA 3BMOB 4CQMB 1B0AA 4ZICA 2EW2A 4RVUA 2NACA 3I9MA 3ETGA 2Q45A 4BO5A 3JD2A 3PHLA 1H0KA 3NTRA 1R15A 1JKJA 2Z95A 5IDXA 3GGPA 4X54A 2VHWA 1H2HA 2O50A 1GPJA 1PJCA 1Q0HA 2ZYAA 5KNLA 2PKQO 3DFZA 4EZBA 3GVPA 3DB2A 2RIRA 2ZTUA 4LK3A 2ZIZA 4OXNA 3M1AA 5JMWA 1QORA 4XR9A 4YJDA 3V1UA 2Q49A 3BYZA 1XKQA 1GYRA 1BSVA 2EV9A 4Q3BA 3FI9A 4QXMA 4JP2A 3OH8A 4QSMA 3R6DA 1Y8RA 5LDGA 5I7VA 5JCXA 3U5TA 2IXAA 4WECA 1LI4A 2CZCA 3ZCXA 3QE3A 4BMNA 1J0XO 1MC4A 5JS6A 2EGHA 4DLBA 2B69A 3GHYA 4A5OA 1J4AA 4IXWA 1Y1PA 4YDRA 1Z7BA 1E1MA 2NTNA 3VH1A 2VRBA 4F46A 4J16A 1KEWA 4J7CA 3LLSA 2CY0A 2P2SA 5H82A 4XA8A 2RH8A 2WMDA 3L0DA 1C3VA 1SCUA 5EPOA 3KSZO 2DTEA 3QJ5A 2CF5A 2VTEA 2H9IA 2VZ8A 4AJ1A 1MGOA 1BXGA 1UDAA 3EGOA 3H4VA 3QVTA 5DN9A 5L3ZA 5FFFA 4BO7A 4JP3A 4DUPA 1M66A 3WQRA 5JO0A 2D1YA 3GDFA 4OH1A 1T26A 1DLIA 2FY8A 4GWGA 5TC4A 1KY4A 3ANNA 2O3RA 2I66A 3Q0EA 1QYVA 4ZQEA 1E5QA 4DQXA 2P5UA 3VPFA 4R1TA 4DXHA 5CDTA 2Q1TA 3QY9A 3N7UA 3AI2A 4YBZA 3KYCA 2Y68A 3WR5A 3RROA 1YOVB 1DB3A 3C1AA 3TWOA 2GRAA 4OQYA 3RSHA 3QVOA 5TSDA 3RUEA 2VHZA 4PG4A 3CZRA 1X7GA 2O4UX 2GERA 4KDFA 1WZEA 4R51A 4PRKA 1A4IA 2QYTA 3PFFA 1NX6A 3DOJA 3JQAA 3M2TA 4HP8A 1Y9EA 2ZKLA 1ONNA 2PA3A 3UHAA 2A92A 2J5RA 3F3SA 4Q3AA 4R3NA 2G1UA 4JNKA 4E13A 3WX0A 3HWRA 4RLSA 4KUHA 3QW2A 1L7EA 2NU6A 4XQGA 4GI2A 3OM9A 1B8PA 4GX1A 3WWYA 3OHSX 2X4GA 3AK4A 1CRWG 3G1TA 5ENVA 3E82A 2BRUA 2Q99A 2DKNA 1ZK0A 3TL2A 3PIDA 3QVSA 2CMDA 3X2EA 2BFAA 2PGDA 4DTIA 1DJNA 4NG5A 3FNFA 3OIFA 1BMDA 3WGIA 2RCYA 4ALLA 4CL3A 4ZGWA 1AUPA 5AXAA 2NADA 4B3HA 4JJIA 4YA6A 5CDGA 3ANMA 2GN8A 1DAOA 4JIGA 3GGGA 3TZCA 2P9GA 4CV3A 1YRLA 4YAKA 2OP1A 2I67A 3W4IA 5JLAA 4L9RA 5ER9A 4R5MA 2YV3A 1EUDA 3CTMA 4IQGA 2G5CA 2GD1O 5A9SB 1IY8A 4PLGA 5CPBA 3Q6IA 3RUCA 4PG7A 1UUFA 1A4UA 5JDCA 5EESA 1HWYA 1YO6A 4NDNE 1GTMA 2EG9A 1P9LA 1I2CA 3GT0A 4DLAA 4HADA 2DFVA 1Y9AA 4EDFA 3QWFA 3ONEA 5K9ZA 2YQ5A 4XB1A 1HT0A 1YDEA 4YTEA 1GD1O 4YWJA 1CJCA 4PVCA 4UVDA 3OIGA 3E8XA 4BNHA 4TZKA 1KY5A 1DIRA 2FR1A 2ZB3A 4EUFA 1EUZA 3IAHA 3L4BA 1P33A 3HSKA 1GYPA 2ZB4A 4OMUA 1G0NA 4P4LA 4DREA 1TEHA 3N74A 5CEFA 3M1LA 1EBUA 3VPGA 2J8ZA 1MXHA 1O95A 2DUWA 3SVTA 3D3EA 1E3WA 3PZBA 4P22A 1ZXLA 2P4HX 2W2KA 2X0RA 3HADA 3MOIA 2YV1A 2HMSA 3RASA 4P4GA 3C7CB 2ZYDA 4B4OA 1P1KA 1ISMA 3MJEA 2OUIA 4Z0PA 1BDBA 3ZNPA 2FZEA 4PG5A 4GH5A 4PFJA 5H81A 3I6IA 1GDHA 4W82A 4RVHA 3RC1A 1EDOA 3PLRA 4I5EA 3ZWMA 2BLLA 1HSZA 2Y66A 3KTDA 2WTBA 2O23A 4RPLA 3PHGA 1U7HA 2VZ9A 4R01A 1ZZEA 2C59A 3VPXA 4RCVA 4L4SA 1U9JA 3KZVA 1ADCA 5GY7A 4CM6A 5G0UA 5DP2A 2AQIA 3ZV4A 4E5PA 3PIIA 2EW8A 2PY6A 2X6TA 4BO9A 4R69A 3ZW8A 4CLOA 4Z0TA 3O03A 2JAHA 2OBNA 3FWZA 3JQGA 5IXYA 5L40A 4XQ9A 5KJCA 1ZFNA 5IFLA 1Y8QA 5IDQA 3ASVA 5CDUA 3EY4A 2UDPA 4O5OA 1JWBB 5HBRA 3WGTA 5FEUA 2VZ0A 4FW8A 3C85A 5KWEA 2I6TA 2X58A 1TI7A 1D8AA 1RM5A 3JYQA 4A03A 4BNXA 3RVDA 2NVBA 1I8TA 2DAPA 1NPYA 2NLOA 5JC1A 1IL0A 4NI5A 3RUAA 1PJTA 1DBVO 4TVOA 1MG0A 5A9TA 5JE8A 3PWKA 2XAAA 4NFYA 1Q0LA 1QXSA 5ILOA 1T25A 4TRNA 2X22A 2ZTMA 3N58A 3CPSA 1JLLA 3HUDA 2DBQA 4Y6PA 3AFNA 1IHYA 2EJWA 4NHEA 3CKYA 4Y9DA 5C3MA 3O9ZA 3RU9A 2VYVD 5DBIA 1L7DA 3PQFA 4OL9A 3DQPA 3ADPA 1NNUA 1YL6A 4BNLA 1BXKA 2CVQA 2V65A 1PR3A 4Q3NA 5G0WA 1X13A 3T7EA 4ZRMA 2Z1MA 3QWAA 3G79A 5FI5A 5AQ1A 3DBLB 3RAJA 1Y8RB 3ZNQA 3LDHA 1QMGA 3VTZA 3RJ9A 1WLYA 2PKQP 3H5AA 3K92A 3IQDB 5CFZA 1B15A 4XDZA 3QSGA 2FMUA 2B36A 2PR2A 1VPDA 4WPGA 3KYDB 4D42A 2HMWA 3SC4A 5LDHA 1GADO 1QRRA 5G2OA 1O5IA 2YQ4A 3DO5A 3TF5A 2VRCD 3EVTA 1BGVA 2VOEA 4OJNA 3NEPX 3DAPA 3GVXA 3F1LA 2D2IA 1Z73A 1Z6ZA 5DOZA 2Q2QA 3B1FA 2GR9A 4BGEA 3DZBA 4YJHB 4BIIA 3WYEA 1V3UA 2AXQA 1L1FA 3OMLA 2QX7A 3VZPA 3MTGA 4DC0A 3DBVO 4RQUA 5T67A 1ISJA 4AG3A 1HDYA 4ZQFA 2Y1EA 1R4NA 2GLXA 3FF4A 2QQ5A 3WOHA 4GLLA 3WQQA 4MP8A 1BXZA 1ENPA 3INGA 3GGOA 2NVUB 4XYGA 4BNIA 3EZYA 4N5MA 3PHHA 4LRTB 4Z9FA 2GDZA 3DFUA 1K5HA 1HDXA 4Z6KA 3JD1A 4HBGA 1EVIA 2D3TA 4OM8A 4D43A 4YAGA 5I7FA 4FOSA 4G81A 4BO1A 1PIWA 1OC2A 1YVEI 1MXFA 1GCUA 3UOGA 4AL4A 2VNAA 2DVMA 3RJ5A 4G5HA 2FN7A 1S7CA 4HFRA 4E30A 2RHCA 3ZHZA 2EHDA 4CM5A 3JQAB 3JQ8B 2JCXA 4OOFA 3FHLA 1H6AA 3RFXA 3ZU5A 2I3AA 4ALIA 2WJPA 3I3OA 3P2OA 5DCYA 3BMQA 5MGBA 4O63O 1PJQA 2ZK7A 3ICCA 1GY8A 2D8AA 5TJHA 5AXBA 3SBOA 2Q2WA 5F5NA 5LC1A 4R9SA 2X0JA 3ETEA 1EVYA 1NASA 2QZ9A 3WFJA 1U3TA 2O4CA 3RC9A 3OJLA 4HXYA 1EDZA 2WWRA 1PGOA 2BGLA 2D5AA 1ULSA 3JTMA 4IINA 4GBJA 2NV6A 1N1GA 3BA1A 4OO3A 5FF9A 2GYYA 3DZGA 2YFQA 4W7HA 1I2BA 1PTJA 1UDCA 3BXXA 2BMAA 4R54A 3CMCO 3PXXA 4DIFA 3U9LA 4BKRA 1HF3A 1F12A 3MJSA 4ND5A 3WSWA 1EK5A 1EQUA 5JDIC 5L53A 1O6ZA 3I4FA 4MVJM 1LDGA 5A5FA 5L7TA 3DHYA 5EMHA 4RQTA 4C7JA 3MJCA 4JROA 4KDEA 1IZ0A 5KKAA 4YRDA 3P2YA 1YL7A 5TNXA 1PL6A 5DDIP 1HYGA 1U5CA 4KTTE 4DYVA 2J6IA 1NQOA 1V6AA 3AY7A 3O4RA 4MVJH 4YJGA 4DBZA 2YW9A 3ZV5A 1VKOA 2GO1A 2YDXA 1E3SA 4KP7A 5AYVA 2UUPA 4HFJA 3JYOA 3JQ9C 1B8UA 5TGDA 3C1TA 4DPLA 5C37A 2YHIA 4BNFA 4EEZA 4O59O 4CMIB 3DWFA 3S2EA 1N2SA 3K9QO 5GZ3A 3K2BA 1WDLA 2P91A 5EJ2A 3TZKA 3OECA 4E12A 1T1SA 1HSOA 1PGQA 2AQKA 4URFA 2QYSA 1PGJA 4LSMA 3KYDA 4NJMB 4RPHA 3ZV6A 4HV4A 1R16A 2RBEA 3FBGA 3CH6A 4LMPA 1O9BA 5L4SA 3A1NA 1DIGA 2W4QA 2HMUA 3QWHA 1I33A 1T24A 2PZKA 3W4JA 2PD6A 3HN2A 3DZHA 4A7PA 3M6IA 4OSOA 3ZHYA 3HE3A 4GVXA 3BMQB 3QLJA 4IDCA 2Q2VA 4AJIA 5A3VA 2R2GA 1RYEA 2P4QA 1ZBQA 5C7LO 1ZKMA 2R00C 3P7MA 3KM0A 2E48A 1K6XA 1PSDA 4B8ZA 3KB6A 4WLOA 4A0SA 1EK6A 2VYNA 1HTBA 4S3MA 1C1DA 4DRYA 4UREA 2PWZA 2VQ3A 3WGGA 4K9DA 1GUZA 5L7YA 3HDYA 1A27A 1QR6A 4D3SA 4HWKA 4OQZA 5KVVA 3I83A 1WDMA 1I5RA 1G0OA 1UXGA 4FR5A 4D3DA 1MUUA 3UUWA 2BFOA 3INRA 3NAQA 1GPDG 4N18A 2GCGA 3TFOA 4TRRA 4BV8A 3KRTA 1RM4A 1GEEA 1VE9A 3ZDFA 3IJPA 4II2A 2C2YA 5TS3A 3SLKA 3GOHA 1AN9A 4XYBA 4WKGA 3DAGA 3AI1A 4EJ6A 3FBTA 5JFOA 3DMYA 1E6EA 3G1UA 3SLGA 3K73O 1WXDA 4RDHA 5FYDA 3TOXA 1EQ2A 3EDMA 3TZQA 8LDHA 1KETA 3IOYA 4WNCA 4YJHA 4J2HA 3PZRA 5ILGA 4N54A 2JJYA 4DL9A 4PLTA 4BKQA 2B5WA 4FJ2A 1ISFA 1YBMA 3V2GA 1YQGA 1KC1A 1NVTA 3AUUA 1P1HA 3KV3O 3V2UA 3FTPA 3ROQA 3GHHA 3MJVA 4U6SA 4CMEA 2DM6A 1V35A 3BTSA 3G3EA 4R16A 4S1VA 3V1TC 2Z5LA 3OIDA 3OF2A 3NJ8A 3MJTA 3TZHA 2ZQYA 2X23A 2NVUA 3CEAA 4J2OA 1NFQA 2XPCA 3ZGYA 3A28A 1LQUA 1NWCA 3HB4X 1HDZA 3UXYA 5IG2A 2OMEA 2OXIA 5BNTA 4EJMA 4DBVO 2B0JA 3KBOA 1IPEA 4MPDA 1E5LA 1QLJA 4IZIA 5CG1A 1GYQA 4JBGA 2EKLA 3T4XA 4NNJA 5AXCA 1W0CA 3TSCA 1N7GA 2JCYA 5A05A 2UUOA 4Q3EA 1ZCJA 4ZD6A 3UH1A 3GNSA 2Q3EA 3PK0A 3GDGA 3QQPA 4HKTA 4NFSA 1MLDA 3QVWA 1MP0A 4R1UA 5DBGA 2D5CA 3BMNB 3ONFA 2C7VA 4UEKA 1VKNA 2B4TO 2H6EA 4BKUA 4E2ZA 1UP7A 3IL2A 5L4NA 2A94A 4EYEA 2I99A 1PGPA 2VCYA 4QTZA 3I5MA 5DNAA 5JBIA 1Q7GA 2DTDA 1M6HA 4XKJA 5I7SA 2Y99A 4PZEA 3OJOA 3KSUA 3NRCA 2ZYGA 3U09A 1P0CA 1U4SA 4BMSA 3R3JA 5C7IO 4Z0HO 3WMXA 1PZHA 5HM8A 2AG5A 3E5RA 4CR8A 5TIIA 3M2PA 5L7WA 5HTOA 1ISGA 4IZHA 3RD5A 1HDCA 1SC6A 1MG5A 3GFBA 3UF0A 1R4NB 1PR9A 1RKXA 4AJPA 3W1VA 4BGVA 2AEJA 5JXWA 1IPFA 2JD2A 4FJ0A 5T64A 1XHLA 2EWMA 1UP4A 3PQDA 3GR6A 3GN2A 3D5TA 4OKNA 2BKAA 4PGFA 1HE3A 3C8MA 4BL5A 1NFFA 1OI7A 4UVIA 4YQZA 2WYWA 4IIUA 4TWRA 3EW7A 1LLDA 4L75A 3KUXA 3ITDA 1GU7A 2ZATA 1RM0A 5A03A 4DMMA 2QW8A 5FWNA 1GUYA 3QRWA 2WM3A 2VWGA 3QWIA 2C29D 3EK2A 3AOGA 3OJFA 3SJUA 4YRBA 3F47A 1ML3A 1ZO8A 3PJDA 4EI2A 1SO8A 2DT5A 3BTVA 1DO8A 1CYDA 1GUFA 1ZSNA 3MCVA 5IN5A 5BSFA 1XQ6A 4BS9A 2I9PA 3BTOA 1GEGA 4H3VA 3A06A 4CUJA 4J6FA 3NGXA 1X14A 3Q9UA 2NQTA 2FZWA 1P1RA 3KOUA 3VOSA 4B4VA 1HLDA 3DOOA 3DDNA 4IGFA 1KIFA 1LSJA 2OBYA 3EC7A 4DYDA 2DTXA 2X9GA 5CEEA 1BG6A 2O48X 4ROSA 1Q7BA 3IC5A 4BV9A 3EZLA 4J90A 4GSLA 5DBFA 1OZAA 4N7RA 1RWBA 1T2FA 3B1JA 4KTVE 1PQPA 4MP3A 3ETDA 3W4KA 3PHJA 1NHGA 3DHEA 4CM8B 4R1SA 4UEOA 4CQLB 1V8BA 2X0NA 2EXXA 4LGVA 3D3WA 1LEHA 3UCXA 1O94A 1NR1A 1ZNQO 1VSVA 2EGGA 3GY0A 4B7UA 1P77A 2HDHA 1A9YA 4L0QA 4GGPA 3S1LA 1VLLA 1X1EA 2VHYA 3ROPA 1U28A 3GNTA 2X5KO 4M1QA 4CMGA 1MFZA 1IOLA 2XXBA 3RKRA 2J5QA 2VOJA 3EAGA 3EVNA 1XEAA 2GN9A 2W8ZA 1TVEA 2YHUA 2JHFA 4J3FA 3WLFA 3AU8A 1EZ4A 1YXMA 2AMFA 3W6UA 4AJLA 4E32A 5I9LA 4RL6A 1PU2A 4D41A 4XGKA 1KS9A 3VVBA 3HB5X 3LC7O 4TKMA 1HYEA 3DONA 2R00A 4R4JA 1F8FA 1PS8A 1YBAA 1I30A 4AJ2A 1LDNA 1UP6A 4LCJA 5DP1A 1FDUA 1NM5A 4GLOA 1DDOA 1IB6A 1LSOA 1M2WA 1O89A 1GZ6A 1AHHA 3D1LA 5A4DA 1Q2XA 1T4BA 3D5QA 3DL2A 1W73A 3DBLA 2O7SA 1B7GO 2AE2A 3UICA 1R0KA 4FIZA 1DLJA 1Y5RA 3IUSA 3DBHB 4R9RA 3EHEA 3OQ6A 1E3EA 3WB9A 3I1JA 1Q0QA 2O3TA 3I9LA 1LBEA 2XXJA 4L8VA 5JAQA 4I9UA 3TFQA 1VJTA 3AW9A 4CM1A 4MO2A 1BW9B 2AHRA 2DPHA 1VSUA 1XU7A 2W98A 2WYVA 5EIOA 2AEMA 3GZNA 2J3IA 1HRDA 3HDQA 3RFVA 3H9GA 4J0FA 4ALMA 4XYEA 5TX7A 1DIBA 4XJTA 4YQYA 4ZQHA 4MOWA 5JAZA 3GG2A 3PYXA 3TQHA 3WSVA 3ZNNA 1QYWA 4E6PA 1G1AA 1TT5B 1ZVMA 3NT4A 2F1KA 4LVUA 4YACA 4AFNA 2Q1WA 4RVGA 3K2EA 2Y1FA 4CQMA 5JNLA 1LDBA 4KZPA 1HE4A 5G4LA 4DMLA 5TRTA 1YOVA 1R0LA 3L6DA 4FGSA 4RF2A 3B70A 3DZKA 3OJ0A 2PKRA 4PG8A 1XGKA 2DBZA 1P1FA 4MIEA 4I5DA 2X0IA 5F5LA 1H9AA 4ZQGA 3JQ7A 1K2WA 3PGJA 1AHIA 3TZ6A 4CMKA 5JSFA 2POQX 4MJLA 4YJFB 2SCUA 3C7AA 3WG9A 3F5QA 3UKOA 5KVSA 1SMKA 3DR3A 5KJ6A 4CPDA 1AE1A 4GX2A 4GAEA 1T4DA 2W2LD 4Y67A 1C1XB 1M67A 1U3WA 4TKLA 4CMAA 1MB4A 1SBYA 2X5JO 4D0RA 1PZFA 4GQAA 3H9EO 4J9VA 4Y98A 1GR0A 3AUAA 3FSRA 4DQVA 4NBTA 4Q3DA 1I32A 3ANLA 4Z3KA 4P8RA 4WCFC 5IDWA 1E3LA 3H8VA 4BNNA 5EN4A 3GG9A 3PJEA 1LLQA 1X15A 1Y7TA 4IDFA 4RPJA 4ESOA 2OGUA 4GSKA
chains in the Genus database with same CATH superfamily
1XTZA 3TXAA 3EVZA 1DWUA 1TW2A 2QTFA 2RHOA 2QZPA 3LM8A 3OEYA 5G1NA 1QH0A 1MNQA 2ZSBA 5BQ3A 5JFGA 4X66B 3NJ4A 4R8RA 1GZ3A 2FZGA 4P0TA 4ED9A 2JFGA 3B1ZA 2NUAB 1PNTA 1NBMA 2PJUA 2IEZA 1M6YA 2IXBA 4NABA 2ZXFA 2XUPA 3KC2A 4PR3A 1W0KA 4ZDJA 4MJ7A 3STUA 4UUNA 4F71A 2WFLA 2A0YA 1JRLA 3OI7A 3KYCB 4OBEA 4PGAA 1EE9A 3ZBUA 4E5YA 4RX1A 2RCNA 4F6RB 5LQNA 2OG2A 3BMCA 3WYBA 3ACCA 3AM1A 4ZVKA 2HCRA 1XZHA 1Z0JA 3ZWCA 3AVOA 5C1PA 5M29A 2QN6A 3LHSA 1U3CA 1NSFA 3BIXA 4KQHA 4ND7A 2O1EA 4JC0A 2HUPA 2LWIA 2ENUA 2JAUA 3VQTA 1T2DA 3NXKA 3BIWA 4YROA 4EW2A 3SEZA 4YV1A 6LDHA 1NLYA 2R7NA 4C06A 3LOPA 3FR8A 3FSGD 3WQHA 2FDXA 4V1CB 2QMZA 2VJBA 3GAZA 3K9LA 4FKMA 3TIVA 3ER8A 4L8FA 2DR3A 3MBOA 3VU3A 1TDJA 3RF7A 3LY8A 4Q37A 2Z9BA 3HJHA 2VS1A 2O6LA 5G0TA 1WABA 5L9AA 3MMSA 3PUZA 1S89A 2IU6A 3JWHA 4G1BA 1EE1A 4XD7D 1GV1A 3MHPA 1QRDA 3MERA 4MQEB 2AN4A 3X1YA 1WMSA 1I7PA 2IBSA 1HKHA 1Y8CA 2BTOA 1SBIA 1QPZA 1CR0A 2JKVA 1TLLA 5JJKA 3UXHA 1USGA 3R5JA 4NYMR 4FR2A 1D0IA 4IY1A 4UNQA 1O77A 2Y1DA 5LZ8A 3C3EA 1EBBA 2H31A 4IBOA 4KE9A 4YMVA 1J2YA 1P60A 3DC7A 3HMQA 2E1PA 4J4BA 3VJKA 4L3WA 4Y2VA 5BWCA 5BN5A 4BMZA 2FX3A 3OX3A 2VDQB 3WBFA 5L3SB 3GXOA 3EOBI 4Q66C 4XUEA 3CX8A 2DMRA 4TTRA 1RWMA 3CLUC 3I9OA 2X7HA 2I3GA 1YE3A 4AQYB 2AZXA 4QXQA 5A3RA 2I0FA 2PH1A 3MCAA 2HEGA 2HRBA 2HIGA 2YASA 4YAUA 1DFIA 2J3KA 4H0NA 1QVRA 4QDTA 5F51A 1QZZA 4OA5A 2XR1A 2PHZA 4CG0A 4AJNA 1EVEA 4DQKA 1USUA 1U9IA 3E7PA 1Z39A 4FSHA 3VR0A 3WQSB 3NT2A 2WU8A 4B83A 2O1SA 3UAGA 1KZ1A 3BSWA 2HH9A 3DE3X 1K8XB 1JFVA 3EFHA 5JS2A 2QTZA 1T2UA 1R6UA 1Z8NA 4EECA 1OLXB 3GZNB 1Q6YA 1OB2A 3DFIA 3ET4A 5DLYA 2CKMA 1K86A 1ZW6A 3HSYA 3QFHA 5T41A 3RVSA 1FVOA 1JG3A 2QRVB 2I7TA 1BMFA 1H2BA 2IPOA 5CYOA 1O58A 2VPYA 1PTJC 3VO1A 1E1RD 1DAEA 4QA9A 3GJ6A 4MQUA 3W77A 3V8RA 5HYVA 1US8A 4RJIA 2DBVO 4UUOA 1KL7A 2EEZA 3G9QA 5CT9A 1N7HA 1OLOA 1JQEA 2BD0A 1PWZA 2Y1KA 5EE3A 5JDIA 3QUQA 4GMXA 3W9YA 4EARA 2AMJA 2P41A 3TOCA 1P74A 1YD7A 5TT0A 4R83A 4PHCA 3O3NB 3TS1A 3UFXA 3H16A 1T0UA 3LC1O 521PA 3K09A 4QU5A 2HMVA 3H6GA 4FC6A 1BJRE 4AM8A 3KXLA 1G8FA 3OWOA 3LDGA 1OLSA 3HDHA 4Q7EA 1JJVA 1KRHA 3SC3A 3AUFA 3GUCA 2W43A 4C0QC 1KJJA 4DA4A 1YNSA 3DDCA 5JCPA 3CZMA 4Q9HA 3UC5A 3C6XA 2P75A 3PUYA 1S9HA 1G9SA 5EHIA 1JSCA 3T61A 3ICQB 3OCYA 5D3QA 3HVHA 1UPXA 3BD7A 2W6JD 4G56A 4I0WB 4URZR 4XM2A 1YSCA 5AOBA 1J33A 4J1TA 3TB6A 3HBLA 1YDWA 4PY2A 2VSYA 1QOPB 2XYPA 3J81A 4EZEA 2O14A 3CXRA 3U4GA 1PYOA 2HK7A 2ZIUB 3DAFA 3EE6A 3NTQA 3IHLA 1ZH8A 5EHNA 2YN2A 1YBVA 2A88A 1MVNA 2L69A 3E27A 3L7MA 1D2MA 3DKRA 3F78A 4FQ5A 5D85A 4DDVA 2JGKA 3AGPA 4R9VA 4ZCRA 4F9TA 3ZQKA 4F3TA 3EG9A 3TCNA 3GN1A 5ALDA 5DHSA 5C81A 2EFDB 1OBFO 3EBLA 2GB4A 3T7CA 1MDFA 3ZTYA 4P33A 4DOMA 5C3UA 5BUQA 2ONYA 3F5DA 1KVUA 4H77A 1U2TA 3OIYA 4DWVA 1F38A 1SGWA 3WB2A 2B37A 3I09A 5J2UF 4Z54A 2FR8A 4YT8A 5GJVC 2VPZA 1AM4D 1QQTA 1SB8A 1PT8A 2Q21A 1HEUA 4NMMA 4PX2A 1VL2A 4LY9A 3P1JA 4Q03A 2BKEA 1ESNA 2D1TA 2E4AA 4TL6A 1RHUA 3B51X 3UMBA 1PE0A 3NQ41 4TT3A 3UYLA 1QB7A 2WFLB 1U2GC 3CPHA 1IOZA 2QG9A 1E18A 1T91A 3FE2A 4MR7A 2WSLA 3EZ6A 5I7OA 3FOCA 4URHA 5CA0A 3UMCA 2OFPA 5E8JA 3QENA 5AVUA 3FUTA 2YN0A 3OLWA 5GZ1A 5IANA 4E14A 3VVCA 4N8DA 4R0NA 3DWIA 4BNTA 2C7RA 4GOOD 3OQIB 1IUKA 1E7SA 1ZNWA 2G9ZA 3X1DA 4YMGA 4J49A 4WZBB 2OFFA 1UC5B 3AB3A 4J29A 3ROTA 5ADWA 4X7BA 5K8CA 3K6SB 3CKMA 4PXYA 2GXUA 1AUOA 1RJFA 5JYCA 2GWHA 5L3RA 1UZMA 4MVJI 2GYUA 4KW7A 2BVNA 5HKLA 3A1SA 4LDRA 1PJAA 2Q8PA 3C4QA 3NBQA 4UE3S 4J7UA 1GQQA 2YUTA 3HU5A 1VC2A 4MTCA 1A50B 3T4EA 3SZRA 4TTVA 3GRCA 2ZUFA 2BI4A 1Z63A 1FNDA 4Q0MA 3C6KA 3EHDA 4QOEA 2J9FA 2IK8A 1HBJA 2XJ9A 3MGCA 2J7PA 4RHUA 4I46A 3AI3A 4S0XA 1DXYA 1O6CA 3CT4A 4HWGA 4MUBA 4O2AB 1E1YA 4QGAA 5EUQB 4CR7A 2FE4A 4GXNA 1BQEA 4Q12A 3ER6A 4O4JB 2H63A 4GX0A 1ESDA 4CLXA 4YV2A 2CNLA 1BRMA 3PGKA 2N47A 2GF2A 2QRKA 2IV3A 3B7WA 3RBZA 1FFCA 4RGYA 1CC1S 4KPUA 1GZ4A 4EUKA 4QASA 2X13A 4H3KB 1XZPA 1L2TA 1H6BA 3JALB 1EGHA 1QGDA 2CFTA 2ZJOA 1VQ1A 3BXOA 3K96A 1SOWA 4JGGA 3NORA 3U4AA 4B7AA 3EXEA 4HYQA 1ZNXA 4ALJA 1TKRA 2X8LA 3M4YA 3RIXA 2QPTA 2V7PA 2FTKE 3DJFA 3P0HA 3I62A 1UFRA 1SPXA 2XH8A 3ICVA 1ESEA 1OGYA 2CXTA 2Z5GA 4NV1A 5FTJA 4Z3DA 3MF4A 2XZTA 3BRWA 4AWXA 2GS9A 2J85A 3X2SA 1N5OX 3PKZA 2UUCB 1T4MA 1EP9A 1N2CB 4G0QA 4L22A 3UG6A 3PX7A 4HTAA 3PUKA 4ZODA 2CJXA 1BVRA 1JKFA 5K7SA 1C4XA 1FFXB 3IAAA 3P0JA 3CX7A 5ICMA 1AK9A 1IG0A 2VNKA 1COWD 3BFJA 4LHXA 5LMZA 2B2NA 2HSWA 3TTWA 2XE4A 1LLCA 1UT8A 3EMDA 3MCZA 4HPJB 1WF6A 1XZFA 4WBNB 4GVPA 4MEBA 4OGWA 4W7IA 4D99A 1XD2B 1UWLA 5HIIA 4YV0A 2IS1A 2NUTB 1W0KD 5CIWA 3AF0A 4I8IA 1KOJA 4IDGA 3A6HA 1K3UB 1J6UA 1RWQA 3I3SR 3NBFA 4QM6A 1C9EA 4UOQA 3AO0B 2AEFA 3OCJA 3OIVA 3HLYA 4NMHA 4P4TA 4ZZ1A 1S8NA 1F06A 3G89A 3K20A 1IEWA 2PNFA 4E2WA 1IXSB 3L8MA 4AO6A 4I8XA 4B5KA 4F3YA 4MRVA 3E3MA 4BMCA 1D3AA 2ST1A 1HLGA 3PXUA 2Q6LA 2IU3A 3II6X 4RIHA 3PDWA 3NDRA 2BFDB 3OQPA 4CV1A 1RRMA 1GNRA 2BGKA 4NZZA 2CHUA 2E4XA 4QQRA 5JAMA 2V1UA 4A0FA 1WXGA 3QPDA 4Q4JB 3BHJA 1PWEA 5LVAA 4BC0A 2F1IA 2X77A 2VJMB 5L51A 3VYUB 3TINA 3TLBA 1VB5A 2G71A 3W5HA 5CXUA 4UJ3A 4JUBA 4BB6A 2YC2C 2REOA 1T9ZA 4H2DA 2FPIA 4OUDA 5F7ZA 4EHDA 3BWMA 4L16A 5THKA 4UU7A 1JKIA 1V71A 2XKBA 1C3OB 1AK1A 3T7RA 2Q7XA 4BP3A 3HBJA 4BX9A 3I2FA 4DLLA 3VZDA 4HB3A 5B1EA 5DM4A 2ZYIA 1TM4E 1H0SA 3EGDA 2A0KA 4HWPA 4KMMA 4PLCA 2HI0A 1HL3A 4PGHA 4D44A 5AVSA 2QLTA 4FGKA 5AP9A 1AZWA 2INGX 2VNIA 3FIJA 3QX7A 4KR2A 5HNKA 3UW1A 1SEVA 3C5CA 1Z0FA 4N0QA 2FPLA 3TVYA 3VPCA 5JADA 2PUCA 1PFQA 1LI5A 3W1WA 2CBZA 3BN3A 1ID8A 4MA5A 4W1SA 3WGYA 1QH1A 5KCZA 1FE8A 1E2NA 4GMFA 5LQDA 4NYJQ 1TM2A 3SC2A 2XQIA 1NBIA 1E7WA 2P7HA 3C8HA 4HQOA 3CPJB 2PLFA 2B98A 3LCRA 4RZXA 1KU0A 3AOEC 3EPLA 4QBIA 2VDNB 4UU1A 1N7JA 4RWEA 4Y6SA 4A10A 4N48A 1LQTA 2IDKA 3IAS1 4A5SA 4DIMA 2VHJA 4BMOB 3H13A 2OQ2A 2XMSA 4PNHA 4UUQA 3O1JC 1AA9A 1NPTO 1OWNA 2HDNB 3PNSA 3R7SA 4QOSA 3M3HA 4CGYA 3PE4A 1VYVA 1XTJA 3L6BA 3MTEA 2HOQA 3OE7A 4PPFA 4EG3A 1CUAA 2GHIA 2NU6B 2A30A 3U62A 1M75A 3QHQA 2MU1A 3O93A 3DO6A 5REQA 4AIIA 4B3RB 2RKBA 1GTL1 1QHHA 1WKBA 2ZYTX 2E85A 1NVMB 2WI8A 3DOCA 2NOAA 3KB2A 4XRRA 2YWCA 5EKDA 1N5RA 1UR5A 2WQZA 4LW8A 5I7RA 5T7BA 4WTOA 3N2EA 1NAHA 2FK8A 4IJWA 2V7QD 1GARA 1HDGO 4OX9B 3QVVA 5E9JA 3F8WA 1C81A 3Q2IA 4MMZB 5FLYA 2RBGA 5B3JA 3OCCA 4PZEA 3QFRA 3WZLA 1K6JA 3Q8LA 3L1UA 2P2YA 1Y8AA 4OU5A 3CA8A 1RJDA 4P3XA 4BZPA 4E94A 2ZRKA 1JLMA 1AVTA 3FNEA 1JX6A 1VL5A 3BEOA 1SK8A 2FN4A 3MFQA 2ZYVX 5B37A 3ZH2A 4E5MA 2ID7A 2H7VA 1XRPA 1Q1QA 2JEOA 3ZU2A 4ZEMA 1GILA 3DBOB 2WQ7A 1EFCA 1S8AA 3H3FA 5AVTA 1DINA 4ETIA 3FCSB 1SBZA 2ZAOA 4CMEC 1W9HA 2IYZA 3IUNA 4GC5A 2VAMA 2GCOB 1LPSA 3OZDA 1UH5A 3E81A 2XYGA 5AVOA 2ASVA 3LI2A 2VWPA 5EEGA 3LF1A 4CG2A 1UKCA 2XVYA 4DEVA 1QHFA 4N49A 3JYLA 5HCIA 1THTA 3B3AA 5ANRB 2ZBEA 3PC4A 3TAUA 1U0SY 1KQPA 2BW0A 1XZDA 2OGSA 3PDIA 4RABA 2VHCA 3H6KA 3ROGA 2XODA 3I34X 3E05A 3AP1A 3LUJA 3SX0A 2IZ1A 4P38A 5AHKA 3C8UA 4UM8B 1KI1A 2A86A 3EQ7A 4MGEA 3WO0A 4CMBA 2H1OA 4Q6BA 1ESMA 1NL3A 3AERB 3GP8A 1ZQ9A 1ZGCA 2H4YA 3M5PA 3PRYA 3N2GB 1MJGM 4FOPA 5KNDD 4AI6A 4L4UA 2A84A 3RYTC 3V00A 4QHTA 4ZDWA 4RHYA 1CU1A 2H0AA 5DBEX 3WMEA 1TVCA 1D6MA 2QRGA 1DT5A 3JCZA 3LDFA 2BI7A 2FZ5A 2ZE8A 3QG5A 4JUCA 4WK2B 1WJGA 4B4WA 4TYWA 4V0QA 1UMCB 2PL1A 3ZWVA 3EYWA 3DAOA 3IPLA 4GMKA 1MAUA 5C32A 4O08A 3UT0A 3FCXA 1O2DA 4FFPA 2PVCA 5JQWA 4QGSA 4PYRA 3A3YA 4CMHA 5CA0F 4QFCA 1G7CA 3KZXA 4LXYA 4YV7A 4ZK6A 5BUZA 1D1TA 4IV5A 4AJOA 1QHEA 3MUNA 5KX5A 2UV8A 1X7ZB 2JGLA 4KN9S 1NJ5A 2ZRQA 1E3TA 3HB0A 3HYSA 4CM9D 2IEIA 1NE7A 1UPFA 2ZSKA 1WNTA 4CL0A 3F96A 4X1KA 1NDQA 2QTGA 3AILA 5AICA 1Z2AA 2O2HA 3CCCA 2XD4A 1WPQA 2WIDA 5K3AA 4EB3A 4YRNA 3VDNB 4OVKA 4QWMA 2Z2XA 2OYRA 1SIBE 4PAWA 2JGIA 2V3CC 1U7WA 2OCPA 2W0SA 3K5IA 3O8RA 3KKQA 1R1DA 5CITA 2OZLA 5HRUA 3ZWNA 1JA1A 1WOMA 2O2GA 3F3MA 3P9QA 4GI5A 4C0AC 3GLIB 5EINA 1KDPA 3RSOA 2HQSA 4MKXA 3UMJA 1KAHA 1CZOA 4B76A 4DZTA 4TXJA 5EIEA 5CD1A 2NO6A 1WCIA 3ZZUA 5BY2A 4GYKA 3GK3A 4OQLA 4CKBA 1TGYA 2CLFB 2ZKIA 5G0SA 3DOHA 3V4PB 3R0VA 5EUBA 5LSAA 4RZQA 3UJBA 3VU9B 4DR2B 1A9RA 2VAVA 2EDCA 3HU2A 4G8DA 1BCRB 1L5HA 4CR6A 1E58A 1XJ5A 4QNRA 3Q88A 3PUJA 4M1WA 3VC2A 1JEDA 2JJ1A 2F9LA 4R8VA 1H1LA 3LZCA 4GMDA 1GNSA 2RHBA 2RI0A 1T9GR 4NYIR 4U5QA 4YCDA 5H4GA 4Y9SA 1Y37A 1HEIA 2FZLA 1WPGA 1XXHA 3THRA 4CTNA 2C4UA 2D2XA 4TL8A 2JATA 1QLHA 2WU0A 4KQGA 4JI4B 2V5VA 3GI1A 2JG3A 2BH9A 2CB9A 2ZQZA 3CE9A 3JWPA 2YR0A 2VDVE 3M5CA 4G0NA 4Q16A 4R84A 1KDTA 1ZH2A 2ECOA 2H16A 1KZGB 2XQFA 2ZI6A 5FO1A 2IKSA 5AXDA 4B9EA 2R4TA 1O95D 4DJJA 3SGLA 1REQB 1QO9A 4BO6A 1EFTA 1LRJA 2WDZA 3OFSA 2IPAB 3DVAB 3Q3IA 4NBWA 4NZNA 4GM4A 1FDRA 2WWIA 4U7PB 5HP4A 4ZYWA 1T9BA 3L4KA 1FFWA 4L73A 4ZANA 3WWEA 2FWBA 1ZW1A 3Q4GA 4M22A 3UCEA 1HH4A 3EYAA 3TDKA 2EJVA 1JR3A 5C8YB 4OQMA 1LRKA 3PENA 3AONB 3GPDG 4FDVA 2WIKA 5KHLB 4MWEA 4R41A 4DQLA 3ZDYB 1CLUA 2HA6A 2P4EA 4PLFA 3FPEA 4K6MA 1FP4B 3DTVA 3RUHA 3FCCA 2QSJA 2VYND 4LZAA 2XNCA 3RSLA 2G04A 2OHJA 3CUEF 3K8OE 3U6BA 4M9RA 3ZKWA 4JBWA 4K26A 1C0EA 2JJ2A 3B7PA 2IYQA 3PJGA 5BN3A 5TMBA 4PAOA 5FKJA 1GNQA 2JAOA 4LSWA 2DF8A 1AQNA 3EX7C 1A69A 1LPOA 1O97C 2BY4A 4NTZA 1VL1A 1H0HA 3NYRA 4ZQBA 3MZ0A 3GT7A 4OHXA 2RD2A 1UXIA 3SC2B 1H22A 2VR1A 2WFZA 1Z4IA 2C07A 4UM5A 3JQBA 1H8ED 3QI2A 1V11A 4BQOA 4PZCA 2PGXA 4ZP1A 4ALKA 1BC5A 1USWA 4WY8A 3DYBA 1NXVA 1B6TA 1Z74A 4XVHA 2JZCA 4EI9A 3JQEA 4AKHA 2ZRDA 2CCKA 4HNRA 1ZC4A 3CVJA 2SHKA 1FTSA 4DV5B 3GGCA 5KVQA 2F67A 1TOAA 2JI8A 4LVNA 1S2LA 4U6QA 4CFZA 1EPUA 2B25A 2R5WA 1PD0A 1QCZA 3UAYA 3ACBA 2DWCA 1LD3A 2ZE7A 2AXNA 4PLPA 5LYJB 1DBPA 2XRZA 1Q57A 4E88A 3AG5A 3K2QA 4TL9A 1D2AA 2HEIA 4X85A 4KPEC 5FBLB 5LA6A 4UFNA 4N12A 2JFWA 1E2UA 1XWWA 3CLHA 1DXQA 3AJRA 1YQQA 4MGKR 1ZHHA 1BX1A 4FHZA 4L0DA 4U0KA 5BOSA 2CXPA 4Q4HB 4BFVA 4UPVA 3KOMA 2OGTA 3MTAA 3SXJA 1J20A 2GPSA 4IVRA 3RH0A 4DHEA 4HQNA 1BVYF 1QO7A 2OGZA 3MFYA 4NK4A 4QYSA 4MVJA 4PLHA 1NUAA 2J4DA 2ONCA 4IO0A 4AULA 2QR5A 4KK4A 3EIUA 3M89A 4CT4B 4H6WA 2A9KA 2JGEA 3UW3A 1PK8A 2OV8A 3U0BA 1NQTA 3T54A 3S27A 1F6BA 3L41A 4RUKA 3G5MA 4MUAA 2CN1A 4QFBA 4YCAA 5A3JA 3F2VA 1JI3A 3GA7A 4FMPA 2R97A 4HH1A 3UUGA 2IOYA 4CCSA 1JN0A 3O26A 1WMDA 1PT6A 2Z3VA 3I2JA 4C7VA 1Z45A 1UJ5A 4ENTA 5B2FA 3VKVA 5KQGA 3AR8A 2ZDQA 4NBRA 2LW7A 3KKOA 5I7AA 4DZRA 2G7ZA 3AJAA 5U9CA 4BFSA 1I4LD 1PR5A 4D4KA 4DCVA 5LU8A 1XPUA 1IULA 3P32A 3HR8A 3VRHA 1KH1A 1UPCA 4TUYB 5JD5A 1CE8A 2FPPA 1Y63A 2C82A 3CVOA 2F17A 2V6JA 3ZY3A 2WIFA 3RS8A 3ZJTA 4CCWA 1MVLA 1B8OA 1XWFA 3F7TA 5IDVA 1G38A 2WWHA 3FRJA 3KHKA 2GCOA 1W8DA 3AHDA 4RV9A 1L5QA 4MK4A 3WLIA 2AA3A 2FOIA 4FXPA 5BPFA 2B8NA 4NQZA 1W47A 3SU8A 1QIHA 3ED5A 4FYYA 3Q7PA 3HKCA 4BWGA 5F1PA 4FMDF 2YWHA 4MCIA 1IWPB 2PZAA 2VHUA 3UAXA 4FT4A 1DO2A 3BFXA 4FM9A 1TJYA 4M8LA 4YMTA 1KJIA 2JKYA 1GOTA 3C6MA 2PV7A 4IVQA 1Z5ZA 4KXWA 5JW6A 3F5MA 2XZOA 1IHXA 1ZM9A 3SYTA 3T7AA 2HCTA 1JAYA 4YJ3A 4GPIB 4DCPA 1SUAA 4HCJA 2YYZA 2JBWA 1Q14A 1M5TA 3J80A 4LV5B 5AK4A 5G53C 1DC4A 5AM5A 2VBIA 1DZ3A 3AR9A 4IHAA 4FFBB 1Q1ZA 1RXCA 5K0FA 2V45A 3C3XA 3ERCA 1ZUD1 3H2ZA 2P9YA 4RIEA 2HK6A 3H4IA 4N41A 3BRQA 4CHTA 1O8BA 1DFGA 4TSFA 5AVQA 1E4EA 4PBRA 5DT2A 1KYVA 1VIYA 5LCXA 4IM7A 4PYQA 5AKXA 4PR0A 2NU9A 1KGDA 4BBJA 2EATA 4BLQA 2Q5LA 3ZDBA 3DZIA 1VG9B 5ESRA 4MLPA 4JBHA 4RH0A 4YGYA 4ZCQA 1GSOA 1T1JA 5F77A 1IAVA 3LL7A 1MA0A 3BOSA 1ADBA 4FWIB 3UG7A 4D57A 2WTEA 4L5CA 4L8LA 5HW0A 2PD3A 1MBZA 1WHSA 2PSHA 4RLHA 3B6KA 3QU4A 1MPTA 2I2WA 4LDJA 3DKKA 1WCYA 3RCBA 1XJQA 1UXHA 2B20A 3FOBA 1XVVA 4M0FA 3FG9A 1UFVA 1Y6QA 4W7SA 1QFZA 4F06A 5JT1A 3LUAA 4KH1A 5IDYA 4RTJA 1I0ZA 5J9FA 1KSJA 1TFRA 4XQEA 3T52A 3Q8WA 4P3OA 5CX1A 3AVVA 3ON5A 4J0CA 1UBGA 3CSDA 3AKEA 1L6RA 4RO0A 2CXOA 1HE8B 2H4ZA 3KKLA 1AGYA 4HN2A 4IZOA 5IF9A 1VPLA 1GG9A 3CXUA 1URPA 3C15C 4DSNA 1G98A 5FV4A 1XMIA 2FZCA 3MM4A 2IV7A 1GAXA 5KYYA 1QTNA 3SBDA 3AF2A 3VZRA 4DCUA 5A62A 1J9GA 3DR5A 1K5DA 1FUIA 1U2RA 1EFPA 2FEWB 1IMOA 3A1WA 1T2EA 5C1IA 4CFSA 2D2VA 3I9V6 4C01A 3P26A 2VJLA 1XTUA 3VDQA 4OJYA 2HT1A 4XGQA 3GJQA 4Z7QB 2VJQA 4J0KA 4Y7CA 5FUXA 4HEQA 1KFCB 2XMQA 4HRVA 1Z12A 3H04A 4MGIR 5DTIA 4YAJA 4CCYB 3S2FA 3ES9A 1LTKA 2ZI5A 4QT4A 2NPFA 3WB1A 4EI8A 5K09A 1SBCA 3B6IA 2G1JA 2B4QA 2HSZA 4H7FA 4HNHA 1HV8A 1JT2A 1VYUA 4UHBA 1P2FA 3L82B 4KMOA 1Z6QA 3L7KA 2QAGC 1ZMBA 1RLOA 4Q9KA 3PD7A 2JLAA 5DYTA 2V03A 5KTYA 1AH2A 2OC9A 3JZAA 5AD1A 4FB5A 3IP1A 4RJJA 4EPRA 1M33A 3W7VA 3GXBA 2CMKA 1KI7A 3K30A 1GL6A 1T29A 2IHJA 4YYZA 2E6KA 4LJSA 1IDN1 2PT9A 3LLVA 2J0VA 1C1XA 1SA0B 2XADA 3CR3C 4QPPA 4ZT2A 1X6VA 5EIHA 2WC1A 3ELUA 1O6GA 3K0KA 4MR9B 1KU6A 4JZKA 3G17A 4XM1A 4EY5A 1X7YB 1T5LA 3OT1B 2J6HA 1XEXB 3I1FA 2AFIE 1IK4A 1IHDA 2XTJA 3HXLA 4PLVA 3ZGOA 2DX7A 3K5PA 1E4EB 1ESCA 2XNSA 2YOFA 2OVFA 1J2EA 3INNA 4KITB 1NNI1 1CIVA 4I9FA 5AJXA 5EIBC 3NH9A 1YZNA 4TMFA 5AI6A 2BKXA 3EFOB 1RLMA 5HS4A 3BHIA 3EY9A 3ASUA 2XZLA 2GM4A 5T3YA 3BL8A 2P9EA 1QDUA 1J0BA 1O54A 2GCIA 3A05A 3DPSA 4Z7JA 4XFDA 2OO5A 2AQHA 2ZJ1A 4JU9A 4TZTA 1US8B 1HK7A 1Y3CE 3ZD8A 2WTUA 2QVGA 2EIHA 3H6HA 1IUNA 4M0CA 2B5VA 1KA9H 1JEEA 4HDSA 1TZBA 4ECAA 4L0MA 3AUTA 1W4LA 4DLVA 2GYVA 4BQRA 3KZCA 1MX1A 2WILA 3QYAA 5K45A 1TLFA 3BSFA 3FB4A 2EFYA 2I29A 3CGGA 5HRAA 3W5CA 1TZCA 5IVDA 4I9HA 1XO1A 3PJFA 4LYGA 5A9RA 1NX9A 2HF2A 2BTQB 4X45A 3PA6A 2E0IA 4RL4A 2OQIA 3D6HA 1KARA 4L8GA 3GEMA 3LPCA 1OAAA 2H1LA 3DH0A 4MWTA 4N5HX 2NTYC 1RPJA 3D2CA 3LE8A 2FWAA 2XMBA 5AJHA 1Y9DA 5J1TB 1XQWA 3SPXA 3UV7A 3GAAA 3WGQA 1IOWA 2Z2KA 3CUYA 1Y7IA 1XVIA 1P0IA 2H07A 1C0LA 3L6OO 5DEIA 2OOKA 3O82A 4P3NA 1YS9A 1RXUA 1XOIA 4NV3A 4QOHA 1M2EA 2R7LA 3AUSA 4A16A 7AT1A 1I1QB 1M8PA 4UMEA 1NZFA 1FMTA 3BDIA 1IJBA 2B4AA 1E3JA 1ZWKA 4Y6LA 3GP5A 1DTEA 4DLSA 4FN5A 2MJLA 4YECA 2OD2A 3BZUA 4XPZA 4N0DA 3QVGA 2WJAA 3COWA 4NEQA 3WIDA 4J9UE 1JR3D 3RK0A 4M1TA 1XG5A 1YB5A 1RI5A 4P84A 4GGMX 4HEA6 3SXUB 4YRCA 2GI4A 3L7BA 3AY3A 5D6NA 1GVHA 3VYWA 3PFKA 4OI0A 4K0RA 1W4AA 3NTLA 3SEFA 1Z6TA 3C87A 1H5UA 3JQ9A 2HC9A 3T8YA 3KETA 1NBMD 3GC6A 2GZMA 4LFCB 4ZMSA 4EG1A 2IIBA 2WZCA 1P7PA 5IT9A 4UHFA 3BH7A 4CG1A 1JS1X 1JZSA 3JATB 3I0MA 1W2HA 3CLTC 2JLXA 5AVJA 1XZAA 3CLRD 5DX8A 4X3CA 4UVEA 3SD7A 3TTUA 5EQFA 2FGJA 3PCXA 1U2PA 5F21A 5C7OO 2W42A 2EKQA 4JR0A 4UNPA 4ITUA 2HWXA 1SK9A 3H5NA 4P2GA 1GGMA 4INAA 2NU8A 2I6FA 2GNAA 4IOLA 4QEKA 1L7BA 2A5GA 1AGXA 2QN7A 3N28A 2BCJQ 1Q7CA 4ER6A 5JVDF 5CFMA 1M5UA 5JD4A 4K1LA 1WAMA 4MV1A 4IGEA 4EY7A 3DA8A 2P3QA 4FYKA 3AF3A 4RIGA 2NO4A 2W2LA 4L72A 4OXYA 4CF6A 1KIMA 3WFZA 4DPMA 1PJBA 2GVZC 3WXBA 1CNEA 2B1IA 2QI9C 5AKYA 3V3KA 1QGED 1Z26A 2G28A 5KMGB 4WXEA 1DKLA 1EAMA 4IICA 3RYFA 4FDMA 1EK1A 1KMCA 1SU4A 1PG0A 2IHYA 4BDSA 3DFMA 1YIDA 4Y2XA 1FXUA 3E8SA 1GTRA 3A9RA 3JVVA 2GF9A 3E0XA 1K89A 3B13B 3HXPA 4JI8B 5EE9A 3FSJX 4JC4A 1I4TD 2C3YA 4FYHA 1R50A 4MWOA 4CTJA 5BN3B 4HDAA 1PNOA 4TWJA 4EAQA 4QTUB 5LL6P 5FPPA 3U44B 3DEYX 2I4NA 3GQVA 3GRPA 4OI4A 1KZHA 4BFWA 2XF8A 5JECA 1M3SA 5C53B 4EEXA 2N1BA 3A36A 5K4AA 5EI5A 2DWPA 4KIFA 1V5IA 5T4BA 3GNQA 2AK2A 4GBGA 4KXVA 1PJ4A 3OX2A 4EUSA 3M4ZA 4DSUA 4F1WA 5LLDA 5I9NA 3UPTA 2ZZKA 2D3WA 1O08A 4ERNA 4LYAA 1RU3A 1JAXA 2H2AA 4JUAA 3AXTA 1TJ5A 3DAYA 3R7AA 4YXWA 1VLZA 2AW5A 1ZD2P 2ZJYA 5DWDA 3CO0S 3WLPA 1Q1EA 2JLVA 4CQJA 3KU1A 3HB1A 4YRZA 1UBTS 3DZCA 3KQUA 1WQ1R 2ASEA 2I7CA 3D0OA 4LRSB 2XOEA 3OAAD 5T5QA 5JV5A 4QC2A 3LL4A 3EUFA 4Z8XA 3EEOA 1X0VA 2OPBA 3PS9A 4RH3A 1QIIA 2QDXA 3IP3A 4LTNA 2ZQ5A 3P9XA 3RSSA 2BHNA 4WH0A 5JCOC 2W2KB 2BGMA 1DVRA 2V9PA 5FLEX 3DWEX 4DIOA 2FOLA 1AURA 2TMYA 1NDUA 4LOJA 5CYPA 3JQCA 2GO7A 2ECQA 4GKVA 3STTA 2V4UA 1M2FA 5KC8A 1WXWA 2QTBA 1JXOA 4H1UA 1IY1A 2C00A 5E2IA 5JCJA 1C0PA 2Q4EA 1CX9B 5A0VA 1LDEA 3PICA 1ULHA 1JMYA 3N2KA 2C4TA 5BSVA 2H5LA 4HAIA 4TSKA 5B12A 3CVXA 1ZQ1A 4QYIB 4XYLA 4EJSB 4OK6A 3BZWA 4X8OA 5KOHA 4UTOA 1TM7E 2RMKA 1A9SA 3VOTA 4DNPA 2PX0A 3M6MD 4BLPA 4IUBS 2QX6A 4HH3C 1I9GA 3MYRA 1JYFA 1UMKA 2DWUA 3B48A 3NIBA 2JFFA 3WRXC 1P0QA 3AW8A 3HGQA 3WLHA 4Q00A 2HRZA 2FZ4A 2H1CA 3N6RA 4J0GA 2DC1A 5IUKC 3PXGA 1E79D 4RPGA 1T8SA 2QRLA 3ZBTA 3QU2A 4X64B 3G8BA 1WB6A 2XVXA 3BFVA 1NI5A 4DNQA 1XCPA 4TROA 1MJFA 4BLOA 2ZTVA 1XUOA 1UPAA 1N33B 5H4HA 1UJ4A 1ZM2A 2MIIA 4YRAA 4X62B 1K5PA 2JLUA 4IRUB 1FS6A 4I4TB 4MS3A 3WL8A 4BMVA 1C50A 3ROMA 5EUCA 3D2BA 3H4MA 5EVJA 1PW5A 3KQHA 4TMKA 4YMWA 5FI0B 4O1IA 1IJKA 3DV9A 1XP8A 4QFDA 4B80A 2HCBA 4AY3A 3SZUA 4K6CA 3KTAA 4KYTA 4U7HA 4L3VA 1FUEA 2X14A 3NIDB 1ZI9A 5B4TA 4AQ7A 1OAKA 5AOVA 2C5SA 1TQDA 4D9FA 5BVHA 2V97A 2QTNA 1LWNA 1DC5A 4M1ZA 4R98A 4BLWA 4ALNA 4ZHQA 2W6NA 4Z4FA 1FDTA 5CTJA 4KGZA 2Z2IA 4HB2A 1V4BA 1F6DA 3PUWA 1P91A 1G6HA 1WNFA 1Z17A 1ZISA 2G5TA 4UQOA 4ZVNA 4MIOA 5JIBA 1FNNA 4TLEA 4BHTA 3IE0A 3N59A 3TAHA 3QVUA 4M86A 2IYPA 4QXOA 1QIKA 3A9VA 2X0FA 4EGSA 1QPGA 1DRUA 4WZ6A 1GPLA 4UUAA 2BYTA 1JFFB 1ONOA 2IW3A 3L77A 1OA1A 3SQXA 4JL6A 1L4LA 1JKJB 2QU7A 3O8OB 4NCHA 4RSGA 4IMRA 3ZDEA 2OHHA 1IE3A 2VHVA 3D6MA 1YZHA 5CDFA 3G0OA 1J0DA 3NHPA 2XUIA 1L4BA 4I55F 5HA5A 4TLAA 4J43A 4LFAB 4M99A 3LTNC 2CLCX 4RK4A 2ZJ2A 1S3IA 3W1EA 3CKLA 1G3QA 1GIAA 4G9EA 2OENG 3RE1A 3TGPA 3U56A 5F98A 3T12A 5K05A 1JQ3A 4H7DA 4BO5A 5K8JB 1W35A 3JD2A 5EQJB 3DFFA 3ZJVA 2VP3A 2BFFB 3EDOA 4GUDA 5IDXA 3IP5A 1IDOA 3FRIA 2O50A 4QBKA 1HI9A 1JU4A 5HVNA 1Q0HA 1X1CA 2GARA 3VR5H 3BJRA 3O9MA 5B36A 4EL0A 2JJ2D 5TMPA 3A0RB 4EZBA 3LLUA 5DNWA 3DEIA 1N5MA 1RQRA 4X93A 5FV7A 4BBPA 3T3MB 2BIFA 3M1AA 2X4LA 4DR1B 1W85A 1VBMA 2IGTA 1AKUA 1XKQA 1BSVA 4WMLA 2ZUUA 3FI9A 4FFDA 4L1KA 5CU7A 5KYVA 3BE6A 1DWPA 2QL7A 4ZZ0A 2P0EA 1Z62A 3DLIA 5C8YA 1OLUA 2IXAA 3OZVA 4WECA 4DT1B 2CZCA 4G84A 4P86A 3QE3A 3ZCXA 4A1FA 4MWCA 4PTLA 5JS6A 1K06A 1TCVA 3K35A 3WNCA 1RLTA 2XDWA 4IXWA 5B30A 4R7ZA 3UWSA 4XVUA 2NTNA 1U6KA 1NXWA 4L85A 1N2IA 5BW8A 2X8AA 3M81A 2BEWB 4J7CA 5FUWA 2ZYSA 4TMWA 4ZT4A 4NXNB 3AH8A 1CJBA 4XA8A 3ABZA 2JGAA 4NV0A 4HEA1 1C3VA 1QB8A 1SCUA 4NDZA 3DE7X 2FG7C 1A04A 1PEAA 3SBEA 2DTEA 1R74A 5DYNA 1CJMA 2H9IA 1YU6A 1A3CA 1VFNA 1CY0A 2PX3A 3GUVA 3M4NA 3QIAA 4QJ4A 1F4VA 1UDAA 4QWWA 3QVTA 2I1WA 4YDHB 2MR5A 4DUPA 4WJLA 2B1JA 2H08A 1DQZA 2DFNA 2P11A 5FOXA 4KX5A 5HF6A 3RYFB 5JO0A 3WNBA 1O0BA 5FUBA 1CCWA 4OLJA 1XE3A 1N75A 3OOEA 4IFEA 1JXAA 1XFDA 2P6NA 4J8PA 7REQA 2I66A 3LUCA 1QYVA 5LA6B 1E5QA 1SUBA 4GRDA 3VPFA 1PG5A 2FMIA 4JGIA 5KDLA 4BJ3A 1YE8A 3EEBA 3BFKA 1JIQA 5F1YA 1CZNA 3TW4A 3AI2A 3PNBA 5FUYA 2FPUA 2XKJE 1R7RA 2Y68A 3WR5A 5CCXA 3U3JA 3GCZA 4YS6A 1P17A 4QJBA 5I7WA 1YOVB 5K0JA 1R9NA 3ZLUA 1P2TA 3GEHA 1U0GA 4OQYA 3SHTA 3OZIA 3RSHA 5TSDA 4JQOA 1UBOS 3ZVMA 4ZT5A 2O4UX 1FX1A 2QBYA 2VL7A 4R51A 3CG4A 3SI7A 4B85A 4EJ2A 2JFOA 1A4IA 3Q3GE 2QYTA 2X40A 4KN8A 4AAYA 1SPBS 2YIVX 1CQZA 3M2TA 4IUDS 2GLTA 3RRFA 2XDAA 4HP8A 1Y9EA 1GRQA 1WXHA 2OWDA 3PXCX 4XIIA 4BTVA 4EENA 3ABSB 2A92A 5CDFE 2J5RA 3F3SA 3PFHA 2BZ1A 4Q3AA 4QRDA 4UQLA 3QFCA 2PV0A 4V3CA 1MOPA 2W6ID 4E13A 2DJIA 3TEJA 5E38A 5AOCA 4DT1A 5FL7D 2WJYA 3N2LA 1PFUA 5EKUA 3G1TA 5ENVA 4X1IA 2BRUA 3NBAA 3TL2A 3PIDA 3QVSA 2HLNA 3P2KA 4NKRA 1QQ6A 5ALNA 2BFAA 2RHLA 1U0RA 2PGDA 3I6YA 3GRRA 4JLBA 3FNFA 5FJIA 2RCYA 2J3LA 3UJ3X 5SYNA 2EJUA 1ECGA 4EKNB 4ALLA 4POAA 1JHOA 3ZBPA 4CL3A 3E22B 5DM0A 4Y2HA 3H2IA 2C4KA 4HVLA 4YA6A 2BV3A 2H18A 4JDUA 1SG0A 4CEIB 3M6AA 3ANMA 2XYRA 1W1IA 4NICA 1NN5A 4Q7QA 3NP7A 4BJ6A 3FMFA 4Q34A 4BUZA 3RYIA 4BBZA 4PQFA 3W4IA 3MTIA 4WOCA 2GVNA 2YV3A 2W2MA 4YDQA 1EUDA 3UWOA 1BXRA 2G9VA 4U02A 5A9SB 1L4YA 1IY8A 1E69A 3MJDA 3RT7A 4BYMA 2C7BA 3MTQA 1H1LB 4XOUA 2IUYA 3NWOA 4JUFA 4S1NA 1RZRA 2N3ZA 4FDTA 3L0ZA 1B8NA 1HWYA 2DLNA 5CCBA 1ND5A 5CVEA 1SVMA 1YO6A 2P2GA 4NDNE 4Y30A 1GTMA 2P6MA 3GWGA 3TOSA 2DLCX 3KT8A 4DLAA