3BMNA

Structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor (compound ax3)
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
267
structure length
250
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 90
structure length 250
sequence length 267
ec nomenclature
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3bmnA00
4F46A 4ZU3A 1PL6A 2VRBA 4AJPA 1HWYA 4CLHA 3K96A 3RFVA 2GO1A 3LF2A 1H6CA 1Y7TA 1H94A 1T4BA 1NHGA 2Y0CA 3GVCA 4BKUA 4O0LA 1YVEI 4A10A 3PGXA 1DO8A 1KOLA 2HSDA 5BSEA 2DPGA 4OSOA 4XYLA 3AOEA 3K8ZA 4WCFA 4CM8B 1M66A 3K31A 1Y8QA 3MJSA 4FJ0A 4II2A 5A04A 4XR9A 1LA2A 3PLRA 2GF2A 1AHHA 4R54A 3KYDB 4YA6A 4WECA 1Z7EA 1B2LA 3ROMA 1AGNA 3GNQA 2WSBA 5KVCA 3U62A 2HK9A 1IUKA 4NNJA 3F6YA 1SMKA 4K1LA 3F47A 4J1SA 2WYVA 3L9WA 2JCVA 1R0LA 3U4DA 4B79A 1LU9A 4J7UA 1VE9A 2XOXA 4ALKA 2R2GA 2NU6A 2CSUA 4QO7A 3ONFA 4RV9A 1HDXA 3K73O 3OJEA 8LDHA 1IZ9A 5EQFA 4E5YA 2WMDA 3V1TC 2X8LA 4F6LA 5L4NA 3JD3A 2BELA 2PFGA 5ITWA 3TRIA 2HJRA 3A14A 3FPLA 4R16A 4DA9A 1CJCA 1YBAA 1H2HA 3F9IA 1U2GA 3DZKA 3OFSA 2I3GA 2J3JA 3P2YA 3AY3A 1O8CA 3DB2A 3QV1A 1YJ8A 5DCWA 1V9LA 2CUKA 2QG4A 3MOIA 1U1IA 3JYLA 4PLZA 1GZ6A 3W4KA 3ADPA 3NT5A 4PLVA 1DIBA 5ENDA 2Z5LA 3I9LA 3E1KA 3WQQA 3JD4A 4MVJI 2AEMA 4E21A 4IZIA 5HTOA 3ONDA 1V0JA 2X0IA 4OQYA 2NU9A 1Y6JA 2NQTA 3U4CA 2ZYAA 4CQLB 2B83A 1ENPA 1HE2A 2OXIA 2VUSA 2O2YA 1EVYA 1JWBB 2Q46A 3SX2A 4I5DA 1X7GA 3F4LA 1LSSA 4BNHA 4P4GA 2NVWA 2OUIA 3OJOA 1JWAB 4CM9A 3B6ZA 4DLLA 5GMOA 4IJWA 3I4FA 4PLFA 2YV3A 4YAEA 4HKTA 1OAAA 4NMHA 4RDIA 1U7HA 4GGOA 2Q4EA 4KMSA 1WZEA 3KV3O 1QYWA 3ON5A 4J4BA 3NAQA 4P4NA 4R1SA 4Z0TA 3V1UA 3OIFA 5JMPA 4RF3A 3OJLA 4M54A 1HETA 4PZDA 4PZEA 1PR3A 3Q9UA 4J3FA 4YACA 3FWZA 4LCEA 1YRLA 1E7YA 4B4VA 1JDJA 3ZWNA 3ZU5A 3GMDA 2ZK7A 5F1PA 2PLAA 2RAFA 5I7SA 4LVUA 2YFHA 4CMGA 4U6SA 2H9IA 2OORA 4IIVA 1EK5A 2CF5A 1RM5A 5JAMA 3PHGA 2NUAA 4L9RA 4GBJA 1NQAO 3NX4A 3GLQA 1TXGA 1FMCA 3X2EA 3DFUA 3PDUA 4B3IA 3F5QA 3S2FA 5BSHA 5JC8A 4YJDA 3SBOA 4FFNA 5TSDA 2AA3A 3GGGA 3GVIA 4XB2A 3WWYA 3FSRA 4CR8A 3IKTA 4NJOA 2D59A 4BO6A 4KUHA 3VH1A 4MIOA 1SAYA 1GAEO 4HP8A 2VWGA 1ENYA 3N58A 4H16A 2NVUA 2J3IA 2I76A 3L0DA 4J43A 2VWPA 2X5JO 3EMKA 2HMVA 2C29D 4GAEA 5DNAA 2CDAA 1YBMA 3TWOA 4DRYA 3E5MA 2ZJ0A 5JW6A 2X22A 4OH1A 3WJ7A 1R66A 1ULSA 2AQIA 3G49A 3UUWA 4XX0A 3ZW8A 3GUCA 1U3WA 2D3TA 3DO5A 1G0NA 1NFRA 3V2HA 4INAA 4IQ8A 2P91A 1IHXA 2XXBA 4NDNE 3OHSX 1UAYA 3VH2A 4GLOA 2HMUA 2G17A 3GZ4A 3HUDA 3OECA 3BMCA 2B4RO 2PR2A 3D64A 3P5SA 2RH4A 1ZK3A 3PZRA 1HT0A 3V2UA 3MJ4A 5I9NA 2YUTA 1MFZA 3BTUA 1ZK2A 3ANNA 1HDRA 5A5FA 4B7UA 3NUGA 1NQTA 4EUEA 4LCJA 3QLJA 2X7HA 4PG6A 2V65A 4II3A 1WAMA 4J16A 4R1TA 3IUSA 4FPXA 2BFOA 1GQQA 2PGJA 4BB5A 1N2SA 3PQDA 1DJNA 1PEDA 2NADA 1E3WA 3OJ0A 1VL6A 1QYDA 1D8AA 3IL2A 4YT8A 1DEHA 1LUAA 2CY0A 3LT0A 1JKJA 3HADA 4ZHSA 3DBRA 1FXSA 4C4OA 4DWVA 1R37A 2NV6A 4BNWA 3B1KA 3RSHA 3DBVO 3QW2A 5U1PA 1QORA 1KY4A 4AJKA 4DC1A 3N74A 1QG6A 5THKA 1PGQA 4YT5A 5L4SA 3H6KA 2IODA 1UXJA 1WDKA 1DC4A 3D7LA 1PZHA 2CVZA 2HDHA 3AUUA 2ZATA 3LYLA 1C1DB 4CUKA 5T8KA 1E3LA 5JCJD 1M6HA 5L7TA 3UH1A 3VPXA 2ZB7A 4TZTA 2JFFA 1YS4A 2YV1A 1KVUA 1QMGA 1R0KA 3UW3A 3EVTA 1UP4A 3JQEA 5HS6A 4YXFA 5DOZA 3UGKA 1QXSA 5CP8A 4E13A 3PEFA 1RM3A 1SBYA 2Z1MA 1IB6A 3LC2O 2E82A 1XKQA 1KETA 2Q49A 3GGOA 2GCGA 2E37A 4J7CA 3I4CA 2D0IA 2C07A 1K89A 4BQPA 1V3VA 3QSGA 4YTEA 2X1HA 5DF1A 4DUPA 5COBA 4YPOA 2VOJA 1YH3A 3WGIA 4AJIA 4XB1A 3WLFA 1A4UA 1LDEA 2Q2VA 2ZB8A 3R0IA 1N1GA 4IIUA 3NTRA 1CQJA 1E92A 4YVFA 3QVXA 3ZN2A 2YYYA 2EIHA 1A9ZA 5A02A 4ZD6A 1UZMA 1EQ2A 4QQRA 1EE2A 5TT0A 1SCUA 4E6PA 3GHHA 3F1KA 3NJ4A 4R41A 4GSLA 4XGIA 4IS2A 3T4XA 3ZU2A 1UAGA 4N5NA 3LVFO 3TDKA 2YHUA 2ZKLA 4CV3A 2UVDA 3EDMA 2DT5A 4IXWA 2C20A 2P9GA 1UR5A 2O4UX 1WPQA 4H15A 4D44A 2Y99A 3M1LA 3GG2A 3MJCA 3AM5A 3GVHA 3DZJA 1X0VA 2JD1A 1NNUA 4DXHA 2B69A 4YAIA 4XJTA 4N5LA 1HYHA 1NAIA 3ZH2A 2GN8A 4FJ2A 2I99A 1T26A 2C7GA 5T6BA 5B37A 4BMVA 5I8WA 2OP1A 4MVJE 2CMDA 3GZNB 1KIFA 1VSUA 4DVJA 1ISIA 1XELA 2OFPA 3PQEA 3TQHA 2AE1A 3GUYA 5BQFA 3GNSA 5KKAA 2PGDA 1EQUA 3LF1A 5EMHA 1EUDA 1EVIA 1PS8A 4EDFA 4WNCA 4WUVA 4CJXA 1WVGA 4JROA 4O1MA 3BTVA 4BUCA 2FP4A 3E82A 2PNFA 3GY0A 2AEJA 3DMYA 3C3XA 4Z9XA 5L53A 4MIEA 4I1IA 4D0SA 1A7AA 1CERA 1DIRA 1PJCA 4DC0A 4OMUA 4RPLA 3E9MA 2JFGA 4L73A 4BO2A 7MDHA 4RVSA 1YOVA 4I9UA 4LK3A 3U3XA 2VNSA 5JLAA 1A4IA 3QVTA 2BFPA 1Q7CA 3IDSA 3QRWA 5JO0A 5EPOA 2O7SA 1X1EA 4AJ1A 3DTTA 3JTMA 3IC5A 2BF7A 2JHGA 4E5NA 3UCFA 4CV2A 2Y1EA 3IP1A 3RFXA 5JDIA 4GVXA 4DBVO 1LLQA 4EJMA 1T1RA 1HKUA 4D42A 1B8UA 5ER6A 2AQKA 1LBEA 2O3JA 3BXXA 4XKJA 2Y1GA 1TVEA 4NU5A 4N5MA 1U4OA 1XCBA 1WDMA 1ZK4A 2H63A 4RGBA 2A94A 3GHYA 1DBVO 4L74A 4YQZA 1LTHR 3Q2KA 3QE3A 1MUUA 4FJ1A 4HWKA 1AXGA 4IDBA 4A26A 4U0KA 4MVJM 1A71A 3PJFA 4P22A 1BTOA 1DLJA 4GMFA 3H65A 3GAZA 4R9RA 4YAGA 3ZI0A 3TOZA 4KP7A 5JO9A 4GX2A 3JQ7B 5JY1A 3I9OA 5K6AC 3F3SA 1PL7A 2R6JA 3I6IA 3VZPA 4R01A 1PSDA 5ER9A 5IDWA 1T24A 3WG9A 1C3VA 1Q0HA 4DLAA 1JA9A 1NPDA 4J0FA 3ZWWA 3GVXA 5AXDA 3CZMA 3OEYA 1GYPA 5COQA 5G0UA 4IGEA 2XXJA 3AUTA 4WLUA 5MGBA 1PWZA 3H9GA 3F1LA 5I9LA 1NXQA 4BNKA 1B15A 1TLTA 2GYYA 4PG4A 1VC2A 4IINA 4GMGA 3ZWPA 5KJFA 1W73A 1UP6A 1GUYA 1TEHA 4FFOA 3TL2A 1YOVB 3JYNA 3ZU3A 4CLEA 5HS4A 3HDJA 2HRZA 2WJPA 4CV1A 4PG5A 1CWUA 3ONEA 2J5KA 5CDGA 4BO5A 1PJ4A 3C85A 4TKMA 4TVOA 1MGOA 1ZMOA 3A1NA 1I5RA 2UYYA 1EUCA 1K3TA 1CQIA 1KEWA 4CMIB 2G5CA 3VAZA 5GZ1A 3TPCA 1DJQA 4E30A 4CQMA 1E6UA 1N92A 4JBIA 1P1FA 5CG2A 4EUHA 2OP0A 3HN2A 3QIVA 1DC3A 1Y8RB 3MOGA 2VUTA 4LW8A 5DP1A 3FR8A 1ZEJA 4UVDA 4RVUA 1R4NA 1IPFA 2C2YA 2VZ9A 3RWBA 3D4OA 4UEKA 3WIDA 3DBHA 3G17A 4FSHA 4G2NA 5TQVA 4NK4A 1P1KA 1P0CA 4TSKA 4DPKA 2W2LA 4IDEA 1E5QA 2X0JA 3FI9A 3CXRA 3PJEA 1TI7A 4E31A 1J4AA 3IJRA 2QYTA 3FTNA 3KBOA 4IDGA 3I9MA 4YJGA 1AHIA 1P1IA 4R3NA 3S8MA 3GMSA 1NFFA 3AM4A 3RAJA 5L9AA 2ZTMA 2CVOA 2X5KO 2X9VA 3K92A 4XZ3A 5TS3A 3RUDA 2YZ7A 1OBFO 4EUFA 1YB4A 5ILGA 3ZWXA 1NWHA 3MTJA 3NDJA 2BH9A 4W9NA 3AI2A 1BXGA 1KEUA 1UZNA 1SB9A 3D0OA 4KQXA 9LDTA 1A5ZA 3VKVA 1HSOA 1GTMA 4TVBA 1QYXA 2WD8A 4GI2A 1VJTA 4UUPA 1MC4A 4CMJA 3HZZA 3TZ6A 5T5QA 1T1SA 1D3AA 4MVJA 4LRTB 4R4JA 2EKQA 2PZLA 3CEAA 5IZCA 1CIVA 1RJWA 1MG0A 1E6WA 3D3WB 5JAQA 3KVOA 2YDXA 1MXFA 2QHXA 3AUAA 1U3TA 1Z75A 1H0KA 1E0DA 3BAZA 2WE7A 3QVOA 1T2FA 1GUFA 4PLYA 2POQX 1XQ1A 4YJFB 2HUNA 4MP8A 1DRWA 1MC5A 2EJWA 1YXMA 1BSVA 1GUZA 2WDZA 4BNNA 5JBIA 1DFGA 3I52A 4PRKA 4CM1A 1QYVA 1J49A 3IUPA 4MVJG 4YEDA 1LDNA 3NV9A 1YONA 1LI4A 3RC9A 4F45A 3ITDA 1HE5A 1ISMA 4FIZA 1U2DA 5K6AA 1M76A 5T67A 2V6GA 3KZVA 4CMHA 1UDBA 2BGMA 2ZB4A 2DBRA 2UAGA 2VQ3A 3ASUA 5G4KA 4AJ4A 2WEKA 4L0QA 4YJHB 1R4MB 4IQ0A 4Q3BA 3HJAA 4J1QA 2D4AA 3E03A 4QX6A 4W7IA 2Y0EA 4WJZA 3S2EA 1TB4A 1BW9A 3QP9A 3RUHA 2J6IA 4DBZA 1P1JA 4RLSA 1H2BA 4DYDA 2O48X 3ZCXA 2AMFA 1ONPA 3WGYA 1DDOA 3L77A 4DTIA 1PZEA 1Z82A 3I9KA 1P45A 1UXIA 5FFFA 3S2GA 2DTXA 4TQGA 2O23A 1T2CA 1B8VA 5LDGA 4CR7A 2FOIA 3H5NA 4TRRA 4J2HA 2A35A 3D5QA 1LJ8A 4JJGA 5L3ZA 4JJFA 1RYEA 4UULA 2O4CA 2DVMA 3AJRA 2I6TA 2JD0A 3FNEA 2XAAA 3ZWYA 1X7HA 3M2TA 5BNTA 1GV1A 4ALJA 4ND5A 2Z1NA 1ZIDA 2Y66A 3E6AA 3U0BA 4J2OA 1RWBA 1DSSG 1PQPA 1KERA 3I83A 1HDOA 4QSMA 2YDYA 5TC4A 4M8SA 1ARZA 3PWZA 3SXPA 3JQDA 2BRUA 2AG5A 3H9UA 4BNFA 2DM6A 2NACA 3STHA 1LC0A 2VRCD 4DIBA 2VYNA 1YB5A 1N7HA 1VLLA 4PLPA 1I2ZA 3KYCA 4KDEA 1Y81A 5L95A 1DFHA 2O50A 4Y6SA 5EJ2A 4ND3A 2LDXA 3TL3A 4ZQBA 4MKZA 2IE0A 3NKLA 3WSVA 4FB5A 4UREA 4JLWA 1HDYA 4A7PA 4A2CA 3FWNA 4ZGWA 1O95A 1ZK1A 2IYPA 3OQ1A 4O5OA 2FZEA 4HFJA 3WSWA 4YR9A 1LQTA 1CETA 2IZ0A 3IOYA 1I3MA 4HUJA 3VDQA 1ZEMA 2PD6A 1QLHA 3BMQA 3JQGB 4ND4A 4QT0A 3VVBA 5G0WA 3C7DB 1N8KA 2BHLA 4L8VA 4HV4A 4RPHA 3ZHXA 4PG8A 4NK5A 4CM9D 1BGVA 1PGNA 2Y05A 4K6CA 4CM3A 4MP3A 3SJUA 3PQFA 3K5PA 1QLJA 3E5RA 3BMNA 4D43A 3LT4A 2GERA 1NHWA 3PHHA 1SEVA 1VKOA 2RBEA 3VKUA 5CEFA 2QQ5A 3QVWA 1DRUA 1ZBQA 1YQDA 4C7JA 4CLRB 2PD4A 1IOLA 5GY7A 4XQCA 4OKNA 4FQ8A 2VZ0A 3DOCA 1O0SA 3H5RA 2EJVA 4FDAA 5KJEA 1OZAA 1GFSA 3FBGA 3JD0A 1O5IA 5IXYA 3C1OA 4RVGA 1C1XB 3TFOA 4CM7A 1BDBA 3LU1A 4XWYA 3SEFA 4XYGA 4BO7A 1PQUA 4TRJA 4BQRA 1DIHA 4IZHA 1VL8A 2B37A 4K28A 3GH3A 1NQOA 5EL0A 1D1TA 2FY8A 1JVBA 4Y6PA 4MIYA 3DEYX 1V3UA 5IXSA 2JFHA 2OOSA 4BGIA 1I2CA 3GA0A 2OMEA 4H3VA 3RUAA 1PS9A 2OHXA 4MKRA 3UFXA 3ROQA 3D3EA 1O6ZA 1GYQA 4YT2A 2DUWA 3R3SA 3JQAA 3WYEA 3ZGYA 1DB3A 4TMFA 4YAKA 4RDHA 1RPNA 3O8QA 4WCFB 5JFOA 1Y8QB 5JDCA 1ZSYA 2EV9A 3D4PA 1HYEA 1HL3A 3RBZA 1P3DA 2W90A 2WTBA 1SOWA 3CTMA 1E7MA 3ZWMA 1PJQA 4Z6KA 2OBYA 4OIMA 2NU7A 4PLTA 2NLOA 3PIDA 5AOVA 1CYDA 1NR1A 3GF4A 1U7TA 3PTZA 3JQBC 2VTEA 1NR7A 3E9NA 4B4OA 3HDYA 5CPFA 1B7GO 1I3LA 5DULA 4JX8A 4OOEA 4JGBA 4KOAA 2VYVD 3DZGA 4XYMA 4ILKA 3W1VA 5IF3A 1X7DA 1NFQA 2IRWA 1QV6A 3W8EA 2QRJA 2WD7A 2CFCA 4NFYA 1UH5A 1EK6A 2EGGA 4XYEA 4CM4A 1E1MA 1EVJA 4PN3A 2PGLA 1ZSNA 5TLSA 1LSJA 3WS7A 3ZV6A 5ADHA 1PTJA 2FWMX 2NU8A 1I10A 2EXXA 4BNLA 1PJTA 4BO8A 2FHSA 4UEJA 1WWKA 4AJ2A 2C59A 1SNYA 1KEPA 4D0RA 4OO3A 3KLPX 3JQ9C 2PKRA 4WEOA 1EFKA 1IYZA 3AFNA 4WK6A 2YHIA 1K5HA 3QVSA 1DAOA 4PLHA 2CZCA 5A06A 2AW5A 3S55A 3OMLA 4AJJA 1NVGA 4NFSA 4PCVA 2P68A 1SO8A 2H6EA 4U0JA 3DDNA 2AHRA 4LGVA 3FBTA 2X4GA 3H5AA 1T2EA 4CLOA 1VRWA 1HZJA 1RM0A 1ZNQO 3DMTC 2X9NA 1V6AA 4Z0HO 3ZV3A 2HKIA 1GY8A 4IM7A 4NIMA 2JL1A 4NQZA 3OICA 2VZ8A 3QQPA 5BSGA 3WQRA 1Q2XA 5ENVA 4D3DA 2ZTUA 4FGSA 2DAPA 3CSDA 4DREA 1P31A 1EBFA 1B3RA 4R69A 2VNAA 3D5TA 1TT5A 1S6YA 4U7WA 3JYOA 3D1LA 2GNAA 3I9NA 3AWDA 2YW9A 4NBRA 4BO1A 4CM6A 3DOJA 3NGLA 4HBGA 4MO2A 5KJCA 3OA2A 4GSKA 4X54A 1WXDA 1EBUA 3BZUA 3Q6IA 3O26A 4XIJA 3WOHA 4OGWA 3FRJA 6ADHA 2P2SA 5EERA 3OF2A 4R1NA 4NI5A 5JNLA 3OEWA 3M6IA 1ZH8A 5KJ6A 3RFTA 3KTDA 4L4XA 2Y0DA 3OQ6A 4EJ6A 2G0TA 3NT4A 3VTFA 4ZRMA 3WQSB 2F1KA 1D7OA 5JY6A 4GQAA 4EYEA 2J5QA 3A06A 3JYQA 4IDDA 2NVUB 1F14A 4C7KA 2RIRA 2X9GA 1A7KA 5C7IO 5GZ3A 2Y68A 2Y1DA 2DFDA 5JYEA 3GC6A 2I3AA 1HSZA 3C1AA 2RCYA 1A72A 1JAXA 2O3UA 2PWZA 3RC2A 3FPCA 4XGNA 1K6IA 4NBVA 2QX7A 2Q2WA 4B7CA 4RORA 1EVZA 1GEEA 4AJLA 4BNVA 4DQUA 1IHYA 1MLDA 2ET6A 3BMCB 2Q3EA 3FR7A 2UUPA 1NBOA 3NEPX 5BNIA 2VHZA 3CINA 4JN6B 4CL8A 1PZFA 3L4SO 4NFHA 4P38A 2YQ4A 3CZRA 1GV0A 3HE3A 5A3VA 4BS9A 5AQ1A 3AUSA 8ADHA 2P5YA 3ASVA 2C5AA 5JAIA 1UDAA 4YRAA 4L75A 3UCEA 3RD5A 3IKVA 1YL7A 3PK0A 4RF4A 4FW8A 1U3VA 4IY1A 5FI3A 4WE3A 3IAHA 3ZV5A 1PX0A 4FCCA 4OXKA 1I01A 1GZ3A 1PQWA 1U3UA 4NPCA 1V35A 4ZRNA 5G4LA 4L4SA 1UP7A 1FDWA 1E3WB 4NJMA 4JQCA 4FBGA 3LC7O 3EYWA 4GKVA 4UUMA 1N1EA 4R5HA 3DBRB 3FHLA 4IBOA 4RO0A 5A9SA 4YAJA 5ICSA 2BLLA 5B4TA 5K0ZA 1GPDG 3S2IA 1DOHA 4PVDA 3ETGA 1X14A 3CUKA 3ZHYA 5BT9A 2EW2A 2E4AA 1P9LA 4DPLA 1X1TA 1EDZA 1KS9A 2GD1O 4GLLA 1E7SA 4YCAA 2J3KA 4MJLA 1KBZA 4J91A 3DWFA 1W8DA 2E49A 3F46A 1Y5MA 3AW9A 5A03A 2B4TO 3GDOA 1MP0A 2FSVA 3QHAA 1XU9A 4HFRA 3PFFA 5CDYA 2G76A 2V6BA 4E2YA 4RL6A 7ADHA 1LDMA 4OKIA 1JKFA 1R12A 2QRKA 4NBWA 3T7EA 3UKOA 3QA9A 4MOWA 4ONEA 4DMLA 3CH6A 3DMTA 5EESA 3DZIA 3KRTA 1N7GA 4Q3NA 3RASA 4E3ZA 4BGEA 3C7AA 3M1AA 4BMNA 5HBRA 1GL3A 3WBFA 4CLDA 2VT3A 2CDBA 4WLNA 3VZRA 2BFMA 4I5GA 3DBLA 2AG8A 3V1YA 2PTGA 1EZ4A 1ULUA 2X0NA 4BHTA 4WEQA 3NJ8A 2W4QA 4CMKA 3AY6A 1K2WA 3TF5A 3OIGA 5AXBA 5H82A 2GUGA 4HNHA 1PGOA 1XA0A 4CUJA 1A9YA 3PYMA 1H6BA 3ZWAA 1TT7A 3AI3A 4J1NA 5LDHA 4I5FA 4P8RA 1P74A 3ENNA 4XIYA 1NPTO 3GDGA 1R16A 2DC1A 2C2XA 3TJRA 3MWDB 4Q9NA 3ZZNA 4EEZA 3ORFA 2FSSA 5AYVA 1DC6A 2NTVA 1K6JA 5FEUA 4WOJA 5C3MA 1UXGA 4JP2A 2Q1TA 4UVIA 2FR0A 5AVOA 2DBQA 4B8WA 3NYWA 4OAQA 3ZHBA 1DPGA 2D5AA 1QRRA 3JD1A 1NYTA 4XEHA 4MINA 4R51A 4XGKA 4KUEA 2O3QA 3UICA 2HCTA 3ANLA 5B1YA 3WYCA 1E1LA 4EEXA 1MFPA 3DTYA 1OOEA 4QEDA 4XCVA 1IZ0A 1E6EA 4HADA 3RCBA 4XQEA 2I9PA 2QYSA 3ZWOA 4UUOA 4XRRA 3SLGA 4KTVE 4IDAA 4DMMA 3DL2A 4B7XA 4BMSA 5A3JA 1N9GA 4KWHA 4XRGA 2UV8A 1E1KA 1GCOA 1VKNA 3M2PA 1YL5A 4EITA 2EF1A 3Q11A 1EDOA 1R15A 4GGPA 3WGTA 4FFMA 1ENZA 3NTQA 2RHRA 3UAGA 4DQXA 3SC6A 1G0OA 4A0SA 2HQ1A 2ZTLA 4ALNA 4YT4A 3AK4A 4PRLA 5G2OA 4ZQEA 1YJQA 1PIWA 1VL0A 3OETA 4BV9A 2QRLA 2B0JA 1C0IA 1O9BA 4KDFA 4D45A 3QWFA 2W2KA 3E8XA 1Z45A 2P9CA 2WE8A 3O03A 4BGVA 1FK8A 3I1JA 3WFJA 2V6MA 3DQPA 2HK7A 4ZJUA 4OOFA 2AQHA 2DTEA 3RQSA 5KNLA 4B4WA 5T57A 5HA5A 2IXAA 5F5LA 3JQ8A 3X2FA 1AUPA 1LNQA 3W6UA 4LN1A 4LRSB 1PJBA 3DXFA 4QFCA 1M2WA 1M6WA 3FNHA 4XQ9A 5LCXA 2OO5A 2VOEA 5IJZA 2IZ1A 2UDPA 3TZHA 3FN4A 3BYZA 1I2BA 2C54A 5C37A 3GN1A 5CEEA 3WTBA 2NNLD 5JC1A 4M1QA 4QO8A 3U5TA 3RC1A 4HXYA 1GR0A 1KVRA 3RBVA 1MV8A 2JKVA 3GEGA 4URFA 3VPSA 2QZZA 4CL3A 5KIAA 4FFLA 4MVJH 4S3MA 2PKQO 1VJ0A 3GG9A 4N18A 1GCUA 3MEQA 3ZDFA 1CRWG 1H9BA 1OFGA 5G0VA 5BR7A 5G0TA 4Y9DA 3UCXA 4ITUA 4RZIA 4OQZA 4WLOA 2Y67A 2FN7A 2X5OA 1MX3A 4QTZA 2ZTVA 4MVJD 4RZHA 1YB1A 4J90A 1FDUA 4BNYA 5JXWA 4ZQHA 2Q4BA 2IYOA 1HYGA 3L6OO 4DQVA 1GQYA 4J9VA 5CDUA 1DIAA 3TOXA 3ULKA 5BNFA 2VHYA 3WXBA 1WMAA 1XR3A 4BNGA 3EGOA 5B4VA 4RF2A 3QY9A 5FF9A 5TX7A 4U6QA 2ZJ1A 2FPIA 1Z6ZA 4KQWA 5KVVA 4TWRA 2JAHA 3RKRA 4IMRA 3JD2A 4I8XA 3OH8A 1NP3A 2XPCA 4U8GA 1FDVA 2GZ2A 4WASA 4IJKA 3JQFC 3PZBA 1FF9A 3H2ZA 4IXTA 2NM0A 3BIOA 2VTDA 4RVHA 1MG5A 4XQGA 4E2ZA 3AOEC 4WCFC 1Q7GA 4M87A 4UUNA 4JCOA 2A9FA 5L7WA 3ROKA 1ZFNA 5AXCA 5TNXA 4OXNA 3ZWCA 3WB9A 1V3TA 1P33A 4AJEA 5DBIA 1HDZA 2LDBA 2X0RA 1C14A 1E5LA 1SEPA 3Q3CA 1OI7A 3H3FA 3ICPA 1HF3A 1KVQA 3O38A 1YDEA 3LC1O 4D7AA 3ZW9A 4BNZA 5A1TA 5IZ4A 4GKBA 5FI5A 1DAPA 2PKQP 3ZU4A 5JE8A 5F1KA 4CQMB 4YWJA 3MWEB 3VHRA 4R1UA 4E4YA 2D5CA 4B4UA 1Z74A 3FTPA 5CDTA 5C7OO 2ZQYA 1GEGA 2CF6A 4FN4A 1O89A 1BVUA 4WLFA 4AG3A 5CFZA 4TRMA 4J49A 4NBUA 1R4NB 5IG2A 3L4BC 1ZMTA 2BFAA 3DAFA 2EWMA 4ZA2A 2VT2A 1BMDA 3DBHB 1T4DA 3EAGA 3ABIA 4DGSA 2WYUA 5MDHA 5JCXA 2Q1SA 1E7RA 1ORRA 3RI3A 4A27A 3L6DA 3IJPA 1M75A 1TA4A 4Y98A 2JD2A 5BSFA 3H9EO 1Y9AA 4DL9A 3HDHA 4CM8A 1H5QA 4WLEA 4YJGB 3ROPA 5CDSA 3OBBA 2CD9A 1Q1NA 4Y6RA 3UHAA 6LDHA 3BTOA 3DR3A 3KYDA 1XYGA 3P2OA 3PWKA 2HAEA 3PP8A 3JCZA 3CE6A 2C5EA 2CNBA 3GPIA 3KEOA 4OM8A 3V8BA 3C1TA 4YRDA 3ZNPA 9LDBA 2BMAA 1BXGB 1LX6A 1I30A 4FS3A 2A4KA 3Q9NA 1EE9A 3HB4X 2B5WA 1ZCJA 1A27A 1P44A 1BDMA 3DHNA 3TNLA 4GX5A 3PLNA 4J0EA 4GL4A 3Q1LA 4BL5A 5U9CA 1PL8A 1R6DA 4RQUA 3KM0A 1XHLA 2C82A 3QWBA 4CMAA 4NHEA 1E3SA 5J23A 2VWHA 2ZYDA 2H1SA 5FWNA 2P4QA 2D2IA 1W0CA 4I08A 3INRA 4NBTA 3V2GA 1K0UA 4ZICA 3KXDA 2DFVA 3KSUA 1E7QA 4ESOA 5L40A 3JV7A 4FGWA 4BO4A 4QXMA 1NAHA 4DYVA 5DN9A 3VVCA 5IDXA 5ILOA 2WWRA 2ZCVA 3G0OA 4O63O 2DPHA 3G3EA 4FC7A 4GVLA 3HQ4O 4IPTA 4ALLA 5I7VA 4ND1A 3PJGA 4RPKA 3LK7A 5B12A 4CQLA 1SC6A 4AJHA 2J3HA 2W8ZA 3UVEA 4ROSA 4UVHA 3RUCA 2JAPA 2BGKA 4NH4A 4EZBA 1LRJA 4GX1A 4Z0PA 3H3JA 2BI7A 4LMRA 3C7CB 3CMMA 4BO0A 4RJTA 3CIFA 1JAYA 5DBGA 2GPTA 4KWIA 5G4KB 3IP3A 3HFSA 3LZ6A 1MXHA 1QR6A 2Q99A 2Q45A 1C0LA 1YDWA 1ZK0A 3JQFA 1U5AA 4YBZA 4XDYA 3GRKA 1BW9B 2GASA 1W4ZA 4BKOA 4J9UE 1I33A 1ONNA 3U4HA 3VPHA 3G1TA 5I7FA 1DIGA 3A9WA 3GN2A 4OL9A 1ZO8A 4HNGA 3PDJA 3PGJA 1VM6A 4BIIA 3ST7A 1L7EA 3R3JA 4RPGA 5IDYA 2I67A 2I5PO 3AFMA 3JQAD 5ITVA 1ADBA 1NWCA 1IPEA 3VZQA 3ENKA 5AXAA 3HNPA 1JW9B 1HLPA 3U09A 3IQDB 4JXKA 2AEFA 1J6UA 2O3RA 3ZNQA 3DFZA 4L76A 1ISGA 1HDCA 3JQCA 4UAGA 4E32A 1U4SA 3O9ZA 4LSWA 2VRCA 1XSEA 1P1HA 2J5RA 3PXXA 1PR9A 4JNKA 1UXHA 1QKIA 5KOIA 4MPDA 3W8DA 3W6ZA 3OQBA 1Q7BA 2HMTA 1J5PA 3LLSA 4HFNA 1XEAA 2VCYA 2JCXA 1OMOA 1UJMA 1ZKMA 5K9ZA 3QWHA 4D79A 2EEZA 3EW7A 5A9RA 3L4BA 4M55A 2X23A 4XYBA 4RCVA 5L7YA 5JYDA 3AOGA 4EW6A 5CPBA 4Z9FA 3KYCB 1P77A 1BWSA 5HRUA 4RVDA 3WWZA 3HB5X 1HZZA 1GZ4A 2NTJA 1T2AA 3INGA 5T8KC 4PVCA 1OC2A 4KTTE 2C7VA 4GWGA 1LLCA 1YE3A 3MZ0A 3NT2A 4CM5A 3WNQA 4JIGA 1FDTA 4MDHA 4D3SA 4UVEA 4Q39A 3DZFA 4CMBA 4HY3A 1KC1A 3RROA 4ZVVA 4WNIA 1WDLA 3H9QA 3G1UA 1E1NA 4IJUA 4JBHA 4DLBA 4IS3A 4QFDA 3BMQB 1QSGA 3OM9A 2JHFA 3P19A 4ND2A 3WX0A 2PD3A 1ADFA 4D41A 4IJVA 3RC7A 4Y8VA 5IN5A 3GVPA 3WGGA 2C0CA 4F3YA 4E2WA 5ICMA 3F5SA 1GYRA 1H6AA 3JQ6A 4E0BA 1ID1A 4XDZA 5DBFA 4NG5A 2IZZA 3BMNB 3VH4A 1CF2O 1UUFA 3KHUA 5IN4A 3ZNOA 1HDGO 2HU2A 3GRPA 3SJ7A 1XDWA 3DHYA 1JTVA 3HN7A 2VN8A 3IS3A 1QP8A 5KWEA 4WKGA 3INTA 2ZYGA 5EN4A 1B14A 3COSA 2O3TA 4TKLA 1HTBA 5DCYA 2BI8A 4Q3CA 3WLEA 1PJ3A 2DU8A 3O4RA 3E48A 3GAFA 2PA3A 3EVNA 4A73A 5JAZA 3TZKA 1ZJZA 4RQTA 4W82A 5THQA 1EEHA 3BHIA 2NQ8A 1C1DA 4R5MA 4G5HA 2PH5A 2E48A 4FC6A 2DLDA 2IXBA 1MB4A 3ANMA 3EZYA 3WIEA 4U5QA 5KVSA 1SZJG 3WMXA 5I8ZA 4M86A 1G6KA 2Y1FA 3EK2A 3OSUA 2R00C 4AFNA 1JQBA 1JVSA 2AXQA 5TJ9A 2XF8A 3JQAB 3BHMA 1RKXA 3K30A 3RKUA 5F21A 4E5KA 4PFJA 1BG6A 1PS0A 1Y1PA 3O8QB 3DZBA 3PPIA 1U9JA 4AJNA 3RVDA 3EUWA 4YQYA 1YWGO 3JSAA 2VYVA 4CMCA 1NPYA 4FFRA 1PWXA 1LQUA 4I9HA 4CR6A 2VUUA 3VDRA 2FRDA 4O6VA 3V5NA 3HWRA 2E6UX 3CKYA 2ZCUA 3KB6A 4K9DA 3GFBA 5EIOA 4XA8A 2TMGA 2HK8A 3QWIA 4Z3KA 2UUOA 5A05A 1LC3A 1I3NA 1T25A 2VWQA 2PY6A 2HRBA 2WD7B 3CMCO 4IUYA 4W99A 2RHCA 4CM4B 3GK3A 3KLMX 2B36A 1W6UA 2Q1UA 1GU7A 1ZW1A 1HLDA 2FPGA 3KSZO 3HFGA 2GDZA 5GZ6A 3WMWA 1SPXA 1KVSA 4OJNA 4OSPA 3NRCA 3UF0A 4E12A 5U4QA 1ZJYA 1IULA 3BHJA 4K26A 1JN0A 3VTZA 4AJOA 5F3RA 4EJ0A 4L4RA 5FYDA 5A9TA 3OP4A 2YHIB 2YV2A 4JP3A 1B0AA 3TN7A 5JDIC 1ENOA 4E33A 1EMDA 4I9NA 4BVAA 1GPJA 1ISJA 1H6DA 1AXEA 2BKAA 3K9QO 2EKPA 2I66A 3PI7A 2EERA 4N7RA 3TSCA 3WGQA 3LSYA 1ZXLA 2BD0A 1HE3A 4CODB 3AU8A 4CLOB 4JK3A 3HSKA 1B16A 3GZNA 3E18A 4RPJA 4GX0A 4NR0A 2HJSA 1LLDA 5I9MA 4FFPA 1Z7BA 1FJHA 1KC3A 2P9EA 2OZPA 1ML3A 3FNFA 1I24A 1DLIA 3JQBA 4W7HA 3F4BA 5F5NA 4EI2A 3LDHA 3ETDA 5H81A 4DPMA 1NX6A 4Y67A 3BTSA 1O94A 1E77A 2QIOA 3GPDG 5DZSA 1TT5B 1KY5A 1QV7A 1I3KA 2NVBA 2WYWA 4BNIA 1J0XO 4CUZA 1IE3A 1PU2A 1NM5A 1F17A 1PGPA 1I8TA 3W8FA 1DXYA 2JCYA 1FDSA 2GR9A 4GH5A 2PV7A 4J1TA 5JCJA 2QZ9A 1R0SA 1HRDA 4KZPA 2PZMA 3RUIA 5A4DA 1LEHA 4BO9A 2Y1OA 5H83A 2FZWA 5TIIA 4BO3A 3A28A 3OJFA 5KJ1A 3JQ9A 5L51A 3PJDA 4TRNA 1U28A 3RUFA 1RM4A 1DFIA 2X6TA 1GQ2A 2OGUA 2Y1CA 4MVJP 4O59O 1YQXA 3HDQA 5L4LA 4JBGA 1ISHA 2Y93A 2YQ5A 2A92A 1SOVA 4PIVA 2NWQA 3C24A 3I23A 5F1OA 2JJYA 3H8VA 3NDIA 4CLXA 4FOOA 2F00A 3WNVA 3BA1A 4RVFA 1ISFA 3B20A 1KVTA 4IDFA 4BOYA 4Q3AA 5DT9A 3DZHA 4K6FA 4CPDA 1U8FO 1QYCA 1ZXBA 4GWKA 2R00A 1E3EA 3PFWO 1PJ2A 2EP5A 3T4EA 3U49A 1E3JA 1F06A 1YQGA 1P1RA 1F12A 3PWSA 1LSUA 5TF4A 3VPGA 3I9JA 3GNTA 3NTOA 1XG5A 3RJ9A 4ZQFA 1D4FA 1X13A 1G1AA 2PZKA 4QUKA 1PZGA 4M89A 3ADOA 4Z3DA 4BKPA 2O7QA 5EINA 2CVQA 3JQ7A 1XU7A 3U4IA 4HX5A 4B8ZA 1XQ6A 2ZQZA 1E7WA 1VSVA 2GRAA 2X86A 3L6EA 1WLYA 3HHPA 3WGOA 3PIIA 2D8AA 4EGFA 3FNGA 1JLLA 2H5LA 4J7XA 3H2SA 3WICA 3I3OA 5C7LO 3DAPA 3H9JA 4CMEC 3OA0A 4RF5A 3WGZA 3I5MA 1I32A 3C8MA 2GLXA 1VI2A 1ZZEA 5ES3A 2IDZA 3LT2A 4S1VA 1UDCA 1NVTA 4NJMB 4PG7A 5IAAA 2IEBA 3RU7A 3I6QA 1X0XA 4BNTA 4BB6A 2WM3A 1IL0A 4J4HA 1PGJA 1VPDA 2GN6A 5A9SB 4HFMA 4E5MA 4UEOA 4W9NC 4D3FA 2GN9A 4LISA 3ZNNA 2HLPA 2V7PA 2X58A 2ZIZA 4XD2A 4OXYA 4IGFA 1U8XX 3DAGA 1BRMA 3DONA 3D4NA 2DQ4A 4ALIA 1AN9A 1PJSA 2VHXA 1XWFA 4J4TA 1Q0LA 1DRVA 2RH8A 1LSOA 3GQVA 2HO5A 1F8FA 1V8BA 1LDBA 4P4LA 4PLCA 4CMIA 2V6FA 5IZCC 4XJSA 2I65A 5KKCA 4A03A 2Q1WA 2HMWA 4WPGA 1KEVA 5HM8A 4LMPA 1VJ1A 3EZLA 4BNMA 1Y8RA 1LXCA 4B3JA 5JSFA 2GSDA 4AVYA 3AU9A 5TGDA 3EY4A 4ID9A 4YRBA 3AI1A 3K2EA 1ZSVA 2GN4A 3T7CA 3RBXA 5LC1A 4CQMD 3MJVA 5COAA 3LLVA 4LVCA 3L07A 2B35A 3DBLB 1I0ZA 3VC7A 3GOHA 1AE1A 2CDCA 3ZHZA 3FD8A 4DIFA 3PYXA 2DTDA 2EW8A 1B26A 3ZV4A 4PGFA 3FF4A 2DKNA 3RUEA 4F6CA 3WTCA 1JKIA 3PHLA 3DHEA 2W2LD 2YFQA 2AE2A 1K6XA 4UVGA 2VHWA 1CEQA 2B4QA 3LT1A 1XIVA 4J6FA 4RLHA 5TRTA 5HWSA 2OBNA 4R68A 1P0FA 5JPIA 4KUGA 2Q2QA 3JYPA 5EQDA 2VHVA 3K6JA 1OC4A 5JMWA 5DOVA 3VH3A 3UXYA 1NQ5A 1NVMB 3WGHA 3D3WA 2FR1A 3HG7A 4Q3DA 1X15A 2EKLA 4FR5A 1GD1O 2SCUA 5JS6A 4MVJF 4R9SA 1NASA 5CHEA 4W4TA 3Q2IA 5TT1A 3GDFA 4ZQGA 4YJFA 4NZ9A 1YO6A 1RYDA 2PK3A 2EP7A 5I7EA 2TMDA 3GEDA 1LDYA 3VZSA 1CDOA 1HXHA 1N9GB 3MTGA 3PHIA 1BXKA 4YYZA 2YY7A 3GR6A 3Q0EA 3TZQA 1SB8A 3U9LA 3KEQA 3KETA 1KYQA 1YL6A 3MCVA 1Z73A 3E9QA 3KO8A 1L7DA 3BMOA 1XLTA 4PLWA 1BXZA 4CV0A 5T64A 2OL4A 2G82A 4AICA 3SC4A 5TJHA 2YJZA 4WLVA 4YJHA 1R4MA 4BKRA 1BHSA 3FCOA 3P7MA 1N5DA 3R6DA 3S1LA 3G79A 1GADO 4E5PA 3H4VA 1UZLA 4IMPA 1ZUD1 4WCDA 3KOUA 2G1UA 2W2KB 5L45A 4CMEA 1BVRA 4AL4A 5G0SA 4XR4A 3GT0A 4D46A 1DHRA 3AM3A 1GDHA 2DBZA 4Z9YA 2PZJA 2FPPA 4A5OA 1U5CA 1F8GA 4ZN6A 3MJTA 1YKFA 3LQFA 3JQ8B 3ETEA 3IIEA 1HEUA 3SVTA 2EHDA 3UN1A 4BNXA 3NDRA 4E2XA 1H93A 2PH3A 4TZKA 3AY7A 2EG9A 2O2SA 3KUXA 1IY8A 3KYBA 3WBBA 4I5EA 3ZWBA 1B3BA 5DCUA 1S7CA 2EGHA 3B1FA 3H7AA 1NTOA 3QWAA 4PLGA 3IMFA 1WP4A 1UXKA 1ZVMA 2FR8A 4FOSA 4YB8A 4M49A 4ALMA 4OHUA 5IFLA 5CG1A 3WDSA 1F0YA 1YBVA 4YDRA 4PZCA 4TROA 4DIOA 1WNTA 3W4JA 3K2BA 1DHTA 1ONOA 5KCZA 4OYRA 4B3HA 5CEJA 3QJ5A 1Y5RA 4BNJA 4WOKA 3CPSA 3PHJA 1WZIA 3N7UA 4BGUA 1C0PA 1EFLA 3R1IA 4QECA 1T2DA 3VPFA 2AQ8A 5KTKA 1ADCA 4FD3A 1B8PA 5B4UA 1MA0A 2GZ1A 2HMSA 3PVZA 1C0KA 3W4IA 2ZB3A 2O3SA 3TFQA 4NU6A 2D1YA 4H7PA 3BMOB 3ICCA 2P4HX 3UOGA 1WMBA 1Q0QA 3WJAA 2NSDA 2VYND 2QW8A 3ITKA 1E3IA 5CAEA 4EBFA 3DC2A 1LLUA 3OIDA 1PJLA 1M67A 1WW8A 5C5IA 4BNUA 2NTNA 5DP2A 3RJ5A 1LRKA 3GEMA 2Q50A 3JQGA 5A5EA 1JU9A 1ADGA 5JDCC 2GZ3A 4W6ZA 3PRJA 3WYBA 3ZWVA 3NGXA 1I36A 1D1SA 4IQGA 3B70A 4BV8A 3EHEA 4GPD1 4MKXA 2Z95A 4WGGA 4MP6A 4JJIA 2GGSA 1HE4A 3KSDO 1LDGA 3TZCA 3GFGA 2DUUA 3MJEA 3RIHA 3L9XA 2W98A 3SLKA 5DDIP 1XGKA 2FMUA 2P5UA 3WR5A 4CLRA 1EUZA 2DBVO 3WFIA 2ILTA 1H9AA 4IDCA 4Q3EA 4G65A 3A4VA 3EC7A 3RU9A 4BKQA 1LRLA 2B5VA 1L1FA 4LSMA 3GGPA 1Y9EA 1C1XA 3PYLA 3DOOA 4N54A 3VOSA 1YGYA 5IDQA 1DC5A 3B1JA 4R3WA 2BGLA 5KVQA 2IEDA 2J8ZA 4G81A
chains in the Genus database with same CATH superfamily
1HPLA 1UBNA 4RIIA 2J31A 2HGSA 2XMGA 3PHBE 5EE0A 2VRBA 4K8RB 1R5BA 3UK0A 3SICE 1XZMA 4CLHA 3RFVA 1AGXA 2C8JA 2AMLA 3DW3X 2P6PA 3L0OA 3ORYA 4AX4A 1N57A 4FN5A 5BVGB 3AKEA 4CCWA 2JLZA 2CHFA 2DHRA 3R3VA 2Y0CA 4MEAA 4AQ7A 3CKLA 3GVCA 2J59A 1MQ8B 4QOSA 1V95A 2R96A 3PGXA 4LPSA 5AI6A 1Q20A 3EWSA 5EJ4A 2DPGA 3VYVA 3K8ZA 4WCFA 4AYXA 2XUAA 1JHMA 1M66A 1Z2AA 1RI1A 2EG5A 2A86A 3K31A 1KY2A 1KAOA 3NFRA 3VO2A 1LI5A 1J0CA 1YB6A 1TYBE 2CUTA 3KS9A 2P5TB 2ZRNA 3COVA 3KYDB 3NHFA 4R54A 1VIAA 4YA6A 3PS9A 5IJXA 3U31A 4CF7A 3O8RA 1B2LA 1L4BA 4Z4QA 2O8FA 2PX0A 5GONB 3D7KA 3PBKA 2YJTD 3O1IC 5LLTA 1P29A 3F6YA 4H3SA 5JD5A 3F4KA 2WYVA 4J1SA 4QELA 5JNVA 4B79A 4MJ3A 5JXHA 4C2BA 4ALKA 2JIRA 3KOWA 2R2GA 4JYPA 3WL6A 4RA6A 4LAFA 4PICA 4RK0A 3ZS9A 3KX2A 5CLIA 3IDOA 4M9SA 1FDRA 4FU0A 3O9MA 4IH1A 5JQGF 2C94A 1MEEA 3ECAA 4LXQA 4M0DA 5EQFA 1Z9BA 4OQLA 3EXG2 4AQYB 4IDOA 2PFGA 5HGXA 3TRIA 1QS0A 1EX6A 2APJA 3ZLTA 3B3JA 4HLNA 5AJHA 5EOVA 2P6RA 3I2JA 2FKAA 2J3JA 3OT1A 4EO9A 5EWLB 2A0WA 1JFFA 1XVIA 3LQYA 4K2AA 1O8CA 1P7CA 1QBKC 3OEED 5DCWA 5ITZA 1GSAA 1EJ2A 2OYRA 2GLTA 3MOIA 3EGCA 3V34A 3FYDA 3ABOB 4M83A 3I0ZA 3W90A 3NT5A 4C7MA 1RKQA 1DIBA 3IP9A 5ENDA 1L5RA 3LCMA 1P4GA 2AEMA 4LJ8A 3DKPA 4YIKA 3NRBA 1EHYA 1Z6XA 2FLVA 5GJWC 2IYAA 2DX7A 2HWKA 1AGPA 2NU9A 2UKDA 3IE2A 4OQYA 5BT8A 2O6HA 1OFUX 3QEBZ 1HE2A 3MGGA 4DR5B 4KR2A 4DJTA 3QOWA 3IIKA 3W77A 1JWBB 2Q46A 3T9BA 1EK2A 4I5DA 3M4YA 3UV7A 2QIPA 2OUIA 4I55F 1YQ9A 4EK9A 4MR8B 3N0TA 4CM9A 3B6ZA 3L8YA 1USWA 1ZINA 4MUYA 5GMOA 2OA0A 4DLLA 5BN1A 1R8XA 4OHKA 4ZT3A 1IIRA 1K5PA 4YMSA 8ABPA 2YV3A 2PS0A 3H9CA 3P8ZA 4YAEA 4CKWA 3QQ5A 3OI7A 4NMHA 3RC3A 3RIYA 2WJVA 4GPBA 4GGOA 1UQUA 1WZEA 4IIBA 4I4LA 4P4NA 3NAQA 4Z0TA 4WBNF 2YWXA 4AZ3B 1SUFA 2JHPA 3IHTA 3OJLA 1Y4ZA 2WTUA 2GFQA 2WIAA 3JATB 2JDIA 5IS2A 2CXSA 1LGYA 2X5NA 4L9AA 3HPRA 4LCEA 5TS2A 3WGUA 4Y30A 4CWAA 5K0CA 3E61A 4B4VA 2C9YA 1Z0JA 5I7SA 1WB6A 2XE7A 2PLAA 2RAFA 4NSNA 4TTVA 4YN3A 5IH3A 3T94A 2FW6A 4U6SA 4E09A 1RR6A 2QTCA 1A97A 2OORA 2FWPA 1KOFA 2YWCA 3LZDA 3NXSA 4IIVA 1Z5GA 1M2OB 3W2GA 2C99A 1Z4MA 3ET4A 4NABA 3S27A 4AB1A 5DX1A 2QTNA 3WKDA 4F8JA 2NUAA 4L9RA 4EQZA 1PBNA 4YO8A 1Q44A 3GLQA 2NPOA 2O2DA 2EX0A 3QYFA 1J07A 1CT9A 2R8BA 3PDUA 3S2FA 2ZM6B 4JBWA 2ZRHA 3DTVB 4DDMA 3DEJA 3O3NB 1C3EA 2GNOA 5TSDA 2AA3A 3U0VA 4DM7A 3U4QB 4CR8A 5A7HA 5T41A 4NJOA 4D8XA 3UJPA 1L8LA 4MIOA 5ALRA 1SAYA 3GRCA 1R4AA 2YMMA 3KZNA 4M1MA 2C9OA 3OQPA 5AHRA 5D87A 3PNBA 2NVUA 4R40A 4DQDA 2I76A 1N7JA 3L0DA 2K4MA 1GN8A 3QENA 2HMVA 2C29D 4GAEA 1UPTA 4MUXA 4DRXB 3VU3A 2PWAA 1N5JA 1G8SA 3E5MA 2PUTA 3S0JA 1XI2A 3D7NA 1EXDA 2JAOA 3WJ7A 5K01A 3U4MA 1A2QA 6REQB 3HKDA 4RHTA 3GUCA 1U3WA 1JPUA 1O97C 4X3CA 4BRUA 3A7DA 1CF4A 4WOPA 4IQ8A 4AZWA 4EECA 3HXQA 4TLCA 5TPWA 1V4BA 4F3CA 4CE6A 5IAOA 4XTCS 2BUCA 1ORWA 1XZNA 1EFUA 4GLOA 3L06A 2HMUA 3CN7A 5FLKA 3GZ4A 5C8VA 3BMCA 2FWBA 1T5DX 3T3HA 1D2HA 3VAYA 1J99A 2JLRA 2YCLA 3B13B 4E7OA 1UJ2A 2KW5A 4TLDA 4BNDB 3CGWA 2XB8A 3RHTA 3ZDBA 2YUTA 1ZM3A 2LTAA 1KIAA 2XVZA 3TUJC 4BN4A 1SKAA 4AAYA 2XMZA 5SZIA 3TB4A 3HUUA 2JIZD 4EKGA 3OE4A 3BFJA 4O2AB 4EUEA 1KI3A 1F9EA 2XQGA 1KJIA 1QK5A 2X7HA 3SJCA 4PG6A 1X7YA 3V80A 2GVZC 4BMZA 1C30B 3CR8A 4GD3Q 4J16A 5FUWA 2AI2A 1RLJA 2P75A 3VBEA 3WLRA 2PAAA 4G9BA 4BZPA 2XV1A 1RFLA 3FWHA 3IUSA 2CLIB 4C4SA 4RHXA 2OQVA 4EB6A 4IAOA 1L5KA 3VX3A 4YR7A 2JLBA 3TLXA 3HTXA 5B5SA 1ZNZA 1V39A 1HEYA 1I4DD 4R6XA 2NADA 3CPEA 1E3WA 1NDUA 1ODKA 1SG6A 1VCNA 4GVPA 2HMAA 4I4TB 5GGXA 4YT8A 1WV1A 4Q3KA 1LUAA 2CY0A 2PBRA 2A9PA 3EWIA 3N2GA 1JKJA 3U7QB 1C7EA 4ZHSA 2QUKA 1NSFA 2WU0A 1Z6TA 4L8WB 2XWBF 1C9MA 1OIVA 3CNQS 2B82A 2ZEJA 1K6EA 2D13A 5U1PA 1J0BA 1MT3A 3N74A 1QG6A 5ALJA 4CCAA 1GNQA 1R8QA 1PGQA 4P4SB 3K1YA 1KFCB 5FWYB 1KYTA 2CLFB 3H6KA 2IODA 4RZSA 1TCVA 1VG0B 2C1EA 1RMYA 1RS0A 3ONVA 3D7LA 1H1LA 1PZHA 4MQUA 1ABEA 1DO0A 3EXFB 3PC2A 3KOYA 4KPGA 4W8OA 3TH5A 3EEOA 3CO5A 3RVRA 5T8KA 1E3LA 2WLSA 3PUKA 3TCKA 3VAAA 3WJ1A 5L7TA 3OVMA 4TYYA 1WMEA 3T7DA 3RVSA 4LDPA 3UH1A 5TXGA 5I6DA 2XMQA 5CIYA 5ALKA 1YS4A 2FXIA 4Y1FA 1QMGA 4FGKA 1IBKB 2C4KA 1UM8A 2I1LA 1OLSA 5HS6A 1A88A 2IIQA 2D0PB 1VKHA 2VH5R 3BD9A 2RGEA 4RTKA 5CP8A 1FRZA 1O6BA 4E13A 3PEFA 3DL7A 4J0QA 4KQJA 3CWCA 4RD3A 4BU0A 2CFOA 4U7FA 5DHQA 3LQ2A 3KYJB 1C7IA 1L5NA 1H0SA 5JNSA 4V3BA 1E98A 1H9CA 3LC2O 3R5FA 2OGWA 3UJCA 4PE5B 3KT3A 3WLLA 1PV1A 5JI2E 3FMGA 1ZJ5A 2GCGA 1DTSA 3D0QA 5K0TA 1Z26A 4FINA 1GCGA 2H65A 5FO0A 4BQNA 3P27A 4QZVA 4Y2TA 5LMZA 4XSVA 1DUIA 4W1PA 2C07A 2AF3C 3OPYB 2AOUB 2FKNA 2WHYA 1J2UA 4W1SA 4YTEA 5ULLA 2XKKA 2B20A 4MS3A 1NMYA 3VYWA 5COBA 2Z2KA 4DUPA 4YLGA 4RV4A 3SX4A 1YH3A 1G3MA 1P0PA 4QNRA 3W2IA 4RGYA 1N8SA 4GPZA 1L5GB 1A4UA 5CX4A 3SD7A 4P92A 5KSYA 1Z8NA 1NMEA 5DU2A 5I5EA 2AN3A 4CT4B 4IIUA 1IZYA 1U31A 5FQNA 1NT2A 3AFGA 1L4UA 4CHGA 5ES4B 5IM4A 4TYWA 1TAGA 3FUUA 2EIHA 1YBFA 3N8DA 1IMOA 3R20A 4C5AA 4XW2A 3RRNA 4NDZA 4DVGA 1EU1A 2QVGA 1EE2A 5TT0A 1ZP6A 4RWZA 4ARSA 1X8XA 3N39C 4MR9A 3NJ4A 1XRPA 2M9MA 3V55A 2PSDA 5C32A 1YNOA 1SOAA 4WKOA 3C6YA 3FCYA 4YCDA 1DS6A 1YFZA 4B43A 5ALZA 3BWEA 3EDMA 2DT5A 4INJA 3MB5A 2P9GA 2C2GA 3FGOA 1XRMA 3I8OA 3MAGA 5CVVA 2HUPA 3GG2A 5CT4A 3DZJA 3ICEA 5CYPA 4GOMD 2NO1A 4IH9A 4HAWA 5BOVA 5K2MA 5TY0A 4DXHA 3DMRA 4YAIA 2CJYA 1SUSA 1F6DA 2RI6A 3EIXA 5FNVB 2P0EA 3BQMB 2I99A 2DKOA 1H4QA 2C7GA 4FQ7A 4EKIA 4NV1A 3LX5A 1AUXA 1Z5UA 4BQEA 1UKVY 4Q1EA 4PHHA 2CMDA 4HX9A 5ICFA 1T6XA 4FUTA 1Z18A 1XELA 1B76A 1S9HA 3TQHA 5HQ3B 1JH9A 1XRLA 5BQFA 3GNSA 3ZCSA 3VNBA 5IYZB 1RBZA 1A2BA 1OZGA 3OOSA 2ZRJA 2ICAA 4AIRA 5CYGA 2WWGA 2ZUFA 4R8LA 4WNCA 5DGCA 4WUVA 1WVGA 2AD1A 2K7FA 1W25A 2V1XA 4IKEA 4AUEA 4G8CA 1AF7A 4P9NA 2VATA 2FP4A 3T3DA 2XTJA 2P8JA 1WO8A 4OM7A 1Z4QA 3ORRA 1RI5A 4JKOA 3L7NA 3MJFA 2BHTA 3T52A 5JPDA 5L53A 4MIEA 3GFOA 3K6SA 2AR0A 3L82B 3FTQA 2A7XA 2IELA 2V1UA 4RPLA 3CLRD 4MB6A 1W6RA 4Y1RB 2JFGA 4L73A 3E70C 1JPJA 4Q1AA 7MDHA 2JI4A 5I01A 3UWKA 1YOVA 3L18A 3D5EA 2VNSA 3C3EA 1A4IA 1OH6A 3LO8A 2G9VA 3CIOA 3IDSA 3T5TA 5EPOA 3T8YA 2VDNB 3TLAA 4AKSA 2XCTB 4LI0A 4WGFA 3ZIAA 1CJMA 3AR8A 3CG0A 5I7WA 2VIIA 3V4LA 2JHGA 4LJ7A 5KNCD 4BLVA 2OZVA 1OLXA 1DELA 1SHKA 2EFYA 3DEHA 1LLQA 4DBVO 5KYYA 1T1RA 1HKUA 4D42A 5ER6A 3WXMA 3E0QA 4E2FA 2F6RA 1LBEA 2IP4A 3NM6B 2PQ6A 2O3JA 3C8ZA 4D97A 1XA3A 1ZI8A 3EVAA 4QDKA 2Y1GA 5IT4A 4DIMA 1TVEA 4JI7B 3FM9A 4N5MA 4QDXA 4TWBA 1E5DA 1U4OA 4DCMA 1WDMA 3CCFA 1D2GA 3GHYA 4FHDA 4QBTA 3UV3A 1W36C 1EFVA 3HSYA 3BC1A 5D3MB 4B32A 4L27A 1CULC 1KJ8A 3Q2KA 2MIIA 1SVUA 4Z2AA 5HOEA 4I1VA 3O5AA 1M0EA 4GKAA 1LFAA 1J97A 3C3JA 4XOIA 4HD8A 4IDBA 4U0KA 4LX8A 1QHHB 3KZCA 1H2YA 1YVUA 3KWJA 3OZCA 3PJFA 2D3WA 1V4VA 2C9CA 5G1PA 3EF1A 3LQ1A 4M88A 5KTPA 1EA5A 1I4TD 4R9RA 3ZI0A 3NORA 1HE1C 4IFTA 3TNJA 1REQA 1K27A 5JO9A 3PQ7A 4J0DA 5CTAA 3JQ7B 4MQ6A 4D92A 3I9OA 1MB3A 1F8UA 2GMWA 5K6AC 1PL7A 3TLMA 2B78A 2H18A 3F3KA 5ALTA 1DBSA 4JA2A 4XXHA 4Y2RA 3I01A 5ER9A 1STOA 3WG9A 1CRZA 3GUVA 4OQFA 4Z7JA 1J5EB 5DW3A 4DLAA 4J0FA 2HPZA 1LBHA 2H4YA 3ZWWA 4G4JA 1TJ4A 1O77A 1JLLB 3K8OE 3LPLA 1GA6A 5AXDA 3VR6H 3CZMA 1HT3A 3HM9A 5E3JA 1GTVA 3CPJB 3C3YA 2JCBA 4TVKA 4I2NA 5MGBA 2RHDA 3H9GA 3QPCA 1WZCA 3F1LA 4G36A 4KYTA 5I9LA 2IS4A 4BNKA 5LBTA 1XDGA 2BKXA 4NU0A 3RV3A 5TF0A 1IN6A 3ZWPA 1FTSA 3RIMA 3BGOS 5I9TA 1W73A 1D03A 1CTQA 2JFZA 1M74A 2RONA 2WZBA 1X1CA 3EZ2A 3L8DA 4EG6A 3ZV6A 3IXLA 2EDCA 3IOBA 3ZU3A 1JSRA 4BCCA 4AKIA 4B48A 2ZSDA 3THYA 1AV7A 1XCJA 2WJPA 1MVLA 4DNOA 2NO7A 2J5KA 3C0KA 3U3OA 1RMTA 3KNZA 3G59A 3ORQA 4MAAA 4GI3A 2PUWA 4TKMA 4TVOA 1ZMOA 3OQIA 3I37X 2FQWA 2LR0A 4ZEOA 4EFDA 2CJPA 3A1NA 5CXQA 2Q3MA 2UYYA 4M1EA 2OV4A 5F12A 4HNQA 4B46A 2XE6A 4KKXB 2DHDA 2CXQA 4UAJA 2HHHB 5IAKA 1NG1A 5HFJA 2VP0A 4BZWA 5EE9A 1U9IC 1J8DA 3LAWA 4CQMA 1ZAYA 3SBXA 2QUAA 3BZWA 4JBIA 3OTOB 5JJKA 5LLSA 2XNJA 3NS7A 1OASA 2BUAA 5CG2A 5FPQA 3QNWA 4RH3A 3TIGA 1RWKA 1UBCA 2VZEA 1UCFA 1Y8RB 2XDAA 3LQQA 1WKBA 2C2MA 1E8DA 2VUTA 4U2BA 4Y2JA 4TLAA 1KO5A 1ZEJA 2Q3BA 2G7ZA 5BURA 2QUBA 3LDUA 4NVRA 1H0RA 1N3IA 2RBKA 2VZ9A 5GM1A 4H7JA 4N8SA 3D4OA 2CNWA 3PUZA 2C42A 3HN6A 1JZTA 4UEKA 4V2IA 5DSTA 5TQVA 1AX9A 4XVUA 3VR3D 1P1KA 2BR5A 1KWGA 1P0CA 1X77A 3KKKA 1IQRA 3QTBA 4TSKA 1JVNA 4DPKA 4IDEA 4R8VA 1E5QA 1Z08A 1N0WA 4NCBA 4J29A 4DNPA 3A36A 4NKRA 2R1TA 3PJEA 1J4AA 1F4VA 2Q3LA 2QYTA 3E22A 2PXHA 3FTNA 4CG2A 3NTUA 1P1IA 3HGQA 4MCJA 2W70A 4CKCA 3TOVA 2X8JA 4NZPA 3QFRA 4OIFA 3S8MA 4CDMA 1R3DA 4RWEA 1N4DA 2YXBA 1RRVA 3FFAA 4KCGA 2X9VA 3KB8A 4XVCA 4CGZA 4FFDA 1AQLA 1KO1A 1OBFO 3ZHUA 2M6RA 1O96B 1C3LA 1W0KD 2EDAA 1NWHA 1ZZGA 3B9QA 3O91A 3MXOA 4YASA 1SR8A 1ECGA 1GL7A 2MR6A 4D9MA 4RYDA 1BXGA 1KEUA 2QZ4A 3H2JA 3VKGA 5E9JA 3ELWA 4G6ZA 4KQXA 4I6EA 4TLLB 2XT9A 3VKVA 4M9UA 5DNEA 4DDTA 1G1MA 4UUQA 1UWVA 4ND7A 3SYLA 4D3ZA 2WD8A 4UUPA 4GI2A 4L6CA 2JIBA 3VM6A 3SVLA 3NWPA 2J07A 4NMMA 2FMXA 4UM9D 4LRTB 1MW8X 4CEJB 4DIDA 2JIDA 3WHKA 1Z2EA 2GZRA 3CEAA 2B8WA 3QF4A 4J0KA 4AD8A 1T3HA 2C0QA 3P9XA 4V3CA 1T8PA 3D3WB 5AVTA 1GIAA 3G8BA 3R3HA 5J2TB 4ZVUA 1MXFA 5C5EA 4BQFA 1H0KA 3WB0A 3PF9A 1HEIA 2JGDB 2POQX 4Y2XA 1PR2A 1KSJA 3HXLA 4OVKA 1W88A 4YJFB 4TZ0A 4BNNA 1BSVA 1GUZA 1W36B 5JBIA 3I52A 4PRKA 4CM1A 1YR9A 2MYPA 1CQIB 1K63A 1U7UA 5DXFA 1U63A 4MVJG 1AXRA 4TLMB 1QF9A 5E4JA 4YV1A 1LDNA 2AXNA 3NV9A 1LY1A 5DLQC 4NEHB 1BCRB 2Q0HA 4F45A 2DWCA 1H3NA 2BJHA 1YC5A 1HE5A 4JYZA 1U2DA 2VDVE 1IXZA 2UYOA 5ALOA 3EE6A 1H3EA 1XZKA 1RWWA 3KZVA 2F3UA 4OU5A 1WZ2A 1UDBA 2A14A 2FPLA 2ZB4A 5B6JA 1BA2A 2JZNA 2VQ3A 3CRNA 3TXYA 1RIFA 4L0QA 4Q3BA 1I6KA 3PFKA 3KC2A 1KF0A 3E03A 3RLFA 3T06B 4OQQA 2Y0EA 4W7IA 5FPHA 4FR2A 3VTKA 4B9AA 2QQFA 5LA6B 3T5GA 4GL2A 1NJ1A 3I0MA 2WICA 1RQPA 1P1JA 1MN6A 4CU2A 5AIBA 3LP8A 1D4OA 1NVEA 1VXRA 3IAM1 1QGUB 3HWX1 2C2BA 4HUTA 4OJQA 3FKQA 1N5MA 2YY6A 1QP4A 2FPPB 3DOHA 2C4MA 2DPXA 1DDOA 2I1QA 1USUA 1LK7A 2FEWB 2WJ3A 2XY4A 3IQXA 4WK0B 1P45A 1ZHFA 4Q0MA 1JDNA 3JPWA 1JIXA 4GYJA 2FK8A 1F2TB 3OZSA 4HWRA 5FUBA 2Z8YA 1UOEA 4H7IA 2IJGX 1V7ZA 4BLTA 2OCDA 3EEIA 3S8YA 5AMXA 3SQMA 2WHPA 3S5UA 4QQKA 5HDBB 3OCUA 2Z4TA 2VSOA 2ZCJA 2WAXA 3AJRA 3EXEB 3FNEA 2JD0A 1WIWA 5JPCA 3ZWYA 1X7HA 1GV1A 4TMVA 1GPBA 4MUKA 4ALJA 5EIAA 1E89A 1Z0FA 1ZIDA 1BQ3A 3FDZA 3RUPA 3PKZA 1DBQA 3E6AA 1PG5A 3U0BA 1JB9A 1J2TA 1PTJC 3QLTA 2BMDA 1PDVA 1QUFA 1XBTA 4KLZA 4N0PA 4QSMA 4ZVMA 5K8UA 2Q8NA 2VDWA 5LYYA 5AJWA 5JD4A 4M8SA 5IT5A 5ALMA 3JQDA 1H05A 4BNFA 2DM6A 3FFTA 4BWVA 4IWXA 2IL1A 2W42A 2G4LA 2VRCD 4D57A 3L92A 4K9NA 3LUAA 4URXR 4B7ZA 3R44A 1RWNA 1YE5A 2I6QA 3KYCA 4PLPA 3FOZA 5IU6A 4LDNA 4QUAA 4CFSA 4PO9A 2QPOA 2R9VA 3AH8A 2A9RA 3D3JA 4HAVA 1YHNA 2YZKA 3H11B 2PIDA 2ZU6A 5CB8A 3WSVA 5I47A 1QRTA 1VE7A 2IE0A 2IFTA 4WFIA 3HJRA 4QATA 4UREA 2MSDB 5F52A 1VI6A 5AJXA 3U40A 2VDLB 4A7PA 4ZGWA 3FGNA 5DNYB 4YUVA 5EJ8A 2V9PA 2MJLA 5CAEB 4UBOA 4B47A 4O5OA 2G1AA 4HWOA 2G88A 4LJLA 4WBSA 3EGDA 1CKEA 1LQTA 2AOXA 2C96A 4NYMQ 4Q12A 4K8OA 3IOYA 1I3MA 4HUJA 4EVIA 7ABPA 2PD6A 5CU7A 1XDBA 521PA 4M1YA 1PZMA 3IPRA 1ZD9A 1AO3A 4L8VA 3AJ9A 4RPHA 3H84A 3UT5B 4HV4A 4PHFA 1MZPA 4H27A 4X71A 2Y05A 2ZYUX 3EQ6A 4MP3A 3SJUA 4LECA 4C0XA 2FRDC 1P2BA 1XC7A 4LSZA 1EA7A 2WY2D 2YIVX 4D43A 2GERA 4LJKA 1KQGA 4EMBA 1E9RA 1SEVA 2E1PA 3TQRA 3S7TA 2AI1A 3FKSA 2EZUA 4DJFC 5CEFA 3HA5A 2QGZA 3L0SA 1YQDA 5ILGA 1NRIA 4C7JA 1GT91 1FP7A 3OX3A 1YCFA 4FQ8A 3WDKA 1XYVA 1VTKA 2EJVA 4LJ6A 7REQA 4ZYTA 4IIJF 4TTTS 1CJTC 3LL4A 4Z4HA 1HT1E 3ZXYA 1ZJJA 3KKMA 5IXYA 1KOJA 3NV7A 3OJCA 2YR0A 3OUUA 4MR7B 1YB2A 4UFNA 1Y33E 5GOTA 1BWRA 1PQUA 4LGCA 1E79D 3O1HB 1U0OC 3X1YA 4C6RA 3ZVNA 3GH3A 3L8CA 2RE8A 4PZYA 3K09A 4BPRA 4CZ2A 4MUFA 4S05A 5IXSA 2JFHA 4KXWA 1WCXA 3VSEA 1SH7A 1SN7A 4IRUB 3LCUA 3UEOA 4C07A 4DMFA 5JU6A 4S24A 4EG1A 1JZSA 1ZPDA 1GA4A 2FQXA 1T3TA 2OLEA 3M70A 3D6JA 2IPNA 3O0DA 1QRUA 3EA5A 1BRTA 3JQAA 4NBLA 3TBKA 4LCBA 1G17A 2M6KA 4WCFB 2IYYA 1IG0A 4XCXA 5JDCA 1T9ZA 5D01A 2V96A 1NJ2A 3M33A 4LE2A 1XTJA 2ZOSA 4N8DA 3RBZA 1P3DA 3IV7A 3QMWA 3Q7EA 5G02A 1PJQA 2O8FB 2OBYA 3IVCA 3PFHA 4CL0A 4NDAA 2JVKA 4DJ5X 5JQGA 2O0KA 2V3CC 4JQSA 1NR1A 5BPHA 5GOZA 4NCHA 4OQ4A 1Y4UA 1XL1A 4C1BA 4DANA 1XPRA 3NUZA 4I9GA 4RA6B 1SCQA 2HX1A 1GN9A 1P3Y1 1XHEA 4KOAA 3DZGA 2PUHA 1FSZA 1QO0A 3IP8A 3YASA 2ETVA 3A7EA 4E46A 4YP0A 4OFBA 3TLYA 5IF3A 3VYTB 1QV6A 5L6LB 2WD7A 2ZSKA 2IS6A 2HQOA 4NFYA 4CM4A 4XYEA 2VP6A 5JCOC 3R0VA 4HMPA 1QS0B 3E1SA 3IIIA 2JJQA 1EVLA 5H59A 1ZSNA 4RULA 3QPWA 2P1ZA 2EFEB 3OT1B 5KQMA 1JFFB 3TQTA 1I10A 4LQDA 4WQMA 4JV5B 3WMRA 2EXXA 3LV8A 2ADMA 1LBIA 3BK7A 1JG7A 3MNFA 2JGNA 3LIIA 4FKBA 4OO3A 3KLPX 2H59A 1XZIA 1NBMD 1N4AA 3K3PA 1RJFA 2N0SA 2NU9B 1DAOA 3S55A 3TDNA 1JJIA 1FTQA 4BTVA 3FWKA 1NVGA 3C8UA 1FP4A 1E9AA 3LQKA 1ZUHA 2P68A 3A1VA 4PCVA 4CU5A 1VLQA 1K0FA 1VYVA 4DUGD 2H6EA 3EDQA 4U0JA 4HDNA 4B2IA 4EMTA 4WBNA 4YXWD 4UEQA 3WA7A 2AHRA 4YY3B 3FBTA 1PJ8A 1T2EA 2MYUA 4Q5IA 1VRWA 3QVMA 3C70A 1GVHA 3RYTC 4TT3D 5G40A 4CKWB 2Q21A 3ZV3A 3Q10A 2XVAA 2L42A 2ZTSA 4IM7A 2NPFA 3OLYA 3ZZMA 1GZHB 4TWZA 4KGZA 1U65A 4BQOA 3MCWA 3C5VA 3MMPA 4OB8A 2PX8A 2ZTUA 4FGSA 2DAPA 4GLBA 4DCCA 3ETCA 3CLSC 5EWMA 3AZPA 4K81B 3NONA 3A1SA 3WZMA 3DMFA 4KK3A 2Z6UA 4RJJA 3NI2A 2FFHA 2PEYA 3LCJA 1TT5A 4V02A 2EBUA 3JYOA 3E9DA 3Q8KA 5A5GA 3FMFA 2OB2A 3C3PA 1C7FA 2YW9A 4KL8S 4R7GA 2HIGA 1SBIA 3DOJA 3NGLA 5KJCA 5AKYA 4RY9A 3UMCA 3OA2A 5KUTA 1KQOA 3OU7A 5FTKA 1EWTA 4RS4A 3N8KA 1NMZA 2NUAB 1LPSA 1SC4A 3O26A 4XIJA 3OE7A 1TAQA 3DGEC 4H18A 6ADHA 1AS0A 3FNBA 3WGJA 4KE9A 4R1NA 5GM2A 1F5NA 3VSCA 1E9EA 1TMYA 1W44A 1RI4A 1ZH8A 2RGBA 3M6IA 2XB4A 2VLIA 1V26A 4JOQA 3WIVA 4CF6A 1I7PA 2WFMA 3KTFA 4IW3B 4J0JA 4L4XA 1NMXA 1THTA 2NYAA 4LYGA 4Q4JB 1C7ZA 4IEIA 3A25A 4TL6A 4ZRMA 2FF5A 2WZDA 4ZAYA 5CD1A 1D7OA 1X19A 1PLKA 3K9GA 4NAHA 4UMFA 2C77A 3KQKA 4G0QA 2NVUB 1LBTA 5LU8A 1BO6A 2VJOA 3OLZA 2I8AA 4LJ9A 4AC9A 3LPMA 4NONA 5H3CA 4YLYA 5GZ3A 2OAEA 5DYWA 2IXDA 3A1CA 4FT4A 4M4SA 2PXAA 1OSNA 1FEZA 2DQKA 2BCGY 4FTWA 3MQ2A 4MMXB 4TUYB 4UHCA 4QGSA 4YMTA 3DO6A 3FB1A 3C1AA 4ESVA 2O59A 1ODJA 1DWQA 3FUXA 4D8YA 2PWZA 3HKDB 4E7PA 3RC2A 1RIIA 1X42A 3OP1A 3G2JA 3FPCA 1KH1A 1NYQA 3OD1A 1XQXA 3R3ZA 4AJ9A 3ZHTA 3DBOB 3MGCA 2OXEA 3QOFA 1M2KA 3DL4A 4EVQA 3MSCA 4BYGA 4QYTA 2C9DA 4D4LA 4AUNA 4PQYA 4B7CA 1Q50A 5TPWB 2F3RA 4KIFA 1RXEA 4UZEA 3BMCB 2V74B 2Q3EA 2RDMA 2WRZA 2UUPA 2IV7A 1NBOA 2E21A 3IXQA 4DV0B 2HA7A 1IBSA 3M5WA 2VHZA 4JN6B 3SM3A 1WE2A 1P2DA 3LCVB 3H2YA 3HE3A 3R0ZA 4L0DA 1IJBA 1NJ5A 4BS9A 3AUSA 2E5LB 3KAQA 4PZZA 1FA9A 1NVXQ 4CFZA 1LNSA 3IDQA 2QNIA 1RZUA 2RI0A 4PFQA 3AEKA 1X7YB 2Q4DA 1O58A 4XI9A 5B3KA 3DZ8A 4FW8A 4IY1A 4O8CA 3IAHA 4HH3C 3IT3A 3ZV5A 3QI7A 1E6LA 1PX0A 4FCCA 2YJGA 1GZ3A 2A8YA 1EZZA 4IIHA 3GLIA 1XF9A 3OLVA 4CLXA 1BDHA 1ZUWA 2J09A 1O6GA 2E6KA 4WZBB 1D8TA 5MFZA 1E3WB 2XGGA 3VR4D 3N28A 5JJBA 1C3XA 5LZ9A 5DM0A 3N2GB 1JKJB 3KOOA 1VP3A 4P2GA 9GPBA 4D8WA 4YJKA 4IBOA 4BCBA 3V8EA 5A9SA 3P71T 5ICSA 4QM6A 2D1SA 3OQJA 4LHEA 1ZM4A 5EZSA 3TDMA 2H5IA 2V7WA 2Q0QA 2LCFA 3S2IA 2OO5C 1DKMA 5DN6D 1A5SB 3F7TA 5AW6A 1R00A 1X1TA 1EDZA 2GJKA 4GLLA 3GELA 3M6VA 4CCYB 4DPLA 4BJ6A 1DCKA 1H1LB 1E2HA 1G8JA 3Q3GE 2YUIA 2ZRQA 1DKUA 4G3XA 3AHFA 4J91A 5A1JA 1QF6A 4G5XA 1JSLA 1Y5MA 1ZIXA 3H6HA 3A6KA 3IA2A 3RNOA 2FWAA 5L3SA 4HMOA 5IK2A 4ZZ2A 3UJ6A 3C43A 2UVQA 1SVKA 2B1QA 3GDOA 4DJJA 3QHAA 1XU9A 4NARA 1W0JA 1FYEA 1HFKA 4N01A 3O2QB 4OKIA 4XD7A 1JKFA 4NBWA 4OJMX 3KR0A 3AJDA 2ES4A 4N1AA 3R6LA 4JI5B 4G0WA 1HOXA 1OLSB 1TDJA 1TM3E 3IQFA 3QH4A 4ONEA 2RHLA 2Z09A 1CUGA 3DZIA 3RASA 4ES6A 2X3FA 4YO7A 3MILA 4NFLA 4EPTA 1KBQA 2J6HA 1WQ4A 2PFKA 4P5DA 5HBRA 1C4OA 1GL3A 4L51A 1OU0A 2W2OA 2HCFA 3JYHA 2XVYA 4LTDA 4D0LB 1NJFA 3OY2A 4UQPA 3VZRA 1Z35A 3HJHA 3P0IA 2XAUA 4GZ6A 4M1TA 4NS1A 4MS3B 1OGJA 1I1OA 2BJWA 3DEAA 2PTGA 2ZBFA 3OCYA 1MB9A 2V8OA 4GDMA 1W30A 4FOLA 4WI1A 3T3IA 4BHTA 1TUGA 3TTYA 4R3UC 4D81A 4DOMA 1CSEE 1X8JA 3AY6A 1K2WA 1ZL0A 1Y5NA 3I6BA 3OIGA 2XRFA 4G09A 4PS0A 5HILA 1L8QA 2BGIA 5EXSA 4BWGA 5KQPA 4JVNA 4F0JA 1RCFA 3KKLA 3FHOA 3PYMA 3DM5A 5LDHA 3AI3A 4J1NA 4JENA 1H2FA 2FUCA 3KXKA 4NZNA 4KRXA 2RARA 3L79A 5E7MA 4F9TA 5F7OA 3F5MA 1ODIA 2EW1A 3GDGA 5I3CA 5EHXA 3H75A 1LX7A 2OCLA 4DLWA 1LJUA 3D8HA 1UBFA 1AUVA 4MR9B 2B94A 3VJLA 2FSSA 2LBPA 1RKVA 1K6JA 4F86A 3SPXA 1TM7E 2FR0A 2EIXA 2DBQA 4OAOA 4B8WA 3NYWA 1JILA 4OAQA 2GTHA 4LDQA 3IOEA 3NHJA 2F17A 4XEHA 1E2EA 2EF0A 4R51A 4XGKA 3E35A 4XVRA 3WLHA 1XVVA 2HCTA 2NMVA 4TXNA 5B1YA 2ZBQA 2ZGVA 4GR4A 4MV0A 4ZOEA 4EEXA 3DTYA 4EJFA 4EH1A 4QEDA 1Z0ZA 4DYHA 5E8JA 2I9PA 3IMKA 4QXPA 4Y3UA 4O3FA 4QSHA 4XRRA 3SZGA 5EKXA 2FHPA 4N12A 4U7GA 1NY6A 1X1RA 4FD2A 2Q7DA 3WRYA 4YIHA 1XNQB 2G7MC 5A3JA 2ZRFA 5M34A 3ZXIA 2QLJA 4E51A 3P9QA 4IUBS 1M72A 5LQMA 1QZ3A 2UV8A 2OV8A 1E1KA 1UBUS 1VKNA 3MRVA 1PKXA 2HEIA 3LNCA 3UJHA 5BRJA 1YL5A 1YTUA 2EC5A 5CYFA 2R8PA 5EP3A 3VZBA 2XOEA 1QYIA 2F43A 4EW1A 2RHRA 4D9CA 3K9LA 5ALPA 4DQXA 1KFEB 2XDQA 5KQRA 1MB0A 5LR6A 1SHJA 1OXBB 4B6PA 4A0SA 5IAJA 1GA1A 3KUUA 4G8JA 4PRLA 2RGDA 5G2OA 3ILHA 4C4RA 1YJQA 2YTZA 1E1QA 2FP4B 1M7BA 2R79A 3OURA 1G5IA 4BV9A 3AR2A 2QRLA 1B41A 2AZTA 4ZDIA 3GU3A 1IAVA 3TEJA 1BGWA 1ONSA 3G2KA 4WA7A 4BGVA 5EKTA 1FK8A 4UTRA 3K6SB 2COUA 3DQPA 1UPBA 3CX8A 4DNXA 1FX0A 3VGPA 1JV2B 2NXEA 2J46A 1K9VF 5T57A 3N5KA 2VEOA 1Q14A 4HAOA 4KB5A 3EUFA 1AUPA 2CLHB 3C7TA 4NULA 2JI6A 2ZE5A 3EDYA 3LTEA 3DXFA 2W48A 4ARVA 5TQJA 5AESA 1MR3F 1KAMA 1M6WA 4P08A 3TNYA 5IJZA 1WY5A 3NAZA 3C4QA 4IQFA 3ZD6A 3TZHA 2RMKA 4MV7A 2ANBA 1I2BA 2J87A 3Q5GA 3K94A 5C37A 1OLXB 5KYYB 4J6EA 1O4VA 1HUQA 4L5AA 2A33A 5JC1A 4QO8A 4PXSA 4ZYXA 1L4MA 3IERA 1J06A 4HXYA 4NNOA 4MI3A 3DG9A 1JZQA 1KVRA 3I58A 1MV8A 3RBVA 5K3OA 3VPSA 1VGRA 2W6ID 1KJ9A 1N5RA 3MMSA 5KIAA 4MWEA 1PUJA 4X7RA 1EP3B 2B61A 2HK6A 1H9BA 1OFGA 3KQSA 1EFVB 2GKOA 5LP6C 1IWOA 1WBBA 3KCQA 5G0TA 3UCXA 1Y1RA 4ITUA 2IXTA 3LH5A 3IUBA 4YRSA 5A3QA 1IN5A 4B45A 1KHHA 2X5OA 2R8XA 4G37A 4JLJA 1JIKA 2OK7A 4QTZA 3LRPA 2AFIE 4KXYA 4RA9A 1F1BA 1N2ZA 5D1NA 2JFBA 2J5XA 2IYOA 3T34A 4BLUA 4TSFA 1GQYA 4J9VA 3ORSA 2YICA 1YUMA 2QL9A 3SI7A 1CEYA 4GDFA 1DIAA 2M32A 1G42A 1WMSA 2KSQA 2VHYA 1SCAA 5FADA 4BNGA 4B09A 3NXKA 3EGOA 1GZVA 1OE0A 1ZUIA 1FBNA 4AT1A 4TWIA 1CUWA 5TX7A 1Z29A 1UK6A 4U6QA 3IKJA 4RHYA 2FPIA 3TW0A 2FW1A 4MW7A 2GVDC 5KVVA 1E9FA 4IMRA 3OH8A 1NP3A 4TV9A 3WBJA 2P6UA 2XPCA 3B48A 1D1PA 1FDVA 2ZETA 3BGWA 3TEMA 2IEZA 4IJKA 3U81A 1WOYA 4ITRC 2OFFA 4UHHA 3BIOA 3F5FA 4YUXA 2VTDA 1RHMA 3BL6A 1JJBA 4XQGA 4E2ZA 2JKYA 4ZANA 4C3VA 1DX4A 4F5YA 1PHPA 4RK5A 1FOEB 2RC5A 2VPQA 4UARA 1XAJA 3WGMA 4UUNA 4EYSA 2A9FA 2O5CA 1SCJA 3H7IA 3I2KA 4LWQA 1E3TA 4I81A 3SN6A 1VHWA 3GCXA 1WDWB 3ZWCA 2D1FA 4OHXA 1T8SA 2O6LA 2JA1A 4H6XA 2JGMA 2HBRA 1IVSA 1HQYE 1UBGA 3UWDA 1Z6PA 3MS7A 1HDZA 2LDBA 2O2XA 1WR8A 4XUEA 1C14A 2AFHA 1E5LA 4IOLA 4EHLA 4PCUA 3BBPA 3G1WA 2WV9A 3VUFA 1JR4A 1TCCA 5KCMA 1VMDA 5KNBD 2BFCA 1G8AA 2QD3A 4QUJA 3K0KA 1OD6A 3M9XA 4F04A 3O2SB 2JNWA 3F0TA 4ZRDA 2G5PA 3U48A 2Z3VA 4WAUA 2WT4A 3SXUA 3ZU4A 3ZYZA 1CXZA 4CQMB 2A59A 2QTRA 5HYVA 2ALJA 3PR3A 2Q6VA 3C4VA 3D1JA 4L15A 1JG2A 2OKCA 4MYCA 1PEYA 2D5CA 2HLDD 1FLAA 2VJKA 5FA6A 5CDTA 5C7OO 4TYPA 2YMLA 3QBJA 5CT8A 1O89A 1BVUA 4OSEA 3BDIA 4AG3A 3FETA 4TRMA 5IG2A 3L4BC 2O1WA 1ZMTA 5BR4A 2EWMA 4RK7A 3AHEA 4FHFA 1U3DA 1UEIA 1T4DA 3R7DA 3ABIA 3WOVA 2XR1A 2BF4A 4DGSA 1Y3BE 4HLDA 4CETA 3IQGX 2JK1A 3PPWA 5JCXA 5MDHA 2TSYB 1ORRA 2X14A 1FFDA 2F1JA 2XTMA 2YXDA 3JWEA 3L6DA 2QJFA 1OKKA 4K9SA 2JD2A 3ZGXA 4W5OA 16PKA 1E1RD 5ESDA 2R1TB 1W87A 3KU4A 1KTVA 1OZFA 1XT6A 4WLEA 3E22B 4UU0A 5IC5A 1U0RA 4E5SA 1GAXA 4CKCB 2VG8A 2X8JB 2O8EA 4RD6A 5F4ZA 2J48A 3TUIC 4JJKA 4MDEA 5CDFE 1V7QA