3BMNA

Structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor (compound ax3)
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
267
structure length
250
Chain Sequence
b'EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase
molecule tags Oxidoreductase
source organism Trypanosoma brucei brucei
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
total genus 90
structure length 250
sequence length 267
ec nomenclature
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3bmnA00
1LC0A 5TT0A 4Q3AA 4QUKA 2W2LD 4E5MA 3NAQA 4D41A 3CSDA 3FF4A 4DIFA 3JQGA 2YJZA 4CM8B 5L7TA 4PRLA 2BGLA 2P9EA 4YRBA 3OFSA 3OHSX 1LSUA 8ADHA 1DIHA 1PGJA 4E2WA 4RL6A 4FJ2A 3DO5A 2ZKLA 3AFNA 2EGGA 4I08A 2LDXA 5JCJD 2WM3A 1OC2A 1GUYA 2FP4A 1PJ2A 2JFFA 4J7XA 2E37A 3H8VA 5IFLA 1GV0A 1ONNA 3DOCA 4GGPA 1U2GA 4GAEA 1U3UA 1Z7BA 2QRKA 4R68A 1HDRA 4OO3A 2A92A 5JMPA 4NIMA 1PGOA 3R3JA 1YWGO 3IJRA 4D0RA 3IMFA 5JXWA 3MJ4A 1T1SA 1U9JA 1RM4A 3UF0A 4QFCA 3EK2A 1N1GA 4BNLA 4RVDA 1SAYA 3GHYA 1EK6A 2Q4EA 2RBEA 3A1NA 1RWBA 1PR3A 4MKXA 2Y1CA 1VM6A 3OIDA 4KZPA 4YYZA 2C59A 3CZRA 3D5QA 4L75A 4ZD6A 1ID1A 3OA0A 2VUUA 5CPBA 5L9AA 1YBMA 2VRCD 2E4AA 3H9QA 4R01A 1C0LA 1GU7A 3H3JA 3GG2A 1PGNA 4WLUA 3DHEA 3EZLA 3SX2A 1LSJA 3PYMA 2UUPA 2O23A 2PH3A 2YV1A 3GK3A 4WEQA 2ZYAA 2QQ5A 1FK8A 4MP3A 5EL0A 4BNWA 2H6EA 3I4FA 5JY6A 1HE4A 1KY4A 1T2AA 3LLSA 5TJHA 5KJEA 3FNGA 2CVQA 3WTBA 3VH2A 3BMNA 5FI5A 3AJRA 2HDHA 5IZCC 1QRRA 3GEDA 4JP2A 4EJ6A 2VNAA 4IDCA 5IDWA 5HWSA 2CDCA 4TRMA 3QV1A 2ZIZA 3B1JA 3BMNB 5FYDA 3RD5A 3RFTA 2F00A 2O50A 3WSVA 4YB8A 3BMCA 1NPDA 4FB5A 2EV9A 1MP0A 4OMUA 2GF2A 1HDYA 3K31A 1OC4A 2O3QA 1VL0A 3ONFA 1UXJA 1M6WA 2AXQA 3EAGA 1LDMA 1R0SA 4PLPA 1YB5A 1UH5A 4PVDA 4IJWA 1E7YA 3ADOA 3IP3A 4ALMA 4R1NA 4RZIA 5KKAA 3TOZA 3EYWA 2GZ3A 3K2EA 4E0BA 2BGKA 3WNQA 1L1FA 3L4BC 1ADCA 3FR7A 1YRLA 2AG5A 3IAHA 1ZUD1 1KVRA 1OI7A 3CXRA 5H83A 1N7HA 1DEHA 2AQKA 3EC7A 3M6IA 4KDEA 2EXXA 1BTOA 1ZMTA 2H63A 3HDYA 3G3EA 3T4EA 4BNKA 1T2FA 3ETEA 3M1LA 1QYDA 2PH5A 3DOOA 3I9KA 4E2YA 5K6AC 3RAJA 3MJEA 3ZU3A 2DT5A 3JD1A 1NQAO 3PGJA 1SOVA 1WVGA 3L6DA 2NVUA 3OMLA 3QQPA 1PGQA 5JC8A 3VPFA 5MDHA 3GRPA 2O3TA 3ASUA 4U6QA 5DBFA 5I7VA 4P4GA 1SEPA 2IYOA 1IL0A 3HB4X 3NV9A 2O7SA 1GTMA 1VSVA 4KOAA 1R0KA 5JC1A 2X7HA 2I9PA 3DFZA 2WD8A 5JAQA 3WJ7A 2B4TO 4Z0PA 1GQQA 1HXHA 3BYZA 4NJMA 5F1PA 1JQBA 3WFJA 1Y1PA 3ZU5A 2D4AA 3NJ8A 2R00A 1Y8RB 1YL5A 1PIWA 3WGZA 3QLJA 2A94A 3ABIA 4NBVA 3AUUA 4BNXA 4CJXA 4JJIA 3JQ6A 5TS3A 4ZQFA 3ST7A 5KVVA 1O89A 2BI8A 2AQIA 4WPGA 4YQZA 1HSZA 4DQVA 3ICCA 4GX2A 3WIDA 1QYXA 3AOEC 4D3DA 5B12A 3DB2A 4N5MA 2V6GA 5T8KC 3PLRA 4BB5A 2UV8A 4LGVA 4R5HA 4ZQEA 2VQ3A 3D3WB 5ICMA 1W73A 3QVTA 4EJ0A 3OEWA 1P0FA 3WGHA 4OIMA 6LDHA 5L4NA 4YJHA 5G0UA 3PDJA 3RUHA 5CDTA 3KRTA 1KEUA 3HE3A 4NNJA 3JYNA 3GZNB 4RGBA 2WEKA 5L7YA 2O4CA 3ROQA 4DMMA 1HDGO 4YJGA 4ALNA 4YA6A 2OORA 3PEFA 3GUCA 3M2TA 3GVHA 3ZHZA 1U3TA 1HDCA 1ZK1A 5G4KA 1Z73A 1N9GA 5JSFA 2RCYA 3WBFA 4Y67A 3S55A 1O5IA 3AY7A 2I99A 1J5PA 3F1KA 3LT1A 1VSUA 1GPDG 1TT7A 1B3BA 3AUSA 4NG5A 3C24A 2GN6A 4ALLA 2P5UA 2BELA 3W1VA 2F1KA 3AK4A 4PLWA 1ARZA 3MJCA 2UUOA 3JQ9A 4ZHSA 2P4QA 1MXFA 3DL2A 1A7KA 4IDGA 1QYWA 3GPIA 2V7PA 4Y9DA 5ER9A 1ZSNA 1PR9A 1O8CA 1M2WA 3UXYA 1P1IA 2EHDA 3PDUA 1E92A 2BLLA 1GV1A 1L7EA 4MO2A 3UH1A 4RCVA 3H2SA 5BNIA 3GVIA 1MFZA 1R16A 4RVUA 4TROA 4EJMA 4J0FA 5F21A 2JFGA 2VYND 4IDEA 5C3MA 1DIAA 3H65A 4R9RA 4YPOA 3FWZA 1EVZA 1DC4A 4YCAA 3NUGA 2GCGA 1UDCA 3VZQA 4E12A 3I83A 3NX4A 3L9WA 1CF2O 4GWGA 2QG4A 1HSOA 1HF3A 1PL8A 4RLSA 3K30A 2FY8A 3UUWA 3WXBA 1PJTA 3JQEA 4J43A 4CM4B 1WWKA 1PJ3A 5EESA 3HDQA 4R5MA 4W4TA 4CM5A 4A5OA 1I5RA 3U0BA 2EF1A 1D1TA 4YAGA 2OFPA 3DQPA 2FR1A 3AFMA 3SJ7A 1E7WA 1IYZA 2YV3A 3AM3A 3R0IA 3RI3A 3VVCA 5LDHA 1H6DA 2X8LA 3VZPA 1MXHA 2Z95A 3PJDA 4XQCA 3D4PA 1HE5A 1B8PA 2NNLD 3I52A 2RAFA 3QHAA 4NFYA 1R37A 3UCXA 1J4AA 2JCVA 2JD2A 1K6XA 3GHHA 4TZTA 2XPCA 2JL1A 1HLDA 4PVCA 1EBUA 2O48X 3H9EO 1JKIA 3E5MA 1E6UA 4MVJA 5I7EA 1FDWA 2OZPA 3INGA 5A4DA 3TFQA 4B8ZA 1ZSVA 4GQAA 4HX5A 1XWFA 4DREA 2I67A 5DNAA 2YHUA 3TZ6A 1R66A 4BNJA 1XU9A 1XU7A 4GMFA 3HWRA 4CV0A 4N5LA 1NYTA 3E6AA 1WP4A 4OYRA 2Y1GA 1UAGA 2HMVA 1MV8A 2ZB4A 3LZ6A 4IZIA 5A3VA 2DKNA 5TGDA 3WS7A 3OQ6A 3GUYA 3TN7A 4XEHA 1DDOA 2GPTA 4QECA 5TC4A 2Q1TA 4HXYA 1ZK0A 1PL6A 3PFFA 2IZ1A 4ND5A 4BVAA 4AL4A 3KO8A 1HZZA 3QW2A 1FF9A 1PWXA 1SEVA 3BHMA 5EQFA 5I8ZA 1U3WA 2AEJA 3EHEA 3RFVA 5IG2A 1SZJG 4FCCA 4ZQBA 1XG5A 3I9LA 1EQUA 4EUEA 4RDIA 4BQRA 1AHHA 1DAOA 4PLGA 4FFMA 1C1DA 2X0RA 4OQZA 1OBFO 5KJFA 4BHTA 3GFGA 3JQ7B 3CMCO 1BSVA 4OXNA 2YHIA 3KEOA 4NDNE 1TEHA 3UCEA 4K28A 4IJVA 5JFOA 5JDCC 4AJ1A 2WSBA 3TL2A 4M54A 1YQXA 1XQ1A 3CE6A 3D4NA 4H3VA 4WOJA 1AXGA 2W2KB 3OQBA 5EN4A 5KCZA 4PG4A 2Y1DA 4NJOA 3V2HA 1B26A 4G81A 3F3SA 2W2KA 2B0JA 3L77A 3AU8A 1KVQA 3QY9A 1C1XB 4BGUA 3O03A 3NYWA 4BGVA 2NVUB 1C0KA 3AY6A 3U4CA 1T2DA 3DOJA 4K6CA 1NXQA 4BO3A 4E2ZA 3DHYA 2C2YA 3TF5A 2RHCA 3RKUA 5FFFA 1A72A 4NBRA 3G1TA 3ICPA 3ZI0A 3JD3A 1F8FA 2E49A 3ZWXA 2ZCVA 3JQBA 3VH4A 3DZKA 1ADGA 3Q6IA 4I5EA 3O9ZA 2YYYA 3C85A 4W9NA 3RASA 4DUPA 2GRAA 3TFOA 5ITWA 1D8AA 1NQOA 1IE3A 4HUJA 3ROMA 1PJBA 3VVBA 4AJOA 1AN9A 2Y1FA 5K9ZA 2C7GA 1NR1A 3DZBA 3ZW8A 2D8AA 3QJ5A 3PVZA 3FTPA 2J5RA 3K9QO 2VOJA 4XQ9A 2V65A 2Y68A 4FGWA 4CLEA 1KETA 2JHFA 2AQ8A 4XDYA 4ZJUA 3EY4A 3H4VA 3HADA 4R16A 4ZRMA 3JQAA 2BFOA 2VNSA 4OH1A 3UKOA 4ESOA 2V6MA 1EUDA 1BDMA 3GVPA 2PGLA 2I76A 4HY3A 4J1QA 3EDMA 4DWVA 3V1YA 1VL8A 2VHYA 4B3HA 2ZJ1A 4PIVA 2C54A 3BTUA 2X9VA 1A9ZA 1I2BA 4J7UA 3WB9A 4MPDA 7MDHA 2IEBA 5KIAA 1J0XO 4L4SA 3GDGA 4CV2A 4E6PA 5GZ1A 1O0SA 3ZWPA 2ZATA 1G6KA 4YWJA 4BNTA 1JN0A 1AE1A 1KVTA 1FJHA 2NU7A 4GL4A 1SBYA 3P2YA 4ALKA 1H6CA 4DBVO 5T67A 3NRCA 5F5LA 3VKVA 4M87A 2Q46A 5DN9A 4IJUA 3TL3A 1ZCJA 3DBRB 4C4OA 5EQDA 3L4BA 5HBRA 3P5SA 1FDSA 2A4KA 2QX7A 4I8XA 2JCYA 3ZW9A 2G76A 2GUGA 3E18A 4IIUA 4CL8A 2ZYGA 4BV9A 4PG7A 3FR8A 2HU2A 3EUWA 3PQDA 3OETA 2HMUA 2JJYA 3WR5A 2WYVA 1YQDA 2O3SA 3OJOA 2JD0A 1K89A 2AA3A 4W9NC 1E1MA 3PK0A 3S1LA 4CL3A 3KLMX 4JLWA 5K0ZA 1IPFA 3HSKA 1AXEA 4CM9A 2PNFA 1E7RA 2BH9A 4J49A 1E7SA 3QVSA 1T25A 2ZTVA 2IDZA 4FGSA 2P4HX 1BXGB 2HMWA 1HT0A 1M66A 4FJ0A 1DHRA 4CUJA 3IS3A 3WYBA 4IXWA 3OF2A 1HKUA 1BXGA 5KKCA 4O6VA 4AJPA 1B7GO 3ZWCA 3UCFA 3C7DB 3VDQA 4AJ4A 1E3IA 1LDNA 3KLPX 2VWGA 3IJPA 4U6SA 4FJ1A 2CMDA 2CSUA 1SC6A 4BMNA 2PD3A 5I9MA 5BR7A 4G65A 4L0QA 2QIOA 1K6IA 1QV7A 4CMCA 1CRWG 2WYWA 4NBWA 4QT0A 4A2CA 2AEMA 3C1AA 4WGGA 5L95A 4XRGA 5KJCA 3F5SA 1IULA 5ENDA 5JCJA 1LTHR 1YOVB 1PQPA 3PIDA 2RH4A 2VYVD 3KVOA 4QFDA 3NT2A 1TVEA 4XCVA 4CLHA 2DAPA 2X22A 3ON5A 1E5QA 3PWZA 1TLTA 1P45A 5EMHA 5JNLA 1UZMA 1XSEA 1OMOA 4R1TA 5JPIA 3S2FA 3LT0A 4AJKA 2J5QA 4TRRA 1GYRA 3RUEA 3F47A 1JWBB 3WMWA 3IL2A 2C82A 4I5FA 5GZ3A 4M1QA 4IINA 4IDAA 2GYYA 3MWDB 1ISIA 1E0DA 1IZ0A 3U62A 1A4UA 2QYSA 3VTZA 4DYVA 2PKQO 1QMGA 1E1NA 3SBOA 2O3UA 4FOSA 3DZFA 1BHSA 3ZV4A 4FC6A 1MFPA 3I9MA 3Q2IA 2E6UX 2NQ8A 4RV9A 2B5WA 2O7QA 4JXKA 4AJLA 3DBHB 4I5DA 2XOXA 1ISFA 5CHEA 4Q3DA 3D0OA 6ADHA 2P9CA 5G4KB 1I3LA 1IOLA 1QSGA 3A4VA 1XQ6A 1GQYA 4ND2A 4BUCA 2J6IA 2Q1UA 1YVEI 5B37A 5IDQA 4HFRA 1U4SA 5IZ4A 4WLFA 5EIOA 2DUWA 3IKVA 2WWRA 1ZXLA 4DIOA 3S2GA 3ZNQA 2R2GA 4LRTB 3K2BA 2DTXA 2GLXA 1Y8QA 1R12A 3P7MA 1HTBA 1DFGA 1V3TA 5IDYA 4YBZA 1JLLA 3B1KA 4FFLA 1X0VA 3MOGA 4NZ9A 3PPIA 3EZYA 4LVCA 4RF5A 2W98A 3PFWO 4HFJA 4LSWA 5TSDA 4ZN6A 3D1LA 2X5JO 4J1NA 1A27A 4B4OA 3C8MA 3JQFA 1P1JA 4E4YA 1PZHA 4GX5A 5HTOA 3ZNPA 1ENPA 4E32A 2BFPA 1XELA 4J0EA 2YQ5A 4ZU3A 4OSPA 5K6AA 1B2LA 1ENZA 3CZMA 5IF3A 5BSFA 2C7VA 2QHXA 3UFXA 4KUEA 3ZGYA 5ENVA 3F4BA 1QYVA 4YXFA 5CG1A 3PYXA 4II2A 3ANLA 1PZEA 3GT0A 4DLAA 1PZFA 4J7CA 3JCZA 4FDAA 1Y5RA 3G17A 1K0UA 3OA2A 5ICSA 1JW9B 4J1SA 4N54A 3U4IA 3AM5A 2CD9A 4O0LA 4YT4A 3OQ1A 4RJTA 3SJUA 1W8DA 1YO6A 4BMSA 4PLFA 3L07A 3ZNNA 5THQA 1U28A 4O1MA 2NUAA 4YDRA 3H9JA 3W8FA 1FDVA 1E6EA 2VHZA 4EBFA 5ITVA 5KJ6A 3T7CA 3KYDA 4YRAA 4HV4A 5I7SA 4S1VA 1KEVA 2GDZA 4Q3NA 1KBZA 4I5GA 4PLCA 1DC6A 1LSOA 5DULA 3LC1O 1Z75A 4WCFA 1V3VA 5CDGA 3RBVA 4WCFB 2X9NA 2JD1A 3PZRA 1R15A 4RPKA 1GUZA 3NT5A 1CYDA 2DU8A 4KQWA 1QP8A 4J9VA 1EUCA 3G79A 4RLHA 4DRYA 4CLOA 4D79A 1ZEMA 1T4BA 1GYPA 1UDBA 5HRUA 3WLEA 1I2ZA 1GR0A 3MTGA 3DZJA 3RBZA 5C7OO 3ZCXA 2YZ7A 4ZA2A 5JW6A 1GQ2A 3KSDO 3B70A 4IIVA 2DLDA 3VKUA 4E5YA 2FR0A 3ZWMA 4XD2A 3AOEA 1S6YA 3Q1LA 4GMGA 1MB4A 3LF1A 3QWBA 5I9NA 1CQJA 2Y1EA 4FPXA 3VPHA 5TLSA 1A9YA 2D5AA 2AW5A 5DCYA 2PD4A 4KTTE 4M8SA 4TWRA 4BGIA 1ULSA 1DLIA 1H6BA 2FZEA 4XYEA 3R1IA 3U5TA 1WZIA 4YT2A 4R3WA 4Z9XA 5JE8A 3E03A 5EJ2A 2UVDA 3DHNA 1PJQA 2RH8A 1G0NA 4PLVA 3LK7A 1WDLA 5IAAA 1UDAA 4BO6A 3V1UA 5L40A 1LUAA 2YY7A 2W90A 2PY6A 4CQLB 1MG0A 2DBRA 5A04A 3I5MA 4FW8A 1OOEA 4W82A 4CR8A 4XQEA 3DTTA 3PWSA 1B0AA 4YJFB 4CMEA 4J3FA 3PHLA 4YQYA 1CDOA 1YH3A 3DMYA 3PLNA 1RPNA 1XYGA 3GRKA 4EUFA 3SLGA 1ZKMA 3KZVA 1X1EA 3AOGA 2X1HA 3LVFO 4JJFA 4UVGA 1YOVA 3HJAA 4HADA 2ZYDA 4A73A 4BKOA 4U8GA 2GZ2A 3UW3A 4EYEA 4HFNA 4UVIA 3H6KA 5HM8A 2GGSA 3WJAA 2IYPA 1P1RA 3PTZA 4PZEA 1DLJA 1J49A 4XGIA 2I3GA 3GY0A 5HS4A 2NSDA 4LN1A 2VWQA 3GN1A 4NJMB 3KYCA 1BMDA 4GLOA 4OJNA 4W7HA 5KVSA 3KV3O 4RO0A 2G1UA 2Q3EA 4B4WA 2IRWA 3LLVA 2D1YA 2VOEA 3DDNA 1EVIA 3OH8A 2EEZA 4LMRA 1NFFA 4FFPA 5L45A 3E5RA 5JO9A 2PLAA 1ISGA 3ANMA 1E7QA 1N2SA 5BQFA 3WYEA 1ML3A 1QORA 2CVZA 3W8DA 2GN9A 3GR6A 4ID9A 1YDEA 4D0SA 3ASVA 3JYPA 1W6UA 4MVJD 2R6JA 1Z74A 2W4QA 3WTCA 4NQZA 4KMSA 4Q3EA 2OMEA 1JVBA 1XR3A 3GDOA 1DC5A 5F5NA 3W6ZA 3HQ4O 1V8BA 1CERA 4J2OA 3GGPA 4RF2A 1I2CA 1X7DA 1HE2A 1N9GB 1GCOA 1T26A 1W4ZA 3A14A 3BIOA 4GVXA 4M89A 3DBRA 5AYVA 1S7CA 4L4RA 3TZHA 2GZ1A 4Z0HO 1UZLA 3OIGA 5ILOA 1Y9EA 4MVJP 4GH5A 5BNFA 3H5NA 4PLYA 3FNEA 4CUZA 1D4FA 2C0CA 3I1JA 3Q9NA 1HETA 4F46A 4U0JA 2OGUA 3KYBA 4CPDA 2X0IA 3U3XA 4DVJA 4UVHA 2UYYA 4BMVA 3GMSA 5DZSA 2ZB7A 2Q50A 4Y8VA 1NFQA 5A05A 4DMLA 2WJPA 1BVRA 4CV1A 1QYCA 4OM8A 2BHLA 1L7DA 2WD7A 3RKRA 2W8ZA 2J8ZA 4LCEA 5C7LO 3ENKA 1Z82A 3NKLA 3STHA 2EW2A 2WD7B 4CM3A 4G2NA 5B4UA 3UN1A 1Q7BA 3FPLA 4ALIA 3BZUA 4RVHA 4GSKA 4BS9A 2P2SA 3PJGA 4B4VA 4IDFA 4JX8A 4AJEA 3ZV3A 1PJSA 3DAFA 4TMFA 4RDHA 1LNQA 3GFBA 1TXGA 4C7KA 2OBYA 2D5CA 3Q0EA 1VE9A 1O9BA 2RIRA 4BNIA 1LLCA 3ZNOA 4RPGA 1ENOA 1UJMA 4CM4A 1SB8A 4EI2A 1XEAA 3JQ8A 3LQFA 4FFOA 1U2DA 4MP6A 4D7AA 3QWFA 1GYQA 1ZMOA 4J4BA 4YACA 3TQHA 4BKRA 1E6WA 1JVSA 3EMKA 3QVWA 4FD3A 4CMBA 4FR5A 3GNQA 3JQBC 4BO7A 2B4RO 4CM1A 1LLDA 4W7IA 2Y05A 4QO7A 2AMFA 5LC1A 3HN2A 4C7JA 1LRKA 1GADO 2VTDA 2EKQA 5CEEA 2HLPA 2PK3A 3AU9A 4YAIA 1LSSA 3T7EA 3NEPX 4HWKA 3UAGA 3DEYX 4K6FA 1A71A 3U4DA 3QE3A 4DQXA 1H6AA 4ALJA 3WNVA 1HYHA 1M6HA 3Q2KA 4PRKA 5DP2A 5CDSA 1KS9A 1PTJA 2FPPA 5CDYA 1KEPA 3QWIA 3IC5A 1UP7A 1NX6A 2DPGA 4CM7A 3E9NA 4IQ0A 1TT5A 4I9HA 4IMRA 1YB1A 1CWUA 3FHLA 2P68A 1IY8A 3N58A 4UVDA 1YL6A 5DP1A 3G0OA 3RUAA 4FC7A 5CEJA 5KVCA 1U7TA 2G5CA 4BKQA 4CR6A 4HNHA 4NU6A 4JJGA 1CJCA 4IJKA 1U3VA 4R9SA 4U0KA 5A06A 2YHIB 2O4UX 1MC4A 4HBGA 2WMDA 2JAPA 4B7CA 2X6TA 3M2PA 5JY1A 3R6DA 1EDZA 2ZB3A 4WNIA 2Q49A 4IGFA 1T2CA 2HO5A 1I3KA 4NBTA 1U8XX 1KYQA 3F9IA 3LF2A 5KWEA 2AQHA 4CR7A 3CINA 1LBEA 4CM8A 3I6QA 4IZHA 2DBVO 2DVMA 2X5OA 1JWAB 4HP8A 2IEDA 4CQLA 2VZ9A 1X13A 4UVEA 2HK9A 2CUKA 3W4KA 1GZ4A 2PZKA 3GEGA 4D44A 4BB6A 3BTOA 2PR2A 2Y66A 4TVOA 3TNLA 4Q9NA 1GAEO 4AJJA 5KTKA 1DIGA 3D64A 5TQVA 3H5RA 5FF9A 2X9GA 5TIIA 1I30A 4U7WA 4ND4A 2OXIA 1SO8A 4PN3A 2Y0DA 1EVYA 2HMTA 4ZQGA 5JDCA 5J23A 1LRLA 1ZJYA 4OL9A 4OQYA 1FDUA 5COAA 5ILGA 1EMDA 2HKIA 4WLEA 4YRDA 2FRDA 1KIFA 5BSHA 1F14A 5A5FA 1LQTA 3HNPA 4NMHA 3DMTA 2YW9A 2DQ4A 3ETDA 1IZ9A 1DPGA 3O8QA 2Q2QA 5C7IO 1VI2A 5CG2A 4J91A 2EKLA 2VHVA 3WGTA 5TT1A 4AICA 3KYDB 1NBOA 1ADFA 1JAYA 2B69A 4FIZA 5GY7A 2NLOA 3E8XA 2QRLA 3H9UA 2VYVA 5L4SA 5BSEA 1LDBA 3P2OA 1YJQA 1R4MB 3GEMA 4DLLA 1XIVA 1RYEA 2NVBA 3FN4A 3GGOA 2NU9A 4QO8A 1DXYA 5EINA 2P91A 4X54A 4RPHA 5DCWA 4KP7A 3ZV5A 1C0IA 3LYLA 2OL4A 1XLTA 3JYOA 1WMAA 1PU2A 4AJHA 1DO8A 2BI7A 1WW8A 1ZK3A 4XR4A 1EEHA 1P44A 5JYDA 1NAIA 1PQWA 3D7LA 2TMDA 5JDIC 3JD0A 5JS6A 4QQRA 5JMWA 3W8EA 1YBAA 4CQMA 1E5LA 4EUHA 1Y9AA 1DRUA 2EWMA 1DSSG 5AOVA 4MVJH 3RUCA 2CNBA 4HFMA 3WQQA 4XYLA 4LK3A 5A9RA 4LW8A 1YB4A 2HJSA 4OGWA 1T4DA 3E48A 1VJ0A 1E77A 3ETGA 4DPMA 3OECA 3IP1A 2Z1NA 4JN6B 1N5DA 3WGQA 5F3RA 5ADHA 4CLXA 4PZCA 1NWHA 3NJ4A 4WASA 2GN4A 4L9RA 3LC7O 4W99A 3I6IA 3MZ0A 3WG9A 4QXMA 1IB6A 3V5NA 3ZWYA 4FS3A 4IS2A 1H2BA 2YDXA 4E2XA 4ITUA 2CDAA 2OP1A 2YQ4A 2UAGA 3AY3A 1ONOA 1GPJA 2OO5A 3H2ZA 3MJVA 1F8GA 4BO4A 4E5PA 3QVXA 3O38A 1HL3A 2R00C 2VZ8A 2BRUA 1B14A 2G17A 1RM3A 2Q4BA 3JQFC 3F5QA 1VKOA 4EITA 4A0SA 1NWCA 1U1IA 5DDIP 4KUGA 3LU1A 3D5TA 1T2EA 1GEGA 3QWAA 4R1SA 1UXIA 2VT3A 1P77A 4PLTA 2X58A 5U1PA 3WGYA 3L0DA 4YEDA 4CM6A 4BNHA 4XJTA 1P1HA 3M1AA 5B4VA 2I65A 2Y0EA 5JBIA 5IN5A 4F45A 4KDFA 3U49A 3WOHA 4J90A 4OXKA 5COBA 1Q7CA 3VZSA 3OBBA 1H9BA 4Y98A 2YFQA 3JQ8B 4GLLA 1PJ4A 4NFHA 3TPCA 3A06A 2Y99A 3H7AA 4XX0A 3WGIA 4IGEA 1WLYA 1WAMA 4P8RA 3FBTA 4OKNA 4TKLA 2Q45A 3HN7A 1FDTA 3AUTA 1WMBA 3BA1A 4GSLA 4H7PA 1WXDA 5JAMA 3UOGA 5BNTA 4CLRA 3LT2A 1NTOA 2EERA 4TZKA 3S2EA 3C3XA 4CV3A 3KETA 4JP3A 1D1SA 4WCFC 1LLQA 5B4TA 5IJZA 4WKGA 5U9CA 2X4GA 3ROPA 1VL6A 2I66A 1ORRA 4CM9D 2CF5A 2FWMX 1F17A 1Z7EA 3RIHA 2HK7A 1I01A 4URFA 3FTNA 4CMKA 4R69A 3WSWA 1IUKA 1QV6A 2VZ0A 5G0SA 4QX6A 2PKQP 3C1OA 3K92A 4N5NA 1UR5A 4Z3DA 2C20A 3VOSA 1U5AA 4XIJA 5DOVA 3DZHA 3RC7A 3QP9A 1HYGA 1H93A 2HCTA 3DTYA 3VDRA 4ND3A 1V3UA 4YJGB 3NTOA 2AE2A 1Y5MA 4D46A 1BGVA 2ZQZA 3VHRA 5DT9A 3CKYA 3HFSA 1M76A 2JHGA 5LCXA 3RVDA 2UDPA 1X7HA 2IZ0A 4GGOA 2VT2A 4OAQA 5AXCA 3OIFA 1DJNA 4GKVA 1T24A 4HKTA 4K1LA 4R54A 3L4SO 3WWZA 3HDJA 3ZWNA 3IUPA 1KC1A 4CMAA 3RU7A 3DBLB 2NU8A 4AJ2A 5C5IA 5KJ1A 4CUKA 3FNFA 3E1KA 4CMIA 4DGSA 2DBQA 1GZ6A 4XIYA 3RJ5A 2VWPA 4BNUA 3GG9A 3HDHA 3CH6A 2EP7A 4MP8A 3SLKA 4GKBA 1H2HA 1GZ3A 5FWNA 1PSDA 1NAHA 1UXHA 5IN4A 4GX0A 3TJRA 1JA9A 1HYEA 4KWIA 5DF1A 3RU9A 1OFGA 4WLOA 1P31A 3INRA 1ZJZA 3OJFA 3IUSA 3OJ0A 4D45A 1BW9A 4UEKA 4Q3BA 3IOYA 4BO2A 4DLBA 1NQTA 1BRMA 2Y1OA 4BNYA 2D0IA 3HFGA 2J5KA 2AG8A 1P33A 2C29D 1IHYA 1JTVA 1G1AA 3DAGA 4ZVVA 1UXKA 4E30A 3CMMA 4RF4A 1YONA 2HRZA 3KHUA 2E82A 3GNSA 4FQ8A 4TQGA 2DBZA 4Q39A 5G0VA 1HDOA 1O6ZA 3GAZA 4GWKA 2GASA 1I3MA 4XKJA 4E33A 4RQTA 1EQ2A 1LLUA 1U4OA 4TVBA 1PJLA 4YTEA 4BO8A 3ADPA 1CETA 3JQ9C 4XA8A 5BT9A 4DC1A 2GNAA 3F4LA 1NNUA 4BL5A 2Q2VA 3LT4A 4YAEA 3ZWAA 3INTA 3JTMA 1K2WA 1N1EA 2FSVA 3FCOA 4ILKA 4II3A 4MKZA 4NK4A 1VLLA 2CZCA 3K5PA 4NU5A 3RC9A 3PIIA 1EZ4A 4S3MA 4JIGA 4RVSA 5FI3A 4CLOB 3LC2O 1NPYA 1C14A 1SOWA 2X86A 1MC5A 2GSDA 1Z45A 1LJ8A 3O26A 3GVXA 1Q1NA 1NM5A 3JQCA 4BO5A 2VRCA 3IQDB 4P4NA 4BO9A 4E13A 4J9UE 1E3WA 3BMQA 3KB6A 4R1UA 3QRWA 4R41A 3KXDA 4BGEA 2QRJA 4O5OA 3DAPA 4E31A 1Q0HA 1JU9A 2XXBA 1P3DA 3VZRA 1BVUA 1KEWA 1I24A 3TZKA 4PFJA 2DPHA 3F46A 3X2FA 3VPXA 5L4LA 3D4OA 5L3ZA 3GQVA 3KOUA 3PQFA 2ZB8A 4IXTA 1KVSA 4DIBA 3KTDA 2J3HA 4OOEA 1EUZA 1YQGA 2NQTA 1HWYA 3OM9A 4IDBA 1HLPA 4YT8A 4FFRA 2PZLA 3RC2A 3NDRA 1NVTA 5KVQA 1AUPA 2VRBA 4PG5A 4HNGA 4BNFA 3DR3A 5COQA 3VPSA 3NTQA 3JQGB 2FHSA 5A5EA 4XQGA 3WICA 4N18A 1CEQA 1C1XA 5ES3A 3BXXA 1U7HA 2PFGA 4CLDA 2AE1A 2O2SA 3SEFA 3C7CB 1LRJA 2O3RA 2PA3A 3PGXA 2Q1SA 5TNXA 2H5LA 4D3FA 3CTMA 5CDUA 2AEFA 3BMOB 1ADBA 3I9JA 4Y6RA 5TJ9A 4NBUA 1V35A 2NWQA 2DFDA 3U9LA 4A03A 1OAAA 3B20A 4R4JA 1NVMB 3BMOA 1ZZEA 1F06A 5U4QA 1WDKA 3ONDA 4IPTA 4R3NA 2Z5LA 1R0LA 4WOKA 4L4XA 2FR8A 5JYEA 1UUFA 1V6AA 3FNHA 2B35A 1LU9A 2XF8A 4U5QA 1LDEA 1KVUA 3PRJA 4FFNA 4GPD1 4JBGA 3O8QB 4MDHA 3NTRA 4BNZA 4UULA 4DTIA 1X15A 2ZQYA 1ZVMA 2HK8A 4CMHA 4H16A 1NPTO 1QR6A 4FBGA 3PQEA 2IXAA 3D3EA 3SXPA 2Q2WA 1ZEJA 1UP6A 2D2IA 2B36A 2XAAA 3HG7A 1N92A 1A5ZA 5DOZA 3WQSB 2CF6A 4MOWA 1SMKA 1YXMA 5T6BA 1BXZA 1R6DA 2BKAA 4IQGA 5AXBA 4DPLA 5A9SB 4D3SA 3ONEA 5AQ1A 1YBVA 1ENYA 3BTSA 3KM0A 4KWHA 3NDIA 4IM7A 1LEHA 1GD1O 4LRSB 2PGDA 3GN2A 4XB2A 1HDZA 4BOYA 5F1OA 4CMJA 5JCXA 1ZH8A 3OICA 3W6UA 1M67A 3DWFA 1D3AA 1DAPA 1SB9A 1FXSA 3RQSA 3OEYA 4E5NA 4K26A 3BHJA 2Y67A 1DBVO 1F0YA 4XWYA 4XZ3A 4RQUA 3E9QA 1VPDA 1LDYA 1JKJA 3MJTA 3OSUA 3QWHA 4Z9FA 2JAHA 4MVJE 3PHGA 4XB1A 3TDKA 1V0JA 4A26A 4B3JA 3PJEA 4XDZA 4YJDA 1EFKA 2OUIA 1GFSA 2WYUA 3AI2A 4IUYA 4TSKA 3TZQA 3GGGA 3QSGA 4AVYA 5CAEA 2BMAA 1XA0A 1NHWA 2YDYA 4Y6PA 3MTJA 4R51A 4OKIA 1PJCA 3E82A 2RHRA 4B79A 1DHTA 2I5PO 4OHUA 5DBGA 3HHPA 3KBOA 4RF3A 1A4IA 5TRTA 3X2EA 4EZBA 4F6LA 4ZICA 1ISJA 3FBGA 4P22A 3ULKA 3WDSA 5I7FA 2EGHA 2QZZA 3VH1A 4P38A 2OP0A 4CMGA 3RUIA 3G49A 1B15A 3GOHA 3ZHXA 2YV2A 2NVWA 1SPXA 1Y81A 3FI9A 3RFXA 4BNNA 3CPSA 2NTNA 1E3SA 1EDOA 2I6TA 5TX7A 2ET6A 2VHWA 3ENNA 4O63O 3A28A 3R3SA 1EFLA 3COSA 4EDFA 5A1TA 3CIFA 1UXGA 1BXKA 2CFCA 4MJLA 4YR9A 4Z6KA 1I32A 1RM5A 3ORFA 5JAZA 3I3OA 4DQUA 3RBXA 5A02A 4MVJM 2B4QA 3EVNA 2HUNA 4OOFA 3JQAD 3SC6A 1UAYA 4Q3CA 3VPGA 4MIEA 2FMUA 1Q0LA 2EG9A 4NPCA 1I10A 2VWHA 4MKRA 5ER6A 4IY1A 3ZV6A 2B37A 3H9GA 1E3EA 1QG6A 1XCBA 4GI2A 2EW8A 4TKMA 2DFVA 2PV7A 3GLQA 5G2OA 3ZH2A 1WNTA 1DFIA 5GMOA 3GMDA 5HS6A 1ZW1A 4KQXA 4DPKA 4M49A 4DYDA 2NV6A 2VTEA 2GERA 1LDGA 1RKXA 2VHXA 3B6ZA 3GC6A 3D3WA 4PGFA 1Y7TA 4H15A 2V6BA 5IZCA 1QKIA 3MEQA 3WMXA 1GDHA 2WTBA 3AI3A 3CUKA 4B7UA 3FRJA 4K9DA 5JDIA 2ZTUA 3LDHA 5T5QA 3IKTA 4IMPA 3RJ9A 3SVTA 3AM4A 1DIBA 1YJ8A 4MIYA 4RPLA 5A9TA 5AXDA 5CEFA 2EP5A 2IXBA 2BFMA 8LDHA 1UP4A 4NI5A 1TT5B 4RORA 2PTGA 3I9OA 5I8WA 2FZWA 2Q99A 2OOSA 1NP3A 3EVTA 2J3IA 1RM0A 5G0WA 2JCXA 2VUSA 4FSHA 2SCUA 1Y8QB 2H1SA 3JYLA 1WZEA 3EGOA 1PS0A 4L8VA 4AJNA 4JGBA 2AHRA 4XYMA 3WBBA 1NQ5A 3HUDA 3GAFA 1K6JA 3QIVA 4TRJA 1JKFA 1GL3A 4XRRA 3GPDG 2PGJA 1E3LA 2B5VA 1J6UA 1HZJA 4DL9A 1BWSA 1HRDA 3RSHA 4EGFA 5BSGA 4WJZA 2X0JA 3BAZA 5F1KA 4DA9A 1BG6A 3DC2A 4PLZA 1XKQA 2CDBA 4B7XA 3KUXA 4WE3A 1X0XA 4XYBA 1X1TA 3GF4A 4ZQHA 3GVCA 3RC1A 1PZGA 2P5YA 3KEQA 3RWBA 1W0CA 2QZ9A 3PZBA 4I9UA 1IPEA 2H9IA 3RCBA 3UHAA 5AXAA 1P0CA 3PI7A 4NR0A 5H82A 1VJTA 1WDMA 1IHXA 2EKPA 3V8BA 1PEDA 1DJQA 5AVOA 5JAIA 5L51A 1BW9B 3V1TC 1KY5A 3DBVO 4BV8A 2E48A 5LDGA 3PYLA 2X5KO 2VN8A 1H9AA 1LC3A 2W2LA 3WFIA 1YDWA 1YGYA 1XDWA 1Q0QA 1PS8A 1E1LA 3RUFA 3W4JA 3RUDA 3ROKA 3VAZA 3V2UA 4LVUA 3ZN2A 4I1IA 1GEEA 2A35A 3K96A 3NDJA 3PJFA 4G5HA 4MVJF 4WECA 3JQAB 4QEDA 4WUVA 1R4MA 1HE3A 1T1RA 2ZK7A 1VKNA 1OZAA 2GD1O 1WPQA 1ONPA 3GZ4A 2QYTA 2PZJA 2ZCUA 1DRVA 4PZDA 4YT5A 1U8FO 3H3FA 3UICA 1E3JA 1ULUA 3ZWVA 2IE0A 4LISA 1HEUA 1MX3A 3L9XA 2LDBA 2J3KA 3F1LA 4IS3A 4CQMB 1P1KA 1DFHA 2EJVA 2Y93A 3S8MA 5L53A 2IODA 3ZU2A 1KC3A 4GX1A 4ZRNA 3Q3CA 1B3RA 4B8WA 4BNVA 3ZZNA 2PKRA 3K6JA 1KERA 4ZGWA 1E3WB 4A27A 1AGNA 1Y6JA 1P74A 2HRBA 3A9WA 4PLHA 4GBJA 4TRNA 3BMCB 1CQIA 4OSOA 3N7UA 3WGOA 4EEXA 2JFHA 1MG5A 2PZMA 4JCOA 1FMCA 3VTFA 2C5EA 3MOIA 2J3JA 1D7OA 1ZIDA 4FOOA 3AWDA 4XGNA 4NH4A 4BKPA 2BFAA 2YFHA 4MVJI 5IDXA 7ADHA 3C7AA 5EPOA 1TB4A 5EERA 2B83A 2VUTA 4UUOA 3U09A 2DM6A 1I36A 3MWEB 3HZZA 4BNGA 2VYNA 5B1YA 2HSDA 1YS4A 3UGKA 1LQUA 4J16A 4BIIA 2CY0A 1NHGA 3OJEA 2DC1A 2G82A 1PWZA 4RPJA 3ZWWA 3Q9UA 3TZCA 2DTEA 1SNYA 3K8ZA 3OJLA 1DC3A 4YJFA 2FOIA 3RROA 1QLJA 4IDDA 3WQRA 1RJWA 4INAA 3WIEA 2GO1A 1PGPA 4Z0TA 1H5QA 4J2HA 1GY8A 3FWNA 2P9GA 3L6OO 2X0NA 3ZHBA 2NADA 4E5KA 4UEJA 4LSMA 4O59O 4WEOA 4D43A 3QVOA 4LMPA 4BO1A 2NM0A 1LX6A 4L73A 4YVFA 2HMSA 3ZU4A 3O4RA 4D42A 3WLFA 1JDJA 1M75A 4PG8A 2D3TA 1VC2A 3ZHYA 5A3JA 3PHHA 2O3JA 4WLNA 4A7PA 2OHXA 2C5AA 4E3ZA 4L74A 3CEAA 3EW7A 1Q2XA 1EK5A 4M55A 2NTVA 4CQMD 4UUNA 1PQUA 1K3TA 1V9LA 4E21A 5L7WA 4DC0A 4RZHA 3B1FA 1X7GA 2GN8A 3WYCA 2Y0CA 2YUTA 2BF7A 4JROA 1I0ZA 2HJRA 4Z9YA 4CLRB 5MGBA 2FN7A 1H0KA 4MINA 4N7RA 3NT4A 3KYCB 5H81A 4MIOA 4IQ8A 3ZWBA 4MVJG 4KUHA 4ONEA 5DBIA 3V2GA 5A9SA 4YAKA 1YL7A 4XYGA 3DONA 4WK6A 1I33A 3S2IA 9LDBA 4NK5A 4KTVE 5GZ6A 5IXYA 3GA0A 5G4LA 3I4CA 3ITDA 1O94A 4Z3KA 1NASA 1JAXA 4OXYA 3T4XA 1YKFA 4YJHB 2NACA 4ROSA 1EE2A 2ILTA 1XHLA 3IIEA 5CFZA 4UAGA 4XJSA 3BTVA 3C1TA 4F3YA 1ISHA 1ZSYA 3GZNA 2TMGA 4L76A 3UVEA 2NTJA 1Q7GA 3JYQA 3QA9A 4M86A 1B8VA 3Q11A 1LI4A 4XR9A 3VC7A 5KOIA 1N7GA 2D59A 2G0TA 2HQ1A 4WNCA 5KNLA 2C07A 1NFRA 2WE7A 2PWZA 3KSUA 1ZO8A 2HAEA 3JD2A 2FPGA 4UUPA 4AJIA 4DXHA 4JK3A 5T57A 3GNTA 1A7AA 3PHIA 1ZXBA 3PHJA 2A9FA 3TWOA 3DBLA 2ZTLA 2POQX 1E7MA 3HB5X 3MJSA 2WE8A 4CMIB 3FD8A 5G0TA 2BD0A 1UZNA 1MGOA 2DUUA 1R4NB 1U5CA 2C2XA 2Q1WA 2BGMA 1ZFNA 1B16A 1E1KA 3N74A 4CMEC 3GDFA 1G0OA 4UEOA 4GVLA 3AUAA 1R4NA 3TOXA 5FEUA 5T8KA 4I9NA 1GCUA 1CIVA 1QLHA 1DOHA 2EJWA 3W4IA 3DFUA 4BNMA 1EE9A 2GR9A 1NR7A 1DRWA 3F6YA 1PX0A 4JNKA 4J4HA 3L6EA 3IDSA 1MUUA 1I8TA 3PP8A 2ZTMA 4IBOA 1HDXA 2QW8A 3TRIA 1VRWA 2JKVA 9LDTA 3NGLA 5CPFA 1TI7A 4EW6A 3H5AA 1NVGA 2XXJA 4DBZA 1DB3A 3PWKA 3E9MA 1MA0A 4YAJA 1P9LA 2IZZA 2PD6A 3KSZO 4NHEA 1F12A 4RVFA 3U4HA 5IXSA 1H94A 1SCUA 1O95A 3FSRA 3SC4A 3G1UA 3DZIA 1XGKA 3BHIA 4JBHA 4ND1A 3AW9A 1EVJA 4CODB 4WCDA 4AFNA 1C3VA 1RYDA 1P1FA 1ZK2A 5CP8A 3WX0A 2EIHA 2FPIA 4NFSA 1N8KA 4LCJA 3I9NA 1BDBA 4F6CA 5I9LA 1Y8RA 4J1TA 4Y6SA 3FPCA 2DTDA 1VJ1A 5JLAA 4EEZA 5THKA 1LXCA 3PXXA 1Z6ZA 4XGKA 4BO0A 3JSAA 4QSMA 2Z1MA 1AHIA 4J6FA 2NU6A 5A03A 4UUMA 4PG6A 1KOLA 4B4UA 2X23A 5TF4A 1MLDA 3DBHA 3JQDA 1K5HA 1ZBQA 4UREA 5C37A 3TSCA 4A10A 3OP4A 4B3IA 3GH3A 1DIRA 3ZDFA 5HA5A 1GUFA 4WLVA 2I3AA 4FN4A 2FSSA 4W6ZA 4JBIA 1ZNQO 3NGXA 3LSYA 4JQCA 3DZGA 3JV7A 3K73O 2O2YA 1PL7A 1X14A 2OBNA 1QXSA 1ISMA 3WWYA 3MCVA 3JD4A 3VH3A 2ZJ0A 4P4LA 2CVOA 4AG3A 4BQPA 3ZWOA 1YE3A 1C0PA 1I3NA 3ANNA 4RVGA 3DXFA 1LA2A 1ZK4A 5T64A 2V6FA 1B8UA 3ITKA 3BMQB 4QTZA 1TA4A 3AI1A 3WGGA 5JO0A 2VCYA 4PCVA 2WDZA 1PS9A 5DCUA 1C1DB 4J4TA 3DMTC 3I23A 3JQ7A 4BKUA 1EBFA 3P19A
chains in the Genus database with same CATH superfamily
1JLKA 2W2LD 4MXDA 1S3SA 5K8VA 2HQSA 1PEKE 2DCUA 4DIFA 3NGMA 4UHKA 3WLSA 4CM8B 5HCNA 2HR1A 3CRNA 1IQ0A 1F9EA 3THWA 5ALXA 3BXFA 1MQAA 4GOOD 3PKJA 4ZIRA 1SUIA 3KTAA 2GMWA 4BUJA 4FNAA 1MD9A 1CUIA 2W2PA 4LQLA 4LTMA 4I08A 2BR5A 1DE0A 1NULA 2WM3A 2ARKA 3VHLB 4TSRA 1L5WA 3D0RA 1P39A 4DKJA 1LKZA 4FEGA 5JJBA 4KLAA 5FPPA 5CFLA 2C3PA 4OBWA 3I01A 3PQ8A 2DLNA 3ILYA 4RHTA 1WD5A 2QRKA 2YJ3A 4NDAA 3EIUA 1Z28A 3OSZA 5BV0A 1JQKA 3W9BA 2C77A 3NQ41 4OO3A 4NIMA 1RVDA 3R3JA 1YWGO 3HBLA 1IY2A 2GWRA 4LJ5A 1CYEA 4OHXA 3GXOA 5LXTF 4QFCA 1X92A 1N1GA 3KALA 3S6JA 2ISSD 5KCMA 3LY5A 1EK6A 5IVHA 1KQPA 2VRNA 4B0OA 1JG4A 1YRQA 4GDFA 4BRWA 1GAWA 4NBSA 5EYPA 1M1NB 1G8GA 1L5ZA 1RC1A 2P6UA 3IUEA 4LUCA 4NCAA 4YJ2F 521PA 1QP4A 4LF8B 4L75A 4BVHA 5TQ2B 2HRQA 1AS0A 1ADYA 3C3DA 4FYVA 5L9AA 2WWGA 2PKXA 4UCQA 3H9QA 3A9CA 2P69A 3H3XA 4PS0A 1SVOA 2EJUA 4IFIA 2H4YA 3H3JA 2EX4A 2HWYA 3KLBA 3GD5A 5TV2A 3RYHA 1O6GA 2GEBA 5JSZA 3EZLA 3QMMA 3SX2A 4CHTA 1HEIA 4S1WA 3TZBA 4DEVA 1A5SB 1E4YA 3GK3A 5JRZA 1ZU4A 1ACJA 4MP3A 2ORED 4A5SA 1G16A 1BCRA 1G3RA 1PK7A 5BNWA 5JY6A 3VAYA 3R40A 4MKGA 5TJHA 3B7WA 1FRZA 1NVVQ 4UOQA 1RQNA 3AV0B 1RYNA 4Z51A 1IXZA 2D4HA 3DDUA 3EC2A 4FYYA 3GJXC 2QN9A 3SJCA 3UHOA 4FUTA 4GQIA 5IZCC 1ZITA 2QUKA 4GHWA 2VNAA 4I6EA 4EJ6A 5IDWA 2CDCA 3HXPA 3LXUX 1GJRA 4M1SA 3TSAA 3B1JA 1I0LA 1IK4A 3HTXA 5E8JA 4N3GA 1SY7A 1TCCA 1MIOB 1XUOA 2IV2X 3L1JA 2YWGA 5F9HA 1QQ7A 1YMUA 1F0KA 3H75A 3I04A 4TQ9A 3PNYA 2EV9A 1MP0A 2BHTA 2GF2A 1HDYA 3WLTA 5B6PA 4PF1A 2LIVA 2FQWA 2AN5A 2O3QA 1LD3A 3ONFA 4JD5A 4MVWA 3LQKA 5I9BA 1UXJA 3HU1A 4Z49A 5LXTB 3USCS 2CXQA 2IDMA 3EUEA 2AXQA 2XNKA 1NZJA 2OGZA 1UH5A 1FVHA 3GFQA 4O2BF 4PVDA 5E2AA 1W4AA 1MO3A 3E8MA 3LG2A 4J6EA 4RHFA 4EYGA 1YDMA 2X6RA 4RZIA 1LBSA 1ZGHA 5C1PA 3S44A 4XE5A 4DADA 1QBKC 3DDHA 1QDEA 2R4UA 4I4NA 2JLQA 2G88A 1USIA 4PO3X 1C7QA 3WNQA 2JVKA 1ZS9A 2HA4A 5IK2D 1MEOA 5IJ0B 1LW6E 2AG5A 3IAHA 5CBPA 1CY8A 4UHEA 1NDQA 3FTFA 2BVNA 4M7WA 3S99A 1RAAA 1N7HA 1SXJC 1EA5A 2JBHA 3LA8A 5AK3A 4C05A 1B23P 2AQKA 4CTOA 1J24A 3HDYA 2H63A 2XSZD 2P2NA 5H3HA 2C5GA 3Q6MA 5I9IA 5AI9A 1WXGA 1UOQA 1Z3IX 1N2IA 2H2AA 4DM7A 3ETEA 2HF2A 1QYDA 1RXCA 2AB0A 4I3FA 5CHYA 4OAOA 5ED0A 3VBCA 1H8ED 2RHHA 2XYHA 2YN0A 3MJEA 1T9HA 4CT5A 1SBQA 3FFWA 4M53A 4URUR 3CF4G 2NVUA 3L6DA 3OMLA 4OJQA 4EYOA 3B7PA 4Y7CA 1I6LA 3ZXSA 2JZOA 2HXYA 1SUPA 1P62B 1KZ7B 2IH2A 4HQ6A 1I2DA 2OT3B 3ZY6A 4C2BA 2J07A 5AW5A 1BRTA 3WGMA 1IL0A 3CHYA 1C2YA 4DCUA 3GJ0A 3MT7A 1T5OA 4V2IA 1FU7A 4W7SA 3GA7A 2QL6A 4JKYA 1O96B 3VGJA 5FQOA 3I04M 1KMIY 2JJQA 2GEVA 4LZZA 4AKSA 1UZUA 5JAQA 3MCWA 5JANA 4OCZA 4A4DA 1CW2B 1SZDA 2RJ3A 3SFZA 3ZU5A 4FZ5A 4QJ4A 1Y8RB 3UPDA 1YL5A 2P6MA 1GGFA 1II8B 1PIWA 4A8JA 4LV8B 5E1MA 1J2TA 5IFKA 1Q0TA 4NBVA 2A94A 3ABIA 2W6IA 3PBKA 4Z7OB 3AUUA 3QBEA 4W5WA 3RC3A 4KNWA 4M0CA 4I8IA 2VAWA 1GZVA 1O89A 1W94A 2W37A 4FWIB 4WPGA 2PKCA 4GX2A 1UKAA 3E2PA 3BRWA 3ZDXB 5B12A 3DB2A 4MX8A 4HUTA 4PU0A 2EARA 1M1XB 1Q3TA 2A9PA 2W11A 4R5HA 1OROA 4ZQEA 3V46A 3UEOA 3WYFA 3WGVA 4EJ0A 3TDNA 1SKBA 3TBFA 1IN8A 2OBLA 3WGHA 1XVTA 4WX2B 4DABA 1J0CA 3FZYA 1J9GA 3HCWA 5TPZA 3W6OA 1KEUA 3HE3A 2X1MA 4NNJA 2FZKA 2OCXA 2XKBA 4IDPA 4RE6A 2ZDHA 4ENSA 5L7YA 2IC5A 4LDRA 2ONJA 3IQGX 3ROQA 3U3DA 2C99A 4UXJA 1HDGO 3VNRA 1KGDA 4EW2A 4YJGA 3RANA 2UYQA 2M6RA 3KWLA 2AZ4A 2OORA 4RY2A 2J0UA 2PBLA 2GNPA 1UADA 3GUCA 2VAMA 5CFQA 4K88A 3WMFA 3IVGA 3ZHZA 2ON6A 1ZGAA 1GNPA 2GF9A 3ESBA 1N9GA 4PCUA 3SMQA 2D7DA 3WBFA 1S2OA 3TLKA 5JQGB 3VYSB 1J00A 1O5IA 2E18A 2I99A 4ZI7A 2PYZA 1JLRA 2XTZA 4DR4B 3F1KA 4EATA 3UHFA 1ZI6A 3FLAA 1RCUA 3B78A 4UDXX 3AUSA 3P9XA 3C24A 1Z5PA 3FYTA 2VK1A 4FEEA 3K2IA 4RVNA 5AM4A 1G60A 3ZYZA 4LQ4A 1Y63A 3OHMA 4JOCA 4PLWA 1S3FA 3VNAA 3MJCA 1P6UA 4PZLA 3HNRA 2IEGA 3KJIA 3WXMA 1FFSA 4ZTZB 1NI4A 3U37A 3WLNA 1MXFA 2C58A 3DL2A 2G71A 2DMRA 1N9KA 3A2NA 3B1VA 4TS9A 3GPIA 1KMQA 2V7PA 5KMGB 1SBIA 2XCUA 4K86A 1UKEA 3DNMA 2QUJA 4B6JA 4IF4A 1QFZA 2GILA 2BLLA 3PDUA 4DB4A 4M1WA 4Y1EA 4JOBA 4ER7A 1GRRA 2QKYA 1AKYA 3B6KA 3UH1A 3H2SA 4UHHA 4B09A 4TLBA 1QRDA 1FLVA 2OD9A 3ETJA 2FP4B 2RBKA 4LWPA 3KQNA 2YW2A 2E5LB 2VPTA 2B99A 1CUUA 3BWXA 1CVIA 2AN1A 4J0FA 4PYRA 2JFGA 2VYND 5F21A 1J8DA 3VR0A 4WBNA 2I2AA 1HA3A 1KARA 3UWDA 3SR4A 3WLOA 4YPOA 3T3MB 1X8KA 4ENPA 4G2TA 3O2JA 5CA0B 5KSZA 3NUGA 1H4VB 4IYRA 3CLVA 1HQKA 1A0OA 3ZE6A 3DE4X 2OCLA 4EKIA 5HYVA 3I83A 4IXNA 2P9ZA 1KO5A 4Z1OA 2GETA 2F43B 3T9EA 2C1EA 1JG3A 1ZOPA 2LR0A 2QG4A 1BKYA 1HF3A 2BHSA 2EYUA 3C97A 3FRHA 2BIFA 3K30A 4TTIA 4WZAA 4M0MA 5E6UB 5FTKA 2AFIB 4CM4B 3GLUA 1EZZA 1WWKA 3HCBA 1E0JA 1K88A 3HRHA 4W4TA 1ODLA 1Z56C 5CNIA 3ZE7A 4A5OA 3QEOA 5AW0A 3ZKAA 4YASA 1NVXQ 2OFPA 2I3DA 2W00A 3WGLA 2JLYA 3SHTA 4QRIA 3FBWA 4GECA 2VUIB 4KX3A 3VZPA 1MXHA 1ZN7A 1GZUA 2Z95A 4HDOB 3B8HA 1M3SA 1HE5A 1LNZA 1VKRA 2NNLD 2RAFA 2J9GA 2PVPA 5HF6A 1R37A 3WE7A 4EQ6B 5C8YB 3FKJA 2PXCA 2PX6A 1GQRA 3V4PB 2ZBDA 4CCSA 4DIEA 2JL1A 5TMBA 3VSCA 3W5IA 4PVCA 1XA3A 2O48X 4BTEA 1HRKA 5I7EA 1JKIA 5GV8A 1E6UA 2Z1DA 2ZI5A 2ZXUA 4UU1A 3E4DA 3INGA 1NT4A 3N2GA 3OM1A 4R81A 1UFVA 1ZD5A 1ZIOA 1BHO1 1INLA 1YVDA 1ZSVA 2AZMA 2DWOA 2PFSA 3AL3A 4GQAA 2I67A 3IQFA 5BN5B 3TZ6A 1R66A 4WY2A 4LSGA 3T7TA 4AWBA 4CV0A 4LJRA 2GPWA 5IBQA 1M2KA 1NYTA 3H04A 4MTCA 4KODA 1WP4A 1MABA 1QC5A 1UAGA 3DEKA 4PZPA 4BATA 5AO9A 1C5KA 1YC5A 4LAFA 3LZ6A 4XW2A 2PBFA 3P0FA 5SY6A 5CA0F 3WK9A 2IYXA 2WVJA 2ZE7A 1L5KA 4HXYA 2YL2A 1ZK0A 4D4LA 5TS2A 4W8GA 3M6LA 4WJKB 1IBRA 2ORIA 4PBTA 4DCJA 3EQ8A 1NOKA 1PWXA 3BHMA 3HYLA 4LSZA 4ZAVA 3RJTA 4FDVA 1GAXA 2VP5A 4NY1A 3DKRA 3GUZA 3I6ZA 2AK2A 2ECKA 3TEMA 5IUNC 2HC9A 3T5CA 1SZJG 2MSDB 4ZQBA 4GOMD 3GLIB 4QQFA 3HMKA 4QJ5A 1QCYA 5K8LA 5F7ZA 1OVMA 1GLVA 4F9FA 3QE9Y 4R8KA 2AOTA 2HSGA 2X2FA 1BS9A 5CK4A 1OBFO 5KINB 3BF7A 2PAAA 2VJLA 3GFGA 4P86A 1GPYA 5IM5A 3A1CA 3MGGA 4HDCA 3VNSA 1TEHA 2OKGA 4K28A 5JFOA 3LK6A 5JDCC 2AGVA 3H9CA 3C6QA 4TTQA 4ZCRA 5K09A 3NEJA 4L2IB 3ZW7A 4AY5A 3B2QA 5FNVF 2RGRA 1XROA 4WOJA 1NJFA 1TJ3A 1VLMA 2AI3A 2GSWA 2W2KB 3GLHB 4RHYA 4B3GA 4RH3A 2PANA 4PG4A 1GGVA 1ZONA 2Y1DA 1EFPB 5LOVF 1B26A 4H2DA 3FNRA 3ORRA 2IBSA 2B0JA 3BJEA 1DTWB 3IQIX 4ZXFA 3KLOA 4HNRA 2BKXA 2GTHA 2ZWIA 3NYWA 1S5PA 4N0EA 4YCMA 4CTJA 3FPGA 3U4CA 3ZJTA 2Y4NA 1R0RE 4OB7A 1RP7A 3ZE1B 5AVWA 3U0VA 1DWUA 4GBED 1MTOA 3KOMA 5DNEA 5FFFA 4GWLA 1A72A 4Q3LA 4J2TA 3QLVA 3ZI0A 2WUGA 1F8FA 5IT5A 2I7XA 2VUHB 3WAGA 2ZCVA 3VH4A 3DZKA 2C0PA 1OD6A 2FSGA 2ZSBA 3C85A 4HNAB 2GRAA 3TFOA 1R6BX 2OLJA 1R8YA 5LP1A 1D6JA 3T9AA 3VUEA 1AN9A 4LJ7A 4TWBA 2C4VA 3O95A 3QJ5A 5FADA 1U9ZA 3FTPA 3IP6A 4OH7A 5ERGB 1FS6A 2JNWA 2ZYSA 4NICA 2F4NA 2JHFA 5K8UA 5AKYA 2PZGA 1IM5A 1D8TA 1IH8A 5KNCA 2R8YA 1Z0FA 2BAGA 5ILQA 2HWKA 3EY4A 2BMDA 1I7SB 1G8KA 1KMNA 2VNSA 4OH1A 3HL0A 1EUDA 4J1QA 3A11A 1XEWX 2C2HA 5EHQA 3ML1A 3HZOA 2BGTA 4F5YA 1MT3A 5AI8A 4GOJA 4P08A 5BPFA 2ZJ1A 3QX9A 3AEKB 4J7UA 3WB9A 1I2BA 4F92B 4MPDA 2OCBA 4MLZA 3ZWQA 3VSDA 3E5HA 2QSJA 1O0SA 4KBFA 3ZWPA 5AVQA 1G6KA 1WCYA 4BNTA 4P0QB 1TKRA 1JN0A 4PR0A 1AUOA 1FJHA 9MHTA 2EKZA 4XLTA 3EOZA 4UTOA 5IANA 3B2NA 4ZO8A 5F5LA 2JI8A 3P9QA 4FFBA 2Q46A 3GUVA 1E6CA 4E08A 4ODIA 5EVCA 3M89A 3TL3A 6Q21A 4OLBA 3DBRB 2AH5A 3LVBA 2I0FA 3WRWA 1G38A 1W5FA 2WIJA 3D7SA 2ZR7A 3D5EA 1D07A 1JHDA 1FDSA 3L0PA 1VKZA 4QYMA 5EJAA 2JCYA 3E18A 4CL8A 3QVUA 3FA2A 5FUQA 5MHTA 1V25A 1FY2A 3FR8A 3HUEA 3LCVB 3T3EA 4EQZA 1Y4DE 5H80A 1UEIA 3OETA 4YMWA 2BSAA 2H48A 2JJYA 3BJRA 2D00A 1XE3A 3U61B 1I1HA 2WYVA 3JQPA 2O3SA 2QLBA 1L4GA 4RD0A 3FJ1A 2JD0A 1CVRA 1K89A 3FOWA 3GEEA 1R5NA 2NO1A 1MAVA 4KO2S 2XLBA 3FHTA 3WLQA 2X3FA 5EKSA 1IPFA 1FFHA 1T0BA 2PTHA 3L1VA 2CNKA 1QDUA 1CZOA 1K9SA 2PNFA 3EGXA 3HYSA 3OWXA 4H7JA 5EI5A 1E7SA 3QW4B 2ZTVA 5DHPA 2A5JA 3IEXA 1T5TA 4IG4A 3L43A 4PSKA 2A5GA 4KN9S 5FA8A 3EIQA 3KQHA 2H1FA 1CHNA 4IXWA 2HLDA 2JZCA 3WV4A 5DI3A 2HIMA 1Z0JA 4KREA 1PAUA 1GG8A 2DWUA 3IUYA 1B7GO 2NSHA 1YSCA 3FYUC 2AFHE 3AZPA 3K3PA 4AJ4A 4Z3OA 2VWGA 3DLPX 4U6SA 1ZCZA 1JFFB 1YR2A 3PL1A 4TN5A 3RS2A 2PD3A 3T0GA 3U7RA 2A5FA 2JGJA 2W71A 4ZYYA 1YF3A 4DV6B 5FNVA 2NV0A 4DA7A 1C41A 1QV7A 3ZIUA 4NBWA 1HYBA 1P2TA 3E7DA 5HE9A 3EWIA 1MHTA 2AEMA 4I1RA 4EKGA 4WGGA 1YZKA 1RIIA 1UOOA 1QJ4A 4JB2A 2Q5LA 3NWPA 1G66A 3FMIA 4XRGA 2LCFA 5JXHA 5KJCA 5IU6A 1IULA 5LFAA 1H5NA 3W5DA 1LTHR 3FZGA 1ZAYA 3J81A 2RH4A 3WP1B 2VPZA 1IJFA 3NT2A 1TLFA 2P79A 3REGA 4CLHA 1JXAA 3WDLA 4E1VA 4H4DA 3JAWB 4O3MA 2DAPA 3NFYA 3OTIA 4WKBA 1BXRB 3FCYA 1W36B 1TLTA 1P45A 4FW9A 5FWXB 2HQBA 3BK2A 1UZMA 1Q91A 4QARA 2D1SA 1PNOA 3IELA 5CXSA 5EMHA 1M7GA 3I62A 4QNNA 5K0SA 3KEMA 1RHJA 2IP1A 2VL7A 3G2NA 4R1TA 5G40A 5JPIA 3S1AA 3S2FA 3TKLA 5JI3E 3QE0A 3VR1A 3ACCA 1XNJA 1J21A 4AF8A 5FPTA 1W85B 1M74A 3HXQA 1Z5ZA 3F47A 2GD0A 3WMWA 1RLUA 1Z07A 1P2BA 3PDWA 2IWRA 4CQNA 3HJGA 3O83A 4AYXA 5KYGA 1PJAA 1T9ZA 3AKEA 4IDAA 4HWOA 3RVMA 2H1RA 3CF2A 4L0CA 3H2GA 3MWDB 3A6DA 3K6SA 1KDPA 1A4UA 2QLTA 3TPFA 2JH9A 2F17A 3UMFA 2Q29A 3H6GA 3SBOA 2O3UA 4FOSA 1PV2A 1ZCFA 1DCKA 3DZFA 3I5UA 4LBZA 3I9MA 3IDFA 4RV9A 3T3DA 2NQ8A 1ECGA 3KPYA 3HA7A 2RC5A 1M5UA 5IDVA 2HSEA 1WPRA 2YZNA 3DBHB 3QKTA 4Q4HB 3VOBA 5L3QA 1ADJA 2YJTD 4MLDA 2XCRB 4D0GA 3QE4A 1ISFA 1K27A 1NJ6A 1SU4A 3D0OA 2D0OB 1QAQA 3VUFA 3L06A 3EX7C 1AQUA 2P9CA 3OQPA 5G4KB 4JYBA 3UK6A 2YJ6A 1E32A 3A4VA 2Q7DA 3COVA 4M8KA 3OCUA 4V0ME 3F96A 4XVRA 2CHVA 3R5TA 3HKEA 4CKCA 4BUCA 3ILVA 3WKDA 4MV0A 3REQA 2HRDA 4TMXA 4EYSA 1R1DA 4TL8A 2V3VA 4H31A 3IKVA 2RHOA 5I48A 2ZAGA 2WWHA 5KDLA 1ZXLA 2X1VA 3MTIA 3CVVA 4HB3A 5K8IA 4DIOA 3AIKA 1JP7A 3BIXA 5TDHA 2R2GA 1OR8A 4LRTB 4ZAXA 3LY7A 4RA6B 3HYCA 2WAXA 4NKRA 1OFTA 3Q7IA 3SEAA 4UFPA 3WBJA 2QGZA 4ZOLF 2C97A 4Z0NA 1V3TA 1W88A 3IERA 4X90A 4YBZA 1KJQA 3BXHA 1VJ5A 1UM9A 3SF8B 4FFLA 4NZ9A 3MOGA 2BL4A 4TLEA 2H8GA 2PMEA 1VGQA 3FI0A 3OZUA 1MJGA 2GZMA 4LSWA 2NZVG 1JEDA 1FVFA 4GXQA 4QG3A 1FFBA 2X5JO 3EVZA 4FHGA 1L9KA 3C8MA 2CKMA 4TGLA 4FSXA 1PJZA 3V2UA 1PZHA 1QPGA 1WQ4A 2V6IA 2P3QA 4CZ2A 1NW3A 4KMMA 4GX5A 3LUKA 1XELA 2XDWA 4RENA 5EZSA 5IC5A 2C78A 3DXZA 1ENZA 4WVLA 3LDUA 4P36A 4IVNA 1UQUA 4KUEA 1OBVA 1ZM2A 2R1TA 1A04A 3ZGYA 1T1GA 4OATA 3RAFC 3UJ8A 3R4CA 4JHLA 4F8EA 5JECA 2BJVA 1YAHA 2IPOA 4J7CA 1Q92A 4A9AA 2VHJA 3EZ6A 4KH1A 1DELA 1K0UA 3OA2A 5ICSA 1JW9B 5AHKA 3F3YA 4J1SA 3W2EA 1P7WA 1G4AE 2CW5A 3TZEA 3M6FA 1QTIA 1SOAA 2CD9A 3KDPA 1SIUA 4LRWA 2FZ5A 4KRXA 4RCYA 1W8DA 3LM8A 1T0UA 1YO6A 3ZVMA 2XJ4A 4GI5A 4F5ZA 2C84A 3L07A 1U28A 3W3ZB 4YRIA 1WZ2A 4MS1B 1AU9A 3FTDA 2CYBA 2CE7A 1JAHA 2I1WA 3EZ7A 3H9JA 3W05A 5ITVA 3IBTA 4H08A 3DOEA 2QL9A 3CLTC 3GJ7A 1TQHA 2BI4A 1UBJS 4EH1A 1M1UA 2GRJA 4B81A 5BN3A 4PLCA 4BJ1A 5GTDA 2WJZB 5DULA 1WBDA 2ZBEA 3DUFB 3QPCA 2QD5A 2CJWA 1J0DA 3MYRA 2BEWA 2L69A 1TEXA 4WCFB 3L8CA 3FMVA 5JARA 3ZGZA 4F5DA 1O2DA 3OPQA 4IHKA 1T5SA 3T1OA 3LS2A 1YDHA 1EX7A 4X20A 3MK31 2XVMA 3NT5A 3OIYA 1E9DA 1MO5A 5LQCA 1DKQA 3CO0S 5DNDA 5E9JA 4M0PA 1WR8A 3RW9A 4ZOCA 3LCRA 3PICA 1KDZA 4D79A 2R6CA 4QBGB 5HRUA 4DV4B 2PGAA 2CXPA 3A9VA 3L0OA 3CF0A 3PXCX 3RAPR 3MTGA 4EO9A 3EZXA 1PX2A 1LFDB 2BC9A 2Z0MA 5ESDA 3ROTA 1BKDR 3WMGA 1GQ2A 1D04A 5H5JA 1X80A 2FPSA 4IIVA 4KIFA 5LYJB 1H23A 3VKUA 4DR7B 1EWTA 2O05A 4MVYA 2Q5OA 3L7LA 4N5HX 4XD2A 5GOZA 4UKDA 2O8VA 5A0VA 1A5AB 2AWOA 4GMXA 3RVJA 1R4ZA 4UUAA 1SOMA 1CSEE 2Y1EA 5TLSA 1ZI8A 2VCHA 3AKYA 1N2GA 4NWIA 5DCYA 5DSZA 4KTTE 1IIBA 1H0HA 1ULSA 3C8DA 4EVSA 5ARBA 2GM5A 3HWX1 5FO1A 3CLRC 2GAJA 4YT2A 2N42A 1UAAA 5I4KA 3E03A 4KQMA 2BGWA 5AOBA 5EJ2A 1QIHA 1I1OA 2FKAA 1DJMA 1QIMA 3OI7A 4WZBB 1WDLA 3V1UA 4YDQA 1D0SA 5JD3A 1LUAA 2J87A 3ZU6A 2FRXA 4CDNA 5CIQA 3ZDRA 2L19A 4WXHA 3VR5D 3R7BA 3IBCA 4F2DA 2DPMA 4Y3UA 3ZC3A 4BJ6A 1Z6GA 3LO8A 5A04A 4W82A 2CHUA 1XDZA 3BSWA 4GFDA 3DO6A 2IYZA 2XV1A 1GRNA 1KH3A 3AEXA 3TVTA 5HPYB 3TR5A 3A6FA 3C5VA 5GWXA 3SEZA 1CDOA 4AN4A 5KQRA 3EQ9A 3GRKA 2G7MC 2P2ZA 1PDWA 1TMKA 2YZMA 3PE4A 2JJ1D 2R48A 2X1HA 2X15A 2JIQA 2PWAA 2R5NA 1T4GA 3HCEA 4PXSA 1YOVA 3SDSA 2O5EA 1SWWA 2UZ4A 3FVTA 4U8GA 4GD3Q 4KL8S 5CMLA 5JSUA 2B4KA 2WNSA 2BDUA 3A1UA 1JUDA 3VPCA 4EYEA 4MS3B 2PQ6A 5TQ0B 2D1QA 2ZDGA 2XCLA 4G97A 4RD3A 2GGSA 4X3PA 1P1RA 3HXLA 2EFEB 2XUQA 3C98A 3PXGA 3K1YA 3TG2A 1VPEA 2RHJA 3Q0TA 2AN4A 5DPMA 1SKYB 2E0IA 3GY0A 1PYGA 4R9NA 5CLGA 1MENA 1R6VA 1W6RA 1CUWA 721PA 2FJPA 3A6PC 1RAHA 3GI1A 4JB8A 1XCOA 4ND7A 1KYZA 4LN1A 2VWQA 3P2IA 5IWCA 4BN5A 1JPJA 2WYHA 1TK9A 4OJNA 2OZLB 1RJFA 3JWPA 4KU4A 2BZ0A 2ZU6A 3KV3O 4NMMA 1F7VA 3ENQA 4R1OA 4YRJA 4A8JB 4JL6A 2G1UA 5I9SA 4B4WA 2IRWA 3JAKA 5DRTA 5BUSA 1U2DC 1YZFA 3KFXA 4IUBS 4UHFA 4LC0A 2FEOA 4BBPA 2ECFA 4B80A 5KNBD 3FTEA 4AYWA 5DHFA 4OYLA 2JFZA 4FFPA 5L45A 5JEDA 1PSZA 2V98A 4MWOA 1JYFA 2CNNA 3INYA 3O75A 4IIBA 4Z2AA 1N2SA 4V39A 3SJAA 1R2QA 1ZMXA 3D7KA 3WWEA 1VDZA 4HZUB 4BX8A 4BEWA 2PU7A 2YFKA 1YDEA 1PFQA 3EQ2A 3DDCA 4P83A 2NSJA 3WTCA 1H2FA 2PUFA 1JVBA 1GGHA 2QLMA 2VKTA 5F35A 3CH7A 2NXWA 3HA5A 4G0OA 1I6KA 5L6LB 3T5PA 1GCOA 1QMPA 4KITB 2GVZC 3RS5A 3U4MA 4H1VA 3IVMA 4DHWA 2BUAA 1S7CA 1BWQA 1P1BA 1JHRA 4XM0A 4IHJA 4MS4A 2I87A 1H69A 1K06A 2NSLA 4JI0B 4BX3A 3E9YA 1C3JA 1UZLA 2P4EA 1Y9EA 4DANA 5HIKA 4ZOLA 3FNQA 4WW0A 1QYIA 3V1MA 1OH6A 4MVJP 3G2IA 3G2KA 3QFTA 4PLYA 2XXAB 2HNKA 3FNEA 1TQ8A 2PPLA 4J16C 1L6IA 4K7JA 1D4FA 2WSLA 4LECA 3F6PA 1L1QA 4CPDA 1D2RA 2VTBB 1MX9A 1TM3E 2EL9A 1OV4A 2AUTA 2H2DA 2ZYIA 3VV3A 2UYYA 3TTYA 4DVJA 1EBBA 1EHIA 1TKBA 5JXGA 2P7IA 2WJVA 3EBOA 3PC2A 3DEJA 4JYPA 5DZSA 2CMGA 4Y8VA 4R2XA 2FG5A 1NI4B 2BMJA 2CLKB 1UBRS 3P8ZA 4R8VA 5SZKB 1BVRA 1FQJA 4PAMA 4CV1A 3PQ7A 5ALYA 2WD7A 4OFWA 4Y2PA 3RKRA 1Z68A 2NN3C 4FE3A 3VR4A 4BU0A 5EAIA 4X6YA 2GVNA 1QUEA 3EAFA 3B6JA 3ENKA 3OPYA 3UT0A 3I6YA 3EH2A 5FHRA 4G2NA 5B4UA 2IF2A 3UN1A 4YRKA 3G89A 1QH8A 1RHKA 4RVHA 1SCKA 1W0JA 3CNOA 2FPLA 3I42A 1JTFA 2BBWA 5FUWA 1FFGA 3PJGA 1SHKA 4X1IB 4DNXA 4C29A 4JX8A 3N2ZB 1K4YA 4AJEA 1PJSA 3SAJA 1SG9A 4TMFA 3Q8KA 1UKYA 5GP1A 4IHJF 3GFBA 1GTRA 2ZPTX 3NHWA 1CV2A 4O4JA 1BEUB 1TPZA 2Q5IA 4BZXA 4F9TA 1O9BA 1U9YA 3K6KA 2VSQA 2AG1A 1LLCA 2XYQA 1GGKA 1TVKB 5E6UA 4N49A 2XCTB 1UJMA 1RBYA 1VE1A 2WHQA 1Z7WA 2XWPA 3K0BA 4PC6A 4AUKA 2RCNA 1SB8A 3DJFA 4OGLA 3DZ8A 4QOIA 2NUAB 1RQXA 4J07A 1IBKB 1YQ9A 1CB0A 2H5IA 4V0OA 1L8OA 1SKYE 4RANA 1SKMA 5EOVA 2CNOA 2FMTA 4PPGA 2NYRA 3QWFA 1I7NA 1V5FA 2HA2A 1BX1A 2IEZA 5LBTA 3RNLA 3HXTA 2AOVA 3U80A 1C1HA 1LTQA 4G5YA 3LUHA 2FI1A 1D6NA 4CMBA 5KYVA 3RODA 1SWVA 4LDQA 1P91A 3A7EA 5SZJA 4PZ0A 3T4PA 4I1SA 3I2HA 1NC3A 1XD2B 3TEJA 4N0PA 1LRKA 1RYYA 1XCGB 1JJIA 2D0PB 2VTDA 2HLPA 4WRRA 1UBOS 1WD7A 3TW4A 2JEZA 4L72A 2V4UA 3QELA 1V9SA 2QTNA 3QNUA 4N82A 1LSSA 3NALA 4BMOB 2DFTA 1Z6PA 3TTUA 3NEPX 5DM4A 1XTIA 1XPRA 3KXIA 4UCWA 3UAGA 7GPBA 1REQA 3PQ4A 4R9VA 2A0XA 2XZLA 1H05A 4TV8F 4ZAZA 3OCXA 1H6AA 5CXXA 2QRUA 1KZYC 2OLKA 3ZY3A 5HKKD 1T0JB 4RK4A 2P90A 1N6IA 3Q8LA 4Q21A 4LPSA 1KS9A 1PL0A 2FPPA 4KLRA 3K8QA 4F2WA 2MSLA 3EVEA 4ZFNA 3G6KA 4G1FA 1Z88A 4P3NA 1NX6A 4IQ0A 4TT3D 5JSQA 3N75A 1Z5OA 3RUAA 1YL6A 1H2AS 1JPNA 1Z4KA 3G0OA 3RKSA 1B4DA 3DTVA 3PC6A 3R3VA 4HNQA 1P4JA 4NMXB 3T06B 4HNUA 5KVCA 1U7TA 1KHTA 4QVIA 1MX5A 3W0LB 3WNDA 3WOVA 4HNHA 3AR7A 4NU6A 4BFSA 4CU5A 3IB3A 4WSOA 2ZJ4A 2FNAA 4C0BA 2R8OA 1L7XA 2OG1A 4CDMA 1XNRB 5MGNA 1NJSA 1M6YA 2GARA 1TKAA 3VI3B 4DSNA 4M22A 3CW8X 1RZVA 4WTOA 2AOTB 2AI2A 2DHRA 4KXUA 3Q72A 3TSWA 2I8AA 4ITRC 2XKJE 3FCCA 4LRQA 3DE5X 4NC9A 2HO5A 1H1TA 2VXYA 4HTAA 5KWEA 1L3CA 1BU8A 2C2WA 4CXMA 4RKFA 1XTVA 4CTKA 3HA3A 2X2EA 2XHEA 3I6QA 1G2PA 1K8XB 4CKWA 2X5OA 1JWAB 1WB6A 3GJYA 3RV4A 2HK9A 3W4KA 3PEWA 5CLLA 2FEMA 4X64B 3HPRA 4X7BA 4BB6A 3BTOA 3H97A 2KMLA 4N76A 5CUQA 1W29A 1PT8A 3LXMA 5GONA 2BR4A 2XMQA 2RD2A 4AJJA 1DMSA 4DCGA 4R0VA 1W9MA 5F77A 5TQVA 5EJ7A 1CVLA 3R8XA 3L6CA 2RGDA 3QXGA 4WFKA 5DYNA 2OK7A 4MQEA 1NBWB 3A3KA 5H70A 4I8DA 2XB4A 1LV8A 1TK3A 1D4AA 4Q9IA 2OXIA 5LR6A 5JNLA 1ORDA 5AW8A 4N6OA 4ZQGA 5JDCA 5KWSA 1RXEA 2MYPA 3PVCA 1MMFB 1LRLA 1CZRA 2B1JA 4WOCA 4CN9A 5COAA 5EXSA 3FKSA 2GPNA 5C1OA 2FRDA 2XGSA 5EHZA 3VO8A 5A5FA 3P0IA 1LQTA 1M2GA 2BMWA 1KPHA 2FWBA 3DMTA 1EP1B 1NI3A 2GBLA 2W6CX 1AZLA 2DQ4A 2WUDA 1UQTA 3DAHA 3JU3A 2WUWE 1R8QA 4HNAA 4TX1A 4UEQA 2OEPA 2RGAA 4EMSA 3ZCTA 2G25A 3CKLA 3O8QA 3TLZA 5AKGA 3VV2A 3JARA 3CS3A 3GPCA 3X1XA 1QVRA 3OLZA 2Y1WA 5KB3A 2VHVA 3C1UA 4A0FA 2DXIA 2XMCA 3TO5A 1F8YA 4NCXA 4KQIA 1MIHA 2I55A 1FXWA 3PI6A 5AVKA 5ECWA 5FO0A 4JITA 2NLOA 2A67A 3H9UA 1Z4JA 5BSEA 5L4SA 3HLYA 5DE3A 1LDBA 2IYAA 2RH5A 2RGYA 2R9VA 4OXRA 4DLLA 5CD1A 2HU7A 4Q18A 1YI8A 3FN4A 3GGOA 4K2AA 3E23A 1BO6A 2NUBA 4G1CA 3MWJA 2Y1LA 3EMBA 2H7VA 4K8OA 2PUTA 3EC1A 2EFJA 3IOMA 4R40A 3QOFA 4X54A 1GA6A 4KEAA 3RS7A 4QGBA 4D9IA 4DJFC 4BQQA 4EGQA 4OA5A 2OCDA 4WKCA 3VU3A 2GYVA 3RADC 3DUWA 4HUQB 4D8VA 4AJHA 1AT1A 3O93A 1WW8A 3O9VA 3PX2A 3F4KA 5LB2A 1E96A 1ZLYA 1EEHA 1P44A 2IHYA 5DK4A 1RLMA 5ECDA 2EFYA 2PXXA 2F6RA 1AOXA 3G59A 2GI4A 1JJVA 3IVRA 2GCIA 1O54A 2XKAA 5AHRA 4DLRA 3LLUA 3IEUA 3HVRA 4XI9A 4LV5B 5ALOA 2B3DA 4MVJH 1YIOA 2CNBA 3KQVA 4E46A 4QPDA 4M1EA 4NCIA 1A7JA 4OGWA 2HJSA 3ACBA 1KQNA 1T4DA 4GICA 3E48A 1NXWA 1A8PA 2QAGB 2UUCB 4KXQA 3I1IA 3OECA 3DV9A 3IP1A 5BMOA 2VBFA 1V45E 4TWAA 3TL6A 3A3NA 5L8VA 2XVXA 5I47A 2PDAA 3HR7A 3NIDB 4KK3A 4LGYA 2Q0XA 3ZEIA 3PUJA 1HNXB 5FUYA 4OJKA 4KC0A 4WASA 5DX8A 1JPVA 1U9CA 4YRTA 3WRXA 2OSBA 3JSXA 4QVKA 4C2TA 3MZ0A 2HNAA 5EP1A 1LQ2A 4OI2A 3ZWYA 1Z36A 2IYWA 2BGIA 4OJMX 4BZPA 2CDAA 2OP1A 2WU4A 2YQ4A 2R7LA 1GNSA 3JTEA 3KEFA 3L41A 4O2BB 5IUKC 3V1KA 3JS5A 4AZ3A 5HKAA 3P20A 3RC8A 1DEXA 1GPJA 2I6XA 2V5UA 2ZRQA 1Y1RA 2OWDA 3Q8MA 1SN7A 3MPUA 2GJ4A 1A9SA 2XI4A 3MMXA 5LYYA 3T35A 2WTUA 1HL3A 4QUEA 3WDKA 4KXLA 4ZCMA 3CLHA 3N5CA 2F8TA 1RM3A 2Q4BA 3C3BA 1E6MA 2GJSA 2XF2A 1FYFA 3F5QA 3I9V6 1X8JA 3NI2A 4LNAA 3OY2A 4UMDA 3LI2A 4P9NA 1AKRA 2ID4A 4MQLA 5DDIP 1P61B 2RH9B 1Z5VA 4PYNA 3QWAA 4R1SA 4A0GA 5K3SA 3KZKA 1C4XA 3KFVA 4I1VA 2VT3A 3K1AA 4GZ5A 4PLTA 2X58A 3EG5A 3WGYA 2AVDA 1EZ1A 1N7IA 4QELA 2Q8QA 4YEDA 4CM6A 6REQB 5I7UA 2ZUEA 4XJTA 3M1AA 2I65A 1XLTC 2GB4A 2O5VA 2PKWA 1F4LA 3KZCA 3C41J 2Z5GA 5JBIA 1M34B 4KDFA 5B2FA 1AHPA 4RGYA 5AKIA 1GTZA 3WOHA 4E31A 1RJ9A 4LOAA 1ZKDA 3B12A 4OXKA 1II0A 3ICOA 1Q7CA 2Y1KA 2W9XA 4Y98A 1WX1A 2XCIA 4GLLA 3A9RA 2FUKA 4AZVA 4L9SA 1G7TA 2AF3C 3B1YA 1Z6TA 1IDOA 4JLBA 4QJIA 4TS4A 4YUAA 4C7OB 1XXHE 3AWIA 3JAWA 4KPUB 3DZDA 1Z83A 5ALNA 1CR1A 1JG6A 3QY0A 1S89A 2FDXA 1A2QA 3HN7A 1FDTA 3WZMA 3R4VA 3A27A 4C0LA 1P0MA 3MLAA 4QU9A 3AF0A 3ZCRA 1SVSA 1X1RA 3MT0A 5JS2A 2FUNB 4DCTA 8GPBA 2WPDA 1X7YB 5FR1A 5BNTA 3KQKA 3PV0A 4ZTBA 4DMRA 1HLGA 4KSYA 2KLHA 4Q1FA 4CV3A 2WY2D 3RVOA 2GVDC 5DB4A 4A36A 3LZDA 2FMIA 1D1SA 4I4TF 4UU8A 1Y33E 4WKGA 4L07A 7REQA 2X4GA 3F67A 4UPDA 1VL6A 4AZTA 2ZSHA 3H99A 1A9XA 2HHLA 3EULA 1N8NA 2KI5A 4MYTA 1I01A 2IPAB 2ZB2A 3FTNA 4HDRB 4R69A 3WSWA 7MHTA 3CBQA 5CT6A 1QU3A 2NP7A 1Z9BA 4NEHB 4QX6A 3K92A 3C1OA 4N5NA 1B6RA 5FTMA 1OGYA 2C20A 2D2VA 1U5AA 1U65A 3NDPA 4GBMA 4IZ6A 3DZHA 5A6SB 2PA0A 2HCTA 2YOGA 3FZEA 4NOJA 1BMQA 1OTHA 1F0PA 2XGMA 4LI3X 1EIZA 5J43A 2OD7A 3U4QB 2R1VB 2IHUA 3AVUA 4U7HA 3R3UA 2O2DA 3VR4H 2OV8A 4IDHA 2ZUDA 5LZ4A 1G2OA 2UDPA 1G2QA 1KH1A 1NU6A 2E4YA 2VT2A 3KR0A 3LPCA 4GGOA 4O4HB 5IK2A 4CKCB 5FLEX 4EUKA 1L4UA 1TW3A 4RPCA 5AXCA 5K2MA 3EUAA 2A0UA 3L5OA 2LCQA 3REQB 3ZGXA 4GKVA 1KAQA 1WCXA 3ET4A 4CL0A 4K1LA 3W5BA 4R54A 2CHGA 2J0QA 2HI0A 1C9EA 4O2AB 1KC1A 1H42A 3IJ5A 1XWIA 2YJNA 3KZMA 1KNXA 1SR8A 3NEYA 4UPEA 4J0GA 4RXUA 3DM5A 5C5IA 2K7FA 4FHEA 4FYIA 2G80A 2CEAA 3E1KA 4ARUA 2I9KA 3GLHE 2XYPA 3KBBA 1DKNA 1SOUA 2B20A 2PBZA 2XWBF 3GW8A 2NUTA 4DGSA 4BPRA 1KOGA 5IULC 4HLUC 2PZAA 1WMEA 3BE4A 3KKMA 4OREX 5EKDA