3BMNB

Structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor (compound ax3)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
267
structure length
252
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords Pteridine reductase
total genus 89
structure length 252
sequence length 267
chains with identical sequence C, D
ec nomenclature
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3bmnB00
1Y9AA 1UXJA 2Z1MA 3F1KA 2QYSA 2O3SA 1JU9A 3BMOA 1KEVA 1FDSA 1PS0A 3OIGA 5JDCC 3DAPA 4K26A 3ETEA 1GR0A 4CM9A 4IJUA 3PJDA 2YZ7A 5DOZA 2NNLD 3WNVA 1ML3A 2CMDA 1J5PA 5TRTA 3BXXA 5F1OA 2VHVA 5TGDA 1CIVA 1DLIA 1T1SA 1JKFA 3KLMX 1F17A 3OA0A 2UUOA 4NMHA 3U09A 4MO2A 3RUAA 3T4EA 4HNGA 3FBGA 5F3RA 3P2YA 5KVVA 3DEYX 3VKUA 3JYPA 4MP8A 3W1VA 3EYWA 3ZN2A 3VDRA 1HDZA 3HB4X 3BTUA 3IL2A 4I5DA 1SMKA 2AG8A 4BKRA 1PL8A 3EC7A 3DZJA 4K9DA 4YDRA 2HRZA 4Z3KA 3JQ7A 2FHSA 3CZMA 2FOIA 3UGKA 1KVRA 3HDQA 3A1NA 2DTDA 5CEEA 3X2EA 3F3SA 3GDGA 1EVIA 2LDXA 1E0DA 1A7KA 4GSKA 4QXMA 5AXDA 5C7OO 3IJPA 3UFXA 1UXIA 2PLAA 1HDGO 2XAAA 2YJZA 4RL6A 4UVEA 3QY9A 1GZ6A 4R4JA 3ROMA 4BV8A 2J3IA 4PCVA 1EQ2A 3GEMA 4DL9A 4YRDA 4BQPA 5G0WA 1KIFA 1IZ0A 2CVZA 3P19A 1EZ4A 1HSOA 2WEKA 3BTOA 3ZV5A 2BFPA 4PLHA 4FSHA 1V6AA 4E33A 2FRDA 3DBHB 2NU9A 2Y68A 3CH6A 5BSEA 1KC3A 3F46A 1RM5A 1NYTA 1PS8A 1G0NA 2P9CA 4A7PA 4JX8A 1GUFA 4B4WA 3DHNA 2GERA 4J3FA 3TPCA 1EUZA 3DAFA 4A0SA 4KQXA 4XJTA 5JE8A 1ZVMA 1LRJA 4U7WA 2VRCD 5EESA 5G4LA 2C2XA 3PWSA 3CXRA 1KVSA 1IPEA 3ANLA 4CPDA 5A3JA 3E9MA 5DZSA 4BB5A 1IB6A 3L9XA 2NVBA 5H81A 4BO6A 1PGOA 1XU7A 3WSVA 1SBYA 4KP7A 1Y6JA 4YJGA 4GWKA 5CEFA 4DIOA 5EERA 4OKNA 4GWGA 4RDIA 3RASA 3VTFA 4OIMA 1KERA 1A5ZA 4CMIB 1P1RA 3AY3A 3R6DA 3ROPA 1P9LA 3ROKA 4TRMA 2W98A 4YT5A 4K6FA 3GT0A 4HKTA 2H9IA 3F1LA 1C0IA 2AQIA 4DQUA 5C3MA 4CMHA 1BW9A 1D1SA 1NP3A 3ZH2A 3ROQA 1I01A 2OXIA 1YRLA 1Q1NA 4NDNE 2QG4A 3ZWNA 1ADBA 4IZHA 4J43A 3OETA 1VI2A 1PJQA 4Y6RA 3ENKA 1ZW1A 4CQMD 4CV1A 3TWOA 2OZPA 1FMCA 1E6UA 3N7UA 3DDNA 1LLDA 1ONOA 1YQGA 4WECA 2P68A 4KDEA 2JD0A 2ILTA 3GA0A 3P5SA 1QYVA 2XXBA 1F8GA 4TVOA 3PQDA 2W90A 4RF3A 5I7VA 1EBFA 3WYCA 3I9JA 1ZIDA 2DUUA 5KVSA 1NBOA 3DWFA 2EKPA 2PKQP 2BLLA 4KTVE 5B12A 3KZVA 1BVRA 4DPKA 2QW8A 5U9CA 2R00A 2J3JA 3AM4A 4GVLA 3ZNNA 3K2BA 2GD1O 3UCXA 5MDHA 5GZ6A 4BNNA 3DZFA 1O95A 4WJZA 4ZGWA 1I5RA 2DAPA 4YQZA 3WS7A 4BO8A 3ZHBA 5KJ1A 3UCFA 5I9LA 4IM7A 3OIFA 1BXKA 3PFFA 1UZLA 1HE3A 3GNSA 2ZB8A 4OOEA 4YRBA 2OUIA 3Q0EA 4CODB 3QLJA 1BXGB 1EVJA 3PHHA 1CDOA 2GGSA 3ZI0A 4Q3DA 3EGOA 4YQYA 3KSUA 3FTNA 3GH3A 4D0SA 1D3AA 1I3MA 3AM5A 3ASVA 1I3LA 4IGFA 3GEDA 2NTVA 4NHEA 2YY7A 3GLQA 1EDZA 1ISJA 1NPTO 2VUSA 1UR5A 3PHJA 1R0KA 1VLLA 2NTJA 2Q1SA 3GG2A 5DCYA 1LUAA 5JYEA 1C1DB 3OHSX 2D3TA 2X1HA 4GKVA 1RYEA 4J4HA 4XJSA 4IXWA 2FMUA 5CP8A 2EKLA 2O7QA 2NWQA 4TMFA 2ZTUA 3GNTA 4NNJA 1Z73A 1ZK2A 1ZNQO 4XB1A 4J7XA 1SO8A 1E5QA 3HG7A 3RIHA 1CF2O 1ZXLA 3ICCA 2IZ1A 2E49A 1RM0A 3D4PA 2RBEA 4NBUA 4ZQEA 1GEGA 1CEQA 3DR3A 5BSGA 3AFMA 3DO5A 3LC2O 1UP7A 2OORA 4YJHA 4IINA 4RPGA 4HP8A 1J6UA 2ZJ1A 5I7FA 1I33A 4C7JA 2D5CA 2RHRA 5I7EA 4PLVA 1ORRA 2W2KA 4RVDA 4JP2A 2B83A 1WP4A 4BO5A 1ENOA 2ZCVA 2A9FA 3LC7O 3LT4A 1AUPA 2EJWA 3OJOA 3JYNA 3WGZA 4MKZA 4FW8A 5T57A 1W4ZA 2CDAA 3OQ6A 2JHFA 4BKPA 1PZGA 5JS6A 4YAGA 5ILOA 3M2TA 4R3NA 1R4NA 3E18A 4R51A 5ENDA 1H93A 4OSOA 1AHIA 2P9EA 3AI3A 3K8ZA 4ZRNA 1YBMA 1HE5A 2B5WA 2WJPA 3AY7A 1H6CA 2P91A 4BO2A 3ZWYA 4BGEA 4EZBA 3PVZA 1BW9B 3DHEA 1PU2A 1MB4A 2RIRA 2BF7A 2PH3A 1E6WA 5T67A 2EGHA 5U4QA 3M1LA 1Y9EA 1F8FA 2CNBA 5JDCA 2JL1A 4Y6PA 4UUNA 1FDTA 3BZUA 2NADA 2P5UA 1N8KA 4U5QA 4IDCA 3OJFA 5BNFA 4RVUA 1KETA 4ZN6A 3BMQB 3CZRA 3HB5X 3WGQA 4D79A 3RFTA 2DFVA 4E4YA 1PJ3A 3Q1LA 2JCYA 4Z3DA 2WMDA 1GL3A 3OQ1A 3U49A 3GHHA 1Y5MA 1PTJA 4TROA 1VKOA 5JAQA 3SLKA 4IMPA 5FYDA 3ENNA 5CG1A 1O5IA 1X14A 4PG5A 2X5JO 1PGNA 1X13A 3FI9A 1Q0LA 2DU8A 4YR9A 2J5RA 4M89A 4B3HA 4XX0A 3P7MA 5L95A 2H1SA 2CD9A 2PY6A 3CEAA 5B4UA 1P44A 1P3DA 4YBZA 1DEHA 4CLDA 5KJ6A 4H3VA 3WFJA 3EVTA 2PGJA 3GFGA 5C37A 1IE3A 1X0XA 2NUAA 2GYYA 1TB4A 2HJRA 3K9QO 4ZA2A 3U0BA 5CDGA 1WAMA 3LU1A 4RPLA 1U3WA 1VE9A 1MA0A 1GYQA 2X5KO 1DHTA 3WWYA 1JAYA 4FGWA 5JO9A 4B3JA 6LDHA 4NQZA 3B1JA 4Q3CA 1NM5A 4ND2A 5IDXA 1B8PA 1GUYA 3NDRA 4N5LA 1GAEO 1MC5A 3D5TA 4BNLA 3E03A 3ZU2A 1N5DA 1ULUA 2AQKA 5LDGA 4DA9A 2Q4EA 4MVJG 4YACA 5L7TA 4JP3A 3W8EA 3PDUA 4RVSA 2VNSA 1NVTA 2I6TA 3KYDA 5CEJA 4M8SA 3QE3A 4BO9A 1NVMB 1A72A 1DBVO 1E3WA 1DIRA 3PQFA 3VVBA 5HM8A 4AG3A 3R3SA 4RPKA 4U6QA 4HFRA 1B3RA 3GNQA 3MTGA 2VZ8A 3JQ8B 4FBGA 5DOVA 3JQGA 2O3RA 5JC8A 4N54A 4UEJA 3ITDA 4CM9D 1NAIA 2POQX 3H5NA 3VAZA 3RC2A 2DQ4A 4HADA 2QZZA 3MJ4A 5THQA 3PJEA 1DSSG 3WB9A 4KZPA 1GZ3A 3GVIA 3QW2A 4CLRB 3BAZA 4FFMA 3NJ8A 2Q3EA 5JAZA 1E7WA 1PX0A 1P0FA 2VYVA 3PRJA 2WTBA 1O6ZA 5TSDA 3WBFA 4R3WA 1U5CA 1AGNA 3VDQA 4FN4A 1U3UA 3JV7A 3VC7A 2GR9A 4PZEA 4CLHA 3EZYA 3L6EA 3EVNA 3UW3A 4BKUA 3E9NA 2W2KB 4EBFA 5FI3A 1BHSA 3CMMA 1PJCA 3SC6A 4MIYA 3UICA 3NTOA 2CY0A 4IBOA 5JMWA 2HK9A 4TZKA 1FJHA 2E4AA 3DZKA 2C7VA 5JDIA 1YGYA 3GHYA 3VZPA 1DRVA 4MOWA 4ITUA 1YJQA 2R00C 2Q46A 2YFQA 4BO7A 4CLEA 1B8UA 2AEJA 3P2OA 3WIEA 5C7LO 1XKQA 3A28A 4MVJE 2VZ0A 4EEZA 3KOUA 3QWFA 4YTEA 5B37A 2PR2A 3HDJA 1H9BA 3GVCA 3WGOA 4OJNA 3KLPX 1X0VA 4IJWA 4FFRA 4GMFA 1EE9A 4JXKA 1ID1A 5G4KA 4B3IA 1C1DA 8ADHA 1YKFA 3OBBA 3F4LA 3RQSA 4MVJP 3RUIA 4NBRA 4E13A 3DBLB 2HDHA 1AXEA 1MLDA 4WOKA 3AWDA 2PTGA 3UUWA 4ALKA 3O9ZA 3A06A 1B2LA 4PLWA 1R16A 4EJ6A 5CAEA 3GGPA 1TI7A 1Q0HA 2TMGA 4JIGA 3B70A 3IDSA 2VWGA 3IOYA 5B4VA 3TL2A 4IS3A 4W9NC 3EZLA 5ITVA 1ADFA 1B0AA 1FF9A 4NK5A 3WLEA 3NAQA 4XDYA 4R68A 1OMOA 1GYPA 3FNEA 2VRCA 3HSKA 1OI7A 2O4CA 1X7DA 4Y98A 4H15A 1RYDA 3ZWVA 2ZKLA 4LRTB 4LRSB 4ID9A 1ISGA 3AOGA 3HUDA 5EQDA 4D3FA 5F5NA 3W4JA 2X9NA 1KYQA 2WWRA 3FF4A 3DONA 1I2CA 1R15A 2HUNA 2Y1CA 3EK2A 3H3JA 2DBVO 4OL9A 3C1OA 2J8ZA 1HE4A 2C82A 4M55A 1E3IA 1M6HA 2YW9A 3LT0A 1ENPA 4CM5A 2FZWA 5A9RA 1JVBA 1HTBA 4E5KA 4WLEA 3UN1A 4BO4A 4ALJA 2OBNA 4FDAA 1PR3A 2VNAA 3R1IA 1B8VA 4II3A 2OMEA 3PTZA 4M49A 4NR0A 4WLFA 1QXSA 1O0SA 2VWQA 3BTSA 5IN4A 1ZXBA 5ER6A 4QT0A 1EMDA 1NNUA 1SB8A 3A4VA 4KWIA 4YAEA 1PEDA 3EY4A 4AJEA 4GGOA 3SBOA 4CMAA 3T7CA 5KTKA 1UZMA 1L7DA 1AE1A 3AI2A 1Q2XA 3HDHA 1B3BA 3JQ7B 4M54A 4YJGB 4J1TA 3ZU3A 3D1LA 1QYWA 4J9VA 4UUOA 3K6JA 1QR6A 4YCAA 1CWUA 4UVDA 3MOIA 2I67A 1GUZA 3PHIA 5L51A 2EG9A 3QV1A 4JBHA 4ZQGA 3OSUA 2X8LA 3F5SA 4NFYA 3RSHA 4CMKA 4I9NA 3ZWBA 5IZCA 5TJ9A 2IYPA 1D1TA 3I83A 1W6UA 3MJVA 4BQRA 1E3SA 5EINA 2O2SA 1T2FA 4XRGA 5GZ1A 4QQRA 4GL4A 1ADGA 3N58A 1YL5A 4HX5A 1VJ0A 1UUFA 4DPMA 2ZK7A 2Y05A 3AOEA 5AVOA 1JKIA 4U6SA 4Q9NA 1GYRA 2C59A 1H0KA 3R0IA 2V6GA 2ZTVA 1L7EA 5JMPA 3ZNQA 2GZ3A 4J1SA 4XYBA 2OP0A 3GDFA 3WSWA 3GY0A 1E7MA 3TZHA 3WBBA 3G0OA 3SX2A 3BIOA 3Q11A 1R37A 3JQCA 3CTMA 1TA4A 1HETA 3ON5A 3ADPA 3JQ6A 3OJEA 3OECA 4ZRMA 4CR6A 4RV9A 4J4TA 4LMRA 5JNLA 3HDYA 2Q2WA 2PGDA 1ISIA 3K31A 1VL8A 3PPIA 4L75A 4PLTA 2OP1A 4QTZA 5A06A 2I65A 4JCOA 4PGFA 4Z0HO 1BGVA 3JD4A 4CL3A 2FPGA 1MXFA 3JYQA 2JHGA 2JD2A 2YV2A 3JYLA 2P9GA 2PNFA 3B20A 3QWBA 5A5EA 2GF2A 4XR9A 3TZKA 4BNWA 1ENYA 2VN8A 4W6ZA 3WGIA 5TNXA 1T25A 1HZJA 3GN1A 3Q2KA 5T8KA 1E7RA 5AQ1A 1JN0A 4J0EA 4ZICA 1YBVA 4ND3A 2NACA 3OMLA 3EW7A 3ICPA 5KKAA 3KYBA 1JDJA 1NWHA 2F00A 4BO3A 3ST7A 3IKTA 5TQVA 4MVJF 4L76A 1NR1A 4DQVA 1IHYA 2VOJA 3INRA 1Z74A 4DXHA 3KYDB 4ZVVA 4JJIA 3I6IA 4CMJA 3U3XA 1I2BA 1EUCA 1IZ9A 2E37A 1YONA 1E7SA 4RORA 1LC0A 4MKRA 1LBEA 4TKMA 4NI5A 5CHEA 1V35A 1EE2A 4CM1A 1R0LA 3GVHA 2E48A 4BNJA 4RVFA 2EW8A 4KUHA 3FSRA 1JKJA 1TXGA 1I36A 3DFUA 4CQLA 3QWIA 3G3EA 3L4SO 1ZH8A 3O8QA 5F1PA 1EEHA 2VCYA 2ZYDA 2DTXA 5A03A 2J5KA 2RCYA 4H7PA 4BS9A 3TOZA 3LDHA 3WGTA 3GDOA 4QEDA 1Z7EA 4XKJA 4BNYA 1J4AA 5ENVA 1MV8A 4XR4A 1DAOA 4FC6A 3D3WA 3GF4A 3DOOA 3JQBC 3MEQA 1NXQA 3RUHA 3IS3A 4MPDA 3F9IA 5G0SA 3U4DA 1YL6A 2EXXA 2NV6A 2B4RO 2D0IA 1OBFO 4Q3EA 4D45A 1Q0QA 2HRBA 3TJRA 4GGPA 3ZWCA 4RVHA 2ZQYA 4NFSA 4OHUA 1M76A 3TF5A 4AJHA 2PH5A 3LYLA 4WUVA 3S2FA 3I52A 3DFZA 2I76A 1FXSA 3HZZA 3I23A 3PYLA 1ZUD1 3JQFA 3AU9A 1AXGA 1LNQA 2GDZA 3PZRA 4IDGA 3ZZNA 3RFVA 2X0JA 3E9QA 1I8TA 1MGOA 3UOGA 1Y7TA 4KUGA 3RC1A 4FPXA 2X4GA 4WGGA 1R0SA 3VTZA 4WEOA 1DHRA 2FZEA 1HYEA 1WVGA 1PZHA 4BNGA 4MDHA 4TRJA 4CM8B 4M86A 3K73O 2CVQA 3K96A 5K6AC 5KNLA 2R2GA 3AU8A 3UH1A 4A2CA 3Q6IA 3RKUA 4BNKA 3GVPA 4NU5A 3RBZA 5DULA 2OL4A 1S7CA 2PV7A 3OQBA 4XCVA 1SC6A 2WYVA 1HEUA 1LC3A 3FN4A 5LCXA 2X86A 1Q7GA 3AI1A 3EUWA 5TLSA 1JLLA 1GY8A 1SEPA 4ZQHA 5T5QA 1BWSA 3CUKA 1FDVA 2IYOA 1UDBA 1NQTA 3FPCA 4LISA 3TSCA 4DVJA 4PG6A 1TT5B 3UXYA 3GGGA 1V3UA 1NFQA 4HXYA 9LDTA 3AOEC 1NAHA 3PK0A 3AJRA 3NX4A 3L07A 4O0LA 4A73A 2QRLA 4K28A 4DWVA 2B36A 3ZGYA 1ONPA 1B26A 4QSMA 1KEUA 2A92A 3LF1A 1A7AA 2GLXA 1GCUA 1O89A 2H63A 2YUTA 2RHCA 2PD6A 2ZB4A 2WDZA 1MXHA 3H7AA 2CF5A 1PWZA 2NVUA 4GX5A 4J7UA 1XWFA 2VTEA 4CMBA 4PN3A 2Y1GA 5L7WA 5JPIA 1HDXA 2GN9A 2VZ9A 2G82A 5GMOA 1E77A 4Q3NA 4L4SA 4E2WA 2X6TA 1Y5RA 1VM6A 1KOLA 4U8GA 3FNFA 4OQYA 3OA2A 1HLDA 4XYMA 1EK6A 4IS2A 4CM4B 4CLOA 1SEVA 3ETDA 4RZIA 4I08A 3PLRA 1C14A 5FWNA 4J91A 2GNAA 4B7UA 4UEKA 1H6DA 1CQIA 2V6BA 1KVUA 2DT5A 1B7GO 1H9AA 1YBAA 2VRBA 2VWHA 3G1UA 3TDKA 4TZTA 3OJ0A 4OXNA 4BUCA 4E21A 4RVGA 5COBA 3VKVA 2Z5LA 1VRWA 4HFJA 3ZV3A 3RCBA 1U5AA 4R1SA 1YVEI 4I9HA 5DDIP 4GMGA 4PFJA 1I24A 1LLCA 4ALLA 3RD5A 4A5OA 4UVGA 1I3NA 4IQ0A 4OH1A 1ZBQA 2V7PA 2UDPA 1U28A 4FC7A 4II2A 2HQ1A 2X0IA 1H2BA 2JFGA 3F6YA 5TT0A 1HDRA 5ICSA 2PZJA 3PP8A 1U4SA 2GPTA 2EHDA 1T24A 2FN7A 3W8DA 3WTCA 1U2GA 3RC9A 1KY5A 3RVDA 4WLUA 4FCCA 4WOJA 4AJ4A 1XU9A 2DFDA 4XGNA 5JCJD 1GV0A 4WNCA 3DB2A 2Q4BA 4BO1A 2IEBA 3ABIA 4TSKA 4XD2A 5ITWA 1EQUA 5JLAA 5T6BA 1P74A 3H5AA 3Q9UA 1XHLA 2HU2A 1DC4A 1PSDA 4L9RA 5L7YA 3VPFA 1XQ6A 2Q2QA 1WLYA 2W2LA 4I8XA 5IF3A 1C3VA 1J0XO 3CKYA 3I4FA 1K3TA 1H5QA 2WD7A 3ONEA 5CPFA 2A4KA 2EEZA 1Z6ZA 1G0OA 1EFKA 4L4RA 3S2IA 1YL7A 3E5RA 4BKOA 3RU9A 3HFSA 2AXQA 4TKLA 1P1IA 3VPGA 3KSDO 3ZHZA 4QX6A 1ISFA 5BNTA 1LRKA 3DC2A 5BSFA 3I9OA 3KV3O 3ULKA 5IXYA 3PJFA 4JROA 4AVYA 1DRWA 3U5TA 2BI8A 3SEFA 2H6EA 1PJLA 4S3MA 1M66A 2AQHA 5KJEA 3W6ZA 4XIJA 4LCEA 2IODA 4J7CA 3STHA 4XYLA 3WTBA 3C8MA 1RPNA 3DXFA 3VH4A 1W73A 2AW5A 1EVZA 1HDYA 3NT5A 4Z9YA 3CSDA 1LDMA 4WASA 1FDWA 1WMAA 1L1FA 2NM0A 1VJ1A 3M2PA 3FPLA 5ER9A 4L4XA 4HBGA 2E82A 1XG5A 1E7YA 3KO8A 2JD1A 1TLTA 5CPBA 1EFLA 3LZ6A 3TFQA 1NQ5A 4G5HA 4AJKA 3LQFA 2VTDA 4CLOB 1UJMA 1Y1PA 2EIHA 2JKVA 4XGIA 4CM3A 4NBVA 2GZ1A 4BGIA 3MOGA 2YV1A 5JCXA 5KJCA 3JCZA 4DC0A 2AG5A 2BHLA 1ZZEA 3BHMA 1DAPA 3QHAA 4EJMA 2I3AA 4WNIA 3WYEA 5THKA 2VQ3A 2VUUA 4MINA 3WYBA 3VHRA 1XR3A 3KEOA 1JAXA 1ZSVA 4XQCA 1DO8A 3DBRB 3AUUA 2EP5A 2YQ5A 5KJFA 5HWSA 4DLBA 3E5MA 1B16A 1GZ4A 1OAAA 1E1NA 2HLPA 4JBIA 4P8RA 4E31A 1HDCA 4EI2A 2JCXA 1LXCA 3NKLA 1I2ZA 1R4MA 1GQ2A 4JJGA 2YHIB 1CQJA 3N74A 2HJSA 4R1TA 1DFGA 4PVCA 5EN4A 2IZ0A 5JY6A 5I8WA 3C3XA 1U3TA 4YA6A 5JC1A 5T8KC 4LSMA 2Y1EA 3WMXA 4AICA 2GN6A 1XA0A 3LT1A 4L8VA 1JTVA 4FOSA 4MKXA 1XQ1A 3RFXA 5HTOA 1ADCA 1WNTA 3PGXA 1YDEA 3I6QA 2Y1FA 2EJVA 1ZSYA 3JD0A 2HMWA 4ONEA 3JTMA 2QYTA 2D8AA 3TZ6A 3WMWA 4D44A 4KOAA 1DJNA 1PJ4A 1E1LA 2Q99A 1ZFNA 1O8CA 1NWCA 4PIVA 5L4NA 1Y81A 5DBIA 3PYXA 4R9SA 5I9MA 1CRWG 2O50A 5CDUA 1P1JA 3KRTA 4ZQFA 3SJ7A 3GMSA 3U4HA 1A9ZA 2OBYA 4HUJA 1DRUA 4GPD1 2FPIA 4DMMA 2A35A 4UUMA 4NJOA 1GQQA 3E6AA 4J4BA 3PJGA 4NK4A 1S6YA 4RZHA 2G0TA 3E82A 1BXGA 3PWKA 3F4BA 5IZCC 4XZ3A 2OFPA 4R01A 4JBGA 3CPSA 4FJ2A 1EK5A 3TNLA 3M1AA 4ALNA 4DTIA 2C07A 1B14A 4LVUA 2BFOA 4UVIA 4AJ2A 3JQ8A 1R4NB 3TZCA 2NU7A 2QRJA 3PI7A 3W4IA 1SPXA 3D4OA 2ZATA 1P1FA 2YDXA 7MDHA 2UUPA 2FP4A 2PK3A 4W4TA 4XWYA 5DT9A 3AY6A 2Y1OA 2RH4A 3GR6A 2BGLA 1FK8A 1ZSNA 3M6IA 3RBVA 4QO7A 4ZJUA 1LSUA 1WDLA 3O4RA 3W6UA 3KBOA 3D3EA 1PJ2A 4Y6SA 4QUKA 3IC5A 3PHLA 3FR8A 1JW9B 3SVTA 3HADA 4GX2A 1Z45A 2CZCA 5EMHA 1PJTA 1SAYA 3ITKA 4BGVA 2C54A 4CUJA 4YAJA 4KQWA 2NQ8A 4J6FA 3DHYA 4F3YA 2Q1TA 4PZCA 4OOFA 4LW8A 2DPHA 3IKVA 5EPOA 3PZBA 5HA5A 3VVCA 1D7OA 3TFOA 4MVJH 2WYWA 3K92A 1GDHA 2AEFA 4JN6B 4M1QA 3GAFA 5A1TA 3MZ0A 3GG9A 3PDJA 3MJSA 1UXHA 4BNXA 4WPGA 1HF3A 2Y0CA 5DCUA 5K9ZA 1VSUA 3CE6A 4MIOA 1OZAA 3E48A 3SLGA 4XYGA 1OFGA 4B8WA 2YQ4A 2HK7A 3WDSA 3G79A 4UREA 4O59O 3KUXA 5BNIA 4ZD6A 1DB3A 1E5LA 1Y8QA 1JQBA 2I3GA 1B15A 3WWZA 7ADHA 4J1NA 3KYCA 1U8XX 4HY3A 1ISHA 1U2DA 1K2WA 4NU6A 5AYVA 4D7AA 3DZBA 3NTQA 2BFAA 4R69A 2X7HA 3QA9A 5GZ3A 4GSLA 3DBLA 3SXPA 3IUSA 3QVXA 1UP4A 3NYWA 4DYVA 2O48X 3QRWA 4MP3A 5A9SB 2EERA 4R5HA 2O7SA 4D0RA 2DBZA 4DBVO 1HYHA 2JJYA 4IJVA 1X15A 3MJTA 2VWPA 4CM6A 4IY1A 2I5PO 2ZIZA 4IDFA 3GUYA 4P4NA 5TC4A 4Z0TA 3KETA 4EITA 3Q2IA 1ZEJA 4HFNA 3DMYA 1H6AA 3FBTA 4FGSA 2V65A 1IPFA 1YH3A 1ZJYA 4CV2A 4JK3A 4OXKA 3ANNA 2PZMA 5TX7A 3V2UA 2C5EA 6ADHA 1BDMA 5A4DA 1YOVA 5IG2A 2VHWA 3FWNA 4LMPA 4R54A 3L4BC 2DTEA 1KEPA 4DIFA 1P1KA 3AUAA 4DREA 4MJLA 4WCFB 2J6IA 1PL7A 2NSDA 2HMSA 2PKQO 3IAHA 3W4KA 4CUKA 3ZDFA 1UDCA 4BNIA 4FFLA 4PLZA 2F1KA 1F14A 4NPCA 2CUKA 1N92A 4GH5A 2ZYAA 4BL5A 2EW2A 3AUTA 3H2ZA 4G81A 3U4CA 2Z1NA 3H9QA 1WZIA 1ZCJA 1HLPA 4P4LA 4DYDA 1K6IA 2DUWA 5K0ZA 2PFGA 1U8FO 1M75A 3RU7A 3WJAA 1I32A 4FJ0A 4RJTA 3I9LA 2UVDA 1LA2A 2B0JA 2D59A 3ZWAA 4OMUA 2O4UX 4B7CA 2XOXA 2NLOA 2P2SA 1ZK0A 2TMDA 4OAQA 3H6KA 1DIGA 3PEFA 5FF9A 1U7HA 2I66A 4RLHA 1WWKA 1U4OA 3WLFA 5DBGA 4DQXA 4AL4A 3JQAD 1A27A 3DZIA 3WR5A 2ZJ0A 4XRRA 4FQ8A 5A9SA 2D4AA 4I5GA 2C29D 3VH3A 1KBZA 2X58A 3SJUA 3R3JA 5DP2A 5BT9A 3FWZA 1WZEA 2NVUB 3LK7A 2YFHA 3ONFA 1DFIA 1H2HA 1VSVA 2C5AA 5ICMA 5EIOA 2ZYGA 4OM8A 3PYMA 4TWRA 5L4LA 5IN5A 1GADO 3KYCB 1OC4A 3MWDB 4LK3A 4Y9DA 1Y8QB 2WSBA 3EAGA 4Q3BA 3L9WA 3WG9A 2QQ5A 3D0OA 3WQRA 1EDOA 1QV7A 1QV6A 1UZNA 5B1YA 4W82A 3BMOB 1PZEA 4U0JA 4BNTA 2X9VA 2PKRA 4JJFA 4BO0A 2AA3A 3BHJA 5JSFA 1I10A 3BHIA 1KEWA 3DBHA 5TJHA 3OFSA 3ZWOA 4CV3A 1ISMA 1JWBB 1N7HA 2NU6A 4INAA 4O63O 1E3JA 4WEQA 2IXAA 5U1PA 1ZK1A 1E1MA 4WLNA 1SCUA 3JD2A 4RO0A 1LI4A 1R6DA 4JGBA 3I5MA 4XIYA 1PGPA 5IZ4A 3INTA 2Z95A 3DL2A 1HE2A 1YQXA 1V9LA 1NTOA 3DTTA 2B5VA 3EDMA 3TZQA 4J1QA 3QVOA 3QVWA 2B4QA 3KSZO 1HXHA 3B6ZA 3JSAA 4E2XA 1VL6A 4AJPA 2UV8A 3S1LA 4IQGA 4GAEA 1NR7A 1LSOA 2FY8A 2GN4A 3O03A 1ZMOA 3ZU4A 4IUYA 4NJMA 5AXCA 3VH2A 2UYYA 1LDGA 4YB8A 3MTJA 3BA1A 2YHUA 4B7XA 1E3LA 5L53A 1PR9A 2DPGA 2P5YA 4JQCA 1FDUA 1PJBA 2OOSA 5F5LA 5L3ZA 4BHTA 3ZW8A 2GRAA 3PHGA 4BNVA 4E5MA 3OM9A 1M2WA 3GQVA 4Z9XA 1MG0A 3OICA 1P77A 2YDYA 3WQSB 1TT5A 2FR1A 2W2LD 4E12A 4E5NA 3NGXA 3U9LA 1T2EA 1EBUA 4FFOA 4CQLB 3W8FA 2DVMA 2H5LA 2ZTMA 1LDYA 2X22A 4MVJD 2IDZA 2I99A 3KXDA 1PWXA 1LDBA 4K1LA 4KUEA 4XQ9A 3OEWA 5I8ZA 5KCZA 2IEDA 3NRCA 4NG5A 2G1UA 3OF2A 4YJHB 4DLLA 4LSWA 4WCDA 3B1KA 1XDWA 4YT2A 1OOEA 3GVXA 1CJCA 3BMCB 2EGGA 3ZV4A 1HT0A 4FR5A 5KWEA 3RKRA 4B4VA 1T1RA 1IYZA 4MVJI 1GQYA 4CR8A 4I5FA 5COQA 3WNQA 2O3QA 4CUZA 1C0LA 3VZRA 1NQAO 4X54A 4E3ZA 3Q3CA 4LCJA 4ROSA 1P45A 1MP0A 4RF5A 1HDOA 5IAAA 2R6JA 1K6JA 1YO6A 4A26A 1V3TA 4E2YA 2HAEA 5J23A 2AEMA 1YJ8A 2J3KA 5HS6A 5G0UA 2UAGA 3GFBA 4HFMA 4IZIA 5JXWA 2X23A 3CIFA 4EEXA 2LDBA 2W8ZA 3MCVA 2GN8A 3WGGA 1SOWA 3EMKA 4PG7A 1QYCA 5IFLA 3I1JA 1XEAA 3C24A 4QO8A 1BMDA 5TIIA 3IJRA 1G1AA 1RWBA 4FFPA 1QYDA 4WKGA 1YWGO 2J5QA 4IXTA 4DGSA 3JD1A 4YAIA 3COSA 4CM7A 1DIBA 3HN7A 1KS9A 3ASUA 3NUGA 1HZZA 1YDWA 3DAGA 1LJ8A 3QP9A 2OO5A 3GZNB 3I9MA 2Q1WA 5EQFA 2PD4A 3FR7A 1G6KA 1YB4A 4RCVA 2BMAA 2WM3A 2Y0EA 5LDHA 3GOHA 1V8BA 3RI3A 2GCGA 1PZFA 1T26A 3GN2A 2V6FA 1GU7A 4RPHA 5ES3A 4GKBA 5KVCA 3UVEA 3V2GA 1A4IA 3QVSA 2FR0A 3FTPA 4BVAA 5A5FA 2X0RA 3FHLA 4PG4A 3FNHA 5IDYA 3CINA 4PLPA 3BYZA 2JCVA 2AMFA 3G17A 1LTHR 4D43A 4N18A 4L74A 3GZNA 3UF0A 4RDHA 5BSHA 1RM4A 4E32A 4NFHA 4BNZA 1NASA 1A9YA 4ND4A 3H2SA 3V5NA 1ZJZA 2EV9A 4YWJA 1NFFA 3X2FA 4CMIA 4K6CA 3D7LA 2VT3A 1CERA 1UXKA 2HK8A 4NBWA 5JY1A 3RJ9A 4N7RA 4PLFA 4CJXA 2YHIA 1K6XA 3OH8A 1LDEA 4OXYA 1PIWA 3FNGA 3V1YA 4P4GA 4Y67A 1HRDA 4IIVA 2DM6A 5DF1A 4E5PA 4Q39A 5B4TA 4LVCA 1QLJA 1UP6A 4B4UA 3LVFO 1E3EA 5AOVA 1VJTA 1X7GA 5F21A 1NVGA 2Q45A 2QHXA 5A05A 3RUFA 5C7IO 3ANMA 4MIEA 1ULSA 2O3JA 2E6UX 1MUUA 1DC5A 5IJZA 1GFSA 5JAIA 3V1UA 1DOHA 5IDQA 2BI7A 3EHEA 3HWRA 3ZCXA 1YS4A 1V0JA 3RUCA 2I9PA 1LX6A 5HS4A 1F12A 4KTTE 4BIIA 1BTOA 2W4QA 1KY4A 3BMQA 3MWEB 5JCJA 1UH5A 2JAHA 3GZ4A 2FSSA 4CLXA 1C1XA 2Y66A 1PQWA 4URFA 4A10A 4G2NA 2O3UA 3HJAA 2EF1A 3ETGA 1H6BA 3H9JA 2B4TO 4Q3AA 1F06A 4UVHA 4RPJA 3WOHA 2PA3A 1CETA 3HE3A 2BELA 3H9EO 3IP3A 3DMTA 1BG6A 2PD3A 3L0DA 4Y8VA 3H3FA 3TQHA 1OC2A 4FFNA 4E6PA 3IMFA 2HMUA 3K5PA 4D42A 3I9NA 2ZTLA 5EJ2A 1LQTA 4EW6A 1N1EA 2ZCUA 4S1VA 4TVBA 1T4DA 4CMEA 4F6CA 2C7GA 2CDCA 2A94A 5CDTA 3KEQA 3DZGA 2VYVD 5G4KB 4GLLA 4IDEA 2IZZA 3ZNPA 1SOVA 2C2YA 3LC1O 2Q1UA 2Q50A 1IULA 3MJCA 4PVDA 2VYND 2ZB3A 3GC6A 2Q49A 3GRPA 2BD0A 4J49A 4F6LA 2OGUA 3ZW9A 2ET6A 3C7AA 5KKCA 3I4CA 2Q2VA 1ZMTA 3HHPA 1U1IA 4EUEA 3ORFA 4RLSA 1BXZA 5JAMA 4W99A 2FWMX 4NH4A 3FD8A 4CMGA 3OJLA 4WCFC 1I0ZA 2JFHA 2VHZA 2WE7A 1I3KA 1DC6A 3L4BA 2AHRA 4R1NA 1P1HA 1VPDA 4EUHA 3NJ4A 4IMRA 3ZHXA 4D46A 1N1GA 4GQAA 4FS3A 3IUPA 2X0NA 3BMCA 4ZQBA 2DBQA 1Z82A 2D5AA 3GEGA 5EL0A 4F45A 3PWZA 3JQ9A 1LDNA 3JD3A 2PZKA 1EVYA 4TRNA 1GV1A 2DKNA 1RJWA 1ZK3A 5HBRA 4J2HA 2O3TA 3FRJA 3HFGA 1LU9A 4G65A 3QVTA 2Y0DA 4DPLA 3GGOA 1QG6A 3ZU5A 3PIIA 4RF2A 3ADOA 4HV4A 5DNAA 4E5YA 1BDBA 2Y99A 2B35A 4DUPA 3ZWXA 3DOJA 2VT2A 2PZLA 1GPJA 3PIDA 3WX0A 3RBXA 5MGBA 4ND5A 1WMBA 1HL3A 1KVQA 1F0YA 4MVJM 1UAGA 4B4OA 4IQ8A 4KWHA 1O9BA 4D3SA 1YB1A 5TS3A 4ALMA 3OP4A 5JFOA 1H94A 2ZB7A 3JQAB 3T4XA 3NDIA 4UAGA 4DMLA 3O38A 4IJKA 1A71A 5L45A 1KVTA 2O23A 4R5MA 3JQAA 3PLNA 1LSJA 5JDIC 1ZKMA 1U3VA 4KDFA 3S8MA 4DRYA 1XGKA 2EKQA 1GD1O 4Z9FA 3T7EA 4NIMA 2VUTA 1ONNA 5L40A 2WE8A 1MG5A 4P38A 2G17A 3L6DA 4IGEA 1ZK4A 4OKIA 1K5HA 2FR8A 1P31A 2WYUA 4L73A 1TEHA 2D2IA 2P4QA 3MJEA 3DZHA 3OEYA 4OGWA 1LRLA 4QECA 3UAGA 4AJ1A 1K89A 4U0KA 1SNYA 3VZQA 3ZWWA 5A02A 5LC1A 4YRAA 4WCFA 2IE0A 3G49A 1PQUA 2BGMA 4IDBA 1MX3A 1ZEMA 1R66A 3LSYA 4QFCA 1GCOA 2NU8A 1BRMA 3PGJA 3SC4A 3TOXA 4PLGA 2JAPA 5JO0A 4XDZA 4EGFA 5JYDA 5A04A 1XLTA 1IUKA 1Q7CA 1KC1A 4E0BA 3O8QB 3RJ5A 4GX1A 1GTMA 4MP6A 2HMTA 3WXBA 4FJ1A 4PLCA 3G1TA 1LSSA 2HSDA 4FOOA 5A3VA 3DQPA 3A9WA 4EYEA 1N7GA 3DOCA 2PWZA 3D4NA 1YXMA 3DTYA 2NTNA 5BR7A 4I1IA 4W7IA 1LEHA 3LF2A 4C4OA 2Y93A 2BGKA 3DBRA 4XB2A 2HKIA 4XA8A 4LN1A 3BTVA 1QKIA 3JQFC 3JQGB 3S2EA 2YYYA 3IQDB 2FPPA 1HSZA 3ZHYA 4W7HA 4AJNA 2BFMA 1R4MB 4HNHA 4KMSA 4RQUA 4NJMB 5L9AA 4IDAA 1M67A 4AJJA 4CLRA 5JBIA 1Q7BA 1E3WB 4ESOA 3GUCA 1K0UA 5FEUA 3QJ5A 4J90A 3IIEA 3I3OA 5FFFA 1I30A 4J2OA 2VHXA 3C7DB 4PRKA 5DP1A 2JFFA 1YB5A 3C1AA 2IXBA 5H82A 2HO5A 3F5QA 1WDKA 4CMEC 4CQMA 1UXGA 2V6MA 3PQEA 1NQOA 1EUDA 3D64A 2QZ9A 3DBVO 1PL6A 3NEPX 4WE3A 1IOLA 4BNFA 3AUSA 4MVJA 4FD3A 3AW9A 4XGKA 2HMVA 1BVUA 2DBRA 4XQEA 3KM0A 4M87A 1DLJA 4YYZA 1RKXA 3C1TA 1CYDA 2B37A 4R16A 3S2GA 5K6AA 5G0VA 3BMNB 3PXXA 4AFNA 5I7SA 1PJSA 5DBFA 1D8AA 1DXYA 4YT8A 4BGUA 2G76A 4UUPA 3NGLA 4YT4A 1HKUA 4J9UE 2VHYA 1E1KA 1TT7A 3WJ7A 1N9GA 4ILKA 4UULA 3WFIA 3QIVA 3H9UA 4TRRA 3ZV6A 3I9KA 3JQ9C 5CDSA 4RF4A 4BKQA 4W9NA 3V2HA 4YJFA 1T2DA 3U4IA 2GSDA 5TT1A 1WDMA 1U7TA 2FSVA 4IDDA 4ND1A 5G2OA 3Q9NA 3E1KA 4RQTA 3WGHA 5HRUA 2NVWA 4FB5A 3DMTC 4E2ZA 1NPYA 1DJQA 1PS9A 1X1TA 4DC1A 3AM3A 3KVOA 5FI5A 1X7HA 5KOIA 1QP8A 1XCBA 1X1EA 5T64A 1A4UA 1DC3A 5CFZA 4OO3A 2OHXA 2X9GA 3RUDA 1T2AA 4XEHA 2EWMA 2AE2A 1V3VA 1JA9A 4GBJA 1GEEA 3VPSA 2C0CA 2SCUA 1LQUA 1NPDA 1QORA 3E8XA 1LLQA 4EUFA 4ZU3A 3JQBA 3ONDA 2CF6A 4AJIA 2IRWA 3K2EA 1LLUA 1Y8RA 3HNPA 2CFCA 4BB6A 3FCOA 3UKOA 4IIUA 4D3DA 3VOSA 3C85A 5CDYA 1WW8A 2QIOA 4TQGA 4BMSA 3NV9A 1UDAA 3C7CB 3D5QA 1D4FA 1AHHA 2XF8A 4F46A 1GPDG 4E30A 2AQ8A 1Y8RB 1IY8A 4XYEA 4GX0A 4C7KA 1DDOA 3H4VA 1C0PA 2XPCA 3RROA 4NZ9A 5COAA 3K30A 1NX6A 3QQPA 4WLOA 5F1KA 3TRIA 2C20A 4AJLA 3V8BA 5KVQA 1YQDA 1T2CA 4CV0A 3LLVA 1VL0A 3WQQA 5ILGA 3V1TC 4DIBA 1U9JA 1NFRA 1WPQA 4GLOA 1QSGA 3H8VA 3GPDG 1NHWA 4FIZA 2GASA 1XSEA 2CVOA 4EDFA 1XELA 2Y67A 1E92A 1DIHA 3GRKA 3PFWO 3B1FA 4N5NA 4R1UA 3VZSA 3GAZA 4CM4A 1JWAB 2J3HA 5DCWA 4BMVA 4D41A 1O94A 2GO1A 2RAFA 1MFZA 1E6EA 3QSGA 3QWAA 2BH9A 4QFDA 1QLHA 1PGQA 4RGBA 3GPIA 2WD8A 4N5MA 3VPXA 4PG8A 1TVEA 3D3WB 3TN7A 5ADHA 4P22A 1YE3A 3H9GA 3KHUA 4OQZA 4BNHA 1C0KA 1N9GB 3JQEA 4GVXA 3RUEA 2YV3A 5IDWA 3GMDA 4A27A 5L4SA 3INGA 3GK3A 2RH8A 3KB6A 4R41A 4YVFA 3UCEA 4HWKA 1PQPA 1P0CA 1HWYA 3LLSA 2Y1DA 2G5CA 4Z6KA 3WICA 1MC4A 3VH1A 4YJFB 4IPTA 3KTDA 3HQ4O 2QRKA 3UHAA 2VOEA 3WIDA 4UEOA 1VC2A 4H16A 1M6WA 3NT2A 4WLVA 5KIAA 5IXSA 4O6VA 2NQTA 2HCTA 4B8ZA 2CDBA 2DLDA 3ZNOA 3NDJA 1NHGA 3F47A 3O26A 3BMNA 1Z75A 2VYNA 3S55A 5BQFA 1T4BA 3NT4A 4OYRA 1QMGA 4WK6A 4CM8A 1DPGA 1C1XB 2BKAA 2GUGA 4CQMB 1DFHA 1YOVB 5H83A 4BNUA 1JVSA 1UAYA 2O2YA 1E7QA 4B79A 4BV9A 1QYXA 4I9UA 4JLWA 1MFPA 4LGVA 4O1MA 4YEDA 4PLYA 3L6OO 5I9NA 4I5EA 1DIAA 1QRRA 4CL8A 2GZ2A 3AK4A 1P33A 4L0QA 1SB9A 1HYGA 3RC7A 3IP1A 3JQDA 3H5RA 4YPOA 1IHXA 4NBTA 5A9TA 1PGJA 1SZJG 3RWBA 2XXJA 1ARZA 1N2SA 5GY7A 1AN9A 4DLAA 4YJDA 4BNMA 5DN9A 1VKNA 1XYGA 3AFNA 2ZQZA 4EJ0A 4R9RA 4AJOA 2X5OA 1Z7BA 2AE1A 3JYOA 4PRLA 4PZDA 3ZWMA 1RM3A 5AXBA 4ALIA 3H65A 2D1YA 4CR7A 3HN2A 4J16A 4DBZA 4ZHSA 2WD7B 2PGLA 4YAKA 4OSPA 3ZWPA 1IL0A 4BOYA 3OIDA 3RAJA 3VPHA 5G0TA 3CMCO 2B69A 3LT2A 3U62A 5TF4A 3QWHA 4A03A 4BMNA 4YXFA 3WGYA 4GI2A 3NTRA 8LDHA 5AXAA 1R12A 1W8DA 4Z0PA 5CG2A 1ZO8A 1J49A 4CMCA 2EP7A 5C5IA 9LDBA 1W0CA 4O5OA 1BSVA 1XIVA 1WXDA 4J0FA 3A14A 3L77A 4JNKA 5JW6A 2DC1A 2BRUA 4XQGA 1ENZA 2P4HX 2CSUA 2QX7A 3TL3A
chains in the Genus database with same CATH superfamily
1X7XA 1Y9AA 1BS9A 3F1KA 5IBPA 2GUWA 1QO7A 2QYSA 1JHMA 1U9YA 1JU9A 1ZH6A 3IDQA 1WB4A 3GPBA 4EFLA 1FDSA 1PS0A 1ECJA 3OIGA 2OO3A 4OMFG 4Q1EA 3QE4A 4XD7D 5AI5A 3LUGA 2PUCA 2A9KA 3ZCTA 3ZHSA 2H5JA 2WTNA 2VQDA 4IJUA 3PJDA 4OQPA 2E5FA 4FZRA 1EYZA 2BIFA 1F9EA 1ML3A 2IS6A 3FI0A 1P4SA 2AMVA 2R8XA 4C4RA 1R64A 2VHVA 5F1OA 1GPKA 4JV5B 5HKLA 3FLEA 1C7JA 4XGQA 2H7YA 3WAJA 1PW7A 4NMHA 4ZEOA 4MO2A 3VC3A 3BCSA 3T4EA 5LQKA 1UPUA 2JFUA 4HNGA 2B1IA 3QEAZ 3FBGA 5ED4A 1IN1A 4HD8A 2BM8A 2G0NA 3HHEA 4QOJA 3JYPA 1C4KA 1R8XA 4MP8A 3HV2A 3W1VA 4F2DA 3BTUA 2NSHA 1E0SA 3FNRA 1WE2A 2VDPB 4C0BA 5CFLA 4I5DA 2PUTA 2FSFA 3TIFA 5HIAA 2VJPA 3E0QA 2G36A 4FKMA 2Z2IA 3NS7A 5HW0A 2D00A 2HRZA 2VYCA 4QICA 3HCPA 3OPYI 5KYTA 2OVBA 1KVRA 3A1NA 2BEUB 1VE5A 1JA0A 1RLMA 2CLSA 4JLDA 4LSGA 1D0SA 1G8PA 3X2EA 5CEEA 3IT3A 5B1EA 3GDGA 5EP1A 5LYJA 3UJPA 3SE7A 1KU6A 1ZMBA 1JHPA 2QXTA 2YN2A 3HL4A 1OREA 1OX4A 4QODA 4QXMA 1T5TA 1KMIY 4PRZA 5HIMA 4LF7B 3R9WA 1Q3HA 2B1GA 4K2HA 3EIFA 3IJPA 2VHJA 5BQ3A 2D62A 2PLAA 3G6WA 4N7MA 2EDCA 2GYUA 4WL0A 1ZD4A 1ONBA 2V7VA 2YQZA 3UFBA 1Z88A 4R4JA 3ROMA 2BGNA 1EQ2A 1L5SA 4BQPA 4KR0A 1Z38A 3RIGA 3ID6C 4KYTA 5EE3A 3T0FA 4EHKA 4HT3B 2WEKA 2C78A 5C2JB 2AD5A 3HYCA 3BTOA 4U7GA 3BM5A 3OTHA 1WQ1R 2VP5A 4OGLA 5KQGA 1EGQA 5DWVA 4BWGA 4EY8A 3FF1A 1S9HA 2GYWA 3QVGA 1NVXQ 4FSHA 2ZBFA 1AJEA 3C8HA 3B8EA 3F6EX 4MV4A 2ZRHA 3IELA 2GFHA 4FWBA 5BSEA 3F46A 1UPXA 1PS8A 2I87A 2P9CA 3ZS9A 4W7SA 3T3OA 5BQ5A 1E69A 2JKYA 3LWZA 4GG1A 4JX8A 1MQSA 2YMPA 4RJKA 4EB6A 1QQBA 3NW9A 1V7QA 2ZSUA 3FKJA 5EJIA 3DHNA 3DWEX 5C8YF 3JR3A 4HL6A 3TPCA 1QHXA 1E2BA 4XJTA 1PFYA 1ZVMA 4TXLA 5KNBD 4PW0A 2MU1A 1C9DB 2C0QA 2O6LA 4GOKA 2M1ZA 4LYAA 4TQ9A 5J1TB 2H2IA 3A2NA 1QU2A 1WBDA 1VCMA 1IPEA 3PC7A 2HH9A 1U8TA 3T5AA 4JYCA 1DO0A 1WSWA 3E9MA 3F7MA 1DOZA 1T8UA 2J0VA 3L9XA 4O25A 2W6ZA 3HZHA 4JDPA 3KQLA 4ISCA 5IJ0A 1QANA 2RGXA 4GQIA 1Y1RA 1U2TA 4MRPA 1N2ZA 5ARCA 5CEFA 2CLKB 4S05A 5FR1A 4DIOA 1Z0UA 2AVDA 4R2IA 1GSIA 2WT9A 1V8PA 3IAUA 3LPDA 2LGJA 3S44A 2CNKA 1Q11A 1DTSA 4HMOA 4DDWA 4L4ZA 4JLAA 4BPBA 3ROPA 4MYCA 2YZ2A 4TRMA 2P2GA 2RD2A 4UXHA 4G0UA 3AJ9A 3K0HA 2PJUA 1FFEA 1PNRA 4OAPA 4QHSA 4NMMA 2B8EA 1PR5A 1Y1QA 4CMHA 5C3MA 1D1SA 3ROQA 3AUFA 1E89A 2ZDHA 4M6WA 3GJ7A 2A5JA 3HU5A 1YRLA 2ZJ4A 2HT1A 4C6HA 1NW4A 4C2UA 2YWEA 2G9NA 1RWPA 4UCFA 3OETA 3ZLUA 1JHUA 1L8LA 1VI2A 2CUNA 1EVLA 4ZXFA 1A5TA 1ZW1A 2ZT8A 2IHUA 4RMGA 1B6SA 2AF4C 3PRHA 4CQMD 1NNEA 2V7EA 4MR8A 4RADA 3HB9A 2IUUA 2RK6A 1XMIA 4ENWA 5CA1F 3KSAC 1E6UA 2C42A 3N7UA 4EA7A 2BH2A 2V6IA 2VJNA 3RS0A 4GSYA 2IEGA 1ONOA 5BOVA 1YQGA 4MUGA 4WECA 1IN7A 4EHLA 3UJAA 4BECA 3EA0A 4KDEA 1J22A 1HPLA 3P5SA 5HP4A 1B0UA 1YR1A 1QYVA 1VMKA 1NQVA 4FMCB 4QNMA 5SY6A 3S28A 2HW8A 3R2JA 5E7QA 5EE1A 3T7KA 1GSHA 1TK3A 4D98A 3R9KA 2GBFA 1KGSA 2EQBA 4W8GA 3LPMA 5E6SB 5KTPA 1KJQA 4AMVA 2WSYB 1K7XB 2C8JA 3IIJA 4DA4A 3JZAA 4Q9IA 5B3JA 4GVLA 3ZGXA 1I4EB 1T8PA 3ZNNA 2PX6A 3BG5A 3BBLA 4BNNA 2HZBA 4I4NA 3WGLA 1TM1E 4ZGWA 5A1JA 2DAPA 4YQZA 1TUEA 3K53A 4WRRA 4ZYXA 3WS7A 4QVGA 2A0YA 4YAWA 1A1SA 4Y2JA 4IM7A 3ZE1B 4JAVC 5BOSB 1GLVA 1H4VB 2GEBA 4KV9A 1UZLA 2WUDA 1G5HA 5K6RA 4YRBA 1SC1A 3H0EA 3Q0EA 3A6HA 3TCNA 1FY2A 1PKEA 4QJ5A 4JR2A 4C1NA 3WLAA 1M2VB 1Z3CA 1DC7A 3ED5A 3M5PA 3MS2A 3ZI0A 2CHVA 4NCBA 4Q3DA 2XRZA 3UHFA 3DCNA 3KSUA 4P5EA 3EJWA 4W1PA 4BFUA 2WTUA 2AFHE 1CY8A 3CRZA 1NPTO 5BRNA 5AM2A 2J9GA 1VRVA 5IXJA 1E4VA 5JYCA 4GM4A 1U0JA 2QN6A 1LUAA 4OHXA 1VPTA 2X5XA 4QLOA 4CG0A 2D3TA 1WA5A 4GS5A 1QGOA 4IIJF 5DHAA 3COVA 4XJSA 1L4EA 3KV1A 3NKVA 5KSWB 2O7QA 1D2EA 2NWQA 2ZTUA 1MAHA 3HA7A 3EXHA 3M4XA 3SHQA 3WLHA 4AU1A 1Z73A 1ZK2A 2J08A 5IYZA 4KAFA 4X1IA 1G6OA 1O94C 1SO8A 3HG7A 5CR9A 1CF2O 1UJCA 3V4LA 3ZBPA 1P6UA 1BOFA 1W4AA 1Y3IA 2P1ZA 3C43A 3FFXA 4QFMA 4D8VA 3EIUA 3C6ZA 4DT1B 2G63A 3AHEA 1SXJC 4PONA 4TTTS 1GRRA 4ZQEA 3KELA 3W5HA 1OVMA 4HB0A 3QH4A 4GOXA 1K4MA 3MTDA 4HGPA 3EUAA 3LC2O 5IAEA 2OORA 1LK5A 2P0AA 4RPGA 2JLCA 4Y9UA 4YRCA 2HF7A 5I7FA 3P8ZA 1CF4A 3G2LA 4NEGA 3D1VA 2YS7A 1ORRA 1RHKA 4ZO9A 2QUBA 4JOBA 4JP2A 3ZIUA 1TJ4A 1HO3A 2QWXA 2QR2A 2A9FA 4ZPXA 3SC2A 1JHRA 1G1MA 5DYNA 3RVPA 4DCNA 4M22A 4UPVA 1TEZA 1E6KA 3N86A 3ND7A 3RG8A 2DULA 2GSWA 2CDAA 4JYBA 2R79A 1ZUNA 5AVKA 4MAFA 2BFEB 3FBWA 1RACA 5IHXA 4BX8A 1ZH4A 2XD4A 4FEEA 5F7JA 1W47A 4ES6A 4MR9A 1LBQA 2WSIA 3B5EA 4PU0A 4Z53A 2P91A 2WFMA 3ZWYA 4F1WA 4BGEA 1VIMA 1BW9B 3DHEA 2W6PA 1WCYA 4JVNA 2GPAA 3NC4A 4R9NA 5FOUA 5FOXA 3W04A 4P4SA 4PGMA 2QAGC 3FNIA 4XWKA 1L8XA 1A96A 3OPXA 1Z4NA 5H7XA 4M46A 1UL1X 5U4QA 3M1LA 4DLRA 5DCLA 5E1BA 5B58C 3LQ2A 4AZ3B 4D9MA 3MPUA 3USES 3VPAA 2NADA 1E9AA 3LM8A 4K9OA 3NIFB 2W2VA 4XJXA 4ZAYA 5IBQA 4ZN6A 1R6XA 3BMQB 1FS4A 4ZVQA 5IKOA 1OXSC 1IOWA 1Z0KA 3RFTA 3IJEB 2VDOB 3K09A 3L1KA 1PJ3A 1FQOA 3Q1LA 3ZLTA 4LXGA 3T15A 4Z3DA 1MVOA 3EGDB 3LAWA 3Q7RA 3C6BA 4RHYA 4TS4A 1EG7A 2CNOA 4IMPA 5FYDA 1O5IA 3WRXA 4H3HB 2OHJA 1PGNA 1OLXA 2ZBDA 2XUPA 2J5RA 2O2GA 3U3ZA 4X7PA 4BYMA 2H1SA 2NO7A 3CEAA 3TD6A 5B4UA 1KJWA 1H3NA 2BMVA 4JOQA 1P3DA 4CLDA 4CZ2A 3W5CA 1NRIA 5C1BA 5M29A 3WLTA 2HNBA 3RGGA 1MD9A 1GUBA 2PGJA 3VNSA 1XRSB 4MJ3A 3GLSA 4XDGA 5FOQA 1FNMA 5CNKA 3H5WA 5FCDA 3MGGA 4AF7A 3U0BA 5F73A 5EWLA 3FVRA 4YCCA 4BP8A 4G0VA 1QB8A 1U3WA 2G40A 2WSMA 3AHHA 4RX1A 3V9AA 1NUAA 1SD5A 5EXTA 5KYGA 3O1JC 1JAYA 2UYQA 3KEFA 1KYIA 2P79A 4PRYA 1NM5A 4ADSG 4DR1B 1X9GA 3TW8B 3DEFA 2DPXA 3D5TA 3Q9LA 1MZVA 1RRPA 1A97A 3E03A 3ZU2A 5LQRA 2AQKA 3CW2A 3TTYA 3I4LA 4DA9A 2BPOA 3O2SB 4XLZA 4IIXA 3TQQA 4UC0A 1BE1A 4JT4A 5LP6B 5L7TA 5MFZA 1J00A 2ZVJA 2I6TA 2J07A 1VMIA 4D9CA 2QVBA 4BO9A 1A72A 3U7HB 1H4SA 1E3WA 2VKTA 3QBDA 2P9YA 2OUKA 4G63A 5DHSA 4B5KA 2FSHA 3A58B 4HWPA 4Q9AA 4U6QA 2KX7A 5ESXA 5JMTA 3DMHA 1MHPA 3TECE 1U0FA 3LTNC 1VLZA 4FBGA 4QOIA 4MW2A 4FYYA 4AWAA 2HHLA 2X1LA 1X9IA 5LYYA 2O3RA 2L2QA 4QTXA 3M3PA 2VZLA 3LCVB 4CCWA 3VNQA 4UEJA 4V38A 3ITDA 3LVQE 3LUCA 4TMVA 2V45A 4LKOA 3D4BA 2OSVA 5E9WA 4F6RB 9GPBA 1Q22A 1WBBA 3MJ4A 3VO1A 2OBFA 4NCNA 4JUIA 4KZPA 5P21A 4PQGA 2JKZA 3BAZA 4CLRB 4D8TA 2AG0A 1KSHA 1AVTA 4GOMD 1L4BA 4TSRA 5HFJA 1X39A 2VA8A 3S68A 1VHLA 4WUTA 4ZAVA 4ERXA 721PA 5BURA 4NAUA 2HU5A 4FN4A 1U3UA 5ILQA 3CNOA 3D2BA 4CT0A 4QJ4A 4F21A 2GR9A 2PA0A 4PZEA 1E9EA 4MLPA 1W93A 1G98A 4GLJA 5F2OA 4PX9A 3UW3A 3QBEA 2FPOA 5B3JC 2IHTA 4EBFA 4IDNA 1BHSA 1XAHA 5HRAA 2PAAA 3V4ZA 1YB2A 3BE8A 4JJAA 4EGQA 3UICA 1RIFA 2BM9A 2CY0A 3KQYA 1FFAA 3CLRD 1V5GA 4KW7A 2FW9A 2WJWA 4N3CA 2O14A 4TZKA 3DZKA 1AY0A 5ALOA 1V37A 2EFGA 2CE7A 5EOVA 3GHYA 3QVLA 4D4LA 3KQHA 1IUNA 4L72A 1Y1KE 1FYWA 5DWQA 1FMFA 3SJAA 1K3UB 3LCRA 3V32A 2N46A 1XWWA 2IGTA 3I2HA 3MD0A 2ZWPA 2D5LA 1E6MA 5DRTA 3VSBA 2AEJA 3ROXA 2CE2X 3PD0A 4KR9A 3NPAA 1M72A 1YRWA 3M1IA 1FUUA 1OYWA 3EVCA 4G26A 3I39X 4MVJE 1AKTA 2BHRA 2XUGA 5C5EA 5CBPA 3TLYA 1FB5A 3GVCA 3KDAA 4MA5A 4OJNA 2WRZA 3KLPX 3NORA 2PHZA 2ZUTA 3TSZA 3WGOA 4RIHA 4BUJA 4AKSA 4F4CA 4JXKA 2WKRA 3IKMB 4QU8A 1PT5A 2PH7A 1WU8A 8ADHA 1SZCA 3OBBA 4P3NA 2ORED 4MVJP 5JANA 4ATNA 2VG8A 3D6VA 3DBLB 1RBMA 1MLDA 3LLCA 4MJ7A 4WOKA 5AM0A 4L27A 2VSFA 1RWMA 2QQ0A 3C97A 3A06A 4P35A 4Q9DA 5E0OA 4CF5A 5AW8A 4BLWA 1FXUA 4KYUA 2TMGA 1VCHA 2Q5JA 3GAMA 5B2FA 1GQRA 1SUDA 3QOWA 2WK1A 3UMSA 4CCAA 3TTTA 5M34A 2PJZA 1QOPB 3EVFA 1XCPA 1GJRA 3BF8A 4R71A 4GDFA 2O57A 1XMQB 5EVJA 1VJRA 5BQPA 1AK1A 1XRJA 2O2IA 2PEZA 4UZFA 1SC3A 3NAQA 1E3DA 4CEJA 1OMOA 4BFLA 2G08A 1U6JA 2EGUA 2VRCA 3CG0A 4FTWA 3TE7A 1USIA 1FSSA 4ZZ3A 3OMXA 4C43A 1USWA 1EFVB 3U60B 1UODA 4FK8A 2C2KA 4I1YA 1YC2A 5LOVF 3MUEA 5AIAA 5E1MA 3U7FB 2C92A 1SBZA 1QFJA 3QX7A 2R7KA 4UHFA 4CRWB 5L4SA 2NNWB 1XO1A 2PQ0A 4I6GA 4DMUB 4U7JA 4F4JA 1YT5A 5JECA 2QAGA 2J8ZA 3ZWKA 1WKBA 1QAQA 2AXEA 2OY0A 1SKMA 3NIBA 1IOVA 2I29A 1XAGA 4I99A 3RAFC 1JE1A 4KQHA 1F2UA 1A9QA 4M7OA 4WLEA 3UJCA 2WKQA 2OAEA 5BXQC 4BO4A 4WZAA 1CR2A 3FVWA 3K35A 1L1EA 2F62A 4GRDA 3F73A 3ROZA 4B75A 1L0BA 4QNRA 2X8JA 1B23P 3HR7A 2PPLA 4P82A 1N4AA 4D97A 1MR3F 3FOWA 2A9PA 2NUTB 4ND7A 4NR0A 3T3MB 3M9WA 3CEJA 1EFVA 2Q9CA 2CB9A 4RVOA 2KSQA 4UHHA 3O8NA 4WLFA 5EFZA 3AFGA 1X80A 1T8RA 1ZXBA 5IN4A 3QNMA 3EZ7A 3RS8A 4CWAA 3A4VA 1WY5A 4MV6A 4KWIA 5K3FA 3AR8A 1XKTA 3H11A 1JIUA 4JEUA 1L5FA 3E8MA 4I3HA 2NPOA 2CBGA 3T12A 1Z5ZA 3SBOA 4UU8A 1UZMA 3AI2A 1CUDA 4JI0B 3VR5D 4HS9A 5FBZA 3ZU3A 3F49S 1OFTA 1RLOA 3RVSA 2Z9CA 4ZT2A 3ZE0B 4Y2TA 3U13A 2I8AA 3LV8A 2HLNA 1QR6A 5J5AA 1CWUA 4O02B 2VK1A 3MOIA 1MC1A 3B13B 3PHIA 4P33A 5L51A 5MGNA 2V3CC 4IWXA 4I36A 4ZQGA 4JVLA 2AI3A 2XNDD 1KFEB 4KYVA 3TOSA 1M1YE 4NZPA 1QCZA 2QV0A 5C1DA 3KS9A 2G72A 5IZCA 2IYPA 1SR8A 1Z5PA 1QAOA 4XIGS 2ALJA 2K5UA 4AWXA 1E3SA 5GZ1A 2G83A 3FDZB 5DN6A 4A15A 5ELMA 4HX5A 2NTEA 2AN3A 4Y7CA 5HIKA 3IYLW 3FYDA 2ZK7A 4P7GA 2XDWA 3LXMA 5L3QB 4Q9NA 5AVQA 2Y0PA 5LQDA 3H13A 1GYRA 3WYAA 4UTNA 3N87A 4C01A 5JTUA 1YR2A 8AT1A 2ZTVA 3AHFA 2G77B 5D8DA 1P2VA 4MMXB 2W8BB 2GZ3A 2JFWA 3GJSA 1RKVA 3ORRA 3ZNQA 4YLEA 4W1SA 1KU0A 1Q0UA 1HQYE 2C5SA 3GDFA 1SHLA 2IC5A 2JFVA 4RA6A 1E7MA 2B6NA 2R87A 3R75A 3WBBA 5HJ7A 3SX2A 4PZAA 2WP8J 1SUAA 3TDMA 4D02A 1Z5UA 3JVDA 5AM4A 4EABA 4XIFA 1TA4A 1G60A 3ON5A 3ADPA 2VDRB 1NN1A 4J0KA 3TRFA 1MOSA 4J4TA 2X3UA 4RV9A 4LMRA 4D3XA 3HDYA 3K31A 1P9NA 2PLFA 4E1VA 4L6IA 3MUFA 2Y27A 4KRXA 2BR3A 4KX5A 3W90A 4QTZA 5IT4A 2NU6B 4ZYWA 2XSZD 3PDWA 5CRIA 1HNNA 3HRHA 1KIAA 4Z0HO 3CE9A 4ENTA 2PTHA 3NCHA 4Q9KA 4CL3A 1MXFA 3V80A 1QU3A 3EUEA 1XL0A 4EMSA 3U2QA 3D4LA 3UMYA 3B20A 4U2CA 1QPZA 2WIGA 3ACBA 1UM9A 3E1GA 1PDOA 2GVNA 1NW5A 4XR9A 1SC9A 2WJVA 1AGPA 2Z3VA 1QV9A 5T8KA 5AQ1A 4WVFA 2AZXA 5LU9A 1UZAA 4J0EA 4KBGA 3HKEB 4M8KA 4ND3A 1IN6A 4IQ4A 4WT7A 2GKSA 1A4RA 3OMLA 3ICPA 3WGMA 1IRIA 4MV9A 3KYBA 3OCZA 1M1YA 5T3UA 3TQIA 1JDJA 2QRQA 2Y92A 1CRLA 4NENA 5KYXB 3J80A 3DAHA 1UAAA 1QIMA 2P2DA 4ML3A 1EBBA 2QMQA 4A0RA 1IHYA 2VOJA 1L7VC 1NBMA 2F43A 4ZVVA 2WSSD 1ZI6A 5DK4A 4JJIA 3I6IA 5DO9A 3ZI7A 1XVIA 2JK0A 4D3ZA 4HAWA 1N3IA 1R4ZA 3BIXA 3EF1A 3CB4A 1F20A 4TKZA 3AG5A 4JOSA 3SFZA 1FU8A 3QEMA 3UATA 4MKIA 1XXLA 1YONA 3E15A 1LC0A 1LJLA 3IO5A 4G4IA 2VF8A 4R2LA 4Z7NB 5K2OA 3K9WA 4MKRA 4RZ2A 1STOA 4B7AA 1XTIA 5CHEA 1Y7HA 1V35A 1EGVB 1EE2A 3UWMA 4CM1A 2JDID 3LP8A 4IGKA 3RDPA 2GEFA 2EW8A 1LW7A 1OAKA 2XQGA 1JDUA 2AN9A 4KUHA 2A5FA 3DFUA 4CQLA 2W00A 4CIVA 5CFNA 4HQNA 3W0LB 2AFIA 3TRJA 2H51A 2Q9BA 2GCNA 2C9DA 2XMDA 4P3KA 3I2IA 3W7BA 4RTJA 3TOZA 1YMQA 4KFRA 2IOQA 2P62A 4HLNA 3WGTA 2BGRA 1LQ2A 4RLFA 2CYCA 5FJJA 1C5KA 3GDOA 3RSCA 1SU6A 4QEDA 3GCZA 3P26A 1GVHA 2KMLA 4AYTA 1ZU5A 2IYUA 3QEMB 1MV8A 4BNYA 4CKCB 1A9XA 1RHJA 1YIDA 2VPZA 3EBOA 4MS3B 1YTLA 2EP8A 4AZ0A 4EG4A 5CH3A 3FNQA 3GF4A 3FDXA 3JQBC 2IYTA 1NXQA 3BJRA 4MPDA 4GPEA 1H9CA 2BEWB 1YL6A 3CUEF 1WULS 4G5GA 2HB6A 4Q3EA 1S3IA 2ZS8A 4GM1A 2XIQA 4H1UA 3TJRA 4BRZA 2IZ6A 1DQZA 3QM1A 4NJEA 3AR6A 1LCIA 2GHIA 4LUCA 4GGPA 4XWWA 4RVHA 4BLVA 2VH2A 3NOVA 4NFSA 1KO7A 4YP9A 1CLUA 1YI8A 2FE1A 4OHUA 1DAGA 2QM3A 3TF5A 4AJHA 1VG1A 1P5RA 3ZDEA 3N5CA 1O8BA 4KL8S 1SULA 4WUVA 1XOIA 3I52A 3BE4A 1BVHA 5CVVA 3L06A 4G1FA 1QQTA 4PBTA 1KR2A 4W9RA 1AQYA 1LNQA 2GDZA 3PZRA 5F1YA 3C3JA 3EWNA 3R5HA 3RFVA 3ENZA 3EVZA 2ZIAA 3MMPA 3RGWS 2HXGA 4C20A 3OLZA 4QIHA 1BKSB 1POXA 1XZFA 3WV5A 3UOGA 1CZLA 1ZW6A 3RC1A 3T1HB 3VUEA 3GJ0A 1R0SA 3LK6A 2Z0MA 4WEOA 4Q24A 1VGRA 1E2FA 3RVBA 1YZ3A 1TC2A 1EUYA 1HYEA 3SXJA 3IPXA 4BNGA 3KQOA 2QLNA 4MDHA 4GQBA 5KNLA 1N6LA 3K6SA 4R40A 2VJBA 3E3AA 1E2NA 1VB3A 4J0QA 5TEVA 5CCXA 4BNKA 5DXAA 1LX7A 3RBZA 3IT0A 2OL4A 3AJEA 4HZUA 1SC6A 2WYVA 1M5TA 2DB3A 1HEUA 2PL3A 3IBGA 4Y3UA 2A2ZA 4P3PA 1WCIB 3AI1A 4D5EA 4D3YA 1N9ZA 1GY8A 4XVHA 5H70A 5DGCA 1SEPA 5D3KA 1UFKA 2DQYA 4BMZA 1I1NA 1GL9B 5FPKA 5BRJA 2Q0XA 4L85A 4FDMA 4S12A 3KWFA 1ULZA 3FDZA 3PRKE 1MZPA 4PG6A 3MELA 5K0BA 4QGFA 2W0MA 1ZRSA 3L18A 4RZUA 3DVQX 4L8YA 4EGSA 1SQGA 1W8IA 2JFBA 421PA 4A2QA 2XDAA 3DSRA 3GELA 3NX4A 1BS1A 1J8VA 2QPAA 1WHTA 3JU3A 3OF3A 2JLUA 4LFAB 4ZAZA 4W5WA 2QRLA 2CLLB 3OT1A 3TUZC 1AG9A 3EH2A 3HKCA 4DWVA 3MT9A 2H18A 1UT5A 3ZGYA 2ZGVA 1BU8A 1ONPA 2H4FA 4XLTA 1KEUA 3SZGA 4YUXA 4YLGA 1WZNA 2VT7A 4FDUA 1GCUA 2H63A 2YUTA 3BVPA 1KQOA 2ZB4A 2WDZA 1PBNA 3D7SA 1PWZA 1CQWA 2WU1A 4GX5A 2HV8A 4X84A 4QJ3A 2VTEA 1SVIA 2AYZA 5AKHA 2GPWA 3F8TA 3A4NA 3WGUA 4CEHA 3OCUA 2GN9A 4JBNA 4Q3NA 3WNBA 3ZJTA 2F1HA 1W0JA 3E3OA 4TL8A 2NT4A 1SWWA 3BFKA 1S4MA 1NUUA 4HQ0A 3FJOA 1N5MA 3BD9A 5J3JA 4RABA 3ZWQA 4UBMA 4ZKEA 3ESAA 2FDRA 4R9VA 1FYXA 3OOEA 1FUKA 1P0PA 2APJA 4CM4B 5BOSA 1L4FA 4CEIA 5K0SA 3P4YA 4ZYLA 3TXAA 3U40A 3B82A 1TECE 3EAQA 1H6DA 3C6YA 4ERNA 1GPLA 4DV5B 1RHRA 1KVUA 4X66B 2X9LA 5AKYA 1B7GO 1H9AA 3AUYA 3D8HA 3G1UA 2WKWA 3EZXA 3TDKA 4TZTA 1HC7A 2GBPA 1JAZA 3IPRA 4OXNA 4BUCA 1D2RA 2WHYA 4RVGA 4E21A 5T7BA 3DZ8A 4YMIA 5COBA 3ZZMA 1P6XA 5H80A 5IULC 1VXOA 1WF3A 2OV1A 2BR4A 1V16A 2GARA 4IIYA 2ERYA 2RONA 2J67A 2ZIXB 3VYTB 4GMGA 3JWIA 2X3YA 7YASA 5AVUA 1ZA2A 4KWEA 2I3BA 1I24A 3HA2A 4A5SA 1ZNXA 1BMFA 3SKVA 2DWUA 3WV4A 1ZMXA 4E5UA 3RD5A 4KQ2A 1XNQB 2DQSA 1OGYA 3I9FA 2O05A 2GZAA 5A3SA 3SMQA 5CFOA 3R40A 4OH1A 3MOSA 4KK3A 3TG8A 1HLGA 1U28A 3QYAA 4UZEA 4C07A 2HQ1A 3G1WA 3EPKA 3N6XA 1CKEA 4TLAA 1EQAA 3LY9A 2ONJA 1TL7C 2PLNA 4OV6B 4ZZ0A 1U4SA 3DBIA 5AHOA 5K3OA 4D6YA 4TWBA 2EHDA 2V9ZA 3T5PA 4EWLA 4G0OA 3WTCA 1YZUA 3GYGA 3MFQA 3NEYA 4JVOA 1FUYB 4FCCA 4WOJA 4LNUB 5KWIA 1EINA 2IYAA 3P32A 4LZJA 3OWHA 2DFDA 3RK1A 5U4XA 1FJXA 1GV0A 1KAOA 4A2PA 3DB2A 3A9UA 3NBAA 2Q4BA 3ZI4A 2RIPA 4FGZA 5ITWA 1GSOA 5KYWB 1KJZA 3GEIA 5E1OA 5D01A 5D7NA 1CG6A 4O0MA 1P8AA 2BEKA 5L7YA 2Q2QA 2ZJ8A 4Y2XA 1AC5A 1J0XO 3ZJVA 1TYAE 2WD7A 5H4GA 1E63A 2R60A 1QP0A 1EFKA 3V9PA 2YFKA 1J2RA 2Z3ZA 3GA7A 4UUBA 3S2IA 4JLPA 3E5RA 4CIDA 1EFUA 3HXMA 2PQ2A 3RU9A 2EIXA 3HFSA 4TKLA 4H1HA 3ZHZA 1Y5IA 3UMGA 5GGXA 2EDAA 3HC7A 3DC2A 3KSRA 4LF9B 1N5RA 1DXQA 1WVMA 4X92A 2DHQA 3INNA 4BXOB 3L8GA 3CNLA 4PQFA 4DDHA 3PJFA 4JROA 4XPZA 3TVYA 1Z2DA 2BI8A 4AVYA 2W70A 2COUA 1PJLA 4NCHA 3U0VA 1M66A 3W6ZA 1KK0A 4GUAA 1QP4A 2C7QA 4MUKA 4WESA 1OJLA 3STHA 5SZKB 4XYLA 4MW7A 3WTBA 2OCBA 3C8MA 3I45A 1L7NA 1RPNA 2CC2A 3QLTA 4AZTA 4BLPA 3EDRA 1W5EA 2P0EA 2RB5A 1EVZA 4OUDA 1U1FA 1HDYA 3NT5A 2H1OA 3L02A 3NHRA 4UOQA 1LDMA 1J8MF 3PL5A 4A8TA 3OCYA 2EFJA 1VJ1A 4I8IA 3FPLA 3E3NA 2JCSA 1DRJA 1PZXA 4RMIA 4QVKA 2OYSA 2AOTA 1PTJC 5AH0A 1EFLA 4J3NA 221PA 4F6RA 1U0SY 2FX2A 3MAJA 3BQMB 3UW1A 4B2PA 1LZKA 1UBCA 4HWRA 4AF6A 3GQBB 4PGGA 3LHSA 2VTDA 2WPDD 4AJKA 4C78A 4X62B 3EVBA 1UJMA 2DECA 2P4EA 3LBAA 1Y1PA 4O4LF 4XGIA 3STVA 3T3HA 1M0TA 2VDLB 4FT4A 1S2IA 1I7PA 4TN5A 4EY4A 1DGQA 1B8OA 4BGIA 1YF3A 1GFZA 1CD5A 5AMXA 4DC0A 1J7KA 4MQLA 1WMFA 3BHMA 4DMRA 1FMLA 1GN9A 2HJHA 4B46A 1YQ9A 2I3AA 4M88A 3VR5A 5ADUS 5H1YA 1H2AS 1PFUA 4B8YA 1HM5A 1GA1A 3LL7A 4Q21A 4ZDWA 3WYBA 3I04A 3ICEA 4TTAA 3BREA 3EQ9A 4NBSA 4CCSA 4I50B 2V9PA 1Z29A 2FYTA 1XZAA 4XQCA 1I5OA 3QLVC 1YFLA 4OPMA 1J25A 2GM9A 4UOZA 4WBSA 3ERCA 3E5MA 1GZ4A 4GBED 3VI4B 4JBIA 2N0SA 4KO1S 4C2BA 1PT6A 4DBLC 4EI2A 1WUIS 4POAA 4E15A 1RLUA 3I09A 3DYBA 4OMCA 5BRAA 3VSCA 1GQ2A 3T5MA 2PT5A 3SM9A 2VR1A 1NRJB 1GSAA 1JDNA 3NATA 4E5VA 1UJ6A 2W43A 2ZZNA 1GNLA 1L5VA 1P7PA 1N2XA 4PVCA 1IK4A 1I1OA 5EN4A 1IEVA 1LJUA 3D6MA 5FWXB 1D6MA 1Z4IA 2JBHA 3IRVA 4JC4A 4QUGA 5FWDA 1J5EB 2FJ0A 2VHEA 2E21A 4LJ7A 5CH8A 4P80A 3OX1A 1D2HA 2JEYA 1BX3A 3FCEA 4GC9A 2PBRA 4G24A 2AFIE 1RRGA 2V59A 2WUVA 4L8VA 1E59A 1TCCA 1JTVA 2RHBA 2YXEA 4JHLA 5IJ9B 1U0TA 3WL8A 2YIDA 4DIDA 1UFVA 1Y48E 2H11A 5KDDA 4B6GA 2IOFK 1L5ZA 1WNTA 1E2GA 2Y1FA 2EJVA 3A26A 3JD0A 5A7FA 1KY3A 1AB5A 3OLWA 4F92B 3VKFA 4UXIA 1G55A 5I01A 2IY8A 3VJRA 4EI8A 2VT6A 4EW1A 2BRUC 3DV0A 1KDTA 5JPCA 1P1BA 5BQFA 1BCRA 1NWCA 2YY6A 3IHTA 5DBIA 5I9MA 1KDVA 5L4NA 1CRWG 1KMNA 3DEZA 1P1JA 3CFYA 2WA1A 3GUVA 2H5IA 1CY0A 2HL6A 3KU4A 2REQB 3N2LA 1UQRA 1YQWA 2P2YA 2PIDA 2CJXA 3ZX4A 2QNRA 5JNWA 3UG6A 4BZXA 1J8YF 1B42A 2WYIA 2W11A 2CXTA 2GYVA 3E6AA 1KO8A 3WNZA 4DKJA 1ZH0A 2G0TA 4U6NA 2GHTA 1BXGA 3HCWA 2CHEA 4OQNA 5CDFE 3DG9A 4BN4A 5LZ7A 4PFKA 3TS1A 4DMKA 2QL7A 2SCUB 2Q6IA 1T6XA 1EK5A 4ZCSA 4N0DA 3M1AA 2ZWOA 1JEQA 1KK3A 3OTQA 2QMZA 4Y0NA 4DTIA 2C07A 1B14A 1JHOA 4LXYA 1T91A 4U7PB 1SVSA 3IIKA 3O0DA 3TZCA 4RAQA 2NU7A 2XTAA 4GYJA 3CKKA 2C8KA 4LDAA 4Q9JA 1SPXA 3D4OA 5K3CA 2ZATA 4N48A 3CZ5A 4CF4A 4RY2A 3X3HA 2YDXA 2CXNA 3EODA 1RCFA 3OQNA 4B34A 2PK3A 5DT9A 4P7JA 1JBQA 1I7NA 3PGA1 4IHKA 3V46A 2Z98A 2BGLA 1FK8A 1ZSNA 3M6IA 5K3FB 3A27A 4Y9SA 3X1MA 4E03A 1K8XB 3JQRA 5IAGA 1JR3A 1LSUA 3NJRA 3AHJA 3UK2A 3W6UA 3QEOA 4EUKA 2BI4A 4TLMB 1VKZA 2NUTA 2XOEA 4D4MA 2OV2A 3GXBA 3CF4A 1GGMA 1W2HA 4LQDA 5LQSA 2PYZA 3NXKA 5EMHA 3A1VA 3ITKA 1Q83A 1KRWA 2IDJA 4YAJA 2XZTA 4KQWA 2RMKA 4WFKA 5J5VA 3L7DA 4CI0B 3QU2A 1I4TD 1EK1A 3VO8A 3GWZA 5EPOA 2OXCA 3TFOA 2ZM6B 4MGYR 5ALKA 1D7OA 1KMMA 1G7CA 3WGKA 1SXQA 1YVPA 5DYGA 2QYOA 1CUIA 1GDHA 1CV2A 4IUBS 3RWOA 1RFLA 2PZFA 5A1TA 2UZ3A 2BTQA 1X8LA 3MJSA 4GGMX 1CYEA 1M73E 3F6PA 1UXHA 1XQXA 4RACA 3Q15C 1EK2A 1HF3A 2JGKA 2Q6VA 3E1SA 1WNFA 4LZZA 1VSUA 4C4ZA 4M0UA 2P9TA 1OZAA 1IK6A 1OH5A 4INOA 1XQYA 3PL1A 1OFGA 3NWEA 1H4QA 1DWUA 3CVYA 4CEJB 2PRSA 2VJDA 2E4ZA 2YQ4A 4TSFA 4G41A 1A2KC 3CUTA 1PNQA 1EX9A 1B0PA 4O59O 5BNIA 4ZD6A 1E5LA 3AJDA 1Y8QA 3P9IA 3KXIA 1B15A 7ADHA 3KT0A 3QTBA 4Q48A 5HE9A 1CUJA 2ETXA 3EWIA 4HEA1 2VCEA 5ECYA 5FT9A 4E7PA 1L5KA 2NXWA 3SR4A 2KW5A 5K8UA 5H3LA 2BFAA 1J1IA 4JXXA 3BAFA 3CSUA 2WJ4A 3KT6A 3IUSA 5ALHA 3VGJA 2GMWA 4S2EA 3I2JA 2YXLA 5A9SB 1T3SA 5F4BA 2PL9A 2C2BA 4F56A 2Q6LA 3L4JA 4ARCA 5FNVA 2ZIZA 2JNWA 5A7GA 1K1EA 5I7HA 5AI4A 2OR3A 3SZ3A 3H8JA 4B3BA 5AHKA 3AT1A 4EITA 1ODJA 4MI6A 1CUZA 3MGAA 4FCWA 1ZJYA 3E22A 4CV2A 4ZHQB 4UATA 5GIPE 3ANNA 5TX7A 1JVNA 1L4NA 3W3AA 6ADHA 1PZNA 2HJ9A 5E9AA 2VHWA 2Q29A 3FWNA 4G97A 1XZBA 4GZ3A 5C1IA 5THXA 5BWLA 1VA4A 2BTOA 4IIJB 3RRZA 4DIFA 4QM7A 1Q7EA 4OK3A 4UMEA 3SS8A 3U48A 1UC9A 5JRDS 4EZEA 3WLJA 1J56A 4PO1A 4EJFA 3THXB 3K1TA 3BIWA 4I9FA 4LFBB 1UBEA 4N7JA 5LWHA 1VG0B 4BNIA 4PLZA 5I9IA 3IQGX 4RFSB 4OQDA 3VTKA 2CUKA 4GI1A 4JHXA 4XGRA 4BJ1A 3CGGA 1OILA 2IA5A 1N92A 2ID9A 3MT0A 1MNAA 5I4BA 3G7UA 3MS7A 2EW2A 3OY2A 1M74A 3GUUA 3H2ZA 3MMSA 5IAJA 2P67A 3U4CA 1WZIA 2FUNB 1ZCJA 4QXQA 1U2GC 1K6IA 1XRRA 2DUWA 3VSEA 1U8FO 3IIIA 1U5BA 2CV1A 3VR6A 2XT9A 3GFPA 2XW6A 3G2PA 4P32A 2CL6X 2FMXA 2XOXA 3MCTA 2TMDA 1ZK0A 4R8KA 2WIKA 3KQSA 3H6KA 2J3QA 3EGCA 4X3PA 1DIGA 3PEFA 1XZGA 2ZRFA 5FF9A 1U7HA 2UU9B 4F1JA 3DUFB 3PNLA 3WLFA 1FJ2A 1A27A 5BN4B 3FGPA 4XRRA 1G2IA 4ARVA 2HMYB 2FUCA 5A9SA 3SHVA 3VH3A 1KBZA 4IFTA 5DYTA 5HZGA 2VNHA 1X1BA 1YDMA 1LFDB 3FWZA 2P65A 1WZEA 4EHAA 4EB8A 1FMTA 1VKJA 2VDWB 4G8BA 5A62A 3LK7A 3IKJA 2GXUA 3B5IA 3ONFA 1PZMA 3DV0B 3N2KB 4G1MB 3ONWA 5DSTA 1S01A 4B2YA 4JKYA 4TWRA 4INJA 3PX7A 5IN5A 1E32A 5CB8A 3MWDB 1B74A 1Y4AE 3EVDA 1Y8QB 3HNRA 3EAGA 1H2XA 4Q3BA 3DL4A 1C4XA 2X2FA 2HYIC 3L9WA 1L5QA 3UWSA 4LOLA 2C5FA 5KU1A 3D0OA 3GOQA 1OV6A 4KXQA 4NAHA 2WWVD 1RADA 3IA2A 1DIOB 1FYVA 4HAZA 4QU9A 4FCVA 4BNTA 2VJMA 3M1YA 2H8GA 1ULHA 4AY3A 2GK6A 3DVAA 2C98A 4H0NA 1M2NA 1TNDA 2XGJA 4DCMA 1YU9A 4WINA 4R98A 3ZPXA 3BHIA 2BZGA 3IH5A 4D8YA 2LRHA 5TB5A 3DBHA 2TMYA 3OFSA 1DP4A 2JBAA 5TJHA 2PWYA 2VAWA 2VPXA 3B7PA 4Q6WA 4RD4A 1QS0B 3AFIA 2YMMA 4US0R 3HI4A 1IY1A 3C6MA 4PHGA 1TIBA 1E3JA 2J9FA 2O6HA 3QE0A 1E1MA 1A8QA 4ZZ1A 1R6DA 1NSFA 4AX8A 4JGBA 1KAHA 3I5MA 5BSMA 1VSBA 3DL2A 3VBEA 5J4YA 3H86A 3R0ZA 1FX1A 2G9VA 1Y82A 2C1EA 2C7BA 5CNIA 1E1CA 1NTOA 2B5VA 3DTTA 3EDMA 4IDPA 1PG0A 3RTGA 3WZ2A 4B6OA 3QVOA 3ZYCA 1LTKA 3GJXC 2W22A 2B4QA 3MQ4A 3CVXA 1VL6A 4AJPA 1PBTA 3S1LA 3OEEA 5IKPA 2FY8A 4XJVA 5IKEA 3BHNA 1VLVA 3D6AA 2OCYC 3VH2A 5ECGC