3BMNB

Structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor (compound ax3)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
267
structure length
252
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 89
structure length 252
sequence length 267
chains with identical sequence C, D
ec nomenclature
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3bmnB00
1MXHA 4CLOA 1YL5A 3WGIA 1D8AA 4S3MA 4XCVA 1FDTA 3DZGA 3FI9A 1K2WA 2X22A 1O94A 2EEZA 3GC6A 1NFQA 3PQDA 5ICMA 2WJPA 1YBVA 2DBRA 3KB6A 4YRDA 3HJAA 3I9OA 4ZQBA 4MIOA 3WICA 2AA3A 4ALIA 3WOHA 1P74A 1B14A 1H94A 4N5MA 3AJRA 1WZIA 5F1PA 4L4SA 1M76A 4ZRMA 3CE6A 4DIOA 3AY7A 2X6TA 1C1XA 4YJFA 5DULA 2C59A 4Q3BA 2NVBA 4P8RA 1QYXA 2PGLA 1E7MA 4J7CA 3RC9A 3ZU4A 1JWBB 3LZ6A 1MXFA 1H6AA 5GZ6A 5IG2A 2WYWA 2XXJA 3W1VA 3VH3A 1M75A 5KTKA 1W0CA 1E3SA 2Y1DA 4TRMA 2J8ZA 4WEQA 4CM8A 1P31A 4S1VA 1HRDA 2DQ4A 3JQBA 1Y9AA 1JA9A 3HN2A 3VC7A 1HSZA 5H83A 5I7EA 2F1KA 2YHIA 4N5LA 5T6BA 3JQ8A 3ON5A 4EJ0A 1QLJA 4AJOA 3H9UA 2NWQA 3F5QA 3I4FA 2Y1CA 5FI3A 4CL3A 4KQWA 2VRBA 4PG5A 1SNYA 1HDGO 4KWHA 2Y68A 4J91A 4IINA 1W73A 4MOWA 4DMMA 2RH4A 1SOVA 2G76A 2P5YA 3ZI0A 2EGHA 4BNWA 2XAAA 4XEHA 4HWKA 2EW8A 2DT5A 3N74A 1E6WA 1NX6A 1T1SA 3ETEA 3CPSA 4A73A 3OIGA 1YONA 3PLRA 2FPIA 1A7KA 3KEQA 3WJ7A 4GLOA 3TNLA 3DWFA 3GG2A 3IL2A 2PZJA 3LVFO 4BKQA 4D43A 3RFXA 2NU7A 3JQ6A 4FN4A 3H9JA 4E3ZA 3PJGA 4YBZA 2LDBA 4I5EA 2IZ0A 3ADOA 2X0IA 3HHPA 1Q2XA 5G0TA 4FJ1A 3VH2A 4Z3DA 4BNHA 3BHIA 3TZ6A 4YT5A 4IZHA 3CSDA 3AUSA 3JQFC 4Z6KA 3WGGA 5IZCA 4R3WA 1AXEA 1ZMTA 2LDXA 4GAEA 1Q0LA 3ETDA 3DZHA 5ITVA 2FN7A 1KVTA 2Y99A 1WAMA 4I1IA 4IS3A 5DBGA 5ILOA 3QIVA 3A4VA 1ONOA 1O9BA 1PJ2A 5F1OA 3RUIA 1LSSA 5JY1A 3JCZA 3QE3A 2GCGA 4E5MA 2A9FA 4M87A 2GUGA 3O4RA 4XD2A 3DB2A 4IPTA 4C7JA 4BB6A 4D45A 3LC7O 1BHSA 2D4AA 1NHGA 3E5RA 4ZD6A 1FF9A 2B0JA 1TT5A 5TJHA 1PJLA 4YACA 3JD2A 3ZV5A 2HRZA 1NR1A 2AEFA 3ICCA 1LRJA 5IJZA 1EQUA 3TZKA 1I3NA 4AJHA 4XGKA 4CLRB 5KVVA 4NDNE 4J4BA 4MP6A 1P1KA 1NQ5A 4P4NA 1ENOA 3AWDA 3GNSA 1T24A 3BMQB 3DBLA 3AI2A 3DBHA 1U2DA 3LC2O 1HYGA 3RAJA 3H6KA 5TRTA 2YYYA 5EINA 2GERA 4FQ8A 3PK0A 3T7EA 5JDCA 4CQMA 1IPFA 3OQ1A 4D46A 4CMIA 4DC1A 3ANLA 3UF0A 3ZWBA 1Q0QA 3IC5A 4J2OA 1I24A 1B8PA 4NIMA 5KIAA 3NRCA 2Y1GA 4IBOA 1LI4A 5A4DA 1GV1A 1VM6A 5COAA 2JHGA 3BZUA 4O1MA 2GZ3A 2BH9A 4ZVVA 2QYSA 4FFLA 2VUTA 4DLAA 1QYDA 1PJTA 1Y1PA 3WR5A 2O2SA 1PTJA 3LU1A 2AE1A 1K5HA 4P4LA 2PLAA 4L73A 4R5MA 5JO9A 4W4TA 1DLJA 5BNIA 5A9SA 2VQ3A 4HFNA 1LJ8A 1NVTA 1PEDA 3OJEA 3QA9A 4YJGA 3ZGYA 3K8ZA 2X5JO 1GCOA 4FCCA 1X15A 4EUHA 5AXAA 1GYPA 1DC6A 3TL2A 3GN1A 5DOVA 2PH3A 3OJ0A 2EERA 3L77A 4BO7A 3WFIA 4IIUA 1EBUA 3EUWA 3JQ9C 1X7GA 2NV6A 1ADGA 2DKNA 4IM7A 2O3JA 4WKGA 2Q45A 3W8FA 2EV9A 2IEDA 3C3XA 3KTDA 5A3VA 1ZSNA 3VZQA 1KEWA 1OI7A 3RBZA 1ADFA 1LC0A 1S6YA 1E7YA 2J5KA 3IOYA 3K31A 1C3VA 4I5FA 4WNIA 1NQTA 2I65A 3QVSA 3WG9A 5G4KB 1PJCA 1GYRA 1TB4A 2QRJA 1B2LA 3UKOA 1F14A 1C0PA 1GUFA 1L7DA 4I9HA 4QSMA 2PNFA 4XWYA 4UVDA 3K9QO 4JN6B 1TI7A 3GQVA 5KKAA 1NAHA 3D4NA 1N7HA 3H2SA 1LLQA 1RM4A 4WOKA 3SEFA 2GYYA 4TKLA 2AE2A 3OEWA 3JYOA 2ZCUA 4XJSA 4FW8A 2BKAA 4XGIA 1PL6A 2J6IA 2O48X 3ZWPA 1Y8QB 4BMNA 4W9NA 4K6FA 2I99A 1P1RA 3DL2A 4AJIA 4DGSA 5JNLA 2P9EA 4YR9A 3SVTA 1V3UA 2D59A 3D3EA 4YAEA 4IGEA 4YTEA 2FSVA 2PZKA 1LBEA 3N58A 1E3IA 3D4PA 2X1HA 4J6FA 4XKJA 5L45A 3OQBA 1DIHA 5I7SA 1HZJA 4CL8A 4OJNA 1NWCA 4PG8A 1GPJA 2FOIA 3IS3A 3P2YA 4HP8A 4B4WA 5IFLA 4GSLA 1JW9B 1CYDA 2JCYA 5I9MA 3KSDO 4XZ3A 1BVRA 2C5EA 3DHNA 3V1YA 1GDHA 4KOAA 3FWZA 4BO4A 1KEVA 1PJBA 1EE9A 4OSOA 1JVBA 4RVGA 3G1TA 3E82A 5CPFA 5TS3A 4E5YA 1Q0HA 5JFOA 1O6ZA 3B6ZA 1NASA 1LSJA 4BGUA 2YDYA 1QORA 2WYVA 4DMLA 4E31A 2IXAA 4NQZA 4GX2A 4IUYA 4LMRA 4Y8VA 5KCZA 1HETA 2OBYA 1B0AA 3MTGA 2C54A 4ND4A 2XOXA 5JDIC 1H6CA 3L0DA 2CMDA 4KUHA 4N18A 4PRKA 4RF3A 4CV1A 1YDWA 1A5ZA 2Q49A 4WASA 1DOHA 4DA9A 1EBFA 2GO1A 4FJ0A 1JDJA 1T2FA 3DBRA 3E9MA 3ONEA 5JO0A 5KJ1A 4ZU3A 3GMSA 3ETGA 3G3EA 1U2GA 2C82A 2GZ1A 3JQCA 5GZ1A 1VL8A 1SAYA 2W8ZA 3PYMA 2HMWA 3PTZA 1HE2A 2ZB4A 4YAKA 6ADHA 1N5DA 3GFGA 3NTQA 3RC7A 2RIRA 3GVPA 3I9JA 5TIIA 1LC3A 3PPIA 1E7SA 2D0IA 5DBFA 3DEYX 2AG8A 3IUSA 4CMAA 5ITWA 5BSEA 1BWSA 1EVYA 3CZRA 5BNTA 2QZ9A 3GF4A 3RIHA 2FY8A 4JNKA 3GNQA 1YXMA 4RORA 1A9ZA 4PLCA 2P4HX 2Y67A 2VOJA 2WDZA 4FOOA 1PU2A 2ZB8A 3ZU2A 4TQGA 2DTDA 1EUCA 3DTTA 1ISGA 3PI7A 1PZEA 2P9CA 3FR7A 3ONFA 1MX3A 3EDMA 3TPCA 4RF5A 1FDVA 2BFAA 4IDDA 4Y6RA 3AOGA 1EEHA 3GT0A 1SEVA 4KDFA 4YRBA 3ZWVA 4EZBA 2QYTA 1PGJA 3QWAA 4MP3A 4UUPA 1HDZA 5CPBA 4QQRA 1QMGA 2TMGA 3PWZA 1DC4A 2JCXA 1Y5MA 1YBMA 2WD7B 3UVEA 1VRWA 1R4MB 4F45A 1CWUA 3OA0A 1P44A 2Q2VA 3CINA 4R4JA 2YDXA 1ZSVA 4RDHA 3JD4A 3OF2A 1T2CA 3JYLA 4NBTA 1W4ZA 1H9AA 4J4HA 5C7IO 2I5PO 2EXXA 1P1HA 3EY4A 1GD1O 4ZA2A 3IJRA 3OFSA 5L7YA 2XXBA 1R4NB 4ND5A 4CR6A 2O4CA 1KC3A 1OOEA 4E5PA 1QLHA 1LX6A 2JAHA 3F1LA 5G0VA 4OQZA 1ZK2A 4II2A 4EJ6A 4NBWA 3HDHA 3ZHZA 3GGOA 4BO1A 3AY6A 2D5AA 3R1IA 1DIRA 4IJKA 2ZTMA 4DYDA 4FIZA 1VJ0A 3DMTA 5I8ZA 3SC6A 1NPDA 2VWQA 5KVCA 3BTUA 4DPMA 4W82A 4CLRA 2VYVA 5G0WA 3PHHA 1PGPA 2DM6A 3FWNA 3QVXA 4DLLA 2B83A 4NBRA 1Y8RB 4BL5A 2NLOA 2G5CA 1MV8A 1X7HA 2V6BA 4PFJA 2CDAA 4NU5A 1ML3A 3AFMA 4YA6A 2QRKA 4AFNA 3EK2A 1D3AA 3E5MA 4CV3A 4F6CA 2OO5A 3QVOA 3I9LA 3Q9NA 4YWJA 3EGOA 1N1GA 4UEOA 4L75A 1Y6JA 4ROSA 3ZNQA 1DPGA 5ER6A 1PS8A 2YV3A 3GN2A 3WWZA 3ZWOA 1WP4A 1T4DA 1B16A 1P3DA 4FGSA 1ZMOA 3RD5A 3TFQA 4DIBA 3WGQA 2ZTVA 4FFMA 4CM5A 3MEQA 3F3SA 2Y05A 1RYDA 1EFLA 1SOWA 1XU7A 1KEPA 4R1TA 5CDGA 2W4QA 3WXBA 2UV8A 3VPGA 1MC4A 5GMOA 3O38A 1UJMA 3AM5A 2NQ8A 2VHVA 3TQHA 5THQA 4JP2A 4LW8A 3KVOA 4XA8A 2FR8A 4BGIA 4XDYA 4BKPA 2OHXA 1LDBA 4QTZA 3LT2A 2DC1A 1B15A 2J3KA 2OGUA 1UAGA 3AW9A 3LK7A 3GGPA 4DXHA 4EYEA 2ZTUA 1EK6A 1R66A 2W2KA 3V2GA 3UCFA 5KOIA 3C8MA 3H3FA 3HB4X 2WE8A 2YFHA 5CHEA 1ID1A 4RPLA 1YVEI 1LA2A 2HAEA 1XQ6A 3O9ZA 3C7AA 4B3IA 5DNAA 5HM8A 4XYGA 5TT0A 1H6BA 5A5FA 5JSFA 2X58A 1JWAB 2D8AA 4J0EA 3VPXA 4FC6A 3W8DA 3EVNA 3K2BA 1U3UA 4YJHB 3WSWA 3I3OA 2EKQA 3A9WA 5T8KC 4LGVA 1ULUA 4CLHA 4UVEA 5AXDA 3K30A 4WJZA 2OL4A 3DFZA 4FOSA 4ID9A 1F12A 4FPXA 1K0UA 3O8QB 3PEFA 1MB4A 1HYEA 2E49A 2X7HA 4I5DA 4QX6A 2HMSA 2YQ4A 3ZCXA 4NFHA 4CM4B 4X54A 5L51A 5KJCA 4CM9A 1KOLA 1IZ0A 4E2WA 1CF2O 2A92A 1PIWA 2Q1WA 1OBFO 3RUCA 2VUUA 4BNYA 4QO7A 3RUAA 1E3JA 1XQ1A 3Q1LA 1IL0A 1YOVB 3E03A 1VSVA 3KBOA 3OM9A 2VHYA 4AJ4A 2NTNA 4CUJA 5FYDA 3CH6A 2X86A 1E77A 4URFA 3FRJA 1EUZA 2WTBA 2ZTLA 4OM8A 4CLDA 1CERA 4ZICA 5ICSA 1GL3A 1NBOA 4YAJA 4U7WA 1XEAA 3QSGA 2EIHA 3ZNOA 1EK5A 1A72A 4IQ0A 4BB5A 3TOXA 2FZWA 3S2IA 5B4VA 4C7KA 3PFFA 3A14A 1MLDA 3MJSA 1DAOA 3NJ8A 4R41A 2CF6A 1BGVA 1M6HA 3K5PA 1VKOA 3EVTA 1O89A 2HJSA 5AVOA 1ZIDA 2A35A 5IDXA 3ROPA 1ZH8A 2G17A 4XYMA 5EIOA 4E13A 1GYQA 3VTZA 4MIYA 3NJ4A 4NG5A 4TZKA 4ITUA 1HTBA 4H15A 3HDJA 3OEYA 4NK5A 2WEKA 3SLKA 1X7DA 5TF4A 3JSAA 3ZWYA 2W2LA 4MKRA 2DVMA 3H3JA 4FS3A 5DOZA 1VI2A 3ICPA 5HWSA 1PQPA 2VWGA 3BIOA 4BQRA 3ASVA 2NTVA 3HN7A 4J7XA 3V2UA 5L4LA 4Q3DA 1UDCA 4J9VA 4WUVA 4A03A 1GU7A 4IQGA 3TZQA 1I10A 2HLPA 1B7GO 5IDYA 1LSOA 3PHGA 4LCEA 3QQPA 4DBZA 1WDLA 1Z45A 4AJ2A 3AUAA 4BNVA 2UUOA 3EAGA 5JCJA 1UZLA 4JK3A 5L4NA 4MVJA 2I3AA 4B7XA 4OL9A 5JAMA 1U5AA 3C85A 2B4QA 3WLFA 3H4VA 4JJGA 4IJWA 3DBVO 1LRLA 2BFOA 3DHEA 4EITA 2ZYDA 3ROMA 1J49A 4FFNA 1V0JA 3GEDA 4PLTA 2JFFA 1DAPA 5T5QA 4Z9XA 3NX4A 4MVJF 4PRLA 3OIDA 4ZQGA 4BOYA 2VZ0A 2C2XA 3MJEA 4MP8A 3V2HA 3FTNA 2VRCA 1GQQA 4YDRA 1DFGA 4UEKA 2R00C 1OC4A 2WE7A 2EWMA 4XR9A 3B1KA 2JL1A 2YY7A 4XQGA 4AJKA 1ISHA 3HQ4O 3B70A 4FC7A 1SO8A 3Q6IA 3PIIA 4DRYA 4GX5A 1Q7GA 3H65A 3V1TC 1YB1A 4QECA 3RSHA 5DP2A 3PJEA 4HBGA 2X9VA 1LLUA 1NNUA 1LDEA 5F5LA 1M2WA 3CXRA 2ZB3A 2NVUA 2VT3A 3OQ6A 2GN8A 3C7DB 3ZNNA 5I9LA 1BW9B 5B12A 3L9WA 3NDRA 4INAA 2JFGA 1MUUA 3G17A 4GBJA 5A9TA 3V5NA 5U1PA 3WGZA 1R4NA 2NACA 4IS2A 3WLEA 5EESA 4ZJUA 3NV9A 4D3SA 3RU7A 3SJUA 2OUIA 3UW3A 5I9NA 3JQDA 4ALLA 2IYPA 3RQSA 1PQUA 1BDBA 4DVJA 4BNXA 1JKIA 1ZSYA 1G0OA 3DHYA 3QWFA 2PWZA 4AJNA 1T26A 2C20A 3BTVA 3JQ9A 1F0YA 3QHAA 3L6OO 4FFRA 2IXBA 4NJMB 4TVOA 1LDGA 1H6DA 3D4OA 4BNJA 2IRWA 4R01A 5LCXA 4CM3A 1OAAA 2RCYA 3BMNB 4J49A 3X2FA 5AQ1A 1QYWA 1BRMA 1JTVA 1RM0A 3WGHA 2G0TA 1GQ2A 1LLDA 4D79A 4XB1A 2X0NA 2CFCA 5HBRA 4JXKA 3OH8A 1XIVA 2BGMA 5G2OA 1VJ1A 5AXBA 3DONA 5CG1A 2HK8A 4RLHA 2VYNA 4OKNA 2Y93A 1ENYA 4I5GA 4ZGWA 4MVJG 1LXCA 1B8VA 1LU9A 1LLCA 3K2EA 4BHTA 2HSDA 5DDIP 2Y1FA 5T57A 1CETA 1O8CA 2PD4A 3GDGA 3L6DA 5EPOA 5FF9A 3SX2A 2VOEA 1P45A 4D7AA 1U7HA 1IY8A 1VPDA 3AUUA 4PGFA 4M86A 3GLQA 1BXZA 1M66A 3P5SA 3WTBA 3BTOA 4YT2A 6LDHA 1Z7BA 3E6AA 3JQGA 1ISFA 1QKIA 3ZWNA 3LLSA 5CDSA 4KMSA 3GZ4A 2ZQYA 3S8MA 4Z0PA 2CY0A 3KSZO 3DMYA 2DBZA 2JFHA 3M2TA 4YEDA 2HMUA 2IDZA 3PWKA 1G1AA 3RUDA 4E21A 1DSSG 3I6QA 2J5QA 1UUFA 1UDBA 2HMVA 2I66A 3FBGA 3OA2A 4G2NA 4J1NA 4UVGA 4Z9YA 2B37A 1DC3A 3DAGA 1U8XX 4AG3A 2HDHA 2GR9A 4L76A 3LSYA 4BV9A 4BGEA 1JKFA 4LCJA 3JQAB 5LDHA 1ZEJA 4GWKA 4YJHA 1H2BA 3G79A 5IN4A 4RVUA 4L74A 3DR3A 3Q3CA 4LISA 4XQEA 1E0DA 2PZLA 4A10A 4E2XA 4BNKA 1C1DB 1U7TA 1Z6ZA 4Q3EA 1FDWA 2DLDA 5JDIA 4CLXA 2CNBA 2CZCA 2J5RA 2PGDA 1WWKA 4JROA 4L0QA 1U28A 3WDSA 1K6JA 2QG4A 1MGOA 2ZJ1A 2VWPA 4IDAA 4R5HA 5BQFA 5BSGA 2QQ5A 3S2EA 1ZXBA 1WNTA 4GGPA 2G82A 2TMDA 1XLTA 5HS6A 3ZW9A 4Z0HO 1P77A 2X5OA 1X13A 4LSMA 1XGKA 4MVJH 5IDWA 3TSCA 3GZNB 1I01A 4I9UA 1Z74A 2UAGA 1YOVA 2O3UA 1JAXA 3L07A 1KY5A 5IXSA 1AHHA 3A06A 4M89A 3JQAD 4R3NA 3HSKA 4D3FA 2J3JA 4NK4A 4MKXA 3D64A 4RL6A 3AM4A 3BMCB 4CLEA 3GRKA 3KLPX 5IAAA 3ABIA 4IY1A 5L40A 4O6VA 4WGGA 1JQBA 2PZMA 3RC2A 4DQUA 4BKOA 4MIEA 1WDKA 4PG7A 3ONDA 4CR8A 4U5QA 2V6GA 2Y1OA 5TSDA 1UZMA 3EZLA 5MGBA 4YQZA 1JU9A 1M67A 1UH5A 4ONEA 1PS9A 2QIOA 4GI2A 5DP1A 3CKYA 4TVBA 1HE4A 2FRDA 2C2YA 4JGBA 4XJTA 3OSUA 5A04A 3WFJA 2O2YA 2AQIA 4OH1A 1DRUA 3RKUA 4TRRA 1N7GA 4BS9A 2DTEA 2E37A 3SLGA 4XRGA 9LDTA 1SBYA 2ZQZA 1P1FA 5KWEA 1SMKA 4CV0A 4K6CA 5EN4A 3DZIA 3D3WA 4BUCA 4NH4A 4AL4A 1E6UA 2JHFA 3BAZA 4EGFA 2JD1A 1DRWA 4IXWA 3O26A 3WQQA 3I52A 4Q3AA 2BGLA 3UOGA 4RVSA 2C7VA 1JN0A 5BNFA 5ADHA 2DUUA 1KVSA 3TZCA 5K9ZA 2I6TA 1YDEA 1QG6A 1KVQA 1CIVA 3KEOA 1LQUA 1RJWA 5A05A 3PJFA 3VDQA 2NU9A 4BKUA 2ZCVA 5TNXA 4BQPA 3T4XA 1LUAA 3ZWAA 3IAHA 1NTOA 3ZZNA 1FDUA 4UUNA 1IPEA 3RI3A 1J4AA 1J5PA 1IB6A 4DQVA 2C0CA 2CDBA 4JBIA 3HADA 4UULA 4J0FA 1W6UA 4PVCA 4PN3A 3QV1A 5CDTA 1HZZA 1MG5A 2HO5A 5JAQA 3JQBC 3AOEC 2CDCA 3PJDA 1B26A 1N1EA 4BO3A 5EQFA 3C7CB 1XU9A 2DUWA 3AU9A 4UAGA 5KJFA 1FMCA 3FD8A 1H5QA 4O59O 1Y7TA 2ZYAA 4KZPA 3Q11A 4PLZA 1AGNA 1T25A 1PX0A 3E9QA 3M6IA 3QVWA 4BNZA 1N9GB 1ZZEA 1HEUA 3GY0A 1E7RA 1GR0A 1TA4A 4YCAA 4CUKA 5KJEA 1ADCA 3DOJA 3UCXA 1B3BA 4ZN6A 5JMWA 3DZJA 4QT0A 2ZYGA 5CFZA 3JV7A 1ZJZA 2H1SA 1I2CA 1WVGA 4DYVA 2BELA 2O4UX 4R16A 4CM6A 4CMHA 2UYYA 2YHUA 2FZEA 3ADPA 3JYNA 3F5SA 1DIAA 4WECA 2GSDA 1RPNA 2V7PA 4XYBA 2A4KA 5C5IA 2HQ1A 3ROKA 2Z1MA 3ZN2A 3PFWO 1YE3A 2Q4BA 1T2EA 3FNHA 2PKRA 4TROA 3BMOB 2VHXA 5IZCC 3RKRA 4XQ9A 3ZNPA 2FSSA 3MCVA 3PQEA 4KTTE 4PLVA 3MWEB 1HWYA 4PZCA 4WLUA 3L4BC 2B4TO 4RZHA 1JLLA 3H9QA 4XRRA 2BFMA 5TJ9A 2B5WA 4M1QA 3JQEA 5FI5A 1HDCA 1YQXA 4Y6SA 5DN9A 4TWRA 3V1UA 5HA5A 1O5IA 1YH3A 4NJMA 4JBHA 3RBVA 1D7OA 1ENZA 2D2IA 4BNIA 4BNUA 3T7CA 2OOSA 1U3WA 4XDZA 2VUSA 2Y0CA 2E48A 1DHTA 4OIMA 1UXHA 2V65A 5FEUA 3GG9A 3LDHA 3C1OA 1K3TA 3ZDFA 1LNQA 3BHJA 4N5NA 1I32A 5F5NA 3DTYA 4BGVA 3LLVA 5ILGA 5EMHA 5IXYA 3BYZA 3GEMA 3F4BA 2OBNA 2EGGA 3K6JA 1DO8A 1ZKMA 1TEHA 4PG6A 1R12A 4GLLA 1E1KA 2XF8A 3Q2IA 1K89A 2EKPA 2O7SA 2POQX 2YFQA 3EW7A 3GPIA 2DBQA 2JD2A 3D0OA 4K26A 1PL8A 3OIFA 4IJVA 5JDCC 3DOOA 3NDIA 4TRNA 3I9KA 2YZ7A 4NJOA 3D5TA 3NUGA 4K28A 3P7MA 4RZIA 4B4UA 1F17A 3S55A 3UUWA 1VC2A 2H5LA 3KYBA 5JCXA 1BSVA 5TQVA 2AHRA 4JP3A 5DT9A 1KYQA 4LSWA 3INGA 3KSUA 3U9LA 4ALNA 1U4SA 2Y1EA 2OXIA 1GY8A 3HFGA 3FF4A 3M1LA 1HDRA 3R0IA 4UUOA 4E30A 1NVMB 3NTOA 4PLPA 2PKQO 1N2SA 2ZJ0A 3ASUA 3NAQA 2YQ5A 3UCEA 3TFOA 4A27A 3FNEA 1Q1NA 3FBTA 1ZVMA 4RGBA 4GWGA 3ZH2A 1KIFA 4UEJA 5ENVA 4CLOB 2EP5A 2OZPA 4WEOA 1E6EA 1V3TA 1HLPA 1ZFNA 1EVIA 1A7AA 3I23A 4WE3A 4CM1A 4BMSA 4XGNA 3KXDA 2Z95A 4QEDA 4I9NA 2EP7A 3HNPA 4IJUA 3KOUA 4W7IA 2PK3A 4BNTA 5K0ZA 2X0JA 1S7CA 4IDEA 4RPKA 3Q2KA 4W99A 2DPGA 1B3RA 2VZ8A 4DIFA 4WLFA 4D42A 3MJTA 5TT1A 2YW9A 3OHSX 5B1YA 1I30A 1Q7CA 4BV8A 4UVIA 5C7LO 3AU8A 3CTMA 4YYZA 1C1XB 1CJCA 2IZZA 3NEPX 4YJFB 5L4SA 3BMQA 4BMVA 1I3KA 1C0KA 4K9DA 1ENPA 4WPGA 3WSVA 4LMPA 3G49A 3RROA 4B3HA 4IMPA 5K6AA 4M54A 3P19A 2IE0A 3TWOA 5JAZA 3B20A 3LC1O 1ZXLA 3LF1A 2GF2A 1KVUA 3SBOA 4CM8B 4E0BA 4ZHSA 1A4UA 5U9CA 2W98A 3QVTA 2HK7A 3ZV6A 3W6UA 2O3QA 1IE3A 2AQHA 1F8FA 1RWBA 2YHIB 4RF4A 1KY4A 3GK3A 3JQ8B 3LT4A 1R0LA 4AJ1A 4O0LA 3INRA 2Q2WA 3ITDA 3FR8A 3BXXA 4BO0A 2RHCA 1MP0A 1AXGA 4LRTB 4G81A 5DCUA 1WMAA 3OJOA 2AQ8A 4W9NC 2WYUA 1WXDA 1NWHA 1NYTA 1U5CA 4MPDA 4PZDA 3MWDB 3H2ZA 3PHIA 1YQGA 4GL4A 3IKTA 2WSBA 3LQFA 4JBGA 1EE2A 1UXIA 2QX7A 4N54A 4BNFA 4RPGA 2GLXA 2BHLA 2GNAA 2YV1A 4OOEA 1EDOA 3CZMA 3PGXA 3IMFA 4ND3A 4GKVA 3WNVA 4OGWA 1HL3A 1I8TA 3NKLA 1VL0A 1P33A 3ULKA 4BIIA 1U1IA 2P91A 2VWHA 3T4EA 4TMFA 5L7WA 2P5UA 2QW8A 1MA0A 2DPHA 4L4XA 2ZIZA 2Z5LA 2VZ9A 1A9YA 3H9GA 2HJRA 4L9RA 1GUYA 4NFYA 4ILKA 4WLNA 2Q99A 4AJEA 3FTPA 1SB9A 3RCBA 5JS6A 3WGTA 3RASA 2X8LA 4ALJA 3S2GA 4FSHA 2SCUA 5L95A 4FFOA 2JCVA 3VTFA 2RHRA 1DB3A 1VKNA 3OECA 2IZ1A 5G4KA 3UAGA 3RFTA 3RUEA 1NXQA 3WBBA 1QV6A 1KC1A 3H9EO 4JQCA 3GVIA 4OKIA 3DDNA 1R15A 3EC7A 4KUGA 3WGYA 2HCTA 3GVHA 4A0SA 4RDIA 2JAPA 4OO3A 4YQYA 3WNQA 3KUXA 1TT5B 4FD3A 2CSUA 1J0XO 4EBFA 1BG6A 3NDJA 4B8ZA 1XR3A 3EZYA 4A5OA 1U8FO 1ZEMA 2V6MA 2PD6A 3GH3A 4I8XA 3WJAA 1Y8QA 3VPHA 5BSFA 4IIVA 5A06A 5ENDA 1YS4A 4KWIA 3UHAA 3D7LA 1NP3A 2H9IA 4KUEA 3WTCA 2B5VA 3DBLB 3TF5A 1QXSA 3KV3O 2BI8A 2O3TA 3L4SO 3I9NA 5KVSA 4UUMA 4CQLB 4CV2A 1YB5A 3EMKA 3TZHA 2AEJA 1C0IA 4CQMB 1NAIA 4Q3CA 3F6YA 3U4DA 5A1TA 5BR7A 4DC0A 4OXYA 4CMIB 3QJ5A 3WMWA 1H0KA 3PRJA 4R9SA 1YRLA 1GAEO 2JD0A 5B4UA 2PV7A 5HS4A 2WMDA 5TX7A 3PYLA 1DIBA 2Q46A 3JQFA 1U9JA 3D1LA 3KZVA 5BT9A 5FFFA 1BVUA 4HNGA 4Y9DA 4IDGA 1CQJA 1CDOA 2OMEA 2ZKLA 4CMKA 3F47A 3WBFA 4BO6A 4J1QA 4HADA 4LRSB 1ZBQA 4D41A 2UDPA 2XPCA 4J43A 4WNCA 4B4OA 5CEFA 4NI5A 4CMJA 1H2HA 1PL7A 1E5LA 4JX8A 5A9SB 2P4QA 2YV2A 3EHEA 1ZW1A 4CQMD 4ALKA 3VVCA 3NT2A 3CMCO 4WLOA 4YJGB 3ZV4A 5EL0A 4B3JA 3WYBA 3RUFA 5DBIA 2HU2A 2EKLA 1XCBA 5JC8A 3E9NA 4F6LA 5I7FA 1OZAA 4PLYA 1UR5A 4W6ZA 3OJLA 1NR7A 5L9AA 3PIDA 1UXGA 4DPKA 1MFZA 4NZ9A 4CJXA 4HNHA 1DRVA 2B36A 3I1JA 1HLDA 5L7TA 4AVYA 4RCVA 4NPCA 5T67A 3UN1A 2G1UA 4YPOA 4CMEC 1HDXA 3G0OA 4B8WA 2GZ2A 5KVQA 2BF7A 2JKVA 4GSKA 4H16A 3QWHA 4QXMA 3LF2A 2EG9A 3IP1A 2OP0A 5CDUA 3BTSA 4PIVA 1I3MA 4IQ8A 1UXKA 1KS9A 3KO8A 4ZQHA 4IGFA 1DDOA 4XQCA 3C1AA 3Q0EA 1DJNA 1Z75A 4BKRA 2CUKA 4XR4A 1F06A 3HDQA 2WD7A 3JYQA 1R4MA 4RQTA 1XWFA 3ZU5A 1LSUA 5ES3A 1YWGO 4LVUA 4HFJA 1GCUA 4ZQFA 1E1LA 4NHEA 5F3RA 4P22A 5KJ6A 4ZRNA 2EF1A 3GRPA 5EERA 5IDQA 4WLEA 1HYHA 1OC2A 4AICA 1WDMA 2J3HA 4CMCA 1EZ4A 1PZFA 1GFSA 3EYWA 1F8GA 1GUZA 4RVHA 3VKVA 1GTMA 4NMHA 1QYCA 3KYCB 5IF3A 4EUFA 4BVAA 4Q3NA 3GR6A 3PXXA 2VT2A 3JYPA 1N92A 3V8BA 3U62A 4A26A 3OMLA 4J9UE 2X9GA 2HRBA 1AUPA 1TLTA 2J3IA 4AJPA 1ADBA 3GOHA 3OBBA 1ZK1A 4HFRA 4YB8A 2DFDA 4II3A 2HMTA 5DCWA 1Y8RA 3MOIA 3E1KA 4R9RA 1R6DA 4NU6A 5JYDA 2NU6A 4NFSA 2WWRA 1PQWA 3JQ7B 1NFRA 2X9NA 8LDHA 2B4RO 5CEJA 2GPTA 4E5KA 3GVCA 3DBRB 3NGLA 4ALMA 1BTOA 4NBVA 4R51A 1QYVA 1CRWG 3L9XA 1LQTA 1ZK4A 3HE3A 2BLLA 1EVJA 3AOEA 5GY7A 1EUDA 4W7HA 5J23A 4KP7A 1XHLA 2YUTA 4H7PA 4Z0TA 1E7WA 1SPXA 1BDMA 2O3RA 2Q3EA 4KTVE 3GDOA 4E2YA 4MKZA 3HDYA 4FDAA 4Y6PA 3CIFA 4CUZA 2NM0A 5C7OO 4OMUA 2CVOA 4R69A 4M49A 3AY3A 3VPSA 2D5CA 3WQRA 2VHZA 3QWBA 3RVDA 4J4TA 5JY6A 5CDYA 1GV0A 5DF1A 1P9LA 1FJHA 4EEXA 2PA3A 1I0ZA 1VL6A 2Q1TA 2ZATA 3KM0A 3KYDB 3ZHYA 3FNGA 2O23A 3UGKA 3VZSA 4R1SA 1IYZA 2ZK7A 1ZCJA 4CMBA 5DCYA 4E32A 4DTIA 1ULSA 1ARZA 2AG5A 1YQDA 4OAQA 4P38A 1GEEA 2HK9A 1PJSA 1G6KA 1JVSA 2Z1NA 1UDAA 4A2CA 4K1LA 5H81A 3W4IA 1YJ8A 3B1FA 2NUAA 1QR6A 1I2ZA 3GFBA 3GMDA 2ET6A 4M8SA 3L4BA 4J90A 3VZRA 3O8QA 3WGOA 3PQFA 3FPCA 3MJVA 3RWBA 3RJ5A 3SC4A 3VZPA 1Z73A 1EDZA 4WCFC 4BO5A 4CM4A 1XDWA 2X0RA 2PR2A 3VVBA 1L7EA 4PLGA 4RLSA 1NM5A 3SJ7A 4YJDA 1BXKA 3W6ZA 2AQKA 3MOGA 1ONNA 4HX5A 4IDFA 2GRAA 3DZFA 5G0SA 2I67A 3TDKA 2DAPA 2PTGA 3M2PA 3NYWA 2ZB7A 1PJ4A 3LYLA 1MFPA 1KBZA 1Z82A 2PH5A 4RVDA 1NPTO 5A5EA 4KQXA 2FHSA 2O50A 1ZK3A 3BHMA 4OXKA 1E92A 1DEHA 4HY3A 1WLYA 5IN5A 1LRKA 1PSDA 5AXCA 4DPLA 3DO5A 4IZIA 4CQLA 2PGJA 3I83A 2AXQA 2A94A 1T2AA 2VCYA 3IDSA 3OETA 2GN6A 3K92A 2DU8A 1UZNA 1WW8A 3UFXA 4KDEA 3G1UA 3JD3A 3AI1A 4BNMA 4NBUA 1HKUA 2CVQA 4NR0A 3MTJA 4HUJA 1V8BA 3DZKA 2C5AA 4F46A 5KKCA 3PZRA 2Y0DA 2GGSA 3RU9A 3CMMA 2Q4EA 4HV4A 1Y5RA 3PZBA 1Z7EA 5I7VA 1ZNQO 3K73O 2VYVD 3S2FA 1M6WA 2EJWA 3S1LA 2W90A 3R3JA 4YT8A 3W8EA 5C37A 4PCVA 5EJ2A 1SEPA 4YT4A 2FWMX 4E2ZA 5MDHA 2C07A 5ER9A 1Y81A 2WD8A 2O3SA 5G4LA 3VH4A 2X4GA 3KLMX 5TC4A 3PWSA 1GADO 3WYCA 4UREA 2W2KB 3K96A 5H82A 1JAYA 3RJ9A 2D3TA 3U09A 2Y0EA 3WWYA 1E3EA 4P4GA 4J1TA 1D1TA 5CP8A 1UAYA 3DOCA 4E33A 2PFGA 4ZQEA 3HB5X 1XSEA 3COSA 3HWRA 1IHXA 1SC6A 2E82A 2VHWA 4FJ2A 2FP4A 1C0LA 2P9GA 1HXHA 1SZJG 5AYVA 4GQAA 1SCUA 2BGKA 4O63O 4BO2A 4EUEA 1VLLA 4GKBA 4EI2A 2DTXA 4HFMA 4PZEA 4TRJA 5LDGA 3C24A 2OP1A 1DFHA 2I3GA 4GVXA 3WIDA 4JLWA 1I33A 3R6DA 3GHHA 4BO8A 3MJCA 4AJJA 3PLNA 1X1TA 2PKQP 1C14A 4E4YA 2CD9A 4LVCA 3ZHBA 3DAFA 3ENNA 2AW5A 1RM3A 1Y9EA 3M1AA 3FHLA 1LDNA 2FR0A 3VKUA 1WPQA 1IZ9A 1AE1A 2IYOA 3DAPA 3VDRA 3WYEA 1V3VA 5CAEA 4CMGA 3GAFA 2DBVO 5BSHA 3VOSA 3QRWA 1BXGB 3ITKA 3MZ0A 4R1UA 2BD0A 4WLVA 5I8WA 3N7UA 4DL9A 4IMRA 5JW6A 5JXWA 3H8VA 1QP8A 4RO0A 4H3VA 3WB9A 2HUNA 3HG7A 1O0SA 1L1FA 1P1JA 1BW9A 1U4OA 2UVDA 3U4HA 3WQSB 3INTA 1E1MA 5CG2A 2B35A 4U0KA 1QV7A 4GMGA 2VNSA 1NQAO 3TOZA 3VAZA 1HE5A 4CM9D 1KERA 3KYCA 2Q2QA 2FPPA 1LDYA 1DJQA 4DREA 2NU8A 1U3VA 3IQDB 4FFPA 4MINA 3SXPA 3WS7A 2FR1A 3U49A 3JTMA 4U8GA 4IXTA 2BFPA 4HXYA 1NFFA 1TT7A 5T8KA 3F1KA 4GVLA 5U4QA 4D44A 5C3MA 4U6QA 2I76A 5GZ3A 1AN9A 1GEGA 3P2OA 3QW2A 3O03A 3BMNA 3ZW8A 5JPIA 8ADHA 3E8XA 3JD1A 4D0RA 3F4LA 3JD0A 3JQ7A 1XKQA 4B4VA 1GZ3A 1ZJYA 5CEEA 4OYRA 4WCFB 4GGOA 1HE3A 1J6UA 3IP3A 3OP4A 4FR5A 2NQTA 1I36A 3LT1A 1BMDA 4I08A 1VJTA 1PGOA 3RBXA 3TRIA 3H5AA 4PVDA 1NHWA 1V9LA 7ADHA 2V6FA 1WZEA 4LN1A 4XYEA 5A9RA 3E18A 5JBIA 4DQXA 3AM3A 2C29D 3I4CA 3PDJA 3GPDG 3Q9UA 1KETA 2H63A 3FN4A 4J16A 4QFDA 4JIGA 5F21A 2W2LD 3PDUA 1HF3A 3PGJA 4WOJA 1AHIA 5DZSA 1EVZA 4NNJA 3PHLA 2PD3A 4BNLA 2AMFA 4C4OA 4QUKA 2R6JA 4CPDA 1UP4A 1HT0A 2R2GA 1TVEA 4XB2A 3QY9A 3PYXA 2GD1O 2NNLD 3KRTA 4E12A 1E3WB 1GZ6A 2X23A 4R68A 2VTDA 4JCOA 4JJFA 1A27A 4OOFA 4BNGA 3KYDA 5A03A 5JCJD 2B69A 1X0XA 2GN9A 1ONPA 3E48A 3GEGA 4FGWA 4MVJD 4PLFA 1WMBA 3OICA 1PS0A 1EQ2A 1PR9A 1ZUD1 4CR7A 1VE9A 2QRLA 1CQIA 1VSUA 3FCOA 3HZZA 2QHXA 2VN8A 3GVXA 3JQAA 4WK6A 4J1SA 4QO8A 2I9PA 1PJ3A 3C1TA 3UICA 1C1DA 4RF2A 3GAZA 1E5QA 2IEBA 3OJFA 1YJQA 1ISJA 3L6EA 5LC1A 1JKJA 5COBA 2NVUB 4PLHA 1XYGA 3KHUA 1XELA 4EEZA 4G5HA 4DLBA 5A3JA 1DLIA 3ANNA 1RM5A 3ZHXA 1EFKA 2VRCD 3VH1A 3U4CA 4YXFA 1MC5A 2RBEA 3GNTA 3I5MA 4QFCA 4ND2A 3TJRA 3DC2A 4OSPA 3B1JA 4F3YA 1FDSA 3GZNA 1LEHA 4Z3KA 1TXGA 1KEUA 1R37A 1YO6A 4DUPA 3ST7A 1K6IA 3TL3A 1IULA 1UP7A 4E5NA 1T1RA 1EMDA 3BMCA 3IKVA 1DFIA 1GPDG 2BRUA 2NSDA 3DZBA 3W4JA 3F46A 2EW2A 4DBVO 4MVJP 3MJ4A 5FWNA 1PGQA 1OMOA 1ZO8A 1DHRA 2Y66A 5F1KA 5HTOA 4XIJA 4CMEA 2VTEA 1UXJA 2P68A 3WMXA 1NVGA 4R1NA 4ESOA 1LTHR 3NT5A 4RJTA 4YAIA 2R00A 4HKTA 1E1NA 4RV9A 5IZ4A 1E7QA 2AEMA 2FPGA 1K6XA 7MDHA 4XX0A 1O95A 3RC1A 4TZTA 4U0JA 5B37A 2NTJA 3IIEA 2HKIA 4GX1A 5TGDA 4IDCA 2BMAA 1X1EA 4MVJI 5L53A 4U6SA 1XG5A 1SB8A 3I9MA 1IUKA 5AOVA 2DFVA 4GX0A 3HUDA 3AUTA 3GGGA 3WIEA 3GUCA 4OQYA 3U3XA 5HRUA 4N7RA 1PZHA 2PY6A 3JQGB 1P1IA 4LK3A 1Q7BA 3FNFA 1YB4A 1R16A 3WX0A 3QP9A 4L4RA 4EDFA 3ORFA 1I5RA 1LDMA 4J3FA 4ND1A 4OXNA 3CEAA 4CM7A 2BI7A 2VYND 4MO2A 4BO9A 3UH1A 2GDZA 3GA0A 4G65A 3ZV3A 1PZGA 4M55A 3GUYA 4JJIA 1P0CA 2E6UX 3IUPA 4BNNA 4E6PA 5EQDA 1A71A 1FXSA 3PP8A 4MJLA 4EJMA 1KVRA 1DBVO 1PWZA 1HDOA 1RYEA 3AFNA 3NTRA 1FK8A 5JE8A 3PHJA 4PLWA 5KNLA 4MVJE 2EJVA 2ILTA 1PWXA 1RKXA 1ZK0A 4Y67A 3I6IA 4B7UA 3ZU3A 1MG0A 2GASA 3W4KA 3ANMA 1ORRA 1QRRA 5COQA 4GPD1 2CF5A 2WM3A 1HSOA 1N9GA 2JJYA 1YKFA 4PG4A 4RPHA 1PJQA 2Q50A 3FPLA 1DIGA 1R0KA 1T2DA 2OFPA 1UP6A 3X2EA 3AK4A 3DBHB 3TN7A 1PGNA 5L3ZA 5JAIA 4TKMA 4TSKA 1PR3A 2RH8A 1BXGA 5TLSA 5JC1A 4MDHA 5THKA 3FSRA 1B8UA 1X0VA 1YL6A 4WCDA 4D3DA 3PVZA 3LT0A 4YRAA 3U5TA 1G0NA 3GDFA 3HFSA 1YGYA 4Y98A 1D1SA 4J2HA 3U0BA 1T4BA 3IJPA 3ROQA 4CODB 4J7UA 1W8DA 5G0UA 2IODA 1E3LA 3VHRA 1H93A 2OORA 4Q39A 3BMOA 3UXYA 1ISMA 4B79A 3KETA 3VPFA 1U3TA 1GQYA 4A7PA 4Z9FA 2F00A 1N8KA 1NPYA 2FMUA 3F9IA 4FBGA 1CEQA 3ZWXA 1DXYA 2X5KO 4IDBA 1R0SA 3CUKA 3ENKA 4MVJM 3H5RA 2O7QA 4O5OA 3QWIA 1NQOA 3ZWMA 3H5NA 2H6EA 1I2BA 1DC5A 2D1YA 2YJZA 5JLAA 4L8VA 3D3WB 1IHYA 4YAGA 2E4AA 3A28A 1H9BA 1XA0A 3DMTC 3R3SA 3H7AA 3STHA 5A02A 5B4TA 4D0SA 1A4IA 3QLJA 4GH5A 4WCFA 4EW6A 2CVZA 4RPJA 2UUPA 3A1NA 2NVWA 2P2SA 4XIYA 1X14A 4RQUA 1I3LA 3ZWCA 3U4IA 1YBAA 2C7GA 4XYLA 5JYEA 2Q1SA 4AJLA 3AI3A 2GN4A 3DXFA 1ISIA 4GMFA 5K6AC 3DFUA 3BA1A 3ZWWA 3DQPA 4R54A 2QZZA 5JMPA 3NGXA 3GHYA 1GZ4A 4FB5A 3D5QA 4Q9NA 4YVFA 1OFGA 2NADA 4B7CA 1IOLA 2VNAA 1V35A 3RFVA 2RAFA 3RUHA 2Q1UA 1P0FA 4DWVA 5T64A 1E3WA 1V6AA 4RVFA 1HDYA 9LDBA 1YL7A 2EHDA 3NT4A 1D4FA 4OHUA 4UVHA 1QSGA
chains in the Genus database with same CATH superfamily
1XRPA 4N7MA 4CLOA 1YL5A 1DKMA 2GCIA 1BCSA 1NLFA 3RRFA 4XCVA 3VR6H 5DTQA 4BQIA 5I9IA 2JKZA 1JE0A 1N2CE 1K2WA 2GLTA 2EEZA 1ZWKA 3HEAA 1VKZA 3PQDA 1ZYUA 5ICMA 4WDQA 1JEYB 4YI5A 3L7MA 3R09A 2C00A 1ZNXA 3A0RB 3UK7A 3BCHA 4ZCSA 5LPNA 1GILA 1P74A 1XMJA 4RD1A 1E2EA 4UHJA 4X44A 5E9AA 1NUHA 5KO2A 3TKYA 3M4YA 4I1SA 5HGXA 4KIJA 4I4IA 3RRZA 1YS9A 1JB9A 1N0IA 1Y3FE 4L4SA 1M76A 3DF9A 4JIMA 1JHMA 3ZGXA 2Y4NA 4DIOA 5AESA 2V7WA 4ZO8A 5C46F 1IVNA 2A0UA 2QG9A 5AM1A 3AY7A 2E9SA 1C1XA 3A70A 2IY9A 4YJFA 5DULA 2HFKA 1SURA 2C59A 3OT5A 4BWGA 4M76B 1RBZA 1Z68A 4DLKA 4AZ3A 2BE9A 4XGRA 1W36B 4J7CA 3D1JA 5D3ZA 5ESDA 3L6BA 5B1IA 5GZ6A 3I2HA 4BWYA 3BK7A 3W1VA 1A88A 4XQ0A 4QUEA 3VUEA 1IHUA 1IDN1 1OH6A 1SG0A 4YJ3F 3BE4A 5DYGA 4BEBA 3JALA 5J4VA 2AGVA 4H7HA 3ILXA 2WHYA 4D5EA 1VJRA 4RTRA 4U2DA 4WEQA 3FYHA 5IBRA 4CM8A 3UJPA 4E7OA 1ZNZA 2I7TA 3N8GA 1HRDA 4CKYA 4JD5A 2PUAA 1UK6A 5J5VA 5ERXA 4NDZA 5KAPA 5E9JA 1Y9AA 4F11A 5KX5B 2GBLA 4JYPA 3UMYA 3IIJA 4ZOCA 3NM5A 5T6BA 3JQ8A 1TADA 3GJXC 4C6TB 4AJOA 4BE7B 1JDBB 3F5QA 1A2KC 5SZJA 4DSAA 2D0OB 2WTEA 2HA6A 3BJRA 2AT1A 4J91A 2A5GA 2O7NA 1EFAA 1IEVA 1KMNA 4G5RA 1TD9A 2XSZA 4Z4FA 1W36D 2G76A 4X0EA 1JH8A 4TKUB 5BV2P 1SA0B 3C3YA 2XAAA 4F4DA 3ZE6A 1SGWA 5IM5A 4QQKA 3M4ZA 1UF9A 1GQSA 1DBQA 3ETEA 4LJ5A 2ZRJA 3KK0A 1OB2A 1YHNA 2WF7A 1TF5A 1E0SA 3STXA 3TW8B 4DMFA 2RGCA 4CKWA 3DWFA 3UAVA 1GFWA 4Y2UA 2PZJA 4D43A 3FOAA 4IHJF 1Q0RA 2WZCA 3VC2A 2IU4A 1R0BA 1VJDA 4E6EA 4FN4A 2GD2A 5GONF 3T5DA 2AWOA 4LXQA 2B92A 1FU7A 2JGLA 1FXUA 3ADOA 2VHJA 3BXOA 5G0TA 3VH2A 1L1RA 3BHIA 1S02A 1XJ5A 3AUSA 3DA8A 3GCXA 4I1OA 4OJQA 4F8EA 4ZAVA 2VJQA 1ZMTA 2ZWIA 3STYA 5J4HA 3K20A 5ITVA 3D3KA 1GTL1 3OTIA 4UJ5A 1XFDA 1P9RA 5DVZA 5KB3A 1WAMA 2V54A 3CZQA 1F9AA 1XZ8A 1I1QB 3QMMA 1MT3A 4UU8A 2VCHA 1VMAA 5D85A 2J9GA 1PJ2A 2OZKA 1DIOB 1TNDA 4FZ3A 1DV2A 5EZYF 3PA8A 1PKEA 1L6IA 1IBSA 1LSSA 3K1TA 2CLMB 3QE3A 2DEUA 1K97A 2HV9A 3O4RA 4J0CA 1G38A 1TTTA 1HNNA 2PL3A 3LC7O 4ZD6A 3E5RA 1FF9A 1U8EA 2VH1A 4FQ5A 5TJHA 3F8WA 2QUBA 4B4KA 1Z0ZA 2ZQ5A 3CN7A 3FDIA 4KRGA 1VPVA 2J9XB 4L9WA 2JC3A 2HRZA 2PX8A 4KH1A 3CE9A 4KVZA 3ICCA 2PUBA 3DEHA 2VNJA 3A1VA 2FPLA 2BFDB 3C0KA 4DLUA 5T4EA 5F73A 4CLRB 3KIPA 2KQUA 4JLDA 1E66A 1QX3A 1H1LB 2P2NA 3AL2A 4J4BA 4L02A 4MP6A 5E4JA 3G5MA 1UANA 3ZX5A 2HTFA 3GNSA 1FX0B 3I01M 5JV5A 5AVSA 4ZO9A 2WICA 1W6RA 1WP9A 2OQIA 2P9QA 3AI2A 3KJGA 3MTIA 1H1DA 1WW2A 3LC2O 5FI0B 5IVDA 3X1YA 4KI7A 4Q03A 4ZVPA 5ICGA 5SYMA 5GJBA 1KOFA 4YP1A 1SXJA 3F0TA 4Y30A 3HCAA 4FHEA 4K9KA 4RTOA 1PJZA 3NM6B 5JBQA 1UPXA 3PK0A 3CJQA 5EJ9A 5K8VA 3RK1A 4LJ8A 5FEMA 1NW7A 1MAHA 4D8TA 3HVIA 4V0RA 3TSYA 3ANLA 2FZKA 2VNKA 5DYWA 1I24A 1B8PA 3BRWD 3U9TA 4NIMA 4HPXB 3W5IA 4OQMA 1DQPA 4FYWA 6REQB 4O4LA 4GC9A 3P1JA 1DMSA 1HFEL 1EM8B 1GVHA 1NXVA 1OFUA 3H1EA 3IURA 4LDQA 3WP0A 1YI8A 1G6HA 2VUTA 4AZ0A 2PL9A 3D6NB 1MMFB 2L18A 3FVQA 3IUBA 4NX2A 2QVXX 4TTQA 4UNQA 4OI4A 3HMQA 1XFAA 2RG7A 3VU3A 1CEEA 2G9VA 5MFZA 5LKRA 2FP3A 4MLDA 2AE1A 2HJWA 2WP0A 3WQBA 2DPXA 3FG9A 3RYCB 4O1HA 4L73A 1QFSA 4P4LA 1NG9A 2FWBA 4QUIA 1C29B 1DLJA 2F9MA 4M4SA 1LB1B 2OHHA 3FE2A 4HFNA 4JX9A 1NVTA 1PEDA 4X8MA 4V1CI 3BJMA 1I7QB 1O4VA 5KYTA 5EHZA 3K8ZA 3U5ZB 5A0TA 5D5HA 4EUHA 5GQSA 4DV3B 3MMZA 2ZSUA 2WB2A 1SIOA 1E0AA 1GAQA 2EERA 3REFA 4A6PA 2PBRA 3L2OB 2L69A 4HNVA 1VPLA 3FSJX 3IOMA 1QX4A 4R8LA 1AZWA 2VH5R 2Q21A 3F74A 1X7GA 2NV6A 4PU0A 3HU2A 1BDHA 1KKLA 3QFSA 3S1SA 3N07A 4FGJA 4FSDA 2XUFA 4QBTA 4WKGA 3JU3A 3IFSA 2EV9A 1ZOLA 3C3XA 4XD7A 4X61A 5A3VA 1QVAA 3P5BA 3QE4A 1KEWA 4IRUB 1P7VA 1LC0A 3IKLA 3K31A 4ZGBA 3D8NA 1C3VA 4RBNA 3QPBA 3GBSA 1MU0A 2WZQA 4L85A 4ZYTA 5B2FA 1YI0A 3QE0A 1NQTA 2I65A 3FKSD 1RFLA 1C4KA 1AU9A 1KJNA 2W83A 4B81A 4EJSC 1TQ8A 1YDGA 5CGQB 1PJCA 1GYRA 5G4KB 4CT4B 2OVFA 1O54A 2NYAA 1ILEA 4HF7A 4F4IA 4FLEA 1TOAA 5E3IA 3MWKA 3OUZA 4RULA 4CZ2A 3UK0A 1L7DA 5CFMA 1NUSA 3GLSA 2VDUE 4B33A 1V11A 1R6BX 3BFVA 3K9QO 3GQVA 4C2TA 2J0UA 2Z98A 1N7HA 1XVTA 2TYSB 2VP4A 3D4NA 4WOKA 4FDVA 1RI1A 1I7PA 3GQBA 4M9XA 5JNWA 3V3TA 1HDEA 3FJ1A 2F43B 3OEWA 2QU8A 5H70A 2CBZA 2BSQA 3BF7A 2GEUA 4XGIA 2AC2A 2J6IA 4YGYA 1ZN2A 4DMGA 4BMNA 3EZ7A 3BIJA 4K6FA 1L8XA 1P1RA 2P7HA 4BFZA 5ECGC 4OK6A 3SVTA 3AHFA 2Y6VA 4CDNA 3HLYA 1VYVA 4YTEA 2FSVA 1TMYA 1CYEA 1GNTA 1NQWA 1CU1A 4Q66C 4XASA 1F60A 5L45A 1IOZA 3QG1A 1DIHA 5AWFC 4DIUA 3N0WA 4P7FA 4IHQA 4OJNA 1YCHA 5AJVB 3UJCA 2E2WA 4X1OA 3P2YA 4B4WA 1T9ZA 4PZLA 5HZGA 3KQOA 1NQXA 1R4ZA 2PU7A 1U2RA 2JCYA 3QEJA 4MV8A 1XD2B 4OUDA 3KSDO 3QFHA 4XZ3A 3GX1A 5EIBC 1AKWA 2AVNA 1F2TA 1UBFA 4C0AC 5ICEA 3FFTA 1PLJA 2GX6A 2JJ1D 3FWZA 4KOAA 3VR0A 1PJBA 4RVGA 4E5YA 1JVBA 5CPFA 5JFOA 2FK8A 3E82A 3J81k 1LBQA 4PYNA 1A8QA 1O6ZA 2P2ZA 2RJ3A 2HHAA 2LVBA 4UDXX 1LSJA 1RRKA 1ZQ1A 4L8GA 1M0EA 3AEKA 3DV0B 5FLKA 1GKUB 2IXAA 3OZEA 1U4NA 4GX2A 2RHWA 4IJQA 1L4LA 4LMRA 4Y2JA 4UQPA 4N0MA 2OBYA 2B7BA 2ECOA 1TTPB 2WMOB 4ND4A 4HAZA 3QU4A 1OBVA 3EWIA 3RR2A 3UUFA 3UMGA 2GPYA 3W8NA 5JDIC 4RLQA 3UJNA 1E2IA 3L0DA 1C9NA 2CMDA 4PRKA 1VYUA 4ZYVA 4B48A 1UFOA 5HSGA 1A5ZA 3QKIA 4WASA 4CF3A 3DPSA 1J00A 2YWBA 1IEXA 2VP5A 3TAXA 5JO0A 1TUIA 5KJ1A 4AF8A 1ZGCA 4QDOA 1KSGA 2J1LA 4Q5IA 4P35A 1P6QA 1GA1A 1XLTC 1YUNA 2GZ1A 3L0BA 5GZ1A 1MJFA 4P5EA 2JFQA 2W8ZA 1KGDA 3PYMA 3WI7A 2ZB4A 4K6HA 3P71T 2YWFA 3WL8A 4ZHQF 4B34A 5KKNB 2D5BA 4IJ6A 4YAOA 3EAQA 3ZI7A 5CX4A 1ANKA 5TIIA 4B46A 2C4KA 4MGHA 3KT3A 3V97A 2HIAA 1Z9BA 5DBFA 1A95A 2AG8A 1XBTA 4UZSA 1Y1SA 1X77A 1XRMA 2BIFA 3QTBA 3ZUGA 2BSXA 2QZ9A 1EGMB 5DJ5A 1TAHA 5BXYA 3ILSA 4JNKA 4E46A 4YDHB 4RORA 3GEPA 1J8DA 4IHAA 4PLCA 3T3IA 1BXRB 2VOJA 1YE5A 1Z5GA 4UPDA 3IE1A 4KRFA 3HU1A 3LY7A 4EW1A 2QQ0A 2ZB8A 4MLCA 4NZMA 3RIXA 1AZTA 3Q7SA 4PX5A 4S0XA 3A9UA 1ISGA 1Z6XA 2P9CA 5BMOA 2WSSA 1OU0A 3ONFA 3TPCA 3EDMA 1O0CA 5HDQA 4RF5A 4M0CA 1FDVA 2NXEA 2RAUA 4IDDA 4KYIB 4Y6RA 4RKEA 3AOGA 1EEHA 3GT0A 2G7MC 5CDFE 1ICIA 5DK4A 4ES6A 1ZW6A 3H8WA 4EZBA 1WDWB 5JROA 1DT3A 1G20A 621PA 3SCZA 2WHPB 1Z17A 2HA5A 3QWAA 4YI3A 2JGRA 4DG5A 1JDNA 3KQYA 1QMGA 3PWZA 3ZXUB 4HVLA 5JWRA 1XDUA 3CWCA 4MRVA 2YZMA 1CUWA 1J56A 3VU9A 3DCNA 2JCXA 1Y5MA 2ZOSA 2AX3A 4FMCF 1LBHA 1SRQA 3OA0A 2FJPA 2UZ1B 3CINA 2G80A 4R4JA 5IDVA 5B6IA 5AVTA 3WRWA 1MJ5A 2JLBA 2OBLA 5HJ2A 3MBOA 1AMUA 1BD3A 2BSAA 3M1YA 3JD4A 3K94A 4YUWA 2GHRA 4EW2A 5B2EA 2Z9CA 4NYMR 4OHXA 1QNFA 1G60A 4DIKA 2FXVA 2EXXA 3DL4A 2FSFA 3VAAA 1NMZA 1RRCA 1NUTA 3IJRA 4ZI5A 1Q1ZA 3OFSA 4JHLA 2XXBA 3F78A 2ZGVA 1TPZA 4C0HA 5BMVB 1JG3A 1RQXA 2BBSA 2ZT5A 4QNNA 1K6MA 3IAFA 1KI9A 1QLHA 2R1VA 2Q3FA 3A27A 1BJTA 3F1LA 3OURA 4O0MA 4TLDA 5G0VA 5IPFA 1BKDR 7REQA 4WZ6A 5IJWA 3GGOA 5JISA 3PUZA 3BRWA 1KJZA 3VSAA 4DYDA 5DGXA 3N8IA 4FIZA 4CDGA 3DMTA 4H6VA 5KVCA 1JG7A 3K3PA 3I2JA 2BFDA 3BTUA 5AFSA 4IXNA 4DPMA 1VSQA 4CLRA 4AUNA 2F8MA 3F5MA 3PHHA 1M1YA 1K88A 3FFWA 3DTNA 5FTMA 1KZ4A 1JIKA 2C5BA 4QYTA 1KQOA 3OE7A 5EIEA 1TUBA 4TL8A 4ARBA 1X7HA 3TTSA 4PFJA 2Q5OA 3BX1A 3PD0A 4MR8A 1ML3A 4I9GA 4YONB 3SKXA 4EKIA 5K4GA 2E5LB 4B3SB 1QHYA 4B73A 3H2KA 1D3AA 3E5MA 1GTSA 1ZD5A 1XZMA 3FMPB 1EAMA 1QS0A 1W9MA 3H9BA 3OY7A 4HMOA 4LYYA 3EGOA 4UEOA 2H7CA 2ZWOA 3HJCA 3G2PA 3ZNQA 1Y6JA 3B48A 4TLBA 3X3HA 2YV3A 3WWZA 4KACA 1C7ZA 1T4DA 2F90A 1B16A 1T8WA 3QXXA 3TIGA 4A0HA 2CV0A 3UATA 4DIBA 1EUDB 1TJ4A 3P94A 3FOZA 3WGQA 2OXRA 3AZOA 3JW8A 4WJLA 2H9YA 1P75A 3F3SA 3N3BC 2VBIA 3G2OA 1RHUA 4K0RA 1KFBB 1CG6A 3MCAA 1CUUA 1R50A 1SBCA 4Q4AA 5ES4B 4JXJA 3GLFE 1JHDA 1Z56C 4EP1A 5KYUB 3CG0A 1U7UA 5BY2A 3AKDA 2UV8A 5EIXA 1SR8A 2CLCX 2DLNA 1LPNA 3D0KA 2Q3JA 3DDHA 1PL0A 3O38A 5KDLA 3SDSA 3VDNB 3ZXYA 1TF7A 3ROXA 3OCUA 1H5NA 3CZCA 4JP2A 4U4AA 3KVOA 4XA8A 4YDSA 1AQ6A 1GNPA 1MEOA 3NVDA 1HOTA 3LECA 3PEVA 4JC8A 2H00A 2OYRA 3NAZA 2ZFUA 3AW9A 4I4TB 4W5JA 3IP7A 5KNCD 2CCKA 3C8MA 3H3FA 1GT6A 1KI4A 1NGSA 2HAEA 3O9ZA 5J2UB 3OJXA 3ITEA 2OENG 2HK6A 1HKHA 4NJEB 2ZT7A 4B3IA 2HHLA 4PSUA 1JFFB 3HCDA 5AM3A 3AX6A 4HDOB 2X58A 1R0WA 2D8AA 3ZE1B 5JAOA 3TI7A 3W8DA 3EVNA 3K2BA 5FPQA 2QLJA 1F7UA 5B3JC 2JIDA 2EKQA 5JXHA 3QUAA 3I42A 2P9TA 4MKGA 3U3KA 4CLHA 1JBKA 3DS8A 3WZMA 3NJRA 4WJZA 3FOCA 2QTCA 2L82A 3QVGA 3DFZA 2H52A 2VAVA 1F12A 4ID9A 3HL4A 2NP7A 1JDBC 2IEYA 1DRJA 3UUEA 1Z2AA 1PYGA 3O8QB 3QGMA 2I3DA 2OB2A 2X7HA 1J8FA 3ZCTA 3FTFA 2YQ4A 2LCIA 1JH9A 2C2BA 1U98A 5L51A 3LUAA 3KKPA 4LXYA 4QYMA 2Q0QA 1AZSC 2IP2A 4IVQA 4UCFA 1IEWA 3K0AB 1PIWA 1D6SA 3F8SA 4UU1A 2VUUA 4OV6B 3E9ZA 4BNYA 4KSCA 2BWJA 1F5NA 1OXXK 4BP8A 1I14A 1L5QA 1XQ1A 3NQ41 2D74A 4LC9A 4R71A 4M0PA 3OM9A 1N2JA 2PUDA 1E9AA 2I2DA 4RHUA 1TM2A 4L6AA 3CY6A 1RJDA 3CH6A 2RKOA 1IY0A 2FZVA 1LI5A 2P2CA 4MGKR 2ROQA 1GJRA 1A3CA 1HM5A 2OLKA 4OM8A 1PBNA 4YGXB 4CYMA 3OAAA 2WYHA 5F12A 2VPIA 4O4IF 3QSGA 2EIHA 4YX9A 3D2LA 3ZNOA 1E2UA 2UYGA 2VIIA 3ICVA 2NUPA 3ZJ4A 1HT1E 1TZCA 3QKSB 1OXSC 4JT9A 3IUNA 1PQ4A 4E1BA 1MLDA 3UJAA 4QXPA 2ZRIA 4BQQA 2Z9DA 1M6HA 3QK7A 1M6VA 3U39A 1O89A 2HJSA 3AIMA 1XD2A 2KW5A 1I0IA 2A35A 1WUKS 2V55B 4RUKA 1HOXA 2G17A 3UFXB 5EIOA 1U94A 4E13A 5CB0A 3K1YA 1QF9A 2QE7D 1W1IA 2SKEA 3FVVA 3NJ4A 4I4LA 4JLAA 1Y1LA 2V7XA 3EUFA 1TMOA 4YQEA 2YJTD 3Q88A 3ZQKA 4BFTA 3OOSA 3UB3A 2P1RA 5CVTA 5LU9A 1NMEA 3SLKA 4ZYXA 2A9KA 3EPRA 1X7DA 4TXJA 2OCIA 3DC7A 4XWKA 2VP9A 4FS3A 4WXEA 5DOZA 3ICPA 4UTXA 4ITRC 3A1TA 2EYUA 3DZ8A 4ROTA 4Z7NB 5ADUS 2A0KA 3E61A 3UXEA 3ASVA 1IK4A 4J7XA 2I2BA 4Q3DA 4J9VA 3EVAA 1L1EA 4YJ2B 4A03A 1C30B 5I7WA 1I10A 5ULLA 5IDYA 1YR2A 4DLWA 4I66A 3DUWA 1G2OA 2P6RA 1J22A 3R2JA 2WF9A 3AUAA 4BNVA 4NY1A 5FL7D 3EAGA 4OPMA 3O3MB 5JCJA 4FNGA 4MVJA 2AXPA 3BPSA 1P19A 3KWFA 4B7XA 1IXKA 4LYFA 2HCJB 3QOFA 3L7OA 3AHHA 2V5VA 1M5UA 5B1SA 1U5AA 3SF8B 5AW0A 4B6PA 2B4QA 2JJQA 1IZ7A 3DJFA 3EVBA 2ZBRA 1TKRA 2IK8A 3H4VA 3KL2A 4OJMX 1QONA 1KEZA 4AN1A 2WUWE 2ZYDA 1BXRA 5AK3A 2JHCA 3LUHA 2VJBA 3ROMA 3P9PA 3BG5A 2ZROA 3FPAA 3NIGB 4JLMA 4S12A 3A6DA 4NNPA 4XSGA 3V42A 1IM5A 3ZY4A 1P91A 1NZJA 2IEIA 1UKYA 4QODA 2Z8XA 2GHIA 2IYVA 2C2XA 4Z4GA 4MP8A 4TLMB 3MERA 1G3MA 1QPZA 1FU4A 4R2XA 1V47A 4YDRA 4NECA 4UEKA 4AY3A 2WE7A 5EXSA 5EJIA 5CLHA 2KI5A 2YMPA 1II8B 1GKYA 3LXRA 1R8YA 4LECA 3IRUA 1BAPA 2BFEB 4XR9A 1O95C 3B1KA 4HAVA 3OE5A 5JG7A 3Q5GA 4XQGA 4AJKA 1ISHA 1E2GA 3JASB 4CRWB 1F3LA 3LYHA 4COOA 1V4VA 4JR2A 3H2HA 3THYA 1KU0A 1SO8A 3NHRA 2ATXA 3B3JA 4BUJA 1EQAA 3EPPA 3GPLA 2E4WA 1CY7A 1S3FA 1FBTA 1OV4A 5ESRA 1E1RD 1YJ5A 4QVGA 3DLBA 2NO0A 1LLUA 2MR5A 1NNUA 1M2WA 1MH1A 2PJZA 1LPAB 2JDID 2ZB3A 2VT3A 4MRPA 2CBGA 2OT3B 1ZR2A 2RGXA 1G2PA 2G1AA 1Z5UA 2R25B 2FW0A 3L9WA 4OM7A 1ZAYA 2JFGA 1MUUA 4GBJA 3RG8A 1UODA 2ACKA 3ZS8A 4EFLA 1XYVA 3WLEA 2FI1A 1E3DA 2C3MA 1SBHA 2W6PA 3FF1A 3NV9A 1Z5PA 2AI2A 2CWDA 3KVRA 3BE5A 4MWGA 4NOMA 3RU7A 3UW3A 2YS7A 4B6SA 4AF6A 4ALLA 1Z16A 1TO1E 3QUSA 1BDBA 3RQSA 1JG4A 1RYYA 1UFQA 3AH8A 4I1UA 2NU8B 3G8BA 2VBCA 3GUUA 4E15A 3QWFA 2PWZA 4AJNA 2OV2A 1VG8A 3QHAA 1ZBDA 1JDZA 1FFXB 2JGMA 4KN8A 3L6OO 2PZFA 4OQFA 3AHDA 3TDNA 3UWDA 5AVRA 3P4YA 4D8YA 4HNUA 1NIPA 3VSBA 1W4LA 1XWIA 4NXNB 2Q41A 3ZE7A 3UY4A 4UATA 3OIWA 5JUWA 4J49A 4TMTA 3X2FA 4EO7A 5AQ1A 1BRMA 3IAM1 3T3PB 4PPGA 2BT4A 2Z30A 5HBRA 2W6QA 3GROA 3KCNA 5B3AA 2XKAA 5A5GA 1MKYA 1MB2A 3TEMA 1VJ1A 3NH9A 4WBSA 5FR1A 2INGX 3KD3A 5IM4F 1GL7A 2JHAA 5D1HA 3ODGA 1UZUA 3FPFA 3M5DA 1XTSA 4N5HX 2Y93A 3HI4A 3Q7RA 2CMGA 4L2IB 2PSHA 4QARA 1IHOA 5KNCA 1LXCA 2GRJA 3LBAA 1LU9A 1TGVA 5JNTA 3WBJA 1RBMA 2OCBA 3CX6A 1X7YA 2NO5A 4QHYA 4BTVA 3AKZA 2B6HA 3PKIA 4M2LA 4V1CB 1VG0B 5FF9A 1UK9A 1ZNYA 5GJVC 1K4YA 1SM4A 3BQNB 4D4KA 2QRPA 1HYQA 4D7AA 1IY8A 2C3YA 4O25A 1IQ0A 4KXVA 4X66B 3GLQA 1KAQA 4UE3S 5K05A 2B4KA 3E6AA 3SEZA 2O05A 1PUJA 1X8JA 1QKIA 1ZJJA 4KKXB 1GA4A 4BP1A 1KEEA 4EHIA 5BYBA 1MAVA 1ORWA 4O8ZA 3F6PA 3D2CA 4MW7A 4REQB 2G5TA 4WXHA 4Z0PA 3UWOA 2CY0A 3GT3A 1JMVA 1ZM2A 4JVLA 2JBAA 3BB4A 4MKIA 4PFSA 3W2GA 4EHAA 4ZC1A 1TEZA 4KBFA 2R79A 2JFHA 4MYCA 2HMUA 2IDZA 4JOBA 1MX1A 3RUDA 2ORED 1UUFA 2I66A 3FBGA 4F60A 4J1NA 4WHMA 1PNRA 5E6SB 3DAGA 5AP9A 3H1PA 1U8XX 3NC0C 4UDNA 1JFFA 4GLFA 1QHXA 4FYVA 3T1VA 4JUBA 4L76A 1J2TA 1CQIB 1AK2A 1KO7A 2CGEA 4WWHA 2DT8A 3S1AA 5LDHA 1H2BA 3G79A 4L74A 3WB1A 1K3FA 2ENWA 4BNKA 1ATZA 1C1DB 1U7TA 4IRMA 4AJHA 2GS9A 4O4JA 1FDWA 4RMHA 1YI1A 5GAJA 3GJ0A 1WHTB 5ILQA 4MRAA 3C3PA 4JROA 1NV9A 1V3QE 2FPWA 4LGMA 3U1TA 2DQSA 1ECGA 1JKJB 3T7DA 2BJWA 1U28A 2B9VA 2QL7A 3WDSA 1AZLA 4CKCA 1XWWA 3K09A 3OHPA 2VWPA 1T9CA 3R20A 1YJXA 5BSGA 3S2EA 2ZBFA 6ABPA 1QHNA 3OI7A 2G82A 1W25A 4UHFA 2ATVA 3Q8KA 2XUAA 5I7AA 4X65B 1D5WA 1Y33E 2AMJA 5CVUA 4A16A 2CLOB 2ZJ3A 1Z3IX 4C22A 3TSCA 1SN7A 3T1TA 4RFSB 2MSDB 4GP6A 2V45A 4G0UA 4KX5A 2AFHB 1JAXA 3WHPA 3GRZA 3FGNA 2P2LA 1AHHA 2C4NA 1NVXQ 4M89A 3E22B 1VHWA 4A8HA 3MELA 4MKXA 4NK4A 3CURA 1G5FA 4RL6A 3PNBA 3BMCB 1MOZA 3KDPA 3WY9A 3RO7A 5EJAA 4D6PA 2FFJA 4WKBA 4DQUA 1CZKA 1WF3A 1YZLA 2O1EA 2EU8A 1WDKA 4EX6A 1CNFA 2P30A 3I30X 1LQ2A 4F2HA 1IZ8A 4Z5XA 3S8EA 4NICA 2Y1OA 4RENA 2WU4A 2MT9A 3NOOA 2BM0A 2C7QA 2J31A 5GV8A 1U9CA 1WVIA 1FS4A 1G3IA 2P3OA 2W2QA 4LJSA 3R9KA 1RYZA 4NYIR 4XX0B 5F9FA 4LHVA 2GCPA 8OHMA 2NO1A 4L5CA 2H2GA 4XJTA 2O2YA 3Q3GE 5FR2A 3CRW1 5NLLA 1X80B 5JBNA 1LWNA 3V34A 4IKEA 1DRUA 5K0BA 3L05A 1SC1A 4K9RA 4L9AA 3K32A 4B2IA 1N3YA 1UBJS 1XXHA 1N5KA 3HKDB 3KUDA 3FCYA 4BS9A 3SLGA 3AL0C 4ZTUB 1Q7TA 1Q50A 1WZNA 1U8TA 4OB6A 4BX0A 3PXUA 3EOAI 1GG5A 4HLUA 1KDOA 4NH4A 4LE2A 1E6UA 2JHFA 3BAZA 2RD2A 2XXAB 1NU8A 1DV1A 1QZ3A 3CF4A 3MS4A 3C2QA 5KYYA 4QBFA 4YJ2A 2C9MA 3OOYA 1U0BB 2QVYX 1L7QA 1Q14A 2QTRA 4C4TA 2DH5A 2MYPA 4EY5A 1NJGA 3ZGVA 3S8YA 1FTQA 2C7VA 2DOKA 2XDYA 2I6TA 1YDEA 3PPYA 3CLTD 1TYZA 3P2MA 4KO8A 1XVVA 5HHTA 3NC4A 1RLTA 4IMJB 3PJFA 3Q7QA 1IWOA 2CHUA 5FA6A 3C8DA 4B6QA 2R6ZA 2X7XA 1S3SA 3CT4A 3LQYA 4KGZA 2NXCA 4MS1B 4X45A 4BQPA 4TYNA 5BWMA 4FMBB 2H07A 2NMVA 1N7JA 1U0SY 4OQNA 4UUNA 5JFGA 4DEYA 3AEUA 5DXFA 5BYJA 3F6EX 3UXHA 1QU3A 2E4YA 5K3OA 1CR0A 3CZAA 5L3QB 2JVKA 1Y6RA 1WTCA 4PXYA 1AJEA 1CJSA 4PVCA 5HZHA 2PRZA 3SQLA 1RZVA 1G66A 1YBHA 3OQJA 4HQKA 1KYZA 4LS3A 3AOEC 3EIOA 2GKSA 3MF4A 3ZH9B 2OD9A 1LNZA 5CYOA 5EQFA 2JFVA 3V1MA 1G6OA 3AU9A 1GLVA 1E94E 1MQSA 4O59O 2VRNA 4FVTA 1Y7TA 4C07A 2C2GA 4KZPA 1CJMA 1YVPA 1DWPA 1AGNA 4MARA 4BBAA 3JAKB 1T3LA 1R00A 5IKOA 2CBXA 4BNZA 1N9GB 1ZZEA 2FLKA 4HT3B 4XAQA 4NEGA 2J08A 1TA4A 5JVDB 4CUKA 4LJ7A 3HBNA 1ADCA 4BATA 3T5BA 1B3BA 2XRMA 3G8DA 3HBLA 4NPAA 4QUDA 5LFAA 1U9IC 4EPTA 1NVAA 5NULA 3IVCA 1HX7A 1ZJZA 1WXQA 4M0KA 1E3MA 4GE3A 1V1RB 3EYAA 4IXDA 1IB0A 2O54A 1QZZA 3IHKA 1ORHA 4PGMA 2HSEA 4CM6A 3EXIB 3G23A 4OGGA 2YHUA 3DFMA 1UT5A 3DEIA 3ET5A 3FDJA 4AN4A 1NBWB 5LB4A 4ZMSA 1EPUA 1I4WA 1DIAA 5GGYA 5GM1A 1DUIA 3JWPA 4FFSA 2FRXA 1E3QA 1EFTA 2R2AA 2DETA 4ZZ1A 5C1OA 4KQEA 1TKAA 5CB4A 1Y9ZA 3MCTA 4LA4A 3ZN2A 2W42A 2X8AA 3QMVA 2ZITA 1XJ0A 2HMAA 2QUJA 3RKRA 3OLYA 1QOPB 5AK5A 2D7JA 3IJ5A 3U17A 5E1DA 4Q9LA 4BLTA 2UXBB 3MCVA 4PLVA 4ZT6A 2OQVA 3WLPA 1FCJA 3CLRD 1BOOA 1B6GA 4DLNA 3KAKA 1JLLA 1VI6A 4HEA6 4URUR 3SSAA 4B3TB 2B5WA 1T6XA 1KY3A 1X1BA 2QMHA 4HVAA 1Z25A 2J9ZB 4M1QA 4AX4A 3X1JA 4ZI7F 3JQEA 3L41A 4IDNA 3LBNA 2PHZA 2AFIA 1YVUA 1O5IA 3W7BA 4M36A 1AUOA 3V6LA 2J85A 4D3XA 5TE9A 1ZLYA 5AK4A 4MQFB 1VG9B 2QN8A 1KDVA 4CDRA 3ZEAA 5KSWB 4KPFC 1RU3A 2W2PA 3ROTA 4BFUA 4BNIA 4YV2A 2Z6AA 3H99A 1F38A 4P84A 1IJBA 3F9CA 3VNSA 1WKBA 3HR4A 4G26A 4HYTA 1YA4A 2DF8A 2CYAA 1M1NA 1RYNA 3BHJA 4N5NA 2XQIA 2VAWA 3HO6A 1OWNA 1M34B 2P4EA 5IXYA 2P90A 3SZGA 1HBJA 2QB5A 2EGGA 2VS1A 1T5OA 4HOYA 2NVOA 4IDQA 2A5LA 2YMQA 4V1CA 3B53X 1XQVA 1KK0A 3VKHA 2XF8A 4OUKX 2ATCA 3TX2A 2O7SA 1IQRA 2QRUA 3EN0A 3EW7A 3WDMA 5GIPE 1W581 3GJ3A 3OIFA 1HY3A 2HXYA 5JDCC 3RS2A 4PS0A 1YDHA 5E9WA 5EHGA 4HXFB 4A82A 4Z4IA 2QR5A 1NRXA 4PPQA 5E4FA 4ENRA 3P7MA 1AN0A 5M3BA 4NZNA 4BCBA 1XCMA 2Q0HA 1G8MA 4D26A 5JCXA 5HMMA 5HQ3B 3K0BA 4IIHA 2I7VA 5DX0A 5FJJA 3OD1A 1YMVA 4JP3A 1X3LA 5IK2D 3RS3A 4LSWA 3U9LA 3KSUA 1W36C 4I4CA 4WQMA 1KJYA 2PX2A 2OXIA 4DNPA 1A8SA 1GY8A 3M1LA 1M6EX 5CFNA 2D3WA 4TL9A 3RJTA 1LBSA 1IAVA 2C9BA 4H9GA 2J32A 1N9ZA 3N8KA 2Q9UA 1X8KA 1DDGA 1UBOS 3UCEA 3TFOA 4DLVA 1PTJC 2C3OA 4TM8A 4A27A 2Q62A 2ANBA 5E6UB 3ZH2A 2GD0A 3ZDAA 2F1JA 4UEJA 1D2MA 2JVJA 2EP5A 4WEOA 5CYGA 1ZFNA 2BBOA 1A7AA 1G5IA 1OX4B 4US2R 2BHSA 2BCEA 3ONVA 4IVPA 4LHWA 2R4QA 3R8CA 3ZWQA 4CM1A 1OI2A 2FVXA 1PTKA 2Z95A 1C50A 1HG0A 4I9NA 3TLGB 3HNPA 4L5AA 5D00A 4W5WA 3U19A 4IJUA 3KOUA 1QO0D 2PK3A 3OIVA 5AOAA 4BNTA 5K0ZA 3ZI4A 5ELXA 1P6XA 2OXEA 3D43A 3MUNA 1S7CA 3NEYA 4J2TA 3DYVA 3NBXX 3BEOA 1OTXA 1Y8ZA 3CNBA 1F0PA 2LZ0A 1B3RA 1M2JA 3AHGA 1J9ZA 3CRVA 2VZ8A 4AB1A 1QGUA 3MS7A 4WLFA 4X84A 5BVHB 2XMPA 3MJTA 3OHSX 1ODKA 2QVBA 2YVQA 2BFCB 3L82B 4KVAA 2IZZA 2HHCA 3MN1A 3NEPX 4JBLA 3DDUA 2QMUA 4YMVA 5L4SA 5LQJA 1I3KA 1TM1E 4PHFA 4NRDA 3VR5A 1RRFA 4WPGA 4WNAB 5I51A 2WINI 3N70A 3RROA 1WV0A 4GYJA 3UEOA 2BMVA 1U7WA 3MLBA 1Z5ZA 4EZIA 5K6AA 3IHLA 1KMMA 3EGIA 3OZGA 1N34B 3CLHA 2ZWMA 2HCFA 1IJKA 1O94D 1W5EA 3NBFA 4FT2A 2C2OA 5G02A 1VZ2A 3LF1A 5TPWB 2GF2A 1KVUA 3S7TA 3SBOA 5DW3A 3AZQA 1DTEA 3IBFA 2JAXA 3ZWDA 4WFKA 5J63A 1PDOA 4G86A 1EX7A 3G2IA 5LLDA 3W6UA 2AR9A 1SQSA 2WIBA 4GRIA 1IE3A 1CJTC 2FZ5A 4HDKB 3TX6A 3CCFA 3NIWA 2ICAA 1G9SA 1RZ3A 5FOTA 3ETLA 2YWJA 3UJ3X 3WZLA 3KZCA 3LXUX 4FYXA 1QUEA 1T9GS 4M21A 4NENA 5H3HA 4CCSA 4EFMA 3LTNC 4DT1A 4LRTB 3J7TA 2CC2A 3RU2A 1R0YA 2KLBA 2MINB 2J4FA 3O84A 4JLKA 1JIIA 1NYTA 1NUUA 4PZDA 3MWDB 2AJDA 1OKKA 2GJKA 4RPIA 3PHIA 1V71A 1Z4IA 4GL4A 1UAAA 3FETA 1YU6A 2WSBA 3OQHA 1UMDB 2FFAA 1EIZA 3JYHA 3PC7A 1UXIA 4QJBA 3OM8A 2C94A 1J24A 2GNAA 4KXFB 4XDGA 3B6JA 3HKDA 4MW1A 4QPDA 4QXQA 2BEVA 4DJDC 2ZZMA 1ODIA 2O20A 5TPZD 2NZYA 1WDTA 1YUMA 3EA0A 3HCEA 2CL6X 3NKLA 3ULKA 3UBMA 5KYXB 3CCBA 1XTVA 5CFRA 2PRYA 2D06A 2FCRA 2WFZA 2HXSA 4X7MA 2YRXA 5ABPA 4L4XA 2ZIZA 4RKFA 4NFLA 1P2UA 2QSZA 3T34A 1L5ZA 4P4TA 1KWKA 2O1XA 4NCHA 1C3OB 5IEBA 4L9RA 5ALZA 2HJRA 4Y6OA 1H8HA 1T9AA 1XZGA 4AJEA 3FTPA 4RY8A 4DJAA 2KE5A 3RCBA 4GHWA 1ESNA 4K2AA 4QBGB 1FSPA 2RHBA 3RASA 1IBCA 4QU9A 2HRDA 3DV9A 1GVNB 3GRAA 4HQOA 4R8RA 4ALJA 5KSYA 2V9PA 1V4NA 1AMOA 1OHHA 2SCUA 4FFOA 1RWQA 2LP4Y 5AI6A 3VTFA 3R9IA 2FWPA 4HPWA 4NEQA 4EH1A 1DWQA 5F2NA 4PO3X 2EZ9A 3A1DA 4LYGA 1NW9B 2LKCA 3F7NA 1I6WA 1UT8A 2G9QA 2HU5A 2DQYA 3O92A 3WBBA 5FQNA 4ANFA 3R3XA 4JQCA 2ZW9A 3GVIA 4C0LA 3KWLA 2EATA 3I2KA 1GTZA 2A3RA 4A0SA 4XOIA 2FJUA 1DBSA 3WYDA 2WA1A 4F9FA 3C3CA 3E27A 1L2TA 1TT5B 3FFXA 4FD3A 1GKKA 2H0AA 5F7ZA 1KDZA 4B43A 1BG6A 1YJBA 1MO4A 4A5OA 5K0LA 1F7VA 3PJRA 2HA7A 5LUAA 3CSUA 2XCTB 3CLVA 4O4HB 2PD6A 1E2FA 3L8GA 2E4VA 1Y8QA 4HLDA 5BSFA 2FKNA 4B6GA 3KQPA 3UHAA 4GDFA 5JVDA 1NP3A 2G9ZA 2H9IA 4KUEA 3R8FA 3DE6X 4G9GA 4P4UA 3RJMA 3RSZA 4LYAA 2OMKA 5TXGA 3Q8WA 2BI8A 4Q7MB 2SECE 4H4CA 3N0VA 3IAEA 2O57A 4UUMA 5IJXA 2XE4A 3W34A 4CV2A 3D3JA 2OTCA 4XEUA 3WQHA 5I45A 3L8MA 1EVLA 4H7FA 4JAVC 1Z0JA 1OZ0A 4GQIA 2FMFA 3OOEA 5A1TA 1PYOA 4Y2PA 3PRYA 1VHLA 2YZNA 4EB3A 3EZ6A 4KQFA 3S27A 2GXSA 3ZS9A 1KYIA 1AKUA 5JSKA 2PDAA 4EB6B 2XT0A 2IQ5A 3LFTA 1C5KA 4Z1MA 3TD6A 2JD0A 4MROA 2PV7A 3AIOA 3G2QA 3PR2B 5ITSA 5JHGB 2GM5A 4EIWA 3PYLA 4FU0A 2JRCA 2Q46A 4MUXA 3HKEA 5KVVA 3CVWA 5BT9A 4QOFA 2QLFA 5FA8A 4MI1A 4HNGA 3M5WA 4CMKA 1K9VF 1Z8NA 4BVKA 1P72A 2F48A 2NXWA 2QQEA 4HADA 3HRIA 4Q1CA 3V6MA 1UADA 1B41A 4KXLA 1Y7HA 1SUIA 3PKZA 3QI7A 1VE1A 4LVOA 4D41A 4UKDA 4KWCA 4LNAA 3H2GA 4Q1DA 1EKXA 4C04A 5IKEA 1H4QA 1VMDA 4MB6A 1PL7A 5DGHA 3SBDA 3ZCSA 5A9SB 2ALJA 3H16A 4JWTA 1KNXA 4M37A 4ALKA 3NT2A 1MRNA 4RW0A 4WLOA 4YJGB 1CTQA 4P33A 3ZZMA 1DPFA 1NP7A 2WAOA 3B9RA 4MQFA 2IV2X 3ZHQA 3ZV4A 4TV9A 3AVYA 1L5FA 4BLUA 1DMRA 4EUKA 4KVFA 2NV2B 4I6EA 2EKLA 1XCBA 1QIHA