3BMNB

Structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor (compound ax3)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
267
structure length
252
Chain Sequence
b'EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase
molecule tags Oxidoreductase
source organism Trypanosoma brucei brucei
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
total genus 89
structure length 252
sequence length 267
chains with identical sequence C, D
ec nomenclature
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3bmnB00
2W2KB 3JYOA 2P9GA 3H9JA 4RL6A 4BO2A 3WNQA 3JD0A 1KVQA 4FCCA 5GZ1A 2Y93A 1MFZA 2PGJA 3VTFA 1NTOA 2J8ZA 2OO5A 1IHXA 5I8ZA 2WD7A 2PKRA 3GMSA 2O3TA 1E1NA 3LVFO 3GH3A 1SEVA 3E8XA 1UJMA 4GSKA 3S55A 2VCYA 1ZO8A 3F46A 1P1RA 4DXHA 1E6UA 1T26A 4XQEA 3EGOA 3OM9A 4CQMA 2QG4A 3GGPA 4FIZA 4Y67A 1QORA 3ZWMA 2EW8A 5AQ1A 2GN8A 1YVEI 4B3IA 1QXSA 4PZDA 4GAEA 1N8KA 4E30A 1TT5A 1ZCJA 3EZLA 2DKNA 1Z45A 4N5NA 2EEZA 5EIOA 4ALKA 5A4DA 3KSZO 5K9ZA 2NVUB 1RYEA 3ABIA 5I7FA 1EEHA 1T25A 4PG6A 5TF4A 4CMHA 1BMDA 4ALNA 2BGKA 3BMQB 2X1HA 3MJSA 4LVCA 4B7UA 3JYPA 3AUSA 3V1UA 1V3TA 1FXSA 4IDBA 2DAPA 1AXGA 2PD6A 4DIBA 2JFGA 3ZHZA 1YQXA 3NDJA 3TZHA 1JLLA 3AW9A 3WS7A 3PFWO 5FI5A 4PZCA 3CZRA 4CLDA 5I8WA 3A28A 4OXYA 1I2ZA 1BHSA 4IIVA 3BHIA 1LC3A 2B4RO 2W90A 1HYHA 3FHLA 4L0QA 5HA5A 4CMKA 2X58A 3OH8A 1JTVA 2Q3EA 2I9PA 4DIFA 4RVGA 2VTDA 1I33A 5ICSA 1DJQA 1U8FO 1JKJA 4WCFA 1O5IA 2PTGA 3BXXA 3OA0A 3LLVA 1RM4A 1E92A 3L9XA 4IBOA 4YRBA 4RZIA 3DB2A 1NQOA 4M1QA 4WOKA 5KKAA 3OHSX 2B37A 1NYTA 1N5DA 1EVJA 4GH5A 4M87A 2C2XA 4B79A 1W8DA 4PGFA 1EBUA 4B8WA 3FR8A 1Z73A 4GBJA 4GMGA 3ETEA 1FK8A 1LLDA 4XX0A 2J5KA 4I9NA 3SX2A 2JHFA 1KY4A 3FWNA 2J6IA 1U7HA 2CF6A 2WD8A 1GADO 1NBOA 4BNYA 2FMUA 3RC2A 3C3XA 3KOUA 5CDTA 2W4QA 2X0JA 3ROPA 1VSUA 2FR8A 2NLOA 1OAAA 5L95A 1UP6A 1PJBA 5EJ2A 1IOLA 1CYDA 3WTCA 3ANMA 4WEOA 3HQ4O 3PYXA 4HX5A 3TFQA 2IZZA 3WFJA 2E49A 2EKPA 2P5YA 2CNBA 3ZV4A 3JD1A 4UVEA 3SVTA 2VQ3A 1R0KA 1PL8A 3IJRA 2OGUA 5TSDA 4CM9D 3I9JA 1V9LA 1Z74A 2VNSA 3H5NA 2CF5A 4F3YA 3NKLA 1WP4A 4IZHA 3GNTA 1QG6A 3OETA 4NFYA 2D5AA 1D3AA 1FJHA 4ZVVA 4W99A 1KEUA 1GY8A 1UR5A 1EUCA 4II2A 3EVNA 1HDYA 3SXPA 4I08A 1DAPA 3A9WA 2Q45A 1OBFO 1NP3A 4C4OA 5IDYA 2IYOA 4Z6KA 1O8CA 1GPJA 3JQBA 3BTVA 1HL3A 1OFGA 3DBRB 3RUAA 5KOIA 1T1RA 4LISA 5KTKA 3VPFA 5JXWA 2C0CA 3C8MA 4ITUA 5AXCA 3IDSA 4MVJF 3GMDA 1GYRA 3EVTA 5LDHA 4UAGA 4EEXA 1Y5RA 4H7PA 4I9UA 2Y99A 1VLLA 2EJVA 3ICPA 3G1TA 3KM0A 3ITDA 3PPIA 2VT2A 3EK2A 1N1GA 2PKQO 3LT1A 3DHYA 1ZK2A 5JDIC 2Z5LA 2GDZA 2ZYGA 4GSLA 4HUJA 4MVJP 4AJ4A 5KJCA 2P9EA 1BW9A 3DBHA 4NJMA 2Q1TA 1VJTA 4CMJA 2DVMA 3E1KA 4R16A 2RBEA 4XCVA 3WYCA 4HADA 2XOXA 2D2IA 2HRBA 5AOVA 3FN4A 1T4BA 3IOYA 4MO2A 3W4IA 4JN6B 4L4XA 1ENYA 4TSKA 1IYZA 4IDAA 3GHHA 3QQPA 3WYBA 2I65A 4PRKA 1DBVO 4RJTA 1ZXLA 2X4GA 4BOYA 4DWVA 2Q46A 4KOAA 3ZNNA 4CQLB 2NU7A 3ZU3A 3RAJA 4IJVA 4EJ0A 2G76A 1GCOA 1K89A 1H2BA 5HRUA 2Q50A 3PTZA 1GUYA 2AEFA 2GRAA 1EVYA 2B0JA 2Y66A 3TNLA 3KYCB 4BNTA 1H6DA 1NPTO 2DLDA 5JO0A 1H5QA 4TRRA 5HM8A 1Q0QA 2X0NA 3F6YA 1YRLA 3E03A 3UFXA 2R00C 4CQMB 4NJOA 2BKAA 1T2DA 3L6OO 4PLYA 3UN1A 1I2BA 2VYVD 3UXYA 3VZQA 4EUEA 1VL8A 1GUFA 1PZEA 1NVTA 3D4OA 3D7LA 5A5EA 4FR5A 3AY6A 4YQZA 4K6FA 2BI7A 2P91A 2WD7B 5A3JA 5F1PA 4A10A 3S2GA 1LJ8A 1MUUA 1P1JA 5G0UA 3RFXA 3VPGA 4A73A 4CMAA 2NU8A 2CD9A 1KY5A 4OSOA 4CUJA 4XRRA 3DZKA 5ITVA 2Q2VA 4CLOB 3T4EA 1V8BA 4XR9A 3ROKA 1BTOA 3ST7A 1YL7A 2HJSA 1NHWA 2O7QA 1C0PA 4C7JA 4BGUA 1LNQA 4MIEA 1BXZA 1C0KA 3UUWA 4B4WA 2CDAA 2YHIA 2Z95A 5IZCA 1ZIDA 4LRTB 4EJMA 5COAA 1FDWA 1A9ZA 1LRJA 3I9NA 4E5PA 1J49A 5JNLA 3GGOA 1DRWA 4DLLA 4BMNA 5FFFA 3HZZA 4DL9A 3H4VA 1ISFA 1P1FA 1SNYA 3D5QA 2NM0A 1H2HA 5A06A 3BHMA 1U1IA 3B1KA 2NTNA 1YBVA 3CZMA 3H65A 2NSDA 1N9GB 4PLFA 1P9LA 3H3JA 4BNHA 3I4FA 2FHSA 2D1YA 3O8QA 2XAAA 3NV9A 4ROSA 3WGHA 2PR2A 4D45A 3MJCA 4OXKA 1HRDA 1ZK4A 2V6GA 2WE8A 2OL4A 5LCXA 3CPSA 4KMSA 3FWZA 4BKOA 2GF2A 2VN8A 3C1TA 3L77A 4E5MA 1XIVA 1IY8A 4R54A 3GT0A 1E3WA 2QX7A 3ORFA 2HK7A 1Y8RA 4HWKA 1DIRA 1AUPA 3BA1A 2O3QA 4URFA 3U3XA 1YOVB 3TRIA 3IUSA 3W4JA 4AJLA 4E2ZA 2NACA 3WIEA 5ER6A 5JCXA 2OP1A 3L6DA 1FF9A 4BO0A 5L4NA 3MJEA 5J23A 3DFZA 3JYLA 4AJ1A 4J4BA 5BSHA 3MWEB 1MLDA 1LDBA 3WGIA 4UVGA 3ONEA 2B36A 1ADBA 4PRLA 4DIOA 1P0FA 2C7VA 2YUTA 5U1PA 1QYCA 3JQAD 1PL7A 4N18A 1ISJA 2HMVA 3V2HA 3CKYA 4CMIA 3UCFA 4DMLA 4OYRA 4D3FA 1A9YA 3HDQA 1EQ2A 1UZNA 2X8LA 3HN2A 4J1NA 2QHXA 4N54A 3LT4A 3EYWA 3RU7A 2R00A 1KC3A 5B4VA 3PDUA 1PGJA 4WPGA 3TWOA 2VHYA 1RPNA 4RF4A 1I5RA 4XGKA 3ENNA 5L9AA 3S2IA 1VL0A 1XU7A 5ADHA 2WEKA 2QYTA 5IDWA 1U9JA 3WWYA 3TPCA 4F6LA 3DAFA 1JAYA 1D1SA 5ENDA 4ND5A 4ND2A 3BMNA 1RJWA 3CE6A 4J91A 1JDJA 1EE9A 1XELA 3KYDB 5U4QA 4HP8A 1P44A 5DN9A 1PGQA 2X86A 4CM1A 1Y9EA 4JJIA 4YAEA 3TZCA 1XKQA 3GEMA 1LLQA 2C20A 3F3SA 1NWHA 2FR0A 2YDYA 3E48A 4FS3A 5TRTA 3RUCA 4B3HA 1E7MA 1YBAA 2GGSA 4IQ0A 2ZB4A 5B4UA 3DQPA 1HLPA 3WLEA 2X7HA 4CMCA 2W2LD 3C7AA 3DC2A 2RAFA 3JQ9C 3QSGA 4JK3A 1DIBA 2YZ7A 3W8FA 4MIOA 4OKNA 1PZHA 3JQFA 4FFLA 2IEBA 4RQUA 2Q1SA 3P7MA 9LDBA 3ZU5A 3E18A 1K5HA 3NRCA 5G4KB 4WOJA 5JBIA 3FTNA 4H15A 4XQCA 2HMWA 4OGWA 5G0VA 2HMSA 3KV3O 4E2YA 4J0FA 3TSCA 1HKUA 1LX6A 1H9BA 3VHRA 4WLUA 4FFPA 1WW8A 5TJHA 1XEAA 2RIRA 3QHAA 3JQ8B 4LCEA 4QTZA 2E82A 4CV0A 2CY0A 4ZQBA 3HJAA 3LC2O 4WGGA 3V8BA 4BO8A 5B37A 3LF2A 4CQLA 1PR3A 2Y0EA 1E3IA 3S1LA 5KJFA 4IUYA 3OSUA 3FNGA 3C1OA 4HFRA 4RVDA 3D0OA 3JQ6A 1GV0A 4CMEC 3AWDA 2CVQA 3PLNA 5EESA 3V5NA 9LDTA 2NUAA 3D3EA 1XYGA 4L9RA 3RCBA 1R37A 4Y9DA 2O23A 4LSWA 4GVXA 4Z3DA 1WZIA 5JFOA 2VYNA 2VHWA 4BO9A 3ETDA 3K6JA 1M67A 3ZDFA 1O6ZA 1UAGA 5JLAA 3KVOA 2ET6A 2Y1OA 4ZQEA 3ZWVA 1PJ2A 5A5FA 1H6BA 4RGBA 4M49A 5IXYA 3I6QA 3AOGA 3HDHA 3TL3A 1PJ3A 1PIWA 1A7KA 1Z7BA 3SJ7A 3WR5A 4B4OA 2GERA 4DREA 4JX8A 1NQ5A 2DFDA 1CF2O 4ZRMA 5BT9A 5C5IA 3I52A 1N1EA 1D1TA 2RH4A 5HTOA 1PEDA 3R3SA 4YJFB 3RROA 1HF3A 2CUKA 3AI2A 4L73A 4NBVA 5G0WA 5JMWA 1I3MA 4XZ3A 1P33A 4DYVA 1X15A 1MP0A 2OHXA 4FN4A 1O95A 1LA2A 3WBFA 3DBLA 2VHXA 3U4IA 2BFOA 5FYDA 1F06A 1CERA 1ADGA 1CDOA 2DM6A 5JY1A 1S7CA 1Y1PA 3K30A 5GZ3A 4LCJA 2PZKA 3KXDA 1M6HA 3UVEA 5JAMA 3PIDA 1W73A 2Q1WA 5A05A 1WPQA 4CLXA 3W8DA 1Y8QA 1ID1A 4W82A 1N2SA 3E5RA 1KEWA 4NPCA 4IJWA 1EUZA 3GR6A 4I1IA 3W1VA 1A27A 4YR9A 4MOWA 5I9MA 3WGGA 3JQ7A 5L40A 2ZK7A 4IY1A 3VPHA 4J3FA 2AA3A 2UUOA 1IUKA 2GCGA 4PN3A 4A5OA 4R5MA 1IB6A 2O7SA 3FCOA 3WWZA 3NT5A 2PLAA 1TT7A 4L8VA 4BNIA 1GQQA 1GQYA 4YJGB 1EMDA 4NR0A 2V6MA 5ENVA 2UAGA 2P68A 2ZB8A 1HTBA 2OMEA 1E7RA 1HDRA 5G4LA 5L4SA 5A04A 3KZVA 4TROA 1T2CA 1E7WA 4EW6A 3TOXA 4FGWA 1EVIA 4TRMA 5DP1A 1X0XA 3LK7A 4XWYA 5B12A 4ESOA 3RUIA 5KJ6A 5MDHA 4ZN6A 2EF1A 4RQTA 3I4CA 2DC1A 4AJHA 1NPYA 4BB6A 4FJ0A 1ZZEA 5DNAA 1PS8A 3DAPA 1Y8RB 3DDNA 2XXBA 5C3MA 4XDYA 1YJ8A 5A03A 3KRTA 3N74A 5KIAA 4D44A 1V35A 2X5JO 4M55A 1GYQA 3ROQA 1UDCA 2GZ2A 1MA0A 1LDEA 2WDZA 2W8ZA 5CEFA 3F5SA 3GUYA 3GAFA 2PZJA 3C7CB 2B5VA 4UREA 1A71A 3VPXA 2PH3A 2XPCA 3KLPX 4YPOA 5IXSA 1ZVMA 1NHGA 1YWGO 4ZICA 2ZKLA 4DA9A 4E31A 1IZ0A 3H9QA 4D46A 3IQDB 4R69A 1GAEO 3VKUA 4GKVA 1T24A 4CM8A 1U3UA 4ZRNA 2J3IA 3P2YA 4CLHA 1C0IA 5BQFA 2GZ3A 4R1UA 4Y6RA 5JDCA 2V7PA 2FRDA 1ZSYA 4UEJA 3EDMA 2VYVA 2G82A 2BELA 4O59O 1TA4A 2VUTA 4YYZA 4WASA 1IHYA 4QO8A 2RHCA 1QYWA 4FBGA 4MDHA 4ND3A 5KKCA 3H5RA 1E7QA 1UP4A 4PLPA 1YOVA 2D4AA 1Y6JA 1GTMA 4A0SA 1Z82A 3RJ5A 3OJFA 1SEPA 2GO1A 2NQTA 1B3BA 4FC7A 1R4NB 2CFCA 4FB5A 2Y1DA 4TKMA 2HCTA 1B8VA 3H3FA 1LSSA 4LMPA 3QVWA 2I6TA 1GZ4A 3PEFA 3LSYA 2B69A 1JU9A 3HFGA 4ILKA 4YB8A 4UUNA 1NAIA 3AOEC 3JQAB 4IGEA 4PLHA 1UXJA 2VUSA 1DAOA 4J9VA 3EHEA 1O89A 4A03A 3CMCO 2EWMA 2EJWA 3S8MA 3BHJA 2IXAA 5T5QA 4TQGA 2C07A 2YDXA 2JHGA 1R66A 3NDIA 5TX7A 3TZQA 3UAGA 3ADOA 3FNHA 1DDOA 2VT3A 2Y0DA 1XHLA 1HE3A 1VKOA 3H5AA 3VAZA 3M1LA 2QRKA 4J2HA 4LW8A 4BVAA 1D7OA 1P3DA 3OF2A 3PVZA 4J6FA 3K2BA 3RKUA 4PLVA 1YL5A 4AJ2A 8ADHA 1ZUD1 2EW2A 1O94A 5DCWA 4QUKA 1UDBA 4I8XA 4XGNA 1HDOA 1KVUA 2A35A 3QP9A 5BSEA 3V1TC 3CMMA 1NXQA 3JV7A 3BZUA 5DP2A 3GDFA 4ALIA 5JY6A 2Y1FA 1XLTA 1U5AA 4DMMA 3VH4A 2C2YA 4FJ1A 4DC0A 3ULKA 4BNJA 1UDAA 1RWBA 2YY7A 3GVCA 4OQZA 4R51A 4WLVA 1HETA 1WMAA 2JL1A 4AJEA 5K6AC 1SC6A 1M6WA 3QA9A 1P74A 3GEGA 1V6AA 4WUVA 1X14A 4LMRA 2NNLD 2VRCD 4E0BA 3MCVA 2E37A 3GVHA 2RH8A 1W6UA 2J3KA 3BMOB 3PJEA 3ZW8A 4EDFA 1I30A 4FFRA 4I9HA 1SBYA 1I10A 5HWSA 2B4TO 3ANNA 1ZBQA 3JQ7B 2WYVA 5K0ZA 5JDCC 2NU6A 1NAHA 4WCDA 3AFNA 1N7GA 1TVEA 1HDGO 3GZ4A 4MP3A 3OJ0A 5CDUA 2DBVO 4IINA 1XU9A 3OECA 4YAKA 4OH1A 2A94A 4CM3A 5H81A 3WQRA 1A4UA 4R3NA 1YXMA 2AHRA 1R4MB 4PLCA 3SC4A 4XRGA 1UXGA 4XIJA 5I9LA 1Y5MA 4WLEA 5ES3A 4E5NA 2FPPA 2JJYA 4A26A 3DO5A 4L76A 1TI7A 1YJQA 3GLQA 1DSSG 4BGEA 3GPIA 1DFIA 3DTYA 2O3JA 3AK4A 1ARZA 1WWKA 4DLBA 2Y67A 5DCUA 3Q6IA 3AJRA 4R1SA 4AJJA 4GWGA 2G5CA 5L51A 1GD1O 2Q99A 2X22A 3GEDA 3TF5A 3GNQA 3U62A 2GN6A 2VZ8A 5COQA 2O3SA 4J43A 1P1KA 2ZTLA 1UAYA 3KBOA 1DC4A 2EKQA 5IN5A 3P2OA 3OFSA 1HE2A 1ORRA 3RC9A 1EK6A 1VSVA 3DHEA 3IP3A 2HSDA 4GX2A 5GY7A 3IMFA 1WDMA 1U5CA 2VWPA 1MXFA 1X1TA 4DBZA 5T57A 5GMOA 3JD2A 2Q2QA 4YJDA 4YT4A 1PL6A 5T8KA 1G1AA 5CPFA 4JP3A 5A1TA 1YBMA 2JCVA 3M6IA 1C0LA 3RBXA 3AU9A 1BXGB 5KJEA 2BF7A 3K31A 1P1IA 4Z9XA 5FI3A 3RFTA 3VH2A 4YAGA 5BNTA 4DVJA 2DPGA 3A14A 3Q11A 4OKIA 2ZJ0A 3MTJA 1VRWA 4NK4A 4PLTA 3MJVA 3FPCA 1XGKA 2CDCA 5DULA 3GRKA 4AJNA 4BNGA 2J5RA 2ZCUA 1LDYA 3ZCXA 2O2YA 4NU6A 3C85A 2DBRA 1GYPA 4WEQA 1KBZA 4NQZA 3S2EA 3ZV5A 4IMRA 1ZFNA 1NWCA 4GX0A 2HU2A 3B20A 4J90A 3W4KA 2HUNA 2WYUA 3CTMA 4UULA 4CQMD 3GDGA 3INRA 4GPD1 3DWFA 2E6UX 1T2EA 1QYVA 2Z1MA 3ZWYA 5C7LO 4YA6A 2ILTA 3K96A 3R1IA 4DQVA 4YAJA 1LQTA 3DZJA 3MWDB 3E82A 3WGTA 4ALLA 1NPDA 3RVDA 2C7GA 3NEPX 1C1DB 3QWAA 4MINA 3GOHA 1VJ1A 2YQ5A 4OMUA 4BO4A 4EYEA 3B1JA 4Q3DA 4LK3A 1Y8QB 4BNKA 1ADFA 2P4HX 4J1QA 3EC7A 4H16A 4L74A 3DR3A 3F4LA 3ZHXA 1H6AA 4RPKA 2AQKA 2VWGA 1MFPA 4E21A 1IZ9A 2H1SA 3NYWA 4PG8A 3PDJA 2DTDA 2VUUA 2D59A 2I3AA 3ZWNA 3A1NA 1PGNA 4RVSA 4EI2A 1SB8A 2YV3A 1R15A 3BMQA 4GI2A 3TN7A 4AJOA 4BNUA 3ADPA 3DBRA 4FOOA 2DT5A 2EHDA 5JW6A 4RDIA 2D3TA 4MIYA 3NAQA 1YE3A 3Q0EA 3U5TA 2E48A 4RPLA 5DCYA 1NVGA 3Q2KA 1WXDA 1XG5A 4D79A 3GN2A 1MC4A 3KYCA 2PGLA 5L45A 2YYYA 3PXXA 3B6ZA 3H2SA 4R68A 2EGHA 4CLRB 4E6PA 2F00A 2X5OA 4DRYA 2B4QA 4U6QA 4FPXA 2BLLA 1ZK3A 3ZW9A 3PP8A 1QYXA 2HJRA 1BRMA 1DJNA 5F3RA 2ZB3A 2JAPA 4RO0A 1TB4A 1MB4A 2A9FA 1TXGA 4MKZA 3DZHA 3GPDG 3WMWA 1Q0HA 4BNZA 2ZJ1A 3ZNOA 2ZB7A 1PJ4A 3H9EO 4KWIA 3ZNPA 1XA0A 1LDNA 1LXCA 2DTEA 3BMNB 1JKFA 3FR7A 4BKQA 3GGGA 2AQHA 4ID9A 3WSVA 1C3VA 3OICA 2QRJA 4CMEA 2Y68A 3HFSA 2FR1A 3VZRA 2HK9A 1OZAA 2PY6A 2IRWA 4I5GA 2NTVA 3OEWA 4KTTE 5JSFA 2P4QA 3L4BA 3NJ4A 4RPJA 3GAZA 1ZSVA 1YDEA 2O3RA 4J4TA 2O48X 3E5MA 2NVUA 1M76A 4RF2A 2VTEA 3TJRA 1P31A 1ZEMA 2FPGA 3LDHA 2I3GA 4JCOA 5G0SA 1ONPA 5BR7A 4PZEA 3PQFA 3SLGA 1A5ZA 1ZXBA 4BO3A 2DU8A 2GNAA 1I32A 1NR7A 3OQBA 5HS4A 3I9MA 1Y7TA 1WDKA 5TT1A 1EFKA 1AGNA 5H83A 1J4AA 3NX4A 2BFPA 5TQVA 4W9NA 1B8PA 3U4CA 3LYLA 5TLSA 4L4RA 3WQSB 4OM8A 6LDHA 1EVZA 5IFLA 4EGFA 1HT0A 4XA8A 1LEHA 4W7HA 3FTPA 3AUAA 4WECA 3GDOA 1LTHR 4YT2A 4GQAA 4N7RA 1NQTA 1YB1A 1XR3A 3OA2A 2DFVA 3TL2A 3O4RA 2Q2WA 3WIDA 4BV8A 4UUOA 3RUHA 2EGGA 3VPSA 1DIHA 2BFAA 3I5MA 3AU8A 1TEHA 3OJEA 1ISGA 4HBGA 4MVJD 4UVDA 1YL6A 3D4PA 1ONNA 3E9MA 3FPLA 2BFMA 4N5LA 4NIMA 4NZ9A 5T67A 3RFVA 2PK3A 1S6YA 1YKFA 2EP5A 1CJCA 5H82A 3KUXA 4DPLA 4DQXA 3AOEA 4ZQHA 4JBGA 4TWRA 3OQ6A 5DF1A 5KVQA 3ASUA 4BO7A 3Q2IA 2VZ0A 3GVIA 3STHA 1VC2A 1X7DA 5IJZA 2Y0CA 3PHJA 1B2LA 1SB9A 1M2WA 4FOSA 5IDQA 4RF3A 4RVHA 3O03A 6ADHA 1F12A 2IE0A 3T7EA 1GZ3A 3A06A 1YH3A 2VRCA 4Q3CA 5ER9A 3ZWXA 2HDHA 3N7UA 2C5AA 3QJ5A 1YO6A 2FSSA 4JIGA 1BVUA 3VH3A 5LDGA 2QZ9A 2YV2A 3HWRA 4M86A 4P4LA 4WKGA 4A27A 4CLOA 2WWRA 1DB3A 5CDGA 1JVBA 3JTMA 4IS3A 3AFMA 1ULUA 2H6EA 2CDBA 3KETA 4HY3A 3LZ6A 3PI7A 1F8GA 4S3MA 5TS3A 3HB5X 5CDYA 4K9DA 4KDFA 3VH1A 1PS0A 3L4BC 3V2UA 4BO6A 4D3DA 1GEGA 5COBA 5JPIA 4AL4A 2X9VA 2ZYAA 5U9CA 4TZKA 4GVLA 4R5HA 3G79A 2NWQA 4IDDA 2OORA 2EP7A 4BO5A 2UVDA 4TVBA 2HQ1A 4PFJA 1F8FA 1U2DA 1H9AA 3WDSA 1HZZA 4BKUA 4EJ6A 5BSGA 3GVPA 2OFPA 3TZ6A 1E5QA 2OP0A 4R1TA 1PJLA 3ZWAA 4RV9A 1FDUA 4UEOA 3D5TA 3K2EA 2Q49A 3ONDA 4N5MA 4BUCA 5KVVA 2IEDA 4FSHA 4K26A 2ZTVA 3I9KA 4FW8A 3UOGA 3O38A 4Y8VA 4YEDA 3H2ZA 3IAHA 4QO7A 4PVCA 4YJFA 3K92A 3DONA 4HFNA 3WGYA 4GX1A 4QXMA 4B7XA 1I01A 1B7GO 1GR0A 3KO8A 1ENZA 4RDHA 4ZD6A 4YJGA 4E12A 2PA3A 1DHTA 3U0BA 4D41A 1V3VA 3E9NA 3VC7A 1R16A 2J5QA 2HLPA 5DBGA 3X2FA 4CV1A 5I9NA 3P19A 4K28A 3DEYX 1RKXA 3PWZA 1J6UA 1KETA 1PQUA 4AVYA 1KEVA 1HE4A 1UP7A 3L07A 3QIVA 4MVJH 3PQDA 5AXAA 2DBZA 4DPMA 4CMIB 4Y6SA 2ZATA 3B1FA 4M8SA 1EBFA 4BGIA 3FSRA 1MXHA 4FC6A 2ZYDA 4LRSB 1BVRA 4NK5A 4CMBA 2PZMA 3GA0A 2Y1EA 3F1KA 4KUHA 1Q2XA 4JNKA 3D1LA 5JO9A 2VNAA 4J7XA 4RVFA 4PLGA 5JS6A 1V3UA 5CDSA 1EDOA 1BXGA 3NGLA 5AVOA 1WZEA 3LT2A 4Q3AA 4XJTA 2EV9A 4BL5A 3PYLA 2ZIZA 3IS3A 1KIFA 3GG9A 3QRWA 3UCXA 1CQJA 5KNLA 5EQDA 3D3WA 5DDIP 3PJGA 3RU9A 4NI5A 4IDCA 4M89A 5CEEA 5DOVA 3IUPA 3KYDA 1PWZA 3I1JA 4R4JA 4XYEA 5FF9A 4ALMA 1SAYA 4GWKA 4PG5A 4XYBA 3VOSA 3GY0A 3Q1LA 3Q3CA 3ROMA 3ZGYA 4CM9A 3HG7A 2NQ8A 2O50A 2SCUA 2D8AA 3KSUA 2YHIB 2D0IA 4GLLA 5THKA 2IDZA 2H5LA 1U3VA 2DUUA 4O63O 1I3NA 2FZEA 1YQDA 4KQWA 2HRZA 3U9LA 4IDGA 3CEAA 3MJ4A 4TVOA 4L75A 3ENKA 2GASA 2W98A 4IS2A 1MG0A 4FFMA 3BIOA 2CVOA 4D3SA 4D42A 3UICA 3FRJA 2B35A 4FFOA 2X6TA 5KCZA 1JN0A 3PK0A 4E5KA 4FDAA 2XF8A 3C1AA 1P1HA 1I8TA 5DT9A 1T1SA 3H6KA 2AG8A 4P22A 3WBBA 4NBUA 1IULA 3G3EA 4AFNA 5EMHA 2HK8A 3WNVA 4B4UA 2PD3A 1I3KA 2A92A 3RC1A 3U09A 3L4SO 5EERA 2OBNA 1PX0A 3HSKA 1PWXA 5FEUA 1K3TA 3F47A 2FPIA 3G1UA 1D4FA 2V65A 4BKPA 1E7SA 2Q1UA 2JD2A 3HNPA 2X0RA 2PWZA 3RBVA 3PLRA 4KZPA 1LI4A 1NFFA 4EBFA 1BW9B 4QSMA 1LC0A 1PU2A 4DPKA 4Z9FA 4MVJE 3JQBC 2D5CA 4DUPA 2CZCA 2O4UX 4PVDA 1LRLA 1WMBA 3WB9A 1E0DA 3F9IA 1GUZA 2UV8A 2VWQA 4FQ8A 4IDEA 4BS9A 1LDGA 1ZJZA 4WLOA 4O0LA 4I5DA 5JCJD 3AI3A 3R3JA 4TZTA 1K6XA 2YHUA 2PKQP 3F4BA 3LC7O 2IZ0A 3PIIA 3WMXA 2QIOA 3BAZA 3ONFA 2AW5A 4J16A 4PG4A 2OUIA 1X7GA 1ZJYA 3TDKA 3ZHYA 2I5PO 1HXHA 3AY7A 3O26A 3T4XA 1JQBA 4RPHA 3A4VA 1H6CA 1ADCA 3WGOA 3JQCA 1B0AA 1PS9A 3FBTA 4RVUA 4Q39A 1BDBA 1DRUA 3ZWOA 2BRUA 3DHNA 3NT2A 5L3ZA 2R2GA 2FSVA 1IL0A 3PZBA 1U8XX 4NHEA 4U6SA 2V6BA 4E4YA 4JQCA 4P4GA 4KWHA 3IL2A 1ZMTA 2C29D 4AJPA 2P2SA 1YGYA 1Y9AA 4G5HA 5DBIA 1B3RA 1K6JA 1K0UA 3WFIA 4CR8A 5ICMA 2YJZA 4BNFA 2DQ4A 2R6JA 3OBBA 4KUGA 4J0EA 3VKVA 2AQIA 4DGSA 1HDCA 1XCBA 2AMFA 5CEJA 2WSBA 4Z9YA 4JJFA 4OO3A 2I76A 4AG3A 3PHLA 1BDMA 2EG9A 1SPXA 4D43A 4XD2A 1MV8A 3QE3A 1DPGA 1GV1A 1U3TA 2Q4EA 4IQGA 1EK5A 3TQHA 5CAEA 4D7AA 4OJNA 1GU7A 2XXJA 1SCUA 3WGQA 1UXHA 4E13A 3NTOA 3GNSA 1JAXA 1SOWA 4MP8A 1E1LA 4W9NC 2BGLA 3WXBA 3DOCA 1VKNA 3FNFA 1DC3A 4OOFA 5LC1A 3W8EA 1H94A 1HWYA 4DQUA 2O4CA 1RM0A 1IE3A 1NASA 4ZQFA 1ZW1A 3VZSA 1SMKA 4JBIA 3JQEA 4RPGA 5DBFA 2F1KA 3H8VA 4UUPA 4WK6A 5TT0A 1ZK0A 1QYDA 3K73O 3PJDA 1UXIA 1VL6A 4J1SA 5THQA 1GDHA 4TKLA 3AM5A 4GL4A 4CODB 1HEUA 1KYQA 1OMOA 2EKLA 4ZU3A 4O5OA 1R0SA 1E77A 1M75A 4MPDA 4YQYA 1LLUA 5JYDA 5L53A 5IF3A 2GUGA 4LSMA 3I23A 1RYDA 2JCYA 3DZIA 4G81A 1ENOA 3WYEA 1YQGA 4BMVA 2QW8A 4E2XA 3JSAA 3IP1A 3DZFA 1Q7GA 4PCVA 3DMTA 7MDHA 1HE5A 1Z7EA 1FDTA 4S1VA 2JCXA 3GRPA 4OQYA 3SJUA 3UCEA 2QZZA 1KC1A 2X5KO 1NVMB 2RHRA 4KQXA 5IZCC 1HDZA 2VHVA 3OQ1A 4AJIA 5EINA 3SLKA 3WGZA 1B26A 5ITWA 2VZ9A 4YBZA 1OOEA 4II3A 5IN4A 2QYSA 2RCYA 3UKOA 2GLXA 1NM5A 3GZNB 2I99A 2NTJA 3VDRA 1JVSA 3OP4A 1G0NA 3DMTC 1CQIA 5I7SA 2I66A 2WJPA 1HZJA 1W0CA 3ANLA 1GL3A 2JKVA 4MP6A 2A4KA 2X9GA 4E2WA 3K9QO 1DFGA 1HSZA 3U49A 3HDYA 1MX3A 1KVSA 5KJ1A 4FJ2A 4W7IA 2EXXA 2GPTA 1HSOA 3AUTA 4DBVO 4ALJA 1ZKMA 4EZBA 1NFQA 1J5PA 2BGMA 2Y1CA 1B8UA 3AM4A 5L7YA 1KOLA 2H63A 1Z6ZA 3WTBA 2JD0A 2ZCVA 3E9QA 3BMCA 1QR6A 1GQ2A 3HHPA 1WNTA 3GF4A 3RUDA 3ZHBA 3ZWCA 5CHEA 4A7PA 4KUEA 1CEQA 3W6UA 3JQAA 3C7DB 1U7TA 2HMUA 3TFOA 1C14A 1FDSA 4YRDA 5DZSA 3CH6A 3JD4A 3K5PA 4R3WA 3WLFA 1O0SA 2Y1GA 8LDHA 4C7KA 1L7DA 3KYBA 4YTEA 4KDEA 5JAZA 3EUWA 4QECA 4R01A 5A9TA 5KVSA 3VZPA 4WLFA 2UYYA 4JLWA 4OAQA 3MEQA 1KVRA 1P0CA 5JYEA 2WM3A 3CIFA 4OOEA 1K6IA 1HYEA 5HBRA 3ZH2A 1QLHA 3LT0A 2YW9A 3QVTA 2AG5A 4IGFA 4QT0A 1C1XB 3PQEA 1DFHA 3ZWWA 1HYGA 2Y05A 3RWBA 1LDMA 3PHHA 2NADA 2YQ4A 4BNWA 2WMDA 1ZK1A 1QSGA 1LSJA 3L6EA 4BHTA 5GZ6A 4IJUA 4BMSA 4FD3A 3X2EA 2DUWA 3NJ8A 2J3JA 1E6WA 4F46A 2NVBA 3JQGA 5F5NA 5C7OO 5IG2A 4CLEA 2P9CA 1JA9A 4CM6A 2V6FA 1B14A 1DLJA 1Q1NA 3RD5A 3KSDO 2DTXA 2GD1O 3BTUA 4MVJA 5EQFA 4WJZA 3HDJA 3WX0A 4MJLA 5FWNA 4IXTA 4J9UE 5AYVA 4XR4A 3RI3A 3NDRA 5A02A 4UEKA 4P8RA 1OI7A 4CM4B 5JAQA 5IDXA 1OC2A 3EW7A 5DOZA 1I36A 4PLZA 4UUMA 4CV3A 3M2PA 1VJ0A 4NBWA 4MKRA 3KTDA 1ML3A 4A2CA 5JDIA 2JFFA 4INAA 2FOIA 3WSWA 3VTZA 2IODA 1QLJA 3UGKA 1E3SA 1XSEA 4ND4A 4NJMB 1X7HA 3R0IA 1E3EA 5C37A 3GC6A 3QVOA 4YWJA 3PWKA 4HNHA 4EEZA 5IAAA 1Y81A 4IDFA 1V0JA 3ITKA 4NH4A 4U5QA 4TRJA 2AE1A 3PGJA 3QWBA 3N58A 4YJHA 4JROA 2YV1A 1PJQA 1R6DA 1WLYA 3H7AA 3NTRA 4BGVA 1BG6A 3IKVA 1A72A 1O9BA 4IXWA 2TMGA 3HN7A 1KERA 1C1DA 1UXKA 1LRKA 3KB6A 4GGPA 4CR6A 1P45A 3BMOA 4WNIA 4BQPA 3I3OA 3QY9A 1E6EA 4RLSA 5F21A 1YB4A 5L7WA 1J0XO 2PFGA 3RKRA 3B70A 5BSFA 3ZWPA 5BNFA 4MKXA 3V2GA 4YRAA 4NU5A 2WYWA 1WDLA 1PSDA 4HNGA 4B7CA 1JWAB 3FI9A 4XYGA 1PZFA 2HKIA 3F5QA 2DBQA 4RLHA 4BO1A 4XGIA 1SO8A 3JD3A 1EQUA 1Q7BA 4Q9NA 4EUHA 4R1NA 3HB4X 1WVGA 2IXBA 3D4NA 5A9RA 1VE9A 4WLNA 1I24A 3G0OA 3I6IA 3OIDA 4U7WA 4AJKA 3JYNA 4W6ZA 1MGOA 3O8QB 5TNXA 4NFSA 3EAGA 3U4DA 4FFNA 2X0IA 2BH9A 3FBGA 1PJSA 1PJCA 2GR9A 3U4HA 1DC5A 1UZMA 2ZTUA 4YVFA 2VRBA 3HADA 3H9GA 4OIMA 3FNEA 1DO8A 3QVXA 1FMCA 1ISMA 2GZ1A 1E1KA 2AEJA 4IQ8A 3MZ0A 1TT5B 1LLCA 3PYMA 4ND1A 3GQVA 5CP8A 4CMGA 3ZZNA 3IIEA 2GN4A 1KEPA 3QVSA 4Z0HO 5A9SB 3MJTA 4YACA 3F1LA 1A4IA 1DEHA 4Y6PA 2Q4BA 3M1AA 3IC5A 1TLTA 1LUAA 1PGOA 4NG5A 2W2KA 4BNLA 2HO5A 4IMPA 3DL2A 4HFJA 5L4LA 4IPTA 4DLAA 2E4AA 1HDXA 1R4NA 3KLMX 3INGA 3O9ZA 3I83A 3UH1A 4H3VA 3ZNQA 3BTOA 2GSDA 2J3HA 3C24A 5JMPA 4CM5A 1X0VA 1L1FA 2JD1A 1YDWA 3GFBA 4B4VA 3ICCA 4CLRA 4BNNA 3NUGA 4BIIA 2AEMA 3JQ8A 4O1MA 4YAIA 4ZHSA 4QFCA 4GKBA 1E5LA 1GPDG 3PZRA 3DZBA 3DZGA 4I5FA 5MGBA 1E3WB 1XQ6A 1H93A 2W2LA 3AY3A 4DTIA 3ZV6A 2FP4A 2NU9A 4K6CA 1E7YA 5IZ4A 2OXIA 1EZ4A 3I9LA 5G4KA 2PZLA 4XB1A 3E6AA 5G0TA 4HXYA 4CR7A 2C82A 5EL0A 1R12A 2YFQA 5G2OA 1NFRA 3OJOA 3ZN2A 4NDNE 3OIGA 1MG5A 2CMDA 4CM7A 3AM3A 1CIVA 1LBEA 5F1OA 5KVCA 1B16A 1EE2A 4O6VA 2TMDA 1UH5A 1BGVA 1XDWA 5EPOA 2NV6A 1N7HA 2PGDA 4E33A 2POQX 5K6AA 4X54A 4RORA 2HMTA 4GGOA 4RF5A 3BTSA 2O3UA 3ETGA 4UVHA 3EZYA 3UHAA 4E3ZA 1U4OA 1Z75A 4OSPA 3VDQA 1M66A 2C5EA 4Q3BA 4R41A 3BMCB 4Q3NA 5I7EA 2OZPA 1VPDA 1K2WA 1D8AA 2UDPA 4CPDA 5B1YA 3LC1O 1ZNQO 1U4SA 3LQFA 2AXQA 3PHGA 4XIYA 2ZQZA 4GLOA 4G65A 4U0KA 4CUZA 3DXFA 5F5LA 1F0YA 3WJ7A 2QQ5A 4XJSA 4XQGA 2G1UA 3JQGB 3H9UA 1C1XA 3ZU2A 4DC1A 1G0OA 3QV1A 2FN7A 2X9NA 3D64A 4YXFA 3CUKA 3AUUA 4HFMA 1T2AA 2Z1NA 4YT5A 4JJGA 3S2FA 2IYPA 5JCJA 3Q9NA 2PH5A 3QW2A 2DPHA 4NBTA 4BNXA 3GG2A 5BNIA 3PFFA 3JCZA 3RUEA 4FGSA 1NR1A 5B4TA 4ZA2A 2YFHA 4JP2A 5TIIA 5CG2A 1BWSA 1EDZA 4QQRA 3ZWBA 1DIGA 3WOHA 3WJAA 3LF1A 1PQWA 3DFUA 1R0LA 4ONEA 3RC7A 3COSA 1KVTA 3OJLA 4J1TA 3QWIA 2OBYA 3L0DA 3CINA 4JGBA 5JC8A 3FF4A 2VYND 3ASVA 4EITA 1CWUA 1UUFA 1T2FA 3IKTA 4IIUA 1CETA 4B8ZA 2ZTMA 3DBLB 1Q7CA 3VVCA 4J4HA 3DTTA 2PNFA 3K8ZA 3QWFA 4XEHA 1LSUA 4BKRA 4XKJA 1PR9A 1SZJG 3MOGA 3EY4A 1I2CA 4BB5A 4Y98A 3WICA 1YB5A 3G17A 4LVUA 3VVBA 4B3JA 4OXNA 1PJTA 4J7CA 1F17A 4M54A 1ZEJA 3KHUA 4GX5A 4IM7A 4RZHA 4NBRA 3GZNA 1DXYA 1CRWG 1ISIA 2HAEA 4MVJM 3KEOA 1VM6A 4QEDA 5A3VA 1MC5A 2C59A 3TOZA 3GFGA 4YCAA 4WE3A 3WG9A 1AE1A 4DYDA 4L4SA 1RM3A 4NNJA 3DOJA 4PIVA 3SC6A 4Z3KA 3HUDA 5JC1A 1E3JA 3NT4A 4ZJUA 1A7AA 5T6BA 1W4ZA 1ZSNA 1ISHA 4HV4A 2CSUA 2G17A 4W4TA 2FZWA 2H9IA 4CV2A 2ZQYA 4NFHA 1YONA 4KTVE 1AHHA 1E3LA 3DOOA 2BI8A 1B15A 1DHRA 1GEEA 5TGDA 1AN9A 4K1LA 1QRRA 1N92A 5EN4A 1BSVA 2P5UA 3M2TA 2VOEA 2FY8A 2UUPA 3DMYA 3PHIA 3Q9UA 1DC6A 1LQUA 4F6CA 4XQ9A 4OL9A 1GFSA 3EMKA 3ZV3A 2LDXA 4XB2A 2OOSA 1AXEA 3WQQA 4P4NA 2GN9A 4KP7A 4E32A 4D0SA 1P77A 2BHLA 4JXKA 4TMFA 1ONOA 4JBHA 4CM8B 1L7EA 3LU1A 1F14A 3ON5A 4BNVA 1DOHA 3SEFA 4J2OA 1YS4A 5I7VA 2PD4A 3PRJA 1JKIA 3D3WB 4CM4A 1GCUA 4R9RA 2PV7A 1XWFA 4D0RA 4E5YA 2EERA 2IZ1A 3R6DA 1U2GA 3KEQA 4Z0PA 4NMHA 4BV9A 3RUFA 4P38A 4HKTA 3PWSA 4I5EA 4BNMA 1GZ6A 4LGVA 1FDVA 3INTA 4ZGWA 5T64A 1X1EA 4J7UA 2JFHA 4R9SA 5CFZA 2BD0A 4RCVA 1ZH8A 4U8GA 1AHIA 4CL3A 3JQ9A 2AE2A 2JAHA 3GHYA 3G49A 4ZQGA 3RQSA 5TJ9A 2EIHA 3GK3A 3GUCA 3P5SA 4TRNA 4UVIA 3UF0A 5A9SA 4YT8A 3DBVO 4MVJG 4WCFB 3DBHB 2CVZA 5F1KA 4XYLA 3RJ9A 3ZU4A 5L7TA 3L9WA 3JQFC 3RASA 2GYYA 1NX6A 1LU9A 1PQPA 1UZLA 2X23A 5ILOA 4OHUA 5AXDA 4AICA 4YJHB 1BXKA 2VHZA 3QWHA 4IJKA 4CUKA 2BMAA 4MVJI 5TC4A 1PZGA 1Q0LA 4QX6A 3MTGA 1WAMA 4QFDA 4CJXA 1G6KA 1QMGA 5HS6A 1NQAO 1ZMOA 2QRLA 3GN1A 4CL8A 4EUFA 1DLIA 1QKIA 3DAGA 2O2SA 3T7CA 3TZKA 3JYQA 3CSDA 3SBOA 4XYMA 1RM5A 2VOJA 3MOIA 4XDZA 1DIAA 3QLJA 2C54A 1T4DA 5JE8A 1LSOA 1JW9B 1ULSA 3ZI0A 1PGPA 4G2NA 1X13A 3OIFA 3PJFA 1E1MA 1QV6A 3BYZA 1ENPA 4BQRA 3CXRA 4F45A 2LDBA 2I67A 2G0TA 1OC4A 1U3WA 5T8KC 3RSHA 1N9GA 1HLDA 2WTBA 5JAIA 7ADHA 3LLSA 1EUDA 2NVWA 4PLWA 3GVXA 1I0ZA 3PGXA 2FWMX 1NNUA 4Z0TA 1JWBB 3W6ZA 2AQ8A 1EFLA 4IZIA 4U0JA 4LN1A 3JQDA 1PTJA 5KWEA 3IJPA 2WE7A 3NTQA 3AI1A 3I9OA 3UW3A 2B83A 4WCFC 1R4MA 2VWHA 3HE3A 3RIHA 3V1YA 1IPFA 1H0KA 3FD8A 5CPBA 3OEYA 2B5WA 4GMFA 5AXBA 5CG1A 4YDRA 1KS9A 5C7IO 1I3LA 4Q3EA 1SOVA 3RBZA 4J49A 1QV7A 1U28A 5ILGA 3OMLA 3NGXA 1DRVA 4WNCA 1XQ1A 4PG7A 1QP8A 1IPEA 1VI2A
chains in the Genus database with same CATH superfamily
3HJBA 2W2KB 4HAVA 4K3UA 4MPRA 1IG3A 3O2SB 4B0PA 4FWBA 3BDAA 4RL6A 1JTFA 3N70A 4Y2RA 4YJ2F 5GZ1A 1GGNA 3L84A 4D5GA 2PGJA 3ENQA 3PQCA 5HCNA 3VTFA 1NTOA 4DM3A 4RZSA 4UOZA 4A6PA 1ZR2A 5I8ZA 3QKWA 1S2GA 1Z16A 3K4HA 5F7XA 2AZMA 3LVFO 4F38A 1U3FA 3G7SA 3M6WA 3R4CA 4ZAFA 5LKAA 1SBCA 1YAJA 2ZUVA 3MCTA 2Q1XA 1UM9B 5TMPA 1Z5GA 4ENVA 1P4SA 3S55A 5JXGA 1ZO8A 1JDUA 3V8QA 4V1CI 1P1RA 1T26A 1VKHA 1GO2A 1FC0A 3OM9A 4OBXA 2IHUA 3ZWMA 4Y67A 1EFRA 2F59A 2OWEA 5FOUA 4KO2S 4C4RA 1GLGA 1QXSA 2GMWA 4PZDA 1WB4A 4MKFA 1POXA 1TT5A 4YUVA 1DKQA 3EZLA 3ZNQA 2DKNA 2ZGVA 4K9KA 2O1XA 1O57A 1TUBB 1Z45A 3IA2A 2PJRA 3IAEA 4IQ4A 4B3CA 3KLOA 5A4DA 2GEVA 3ABIA 4LC0A 3E0XA 5HW0A 5TF4A 4JX9A 1Y42X 2OD2A 4ALNA 2V1XA 2BGKA 4M1TA 1EINA 4LVCA 4DV7B 1NBEA 3BFJA 1QK3A 2J45A 1U90A 3CLSC 3G82C 3LVBA 3PDHA 3VHXB 1FXSA 2C2MA 3C8UA 1EFUA 1T8WA 4GIBA 4MQEA 4TT3A 1AXGA 1VE3A 4G0WA 3QTBA 4ZEVA 5AK6A 3NDJA 5LMUB 3JZIA 1JLLA 2ZJZA 3NDBB 1PNOA 1U02A 2P8SA 2IYZA 4P58A 3PFWO 4PZCA 3CZRA 4M0CA 3K6SA 4CLDA 5K3AA 4OXYA 1BHSA 3RH0A 1QCCA 3BILA 3BHIA 1LC3A 2B4RO 3HA7A 1HYHA 2MMCA 3DV0B 3FHLA 1UT5A 5HA5A 2PX2A 1P8JA 4EY6A 2R1VA 2XUGA 1WPGA 3G89A 1NXPA 1PTJC 3BE6A 3BC1A 1RYNA 3GFQA 1AUVA 3VYTB 2R97A 4D9CA 4WCFA 1O5IA 1YGPA 2E1RA 1KAOA 3WHIA 3OA0A 4X24A 1E92A 5FNVA 5EZYF 4L02A 3DB2A 1FMFA 4M1QA 4Q9JA 4WOKA 1OTYA 4P1ZA 4HDRB 2B37A 4FZVA 4OHPA 4M8KA 3ID6C 2WZCA 4YP7A 5LYYA 3N2NA 4M87A 2XZLA 1RPTA 4B79A 2DHDA 1W8DA 2UYQA 2JLVA 2ISQA 1K4KA 4PGFA 4EVQA 3FR8A 1GZSA 3WLIA 2ECFA 1Z73A 3P9CA 5CFPA 3LUAA 4GBJA 1T5TA 4JLKA 3E15A 4GMGA 3ETEA 5EHNA 3VTKA 1FK8A 3AESB 3WLMA 1LLDA 4I9NA 1XQ9A 5HJ2A 2PX0A 5REQB 5IK2A 4CFYA 1MAAA 3FWNA 1OVGA 4BNYA 3WLLA 4PCLA 5B58T 3C3XA 2VI5A 3W5JA 3GFPA 1GUDA 5JXJA 3CLRC 3N6XA 5H7XA 3OIUA 1VSUA 4RZ2A 2NOAA 1N2EA 1Y1QA 3EXEB 1MC8A 4Q00A 1UP6A 1PJBA 1W5AA 3AG6A 3ANMA 3UMGA 1MJGA 3O83A 4GI3A 2BP7B 1IVYA 3HQ4O 3PYXA 5F12A 1W36D 2IZZA 3WFJA 3B5EA 4DXAA 1RHUA 2EKPA 2OSVA 2PVSA 3BWDD 3V46A 2CNBA 5KBYA 5KOJB 3TZLA 3JD1A 4UVEA 3EVBA 3LCJA 3WSTA 2VQ3A 1KYZA 1NLUA 1EAYA 5B1HA 2UVQA 1D2RA 4FEYA 1JI3A 4J0QA 4YV1A 1MOSA 2Q8NA 4CM9D 1UC5B 2ZULA 3E8SA 3I9JA 1PFQA 1L5HB 1XRLA 2X41A 4EHKA 1RW4A 1R88A 1Q2UA 4PZAA 3AV0B 1E1QD 3FYUA 1JS1X 2Q3JA 1FJHA 1BH2A 5IUJC 3EXFA 1RT9A 1UR5A 4KIJA 3SBEA 1QVAA 4YCLA 5SV2A 3CQ9A 1QHYA 3EVNA 3F7MA 2IEIA 4I08A 3A9WA 5EJAA 1G20A 1Y3AA 4W8GA 3FB4A 1YUBA 1JHDA 3ACDA 4DN6A 4Z6KA 4H7IA 3JQBA 5C8YB 3BTVA 3SYKA 3V6LA 4BAZA 3CLKA 3ILXA 3RUAA 3KOWA 3CZAA 2FFBA 1JSRA 3OOSA 3QPBA 4NYIR 4ZOBA 1H1DA 3BBPA 2OO7A 3JVUA 3VPFA 2ZI4A 4GKKB 5IDVA 2C57A 4G5RA 4BLPA 4F8YA 4OHOA 4JHXA 4ZV7A 4JY7A 1V71A 1W5EA 3GMDA 4WVLA 3EVTA 1D0IA 3QELA 3ECAA 2QRUA 2DPMA 2X8JA 2YJ4A 4UAGA 1MX5A 2WNIA 3MT7A 4I9UA 2HYIC 1Q50A 2GAOA 2GK3A 5EIHA 3NIWA 1OBOA 3DTVD 4AIRA 2H1LA 2YV5A 1N1GA 2DJIA 1VCMA 2C9CA 4TKVA 1XZAA 1TK3A 2EIXA 2BFCB 3IE0A 3LQ2A 4HUJA 1HG0A 1XTTA 3LWNA 4OXQA 1WSDA 2X3FA 2XMBA 4TV9A 4AJ4A 4AY5A 5D3QA 4BQQA 2MSKA 1SULA 3E1KA 4DOMA 4LRYA 4GDFA 4BPRA 3WYCA 4M1MA 4HADA 1A2KC 3MINA 1W94A 3FN4A 1JQJC 2ODPA 4MO2A 1I4TD 3H0CA 4DCNA 1ENYA 1VIYA 4LXYA 2H2HA 2O5CA 4TSKA 3OIWA 4CF4A 1M6VA 3GHHA 1PEAA 1RWMA 3WYBA 2I65A 4PRKA 1DBVO 3RU2A 4RJTA 2OK7A 2VYCA 4DWVA 3ZNNA 2XMDA 5JOQA 1EX7A 1EVEA 3I5UA 3R5HA 4D3ZA 4KXMA 4QU9A 1EK1A 3VU8A 2ZI3A 1GCOA 3A6ZA 3HM2A 1H2BA 3P26A 3R77A 4PF1A 2PMWB 3PTZA 2JBAB 1LTQA 4Y1FA 1EVYA 1SQFA 4Q18A 2Y66A 4JD5A 2QN3A 3ICWA 3U4GA 1AURA 2OV8A 2QM0A 4BNTA 3GV0A 1NPTO 2DLDA 2Q3CA 2YHBA 1ISSA 4TRRA 2M1XA 4RVCA 3JAKA 1Q0QA 2X0NA 1YRLA 4LJ4A 2XTAA 3ND8A 3K9FC 3UFXA 3GUUA 4NXMB 1IXKA 3JVVA 4JWTA 4NJOA 2VC2B 4ZAWA 3ODPA 2BKAA 2UZ1B 3L6OO 5UKDA 3TLKA 4Q5IA 4EUEA 2DB3A 2FV8A 3HJRA 2FR8C 1N5IA 5A5EA 1MB9A 4QSHA 4LRXA 3T5GA 4K6FA 3UJHA 3V8NA 1K2VN 4C4YA 1V1MB 3RHTA 1LJ8A 1MUUA 3SQLA 5CVUA 1IWBB 3RFXA 2YXDA 2IZ5A 1I9CA 2XUOA 3HBJA 4DJ5X 4A73A 1ABBA 2NU8A 5LM3A 3P32A 1KY5A 2VXYA 2WPDA 4OSOA 1NBMD 4YIKA 3A7DA 1QYRA 1V8BA 2EZUA 3QFFA 1YR3A 3T3PB 4FIDA 3W9BA 1YL7A 4FYXA 1NHWA 1FFGA 1C0PA 1G6Q1 2WKWA 4BMOB 4ZZ2A 4I55F 4B75A 1PVVA 4BGUA 1RRFA 3F2IA 1P6UA 1LNQA 3NS7A 1JG3A 4MIEA 2G9RA 1UINA 5I01A 3UUWA 3SC2A 2ZSEA 1NYLA 2W6CX 3KKLA 4CNBA 1E1RA 5CVJA 2IHVA 1LRJA 1A9ZA 4M1EA 4HVCA 2AR0A 3I9NA 4HQ6A 4U2EA 4RD2A 3T54A 4ZGBA 3ZVMA 4F60A 2EL7A 4M0EA 1AB5A 1JIUA 3CN7A 5LUBA 5DV9A 1N77A 4E7OA 2BFCA 3L04A 3REOA 4UAVA 4UPDA 1MEOA 1ISFA 1E0JA 4AKSA 1IEVA 4Q4CA 3D5QA 2CSXA 5SZIA 4Y7CA 4I1VA 4XFJA 3BHMA 2VF8A 2JIBA 4DLKA 1ACJA 1JU3A 2AH5A 2TSYB 1NF9A 4QYTA 1ESZA 1TYZA 4LE2A 3RU3A 1N9GB 1OI2A 1VLVA 3AHEA 3B85A 3HBMA 4UAUA 3ZZ0A 2F4NA 1IHOA 1OKKD 2WJAA 3D2LA 2FHSA 4I4TB 3V7NA 1S4MA 4BDTA 4ER0A 5IYZA 2RBGA 2XAAA 4X20B 1U31A 1NJSA 4HS4A 5DRTA 3TX6A 3FBWA 4EFMA 2LCFA 4PPNA 4LZOA 4PTLA 2WPDD 3T5DA 1BEZA 2HQRA 1DAKA 1TNDA 1TO2E 3BERA 3QFTA 2HSJA 5AKIA 5GP1A 3MTEA 4DEXA 1PK9A 3C1TA 1V11B 4XD7D 5AP9A 1L8AA 3A9UA 1N5RA 1IY8A 3REGA 1R8YA 2B7BA 1E3WA 3CF2A 4INZA 4MCIA 1KI4A 1Q84A 1Y8RA 4HWKA 1H3EA 4YMVA 3AR8A 3BA1A 2P9QA 1GAJA 3U3XA 1YOVB 3IUSA 4HN4B 3BEOA 3W4JA 4E2ZA 1S8AA 5EP4A 4BUJA 1F3OA 1WCIA 2BL4A 1SXJC 2GHIA 2P77A 3E7XA 4LI3X 3NBFA 2GZHA 2J4DA 1A97A 3EEBA 3O93A 4YQFA 4MS3B 1SRQA 3DFZA 4X0EA 4OI1A 2FHPA 2H4JA 3Q7PA 4QVKA 3WGIA 4UVGA 1BJTA 4CIAA 2Y1XA 3D4LA 2XJ4A 3IHTA 4WBSA 3TECE 1OYYA 4ID3A 4X1YB 4AURA 5U1PA 5DRYA 1QE5A 3HNOA 1Q7TA 1QK5A 3H2IA 1QGAA 2RG7A 2VPPA 2QMHA 1T0IA 3F2VA 1Q21A 4OYRA 3DEAA 1A9YA 2ZVPX 1EQ2A 1KZ9A 3SAJA 4J1NA 5CFNA 4P6VF 2QHXA 4I3GA 3NBQA 1KFJB 4WY5A 2JGNA 1KKUA 1PJ8A 3B6KA 1ZU4A 1JIJA 4BC0A 1M7GA 4ZMSA 3EYWA 4UHBA 3OLZA 1W75A 3WRYA 1Z0IA 3PDUA 4MV8A 4OMFG 3T9EA 1P17A 2VHYA 3WVNA 4RF4A 5BSMA 4YMTA 3MWGA 3H1FA 1C4OA 4TUYA 1VL0A 1XU7A 4FGUA 5ADHA 2WEKA 1U9JA 3OE4A 5M5BA 5DEOA 2XY4A 3AR9A 3KOXA 3LY8A 1KNXA 1YKSA 4JQOA 1H23A 3GW8A 1B74A 4ND5A 1KFEB 1TM3E 3MT0A 2DKOA 1FFXB 4ND2A 5DISB 1PD1A 5DVZA 3ZD8A 4AG6A 1QFZA 4J91A 5K2MA 1EWKA 1JDJA 3WAGA 3FNBA 2ENWA 4OHRA 4Q1FA 4AMYA 4AY2A 1XELA 4KQCA 2QL5A 3A32A 1PGQA 1ZD2P 2B21A 3CWQA 4MPTA 4CKCB 4YAEA 5DNCA 4C9BA 3TB6A 2QIPA 3F3MA 3O94A 3THWB 4Y6QA 5ICEA 1QU3A 2YDYA 4NJEB 4EY3A 4B3HA 2H4ZA 3K0BA 3RT9A 3VBEA 5FNZA 1K9SA 4ND7A 2GGSA 3CRMA 2FFAA 4IQ0A 5DEIA 2ZB4A 4XDHA 4G9GA 3WGLA 2CCGA 2JLUA 3BCSA 3HWX1 2LBPA 2WPNA 3WIBA 2XWPA 2Z4SA 3DC2A 4ARSA 1ECPA 2FPRA 2RAFA 2WW8A 2O6HA 3KE8A 3OX3A 3QSGA 4H3SA 5AKEA 3A3OA 3TKYA 3W8FA 3U39A 4ZI3A 1RYBA 3HRKA 4HDSA 4FFLA 3P4YA 4RQUA 3R7NA 2Q1SA 2GF0A 2FZ4A 3ZK8A 4LNUA 1QR2A 1X7XA 3R7LA 5HP4A 3TB4A 1AS0A 3DYIA 5HTKA 4E2FA 4AF7A 2RI1A 1QMPA 3AKYA 3FTNA 1FUKA 4JLJA 2IHTA 1W76A 3DAYA 4R9VA 3OMWA 4YUZA 2QY6A 2VHEA 4M6WB 2Z5GA 4C88A 2AR7A 2VRWA 3KV3O 3B9QA 3SFVA 3TSCA 2AFHE 3IPYA 5L6LB 3ZYCA 1A8UA 1E8MA 5E38A 2N47A 1YS7A 2GWHA 1WW8A 4H27A 2AOVA 3MIIA 3ETHA 3JQ8B 4K9MA 1OF1A 2E82A 3FUXA 2YCLA 4QTZA 1SBNE 4CV0A 5LN1A 2HWKA 3BA6A 2H2WA 2Y71A 5JS2A 1GTL1 1JLHA 2XADA 1D4OA 1UBGA 3DWGA 5AW1A 2ZRBA 2I1QA 1MR3F 3LF2A 4CQLA 3PXBA 1E3IA 4EI9A 3T5CA 1PZNA 1KJIA 4KFTA 3BN3A 3MLBA 1WIWA 3ZV7A 4DUGA 3OSUA 4XWWA 4HFRA 3T5BA 1A8IA 3D0OA 5JQWA 1ZISA 3EFOB 1K5DA 2CJFA 3JQ6A 4ISBA 4DSTA 2YIMA 5J2TA 3DUFA 1EP3B 1L4YA 1N9KA 3HHEA 3LZCA 3KSBC 1FS5A 1E96A 3U19A 2J0EA 3HB9A 1XDGA 1ECCA 3QI7A 2Q3LA 1R37A 4Y9DA 1A2BA 1JEQA 1MQAA 3LNCA 4LSWA 1LWOA 4MRNA 2BDEA 2QJWA 4ML3A 4H7EA 1M2EA 4YPVA 2C7OA 3FIJA 1WZIA 5LP6F 3HABA 3KKPA 4BO9A 4Y2TA 4U2FA 3FTQA 4QXOA 1VXOA 2QJTA 1M67A 3RS3A 1WCYA 3TD2A 3W2FA 4L5IA 4BLRA 1CVIA 3Q9SA 4O1HA 4C0QC 3OKPA 1ZNXA 2BJWA 4IJ6A 2NZUG 1LZLA 3CZPA 3F90A 3H6GA 3EJWA 5J3JA 3LRPA 1PJ2A 4UAJA 2J9ZB 4NU0A 2IT1A 4DZTA 2PYZA 2J6HA 3C5WP 1TM1E 3O3CA 1DKNA 3R6GA 2PQMA 4QDZA 3KJEA 1Z7BA 2E89A 4LHYA 3WR5A 3USES 4B4OA 4CEHA 5DTEA 3SR3A 2PAFA 2Q21A 1T6YA 4JP1A 3ZH9B 1CF4A 4RNDB 2ZDQA 3K0AB 4Z1OA 6PFKA 1JWLA 1T10A 1E4VA 4Y2UA 4ZRMA 3ZYZA 5C5IA 1W36C 3I52A 1JH9A 2B8WA 5LU8A 3BJIC 1XL1A 3IJEB 3P0FA 3AJ9A 4B34A 3RROA 1TUBA 1XCGB 1ZMRA 3AI2A 3VTAA 1JIXA 1YASA 5EIEA 1MCZA 4UZFA 5IKOA 1ICEA 1CK4A 2AJBA 2VBFA 4WI1A 4KDCA 3UATA 5IJAA 5HKAA 1X15A 2I1LA 4HXFB 5I47A 3I5XA 1R9MA 3W8RA 4M3NA 4OQPA 1Y7HA 3SQOA 4WXRA 4DRZA 1USIA 1ZG3A 2GAJA 1YC2A 3DBLA 4IV5A 3U4IA 3QKRB 4JLNA 4AK9A 4F0JA 1MKYA 4FINA 4CTOA 4LDPA 1CERA 2J41A 4J1TC 2JANA 4FYWA 4YMIA 5JSYA 4CG0A 1RXUA 4HTAA 1UBKS 4PS1A 4G1BA 4L2IB 1GL6A 4I3FA 1ACLA 2IHBA 3VZQA 4F97A 2PZKA 1XCPA 5AW3A 2QI9C 4KLAA 5LLSA 2F9MA 2VPTA 3UJBA 4C5CA 1RVV1 5JAMA 4AY4A 5K0GA 3HNRA 1D5WA 1KA9H 1ODFA 3NB0A 3QY0A 4UEWA 3I5YA 1VB3A 1Y8QA 1PE0A 2I6XA 3NHYA 2C3YA 2PCLA 1KEWA 3ADKA 3R3ZA 4MUXA 3SYTA 1LK0A 3I64A 3A1VA 1R6XA 5H4HA 1R5BA 4KK4A 3UO8B 4AZ0B 4TLMB 3JQ7A 4RXTA 1CTQA 1MH1A 2VS1A 4QUGA 3EFOA 4IXDA 5BSRA 2GCGA 3EUAA 3K35A 2X5NA 3S6JA 2XWSA 5KYGA 3C1UA 3VNAA 1EHIA 1C7IA 2I7XA 3OX1A 1U0TA 2PLAA 3GLFB 1TT7A 3PFKA 1SC1A 3GRAA 5KNCA 5AW5A 3T3IA 3R8FA 3U13A 2ID4A 2V6MA 5ENVA 1NOJA 4X64B 1AQUA 2NAPA 2P68A 4PFQA 5KYTA 4Y6LA 2ZB8A 2LR0A 3L1HA 3MK31 4FMBB 2OMEA 3O2JA 2Q5FA 5HOQA 3KZVA 1M2VB 1T2CA 4OF4A 5ECYA 1KYIA 3IXMA 4RA9A 4E14A 4FGWA 4OTZA 1KI6B 3CZ9A 2ZJ6A 1B41A 4LQCA 4WOPA 4XWYA 2V3CC 4KWTA 5DNYB 3KYIB 1F1BA 1R3UA 3AHDA 4RQTA 1E79A 5A2QA 4WMLA 4AJHA 2K7FA 1VMAA 1ZZEA 2GPSA 3N76A 1XOIA 1G19A 2QD1A 3DAPA 1Y4ZA 1E2EA 1GL9B 1KAHA 4JLVA 5J4LA 3T3NA 3GJ5A 5FWYA 5KHAA 3KRTA 1E2IA 4BZZA 5IM4A 5KIAA 3E4DA 2IS2A 3HBAA 1OZFA 3CNBA 2AS0A 5BW6B 4ARZA 4X1YA 1QGED 1XN4A 1PLKA 2QMZA 2R79A 3TCXB 4FHGA 1GYQA 2DPLA 5AVJA 1UDCA 1MA0A 1C30B 1K08A 2R68A 2YBEA 4HXEB 2QZ4A 2BN4A 3GAFA 1ZVKA 3GUYA 3PC8A 2O59A 2PZJA 2QMUA 2H5EA 5J5AA 1SQ0A 1TJNA 1O6BA 2NV2B 3EEIA 1J9GA 1VMIA 2B5VA 2ZTHA 4UREA 4RTSA 1GCAA 4Z7OB 1ZR4A 3BXPA 2BUCA 2OVBA 2WDPA 4EBBA 1KNQA 1ZW6A 4UDOA 4N0QA 2GH1A 5A3QA 4JXXA 3P9YA 1C50A 1WSWA 3ETJA 3IQDB 2GARA 1GAEO 3LH5A 1L5KA 1WKVA 4KO1S 3DP7A 3MQ4A 7AT1A 3Q87B 3CISA 2LKDA 4KBFA 4G86A 2R96A 3P2YA 5INTA 1XTSA 2N75A 2V7UA 5IJ0A 5BN3A 4Y6RA 1A4RA 1HT3A 2DHQA 2V7PA 2ZWPA 3JWPA 4CKXA 4Z7JA 1DG3A 4FKBA 1OYOA 1GTG1 2BELA 5FWXB 2N1BA 3SJBA 2EX0A 4WASA 1PUXA 1RXSA 2VBGA 2WYHA 4MA0A 2NU9B 3RYTC 3TIGA 1H0SA 4C03A 2W2VA 4FXPA 4KDRA 2VAWA 1J2TA 1QJCA 1YZTA 3TS1A 1KZ4A 3H5RA 1E7QA 1GVNB 2GD0A 4Q7EA 4L5CA 3C0KA 5E2IA 3PKJA 1QH1B 2GCOB 3U9TA 2G0AA 5FTWA 1Y1RA 2GO1A 2G08A 1B3BA 4ND8A 4FC7A 1V16A 1VJGA 2CFCA 4Y6GB 2ZDHA 2A88A 2Y1DA 4TKMA 4R9NA 5AOBA 3RDPA 1ZI6A 2WKSA 1LSSA 3QVWA 4DCVA 1XZBA 3PU6A 4FZRA 4YO8A 1U8TA 1U1EA 2I6TA 2P69A 4RANA 1JU9A 1A95A 4XSGA 2HDOA 3AOEC 2I4TA 3JQAB 4YDHB 5HKOA 2IYEA 2WWVD 5KU1A 7MHTA 4HDOB 4B3MB 1DAOA 2E0IA 4J9VA 1XNHA 2J46A 1O89A 3WV4A 2AUNA 3CRZA 4JS0A 3S8MA 3K0SA 1IN1A 4J07A 1P81A 2WF9A 2IEAA 1O9HA 5BQPA 3E9DA 3VR3D 1I6KA 1B6RA 1SURA 5TX7A 1N6LA 1UWKA 4K03A 2G8LA 2B3TA 2AJTA 1B43A 4LJ7A 3SHVA 1JHQA 3ADOA 1CULC 2OHGA 3H2BA 3EQ2A 5ALUA 1DDOA 3TAXA 1Y3FE 3BICA 3KNZA 4AKIA 2K87A 1VKOA 3LUBA 4K9SA 5ETJA 3COZA 1ZAKA 1P3Y1 5DM60 4Z49A 5J2UA 4LW8A 2V1UA 4R2WA 3SZRA 1PR0A 1P3DA 1ZCBA 4A0HA 5LQSA 3U17A 4QUDA 2VDRB 3K2BA 3SSAA 5JANA 5J2TB 4IVQA 4ISCA 2GVDC 4DARA 1C41A 4PTYA 1O94A 3M5CA 3OTQA 4XWTA 1T4MA 1UDBA 4OQNA 4K9LA 4HPXB 4RNCA 5DSTA 2RH5A 3FDXA 4LTNA 1KVUA 1AUOA 3WO0A 3M6LA 3V1TC 1IQ0A 5AIBA 1XWWA 4QUJA 4Y1GA 4ZEXA 4A6XA 2KS6A 4FBLA 3TVTA 2EDCA 3JV7A 2A7XA 4HDMA 2ZAGA 3UMFA 2C58A 3KQOA 4P4SA 3VAAA 5IT5A 1JR6A 4WQMA 2CVHA 3R23A 1ZD1A 3BSYA 5IK2D 4XWAA 3WGMA 3VH4A 2C2YA 2WKPA 4DC0A 5EGNA 4LA4A 5FP0A 5ULLA 3ULKA 5J1SB 3T5TA 4WLVA 1OILA 4R51A 5KEIA 4HO1X 4F2GA 2ZRGA 1P74A 4JJ7A 4LHVA 1J5EB 4I6EA 4YPFA 4J0KA 1BE1A 3H1TA 1CR4A 4MR7A 1YZLA 3G0DA 2BFEB 3DPUA 3RV4A 4ZTUB 1RC1A 2NNLD 1V5FA 5BV8A 1QTQA 4HL6A 3BCRA 5ELLA 4CL2A 1GWNA 2B1GA 2J3KA 2VVTA 5K3CA 4EDFA 4KR9A 1JKXA 2N46A 1QE3A 1USWA 1XCJA 1RVDA 1IMOA 2DQKA 1CZRA 4MYHA 2ZJYA 4E5VA 3O47A 3VU1A 5CGQB 2NU6A 1Q17A 1NAHA 1YR7A 5AJTA 3TOSA 3BF8A 3OCCA 3VYWA 1M3SA 2HSGA 1G18A 1HDGO 1EFPB 2FGJA 2WWXA 2YQZA 3GZ4A 5CDUA 2DBVO 2QXYA 1W581 4P5EA 3SGLA 3NXKA 2WQZA 1JHAA 1L7BA 1A4UA 3C6QA 4R3NA 3PFHA 4M9XA 4O33A 2VPWA 5J47A 5GQSA 4YJ3A 2AHRA 3K20A 3RANA 1N5LA 4PLCA 2D6FA 3QHPA 3H84A 2E2WA 2EWWA 1MGPA 1XZKA 5I9LA 2FPLA 4JA0A 4A26A 1JV2B 2OEPA 3RSSA 1UBTS 4YCBA 1TI7A 1OLUA 4FGJA 2QZPA 3ZHOA 4EVIA 4N41A 1DSSG 4DM7A 4MHOA 3GPIA 3DEHA 4TM7A 1EG2A 5DCUA 4LF4B 1L7XA 3TQSA 4LBVA 3OQNA 1G59A 1EFDN 2WF8A 3D9QX 3GJZA 3HWWA 4AJJA 4D25A 4NOJA 3K5HA 3KJZA 4RH0A 2RGRA 3T7DA 1O96A 1WPXA 3VGJA 5BWMA 1UBHS 3GNQA 1QX3A 3GJ4A 3OTWA 5J63A 3TTUA 3U62A 5CD9A 4J43A 2FP3A 4IEEA 1P1KA 1T1JA 2I4IA 2ZTLA 1IJBA 2RBKA 4E3WA 4YHBA 1J21A 2B8TA 1KL7A 4OKSA 3OQMA 1Y37A 3IMFA 4MITA 1WDMA 2VWPA 2WIKA 2XYQA 4AP5A 3UUGA 3PVSA 4NEGA 5T57A 5BPFA 3LWDA 3IUMA 4UJ5A 3QYAA 3IQFA 1BCSA 4M60A 4Q7QA 2WWGA 3H1PA 3R6TA 2VDKB 4IX9A 1GLNA 4A91A 5JMOA 2XYRA 1DBIA 5CPFA 1KSJA 2A9JA 1N1MA 1C0LA 2EVWX 1SKYB 1LD3A 1K7YA 3RFTA 3NRBA 3QU2A 5BNTA 3A6KA 4DVJA 5FOSA 3Q11A 4JUAA 1N6IA 1U0EA 2RGNA 4US0R 3QFCA 3PFNA 1TF5A 4UTVA 4YFYA 4U2KA 1AY0A 4YHHB 4JEUA 2QTTA 1XGKA 1D2CA 4NE7A 2OAQ1 2Q5EA 4DHEA 3GRKA 4O4LB 4BNGA 2J5RA 1T91A 3MUOA 1LDYA 2YXBA 2O2YA 4NZPA 3T34A 3W9YA 3GCDA 3U7QA 4IGAA 1PDWA 5E95A 4URXR 1NWCA 2YIVX 2H1WA 3NMUF 3N2ZB 2GILA 3STYA 3W4KA 4J90A 1K8ZB 2HUNA 3X1XA 4IHKA 4ZU6X 2QRNA 1NBAA 3INRA 5DHFA 3ETLA 2IYYA 2Z1MA 1HOXA 3ZWYA 5JSZB 3R1IA 1UM9A 3O1LA 4KLCA 2P65A 1GGFA 3IT0A 4CHTA 3HMQA 3ORRA 4DQVA 1GQOA 4YAJA 1KJJA 1LQTA 3MWDB 3WNBA 4G0XA 5EYPB 3RTGA 2ODEA 3RVDA 3NEPX 2V7VA 1C1DB 3QWAA 4KB5A 4EYEA 3RK1A 4ZFNA 5C52B 1VDZA 4Q3DA 4G01B 1Y8QB 4BNKA 1GT6A 2WAXA 3M3DA 5EUQB 1W85A 3BZWA 4L74A 3DR3A 3ESAA 3RUPA 1LPAB 2MT9A 1T3ZA 2XMCA 4LJAA 4GBGA 1IZ9A 4OQEA 1MIOB 2JEOA 2LE0A 3O8BA 2VUUA 1QZ3A 4FN5A 1U99A 4ZJZA 1D6MA 1XRMA 4S1TA 1E0AA 4EI7A 1CUXA 1KFCB 3TTXA 4DANA 5EJ6A 2JI6A 3UA4A 2FWAA 1RE0A 3LDGA 2CVFA 3CLHA 3LKZA 1WABA 3LV8A 4JI1B 4AJOA 4EI2A 4RTNA 2DT5A 2W48A 3NV7A 4DLNA 4ENQA 1GCIA 5E8RA 3CA8A 7REQB 3BAFA 5JW6A 4GLJA 5K4GA 1OA0A 3SU8A 2XUHA 3AONB 3GRZA 3NAQA 3Q0EA 2ZYHA 3EF0A 5IMBA 4D4GA 4F7WA 2HTEA 4IIDA 1KRHA 1ODCA 5AJWA 4EG5A 3V4VB 4TWZA 1MC4A 1EHYA 4XASA 2PGLA 1V4VA 1XF9A 4C0KA 2FPXA 3B6ZA 3N3BC 4ZCMA 4OHBA 2X5OA 1FYWA 2WWHA 5KDDA 4PRZA 5K5EA 2BLLA 2IS1A 3PQ3A 2IOQA 3BGVA 4Q21A 1QFSA 4C0BA 2NU6B 3NFRA 3UPDA 4QVIA 1MRZA 2HJRA 2I6QA 2QTGA 3SHWA 5BMVA 4QD3A 1G21A 2OC4A 4RO0A 1TB4A 2A9FA 5H8WA 3OHMA 3LX8A 3GPDG 3WMWA 1Q0HA 3ZC3A 2DETA 4R2HA 1N2ZA 1R18A 1NV8A 2ZB7A 1XXHE 4ARZB 3IODA 5E0KB 3DGEC 1TL7C 4OUDB 2OKGA 3ZNPA 4YMGA 1XA0A 2ETXA 3ZE1B 2AT1A 4P5DA 5JD3A 1HEYA 2A14A 1JQKA 4R0VA 1QQ6A 2XVYA 3TLXA 1X70A 2C96A 4ID9A 3VNBA 5I4BA 3CNHA 1C3VA 1D2AA 1GNSA 1KARA 1ZUNA 3D2CA 2FR1A 4OHVA 3EIOA 3ZX5A 3VZRA 4N3AA 2MJLA 1OZAA 3UAWA 4I5GA 2HNAA 2PUJA 3OEWA 2NT3A 1L6IA 2I78A 2L69A 2RONA 4KTTE 4UD6A 3V3KA 2XE8A 4AO8A 1S2IA 3NJ4A 4RPJA 1NMEA 1T5BA 5BQ3A 2CXNA 5GINE 4KXNA 4CKBA 3HXMA 3I2HA 2VP0A 3G2NA 4PC7A 3HZHA 2NVUA 5EIFA 1OJ7A 5EP3A 4K9QA 2P7IA 5HDQA 2ZSDA 2VTEA 3TJRA 4ZVPA 3HCCA 4YJ3B 1JG2A 1ONPA 3PUHA 4U02A 1TW3A 2IP2A 3DE1X 4PANA 2FMXA 4NENB 3PQFA 1N2CB 1SCUB 3AUKA 1HDIA 4FVTA 3SLGA 4DV1B 3IR7A 2REQB 5FLKA 1NXSA 3JZDA 3I9MA 5FWXA 5TT1A 4EH1A 3V8PA 1C0EA 1EFKA 4KWEA 1PI3A 1FU8A 1YRWA 1AGNA 2JBWA 3CTPA 1J4AA 2YWRA 3EXAA 2BFPA 2JIZD 4HT3B 3LQQA 3ZWDA 1B8PA 4L4RA 4UXIA 4RLQA 4QRDA 4OM8A 5DJ5A 4AMUA 2Z6AA 4M0MA 1TTTA 4EGFA 2WD9A 3TTWA 3NXSA 3B53X 5EWLA 1XRSB 4MPJA 5D87A 2IVFA 2XRFA 2P40A 4JQYA 4NOLA 1SCDA 1Z08A 1CUIA 2QD2A 4MZDA 3WIDA 4BV8A 1AK1A 2ZEJA 3NORA 4DJDC 3SF0A 3RC3A 5F2OA 2JLYA 2EGGA 3VPSA 4IOKA 3I5MA 1FIUA 1G4UR 3ZLVA 1ISGA 1ULTA 2XVZA 4NONA 1NW9B 2IX3A 1KORA 4LC9A 4N5LA 2BFMA 4NY1A 4NIMA 2COKA 3RFVA 1I7QB 1IUPA 1KEZA 1U2EA 3N8NA 4RMGA 1M6NA 1YKFA 2EP5A 3MCUA 1HH4A 5KHLB 4ZEWA 3GJTA 3HJCA 3HVKA 2YZKA 3H9CA 3IA7A 4W1PA 3WDMA 3ZI4A 3EZ7A 2WSLA 4DPLA 4DQXA 2OCYC 1QO9A 4KN9S 2A5LA 4P4TA 5K4HA 1GCGA 1JDVA 5AKKA 4YCDA 5DF1A 2V0GA 3O8RA 3LM8A 2YWJA 2VZ0A 3Q2IA 3T1YB 4HYTA 4OQXA 3OE7A 3EA4A 1VSQA 3PHJA 1SB9A 4N6OA 4FOSA 4M6WA 2IP1A 1TU3A 4ROTA 4KLRA 2WNHA 3DE5X 2OHOA 3O03A 4WXPA 3RIEA 3ZIUA 5CFMA 6ADHA 4DB4A 4JENA 2FLWA 2IE0A 2VRNA 4HGNA 3T7EA 4BY9E 2I87A 2Z6VA 1UKYA 4MRMA 2GDJA 2ZRQA 3A06A 2IY7A 3ZWXA 4HB3A 2FNAA 2WFZA 4FKZA 1N0WA 5LMNB 3KKQA 1O3YA 3QJ5A 4ZOLB 4ITRC 1F0NA 2FSSA 2V3WA 5BRJA 1BVUA 4MB2A 1NF3A 3VH3A 3HWSA 1DKUA 3LHFA 2M6KA 3ND6A 1P9WA 3PUKA 4PX2A 3VR5D 1I6WA 1HFWA 4QYIA 1ESEA 2V4ZA 3FKJA 3HSSA 4H7HA 4IUCS 2BKUA 2LWIA 3JTMA 2ZUWA 3L8DA 4HRYA 2GYUA 4MV6A 1CUGA 3PQ5A 4Y0NA 1S89A 2AUMA 2H6EA 2CDBA 2IY8A 5KSZA 1JHPA 3EZNA 4NBNA 1U0OC 3ABSB 3LZ6A 1C1YA 4PW0A 3DCNA 1F8GA 3PI7A 2YXNA 1N0VC 4H1TA 2V7QA 3KR2A 3KFLA 4LBWA 3WGVA 1O87A 3HEMA 4TV8F 2I29A 2VP6A 2D13A 3BJMA 5CDYA 1EGAA 2KM1A 3VH1A 3FJOA 3EEOA 3ESRA 3MWLA 4YI5A 2FJPA 1PS0A 2GBCA 1FUIA 3G68A 2W8BB 4DDTA 4Z9BA 3A0RB 3PE3A 4V02A 1IBKB 1WVMA 2R7KA 2ZYAA 3LHSA 4RZUA 1XZLA 2RHOA 4GVLA 4O3MA 1C5KA 2OO3A 2X6QA 2OORA 5H3HA 2EP7A 3V4OA 1EGHA 3BM5A 4PFJA 3ZDQA 1UBOS 5EWLB 1RWWA 1F8FA 1U2DA 2XYGA 3IPXA 3QLVC 1R0WA 1G16A 2QLNA 2AOWA 4L08A 5ECGC 5HVNA 3QEBZ 2HMYB 1TUGA 4D9KA 1E5QA 1OROA 3RREA 2XLBA 3HI6A 1V9CA 3ZWAA 2XMPA 1C7RA 4A1FA 3C3BA 3ONDA 1XJQA 1AKUA 2E7ZA 2FW7A 2Q49A 5DHPA 5G1OA 3PD0A 3WLNA 1G5QA 4FSHA 1EJ0A 5CNJA 4E08A 1H1LA 3I9KA 5HMLA 5I6DA 3SK0A 4TL9A 5D3MA 5HUHA 3H2ZA 4NVRA 3V2IA 1QPZA 1N2OA 3AIMA 4PVCA 4AWXA 1CKEA 2WU1A 4JLUA 4OQQA 3OF5A 3WGYA 3K1YA 2Q1YA 4RC9A 5C32A 2P3LA 3DC7A 1KO4A 5C4MA 4KSCA 1KOFA 1MA3A 2FMIA 2PA3A 5BN4A 4IHJA 4IIYA 4JT2A 2J5QA 1IC6A 1VB5A 4HI0E 3E22B 4LSZA 1G8HA 3WL4A 5I9NA 4DV4B 4EW1A 5EZYA 3N7AA 3DEYX 1Z56C 1QHHB 1RWNA 2HJ9A 1KETA 1LW7A 2XWBF 2ZRNA 5JASA 5CB0A 1KEVA 3CG0A 2HIAA 2LVBA 3WK5A 1WA5A 3C3EA 4L4YA 4LXQA 2VXOA 4FSDA 5AW4A 3IHKA 3S1AA 4DPMA 4LPSA 3HXLA 3Q2OA 1WUJS 3EEYA 4X7RA 3B1FA 2J6CA 1UBUS 2ZIFA 3PSHA 4CF6A 3ZHQA 1ZESA 4R83A 3TGPA 3TTSA 3F1KA 1JECA 4JNKA 2D8MA 2VNAA 1R6UA 3MQ2A 4RVFA 4U9IS 2OK8A 3NM5A 5D7BA 2YVQA 3CH5A 3NIBA 4FFWA 2X7JA 3HY6A 1WZEA 2Q5OA 3QKSA 2IPNA 3WNDA 3PYLA 4UOQA 4MV5A 4ZAVA 3SYRA 2ZT5A 4XXHA 2HH9A 2IEGA 2P6MA 4BXOA 5B3AA 2GOYA 1WXWA 1KZGB 3IEIA 4K8RB 2LD4A 4QXAA 2XRMA 3SM9A 4M89A 1A50B 3IUPA 2QV7A 4UTRA 1YS9A 3ZBPA 3G2OA 2YUIA 1CPYA 3K7EA 5B7QA 4PG5A 5P8WA 2X0DA 3ZCPA 3ELWA 3VOSA 5M34A 3DF9A 3ROMA 3PF9A 1YZGA 3ZGYA 2IOFK 1WEKA 2O50A 2PFKA 2SCUA 2D8AA 4F5YA 3UT6A 3ASZA 1M8FA 2D0IA 4CKBB 2AOUB 3CW9A 1XCOA 4NBSA 2QK4A 1U3VA 3V8MA 1BOFA 1I3NA 4AZVA 4B7AA 1R27A 2HRZA 4PQEA 3CEAA 3GWZA 4I99A 1E79D 4L75A 4XLTA 3KXIA 2XB6A 2XD9A 4JXZA 3ENKA 1GFIA 5K3FB 4D0NA 3TR6A 2REBA 4FFMA 4YQEA 1S96A 4RM2A 2X1VA 4G89A 3EDYA 4M0PA 2ECKA 3L1UA 1XZCA 2GM3A 2A0WA 2FEXA 2RGGA 3NHUA 1U2DC 4FDAA 2XF8A 2HFJA 3C1AA 5HK8A 1P1HA 3GLSA 5DT9A 3IPLA 1QS0A 3IIMA 3H6KA 3LPNA 4C4SA 4EMUA 1G3MA 1UPXA 1DRKA 3LTNC 1RI4A 3DOFA 3J81k 2QGZA 3LXUX 3X1ZA 5K8TA 2XA2A 3W6PA 3FPAA 3L4SO 4IIJB 4NENA 1V4BA 5ELXA 4EQ6A 2A8YA 3L82B 5E7IA 4ZQIA 1PWXA 5BOSB 3PXCX 4IKPA 3LX4A 3RYIB 1K3TA 4ECEA 1K8RA 3DXYA 3RIMA 4AUNA 1A8SA 1C2TA 3G1UA 4LQ4A 4X62B 5DXFA 5F9HA 4HVTA 2WV9A 3U1VA 2JD2A 5J43A 4DR7B 1FTYA 1PV2A 3K05A 5JARA 5JSUA 2RGEA 3RBVA 2J9RA 2QGNA 1XNQB 3W06A 1HL7A 1S1MA 1FSSA 4KXFB 1BW9B 1P9NA 1LC0A 3PHCA 5AM2A 1T3HA 4Z9FA 2L2QA 2A0XA 2Z9DA 2HY7A 2ZE8A 2RI6A 4GQBA 5E6RA 3UA3A 3KXLA 1ELOA 2J31A 2BKLA 1GA4A 2Z3WA 3LBAA 2DGDA 3RW9A 3UH0A 3WAKA 1Y6FA 1WMBA 2RGXA 3WB9A 3GXBA 4LXGA 1E0DA 3F9IA 5D6OA 5JZBA 2VWQA 4BS9A 1OAKA 1LDGA 2NUBA 3BDIA 4XWKA