3BMQB

Structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor (compound ax5)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
267
structure length
252
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords Pteridine reductase
total genus 93
structure length 252
sequence length 267
chains with identical sequence C
ec nomenclature
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3bmqB00
1ULUA 4FN4A 2P5UA 3E9MA 3MEQA 4CMGA 4GH5A 4YQYA 4R9RA 4NBUA 1K3TA 1R0KA 1U3VA 5JMWA 4PLTA 1XKQA 3WSVA 3F4LA 3I5MA 4XQ9A 4BUCA 3RU9A 3IMFA 5FEUA 3SJUA 2VWQA 1MUUA 4IY1A 4KQXA 4W9NC 5JAZA 4WCFB 1PJTA 4PG5A 2RCYA 1YOVA 3AK4A 3W8FA 3JQ7B 2BFPA 2DBRA 1KVSA 4MVJE 2PH3A 1GFSA 3D3WA 1PZFA 3L07A 4U6QA 1LQUA 2C5AA 1HE3A 5DP1A 3JYPA 3QIVA 2I6TA 1HE4A 4F6LA 1CQJA 3X2EA 4YCAA 1QG6A 5F1OA 3KBOA 4UVDA 8LDHA 1I3LA 3DZHA 3RU7A 1WAMA 4L8VA 2BMAA 1R4MB 2BGMA 4TROA 1C3VA 4CUJA 4PLVA 3PHHA 1ADBA 4RPHA 2NLOA 2Y1FA 1GV1A 3JSAA 3AJRA 3MWEB 4IZHA 2AQHA 1Z7EA 1PWZA 2ILTA 1WLYA 2PD3A 4W99A 4YTEA 3WJ7A 4UAGA 1NHWA 3WBFA 4U8GA 4WOJA 1UJMA 2B4QA 3RWBA 1XCBA 4BQPA 1N1EA 2QZ9A 4XA8A 3DBHB 3EY4A 4J91A 5A3JA 2V6FA 3GN1A 3FF4A 1EVJA 4FC6A 4II2A 4TQGA 1FXSA 1H9AA 5DN9A 2DTEA 5K0ZA 1V8BA 1VM6A 4BNMA 4J4BA 4BNTA 1KY5A 2YFHA 1QKIA 2BRUA 1K6IA 2DPGA 5KKCA 3GGPA 2ZIZA 5TQVA 1HDOA 2B5VA 5J23A 1UXJA 2PTGA 2C54A 1O0SA 3BMQA 1E3EA 1DEHA 4XYMA 1U3TA 2CFCA 3SX2A 3DZIA 3H65A 3V2GA 4PVDA 1Q0HA 4IGEA 4GSLA 4ZICA 1LBEA 2GRAA 4GPD1 2I67A 1SZJG 3FR8A 2POQX 4Y8VA 1JN0A 4GVXA 3GN2A 4NI5A 5HWSA 1EFKA 1UDBA 4R3NA 2QRLA 1I2ZA 4IDCA 3FRJA 3NUGA 2I66A 4NFHA 3PK0A 4FQ8A 3OHSX 3BTOA 1GDHA 2NU9A 4ZGWA 5ITWA 1QYXA 2PLAA 3QV1A 1C0KA 1C14A 3RCBA 2O4CA 3ZWPA 1DIHA 4R5HA 3VPXA 3D64A 4OOFA 3OICA 2IZ0A 5IZCA 1I01A 1KC3A 1BG6A 1YS4A 4ZU3A 3F5SA 4AJJA 3JQ8B 4RO0A 3WLFA 3ICCA 3K96A 4E2WA 3TL3A 4E12A 3UCEA 1MC4A 3RUDA 3KRTA 2GZ1A 4GKVA 3CMCO 3T7EA 3E48A 3FTPA 5IXYA 4HFMA 1C1XB 1K6JA 3MJSA 4RZHA 4E5YA 2D5CA 1UDCA 2O3RA 2GPTA 4CV3A 3Q9UA 4CM5A 1R4NB 1VPDA 3FD8A 1YE3A 5ICMA 2YV1A 4KWHA 1LXCA 3F6YA 2ZTUA 4RF5A 2JFFA 4BKUA 4JNKA 1Q7CA 2J8ZA 2X8LA 1H0KA 4R69A 2XXJA 3GNQA 4UEOA 3GT0A 3A9WA 1E7SA 3UUWA 4RF4A 3SJ7A 4MP6A 3LDHA 3LF1A 3R6DA 3RC2A 2J3JA 3Q0EA 4FFMA 3GPIA 5I7EA 3ZZNA 1YL5A 4WCFC 2OO5A 4DL9A 2O7QA 1LSSA 3H3FA 3OF2A 4TVOA 2VZ9A 4IDAA 5JO0A 3JV7A 4HNHA 5BNIA 1O6ZA 4LSWA 4Q3BA 3ST7A 2ZYGA 1LDBA 2ZJ1A 3AY7A 3K6JA 3RIHA 1SBYA 5L7TA 3TFOA 4NFYA 1HE2A 3RUCA 1DC6A 1YJQA 3JQ9A 3L9XA 4G5HA 3RUIA 1JAXA 5JC8A 3MCVA 1XYGA 5JS6A 1BXKA 3I3OA 1RM0A 5K9ZA 1U28A 4LN1A 3RFTA 2NSDA 1XA0A 4WLUA 4FPXA 2EIHA 4MDHA 3WYEA 1LNQA 1WZIA 3IUPA 3MJTA 1QLHA 3JQ9C 2OORA 5GZ6A 5I8WA 1PL7A 4N54A 4BOYA 2DBVO 4E0BA 1KYQA 2HJRA 1PQPA 4QX6A 2VRBA 3DZJA 3DAGA 2Z1NA 4BGIA 4PLGA 4RL6A 4YJHB 3ZNQA 2AW5A 4WOKA 1ZK1A 4ZJUA 3ANLA 1XG5A 2BLLA 1WDKA 4A0SA 3GRKA 1QORA 4I1IA 1TI7A 4XGNA 1ZEMA 3NT2A 4FJ0A 4D3FA 5EERA 2YV2A 5IFLA 3DBVO 1E3SA 3F9IA 3ZCXA 4LRTB 1WW8A 5G0VA 3UCFA 4FFRA 5EINA 1ZMTA 4Q39A 3JYLA 4BNFA 3WGYA 1BGVA 2PWZA 4GL4A 4XYEA 4OKIA 4D46A 4R41A 3K9QO 1K0UA 1K2WA 1X7GA 2J3KA 4L4SA 4NJOA 5HS6A 1NYTA 1OZAA 1QLJA 4DYDA 4UVHA 3C1TA 1YONA 3AUUA 3ENNA 1NASA 3G1UA 3B1KA 4E30A 3VPSA 3ETEA 3VC7A 5K6AC 1Q1NA 5A9TA 4DYVA 4EJ6A 3PIDA 3INGA 2UDPA 1ONPA 4AJ2A 4YJGA 1JU9A 3QE3A 4BO2A 2B5WA 2DUUA 3ZHZA 4PVCA 3PHLA 5TF4A 3IP1A 4YYZA 3VH4A 1UZNA 1P9LA 1Y8RB 3LK7A 4ND4A 1D3AA 5IXSA 1OC2A 3VVCA 4Z3KA 4CLOA 3JQ7A 1U9JA 4BGUA 2C82A 1F0YA 3D3WB 1LSJA 2NU8A 2G76A 1M6HA 2G5CA 1HDGO 1PJQA 4O6VA 2AEJA 5JDIC 2R00C 3S55A 3HDHA 1I36A 2W2KA 1X1EA 2UYYA 1I33A 4MPDA 5KVCA 4YBZA 3WGTA 3QWFA 1R4MA 2EHDA 1MB4A 1BDMA 1I2CA 4WEQA 4WK6A 1A7AA 4Y98A 4M86A 3JQBC 1DHTA 3KZVA 1FMCA 2JFHA 3JD3A 3K5PA 4RF3A 3HFGA 4YVFA 4L74A 4JP3A 3P19A 3H5RA 1DFHA 1QYVA 4YRDA 2A92A 3EVTA 5L7YA 3C3XA 1ZW1A 2WSBA 2EEZA 4PZCA 1V3VA 3GY0A 3DWFA 4E2YA 2FOIA 1FDUA 1GYRA 2IXAA 1LQTA 3VH2A 4ALIA 4FW8A 1W4ZA 2OOSA 4NH4A 3WXBA 3WR5A 2Q45A 1BXGA 1K89A 1UUFA 5F5NA 4BNHA 4AG3A 4BMSA 2WYUA 2NVBA 3JQGB 2O3TA 1E3WA 4FCCA 4JCOA 5LC1A 5T64A 1E1KA 4XYLA 3NGXA 5A4DA 3JQBA 1N2SA 5COBA 4JBHA 4LSMA 1DJNA 4DLLA 3QW2A 5G0WA 3OBBA 4N18A 3JQAA 3WGOA 4YB8A 3I4CA 3V5NA 3NGLA 5DBIA 1V0JA 3PJEA 5JXWA 2HMUA 4BNUA 3F5QA 1Q7GA 4BO6A 3A1NA 4KWIA 3Q2IA 1KEWA 3HJAA 1SB9A 1HSOA 1CQIA 5F3RA 5EL0A 3E5MA 3KHUA 4NIMA 2WWRA 5GY7A 3EDMA 3DTYA 3HDYA 5JAMA 3FCOA 3ABIA 2GF2A 3JQFC 5H83A 3DL2A 1XQ1A 4XRGA 3ZNNA 4EYEA 5L95A 1WP4A 2X9NA 3I9KA 4PLYA 4DWVA 3EHEA 4NJMA 3GVPA 3LT0A 3W8DA 2ZYAA 2ZB4A 3V8BA 3ZNPA 2NQTA 4XJTA 2FSSA 4JX8A 2J3HA 4DMLA 1ENYA 2DPHA 3D3EA 4IJUA 1RPNA 3O9ZA 4JLWA 4BNZA 2DQ4A 1XELA 2A94A 5I9LA 2X58A 4R9SA 2YW9A 1E3WB 2JAPA 4BO4A 1ENOA 2CVOA 2FWMX 3BHIA 4PFJA 5L9AA 2WDZA 1GTMA 4RVFA 3TJRA 3PYLA 2X23A 4A10A 3EUWA 5BSEA 1HZZA 5TX7A 5L3ZA 3GLQA 3BMOB 1KS9A 1NVGA 5JYDA 1GQYA 4J6FA 4Q3NA 1SNYA 3GFBA 5KVQA 3TOZA 2ZYDA 2Q4BA 2DAPA 5BR7A 4NZ9A 2PGDA 3BTVA 1LDNA 1UXIA 2I3GA 5CEFA 2I9PA 1BWSA 1C1DA 4J1TA 3OSUA 5JLAA 4ILKA 4MVJF 1N7HA 1R0LA 2YHIA 1O8CA 1U8FO 2OL4A 3QHAA 3VZQA 3NT4A 3PZRA 2QRJA 2GERA 5G2OA 3CIFA 4B7UA 3IAHA 4OM8A 1R37A 4ALNA 5A5EA 2G17A 2NUAA 3KOUA 5F1KA 3HFSA 2PZJA 3QWIA 2Y1CA 1WWKA 2VOJA 1QMGA 4J0EA 4Y6PA 4RF2A 1NAIA 1NFFA 4NPCA 3ULKA 1Q7BA 2ZB7A 2H9IA 4IDGA 4PRKA 3F46A 5A05A 1P1IA 4M87A 3OJFA 5TJ9A 3T7CA 1RYEA 3OJ0A 4YJDA 5A9SB 2FN7A 1VRWA 3KSZO 1QYWA 1T25A 4R1NA 3GDGA 4IIVA 3JQDA 2B0JA 5MGBA 3HWRA 1NHGA 3PHIA 3I83A 4BHTA 3NKLA 4FBGA 4IJVA 2ZTMA 1ZMOA 4MP8A 4PIVA 2R6JA 4WGGA 4Z0TA 4CM6A 1ZNQO 4C4OA 2ZB3A 3M1AA 1HLDA 1PJBA 5F5LA 3B6ZA 2B4TO 4ZVVA 1E92A 4K6FA 1NAHA 2CNBA 3ROPA 2Q2VA 4BNLA 3I9LA 3UXYA 2WM3A 3GVHA 3LVFO 4RVUA 3NV9A 4MVJM 1NWHA 1WPQA 1CJCA 3UAGA 2E6UX 3JYNA 1AHHA 1HRDA 4H7PA 3I9JA 2PY6A 5L53A 4NBRA 1IUKA 2CD9A 1X7DA 3C7DB 5U1PA 1OC4A 2VUTA 4QO7A 4OQZA 2NNLD 4PZDA 1XDWA 4NG5A 4WCFA 4BKOA 2VT3A 1Z73A 4JN6B 3C7AA 3GZNA 4N5MA 4XGIA 5B4UA 3N58A 1CERA 1LX6A 1TVEA 4MIOA 4NU6A 1B3BA 4W82A 5AQ1A 3WQQA 4LVUA 3DZKA 4UUPA 5ER9A 4IDBA 4KDEA 4DPLA 4RLHA 1J4AA 3AM4A 1O9BA 5HS4A 4L76A 3INTA 1PQWA 1PEDA 2LDBA 3QVWA 4Q3DA 4WJZA 4AL4A 5G0UA 4BO5A 1UAYA 3LSYA 4C7JA 2EV9A 4H16A 2QYSA 1PGNA 2HK7A 3ASVA 1OBFO 3E82A 4J9VA 1XU7A 1RKXA 4CMIA 4CMJA 4IINA 4PG4A 3PDUA 1JKIA 1KVTA 3PQDA 2EXXA 4W4TA 3BZUA 1U3UA 3FTNA 4ND5A 3C24A 3NDRA 3OA2A 3D4PA 3I9OA 3S2FA 2GLXA 1DIRA 4IZIA 3PJFA 3H9UA 4BKRA 1SEVA 2O2YA 3ONEA 1O95A 2HLPA 2CMDA 1LSUA 1IPFA 1PWXA 3GNSA 2NQ8A 3AI1A 3UGKA 2JAHA 2HMSA 3O26A 4CL8A 1PIWA 2BGKA 1H2BA 3U4IA 2JL1A 4A03A 2O3SA 3MJEA 4B3JA 4BGEA 4GKBA 3Q2KA 1E3JA 4WLEA 2JHGA 3E18A 4OXKA 1GCOA 5COQA 2EKQA 4RPJA 3ZGYA 4PLZA 4PLPA 5COAA 2VYVA 4G65A 2YDXA 4ZQFA 1BHSA 2BI8A 4E31A 3JYQA 4GQAA 2W8ZA 3K92A 4YJHA 5LCXA 3ITKA 4QECA 3PYXA 5TC4A 4YR9A 1GCUA 2C5EA 3E1KA 3JQAD 5EQDA 4B4WA 3DMYA 1V35A 1PL6A 4ZRNA 1XQ6A 2DTDA 2GR9A 4DUPA 2HAEA 4CV2A 2CF5A 3NYWA 5IAAA 3PFWO 1YGYA 3ITDA 2CVQA 3WGZA 3WDSA 4HV4A 4NBTA 4DA9A 3GHYA 1HXHA 5TS3A 4B79A 2HSDA 5DF1A 2PR2A 1I8TA 1X7HA 4GX5A 2Q46A 1J5PA 4I8XA 1OAAA 1XHLA 1AE1A 3GDOA 1F14A 1Y81A 1EBFA 1RJWA 3PLRA 4UEJA 2D4AA 4ZHSA 4YJGB 4BMVA 4CR8A 3O38A 5JO9A 4UEKA 5EN4A 3DFUA 4CL3A 3VKUA 3JQCA 5IDXA 4C7KA 4B4UA 2J3IA 1H93A 1Z74A 2DBQA 3HN7A 1B2LA 2PK3A 3FI9A 4ND3A 2C7VA 1YVEI 3RUAA 4IPTA 4R68A 2FSVA 1ISGA 1Q0LA 3NX4A 1NFQA 4XJSA 4XYGA 3EC7A 4IQGA 3LC1O 1ZBQA 3ZDFA 4TKLA 4JXKA 3WICA 1QXSA 3CPSA 2IEDA 5KOIA 2X7HA 4J7CA 2PGLA 1N5DA 1YOVB 1TA4A 3I9NA 4BS9A 1GZ4A 3VZPA 1I32A 4J1QA 4OXYA 4JJFA 4Z0PA 3WMXA 4E3ZA 2H63A 1I5RA 3BTUA 2WE7A 1DC4A 3TOXA 3OIGA 1R15A 4J16A 4PRLA 5IG2A 3OFSA 3LZ6A 1DSSG 1Y6JA 3HHPA 2WD8A 3QQPA 4PLHA 3HB5X 2IXBA 1UXKA 4FJ2A 1G0OA 3IIEA 2O23A 3WG9A 3B1JA 4Z9XA 1HE5A 3RKRA 4R4JA 4UULA 4XEHA 1CWUA 1NPYA 4RQTA 4XB2A 5K6AA 1SPXA 1C0PA 1E0DA 5A9SA 4BO9A 3AWDA 3RC9A 4RV9A 4ESOA 1HZJA 2Y66A 2HQ1A 4FS3A 1ZXBA 1W6UA 4OQYA 4EGFA 2JD2A 4CR7A 5A03A 3NDJA 1E7QA 4PLFA 1VJ0A 1KY4A 1DFGA 2NV6A 4O63O 5HRUA 2P5YA 3O03A 2EKLA 3TDKA 3ZWBA 2DUWA 3S2EA 2FRDA 4CQMB 1Y5RA 3CUKA 3WOHA 1LJ8A 3IKVA 4CMKA 2G1UA 1M66A 1WMAA 3B1FA 2BH9A 1ZVMA 4A73A 4FSHA 2Q3EA 1KETA 4WNCA 4RDHA 4RZIA 2VUUA 3GH3A 2O2SA 3GMDA 1DHRA 3SLKA 3ZU3A 3R3JA 3DBLB 4BNWA 2BGLA 5CG1A 1HT0A 1HYEA 4XQEA 2JJYA 1LLQA 4CUZA 5I7VA 2O4UX 1T1RA 4M1QA 3ADOA 2EW8A 1AXGA 3AY6A 1Z45A 3IUSA 4IDEA 4MINA 3C8MA 4OIMA 4BL5A 5A06A 5B12A 5CDYA 1I30A 2GO1A 1PQUA 2E4AA 3LT4A 4PLCA 4NNJA 1P1HA 3UVEA 1NXQA 3W4KA 2BFMA 4DIOA 2BF7A 2PFGA 3DMTA 3SBOA 1VC2A 1HSZA 2QYTA 4GMFA 4RCVA 4YACA 1P77A 1DJQA 1YQDA 1JA9A 1FK8A 3A06A 3JCZA 2YY7A 3PGJA 4J9UE 4K26A 2NU6A 3KYBA 2WMDA 4B4OA 1LLCA 2Q1UA 3EW7A 1NM5A 5B1YA 2F1KA 2QZZA 2WD7B 5DBFA 5KJEA 1TT7A 3F4BA 3PFFA 3HADA 1L1FA 2B36A 2UVDA 5L40A 2VN8A 4U7WA 1GUFA 4CQMA 3C1OA 3CE6A 3VAZA 2EGHA 1WVGA 4H3VA 3ZWCA 4DIFA 4EDFA 4YAKA 1GU7A 5LDHA 3HN2A 2YFQA 1VE9A 1K5HA 4Y6RA 1V9LA 4M49A 3MOIA 3GK3A 2DKNA 3H7AA 5HBRA 4XR9A 4LW8A 4II3A 3IDSA 1P1KA 3DZBA 2GDZA 4PGFA 4E5NA 4MIYA 3QA9A 1NBOA 3ZW9A 1X1TA 1HDCA 2GASA 3IC5A 1YO6A 3AI3A 2VNAA 1LTHR 1A4IA 2JCXA 2ZCUA 1PJ3A 1JDJA 2G82A 4DTIA 1F06A 1HEUA 3DONA 1LUAA 3BA1A 2AEFA 3PQFA 3DAFA 1EK6A 3P5SA 3CSDA 3RBVA 5KJ1A 2VHWA 1PJLA 1LDYA 4IDDA 2AE2A 1FDSA 2YV3A 1W0CA 4QXMA 3H6KA 1LRJA 5CHEA 3INRA 4QSMA 4DLBA 1LRKA 1UP6A 5TJHA 3L4SO 2DM6A 1D7OA 2GCGA 4D3DA 1H6DA 1U2GA 3WYBA 1TB4A 3TZKA 5C7LO 3CTMA 1FF9A 3E03A 4RDIA 1ONNA 2CDCA 1ZK3A 2NACA 4ZA2A 2Q49A 3GVIA 3ROKA 2E49A 3RROA 3QP9A 3RSHA 1P44A 1VL8A 2NTNA 1ONOA 1M2WA 3ZWXA 3KLMX 3KYCA 2ZQZA 1ZCJA 5FI3A 1E5QA 1GL3A 1RM4A 3UW3A 3SC6A 4D3SA 1IY8A 1Y5MA 2VRCA 3CZRA 4LGVA 3H4VA 3ZWAA 1EE2A 3JQGA 4HFRA 5CDTA 5F21A 5L45A 4J43A 3OJOA 3ON5A 1MFPA 4TSKA 3U49A 4BO0A 4MVJA 4QO8A 4EI2A 4U6SA 3RD5A 2X4GA 2Q4EA 4OOEA 1EQ2A 4R51A 7ADHA 3L77A 3G0OA 3ONDA 3KEQA 2ZTVA 1LI4A 4NHEA 4WASA 4B7CA 2FR1A 1B8VA 3IKTA 3K2BA 1Q2XA 4FOSA 4B3HA 3VTZA 1Z7BA 2O7SA 1PS8A 2PNFA 5BSHA 3PP8A 1LA2A 2QG4A 4WPGA 5G0TA 3L4BA 3PXXA 4BO1A 3AM5A 2X0RA 3KYDB 3W6ZA 3GMSA 5L7WA 3DO5A 1UAGA 1ZK4A 4W6ZA 4YAEA 1IHXA 4BQRA 1KEUA 2DFVA 3GZNB 1EBUA 4JJGA 2ZATA 3KV3O 4WLFA 4DREA 1XGKA 4YDRA 4NMHA 1GUYA 1I3MA 1DOHA 4DPMA 4CPDA 3AOEA 3KLPX 2PKRA 1FDTA 2X6TA 2VZ8A 3P2OA 4QUKA 4RORA 5T5QA 4CV0A 3IOYA 4CR6A 4YAGA 3OQ6A 4R1UA 2IE0A 8ADHA 1JQBA 1NVTA 1WNTA 2OBNA 2V7PA 1EUDA 4CM9D 1PZEA 2EERA 4RPKA 1TT5B 2D5AA 2Y68A 3WFJA 1CDOA 4D45A 5A5FA 4YQZA 4GLLA 5IF3A 3CZMA 5JNLA 2JD1A 1Z82A 1XIVA 1LRLA 1ZUD1 3H9EO 4CM1A 4YT5A 4M8SA 1N7GA 5F1PA 3WWYA 1ZK0A 3FR7A 1HYGA 4YA6A 4ZRMA 2C0CA 4HY3A 2Q99A 2VWGA 4CQLB 4E13A 3MTGA 1GZ3A 1X0XA 1YWGO 1HL3A 3KVOA 3H2SA 4K9DA 5I8ZA 1PU2A 3L6OO 3H5NA 5AXCA 2VHYA 2B69A 2F00A 4I5EA 1W8DA 2BHLA 1GPJA 3KYDA 1PGJA 3TRIA 1HDXA 3FNHA 2EP7A 2WEKA 1ARZA 3AUSA 2J5RA 2PZLA 2XPCA 1BVUA 1H2HA 3NTOA 1PZGA 4RJTA 3DBRB 4CMBA 1T24A 5DP2A 3LU1A 4MOWA 5G4LA 4E33A 2Y0EA 4W7HA 4ZQBA 1XWFA 2O3QA 3CINA 3R0IA 4D0SA 4IS3A 4CJXA 1F8GA 2C59A 2YHIB 3TZCA 4NBVA 1I2BA 1F8FA 2EGGA 4E4YA 2HK8A 5FWNA 3SVTA 3WGIA 2Y93A 3GG2A 1JVBA 3D5QA 5KCZA 2YUTA 3RQSA 4E2ZA 3GEGA 4EBFA 1IL0A 4B4VA 4MKXA 5T67A 4P4LA 2P9GA 2GZ2A 1EZ4A 1R0SA 3DAPA 3WQSB 5I9NA 4CMCA 3UH1A 4AFNA 4O5OA 4BNIA 4IQ0A 3X2FA 4MP3A 3DC2A 1EVYA 3D0OA 3PI7A 2H6EA 4CM9A 1VLLA 3OETA 4UUMA 4XYBA 3GHHA 3BHJA 3M2PA 4MVJP 3VOSA 4EZBA 2OGUA 4WECA 3G3EA 2FR0A 2W90A 1C0IA 3I1JA 3LC7O 3LF2A 2R2GA 2W2LD 4DC1A 1QV7A 4OMUA 4YEDA 3S8MA 4YRBA 4KUGA 1PS9A 4BNYA 2Y1EA 3AFMA 1DRVA 4L4XA 3ZWYA 3QVSA 5AXDA 3CKYA 2GNAA 2IYOA 3HQ4O 3FNGA 4J2HA 3KB6A 1DIBA 4ND2A 5IJZA 4P8RA 3TSCA 1ZZEA 1U7HA 4XR4A 3TZ6A 2OP0A 3FWZA 3BMQB 3OIFA 2GSDA 5DCWA 2DTXA 2RBEA 4WE3A 2E48A 4IGFA 4XRRA 2GD1O 5FYDA 3I6IA 4NDNE 3ZWWA 5L4SA 1XLTA 5EJ2A 1Z75A 4G2NA 4BNXA 1I24A 4FOOA 4J2OA 4J7UA 4OO3A 4BKPA 4DIBA 2WTBA 3UKOA 2WE8A 3RUEA 1UP4A 5DULA 1G0NA 4YT4A 1QYDA 1NP3A 2EJWA 3U5TA 1PGOA 1WDLA 1Y8QA 1NFRA 1FDVA 1U5CA 4GMGA 1E7RA 4I08A 4JQCA 5CDSA 1YL7A 4K28A 4GLOA 5H82A 3AW9A 3UF0A 4TRRA 4A7PA 5KWEA 3RJ5A 2XF8A 2J6IA 4KZPA 4D44A 3I9MA 2IZZA 1KEVA 2Y0CA 4Z3DA 4RVGA 4BB5A 2NWQA 4KP7A 1WZEA 1NQ5A 3QWHA 4ID9A 3GRPA 5CDGA 2O48X 1EEHA 4WLVA 3NTQA 3S2GA 1NR7A 3TL2A 4Z6KA 3CMMA 5MDHA 1KBZA 2A9FA 2HMVA 3OM9A 4RVDA 5IDQA 2NADA 3GOHA 3QVOA 1PL8A 5DBGA 4EITA 3OH8A 2OP1A 2X1HA 3G49A 1BW9A 4R01A 1BTOA 1GY8A 2JHFA 5TSDA 2OBYA 4U0JA 4PG8A 4MKZA 1KVQA 5TRTA 2AG8A 3M6IA 3PWZA 3R1IA 4NQZA 3WWZA 2WYWA 5TLSA 1NR1A 4MVJG 3ZWMA 2G0TA 3WSWA 3I52A 5THKA 2CVZA 1E3IA 4JBGA 4NFSA 1EDZA 5A9RA 5JE8A 3GGOA 1O5IA 3A14A 2CUKA 4IIUA 4W9NA 2HDHA 3AU9A 3SC4A 1NPDA 1JKFA 2WYVA 4DBVO 3KSUA 2BFOA 1DXYA 3NJ4A 3B20A 2AHRA 2XAAA 2ZCVA 3DXFA 3LYLA 3ETGA 3BHMA 3AOGA 1MG0A 1R4NA 3NEPX 1GYQA 4QFCA 3NAQA 1A9ZA 4LCJA 4PN3A 1J6UA 3EYWA 1PGPA 3GZ4A 2P4QA 1HWYA 1MGOA 3BAZA 3IQDB 3Q1LA 1LEHA 4CODB 1D1SA 2NU7A 4D41A 1BXZA 1PJSA 1VL6A 2Y67A 3MTJA 1NQTA 3O8QB 4R5MA 1UXGA 3BMCA 4YT2A 1UP7A 3O4RA 3KTDA 1UH5A 1GADO 1VKNA 3V1UA 2B4RO 1A72A 5ADHA 1A5ZA 3UN1A 3PHJA 3GVCA 2GN6A 4ONEA 3WFIA 5JCJD 3KUXA 5G4KB 3RJ9A 4RPGA 2FPIA 2UV8A 2X5KO 4XZ3A 1CF2O 2NTJA 4RLSA 1C0LA 2TMDA 3K30A 4GX0A 1BW9B 1YRLA 2D1YA 1X15A 4YJFA 3W4JA 2VOEA 3ZWOA 2DLDA 2XOXA 3COSA 3ANNA 2W4QA 2NM0A 3S2IA 4P22A 4YRAA 1A27A 2A35A 4S1VA 4XKJA 4Q3CA 4FFNA 3U4DA 2AMFA 2OXIA 3U09A 4OAQA 3VDRA 1W73A 4IMRA 4GX2A 1XR3A 1DBVO 1NPTO 3WTCA 3L9WA 4BB6A 2PZKA 4I5DA 4WKGA 2D8AA 2I3AA 3ASUA 4A26A 3VH1A 4YT8A 5JYEA 3TZQA 5U4QA 5BQFA 4R1SA 3MJVA 1B8PA 4LMRA 4F3YA 1T1SA 1EVZA 4CM8B 6LDHA 4CM3A 4X54A 1BDBA 3MWDB 5BNFA 3D1LA 4UUNA 1UZLA 2C29D 4IS2A 1U7TA 5AOVA 4RGBA 2HKIA 5HM8A 5A02A 3EZLA 1T4DA 1B14A 2FZEA 3AOEC 3GAZA 2H5LA 4AJKA 1T26A 3VPFA 4UVIA 2DC1A 3T4XA 4OYRA 4BNJA 3HUDA 1HETA 2ZJ0A 1MFZA 2I65A 4H15A 3DBRA 2LDXA 3DB2A 1GUZA 1DC5A 2HO5A 1A71A 1PGQA 3DR3A 4W7IA 5JAQA 2I76A 4MKRA 3U4CA 2V65A 1SB8A 1YB4A 1TEHA 1KERA 4F45A 2JFGA 4J90A 4Q3AA 4RVSA 2YQ4A 9LDTA 3NDIA 5KJ6A 1Y8RA 4AJLA 3AM3A 3FHLA 4QTZA 2E37A 1S6YA 3FN4A 3QJ5A 4CLDA 4HFNA 2EWMA 2HMTA 2J5QA 2FPPA 4OSPA 3ZH2A 4P4GA 1HDRA 4OH1A 4WEOA 4CLHA 3H3JA 3JQ8A 3JTMA 3WGHA 1D8AA 4E5KA 3DZGA 2PV7A 1QYCA 1T2FA 1ZEJA 1KIFA 4R3WA 3GA0A 1U4OA 3DZFA 3VHRA 2O3UA 2ZTLA 5JC1A 3D5TA 2HRBA 5TNXA 1FJHA 5B4TA 3L6DA 1G6KA 1PZHA 3ZWVA 3WJAA 1OI7A 4BV9A 4ZQGA 3VPHA 1QV6A 4JP2A 3OJEA 4QEDA 1E6UA 2P9CA 1KVRA 1E7WA 4BMNA 4OL9A 4CM8A 1E6WA 3OEYA 2BD0A 3V1YA 3G79A 2IDZA 3RC7A 3TN7A 3BXXA 4BNVA 4HXYA 1B26A 3ETDA 1WXDA 3UICA 1YB5A 3VTFA 2GUGA 3RUHA 4D0RA 4EJMA 4PG6A 1ISMA 3RC1A 1EUCA 2AG5A 2PD4A 4GX1A 1JAYA 1DDOA 4Y9DA 3AY3A 1IB6A 4DRYA 5AXBA 2BELA 3D4OA 2RH4A 2GYYA 3PRJA 4GWKA 3DHNA 2X0IA 4FJ1A 4L73A 1I3NA 1GPDG 2IRWA 4BKQA 2GGSA 1E3LA 4PG7A 3E9NA 4Z9YA 1T2DA 4FGSA 1NWCA 4ZQEA 3T4EA 1LSOA 1M76A 1JKJA 2UUPA 1YL6A 2HU2A 3FBTA 4UUOA 3ONFA 1ZKMA 1PJ2A 3AU8A 1D4FA 1U5AA 1E6EA 3DEYX 1JWAB 5B37A 4F46A 1ORRA 1Y9EA 1D1TA 2I99A 4KUHA 3HDQA 1HTBA 3ICPA 5AVOA 1AN9A 1V6AA 3D7LA 4OJNA 4Z0HO 2DT5A 2RHCA 5JCJA 3M2TA 5KKAA 1SMKA 1SAYA 4Y6SA 4AJOA 5ENVA 3DMTC 3WBBA 4DXHA 3GF4A 4BVAA 2YHUA 3MJ4A 4IDFA 2OZPA 5DT9A 3WNVA 3AUAA 5KJFA 5JBIA 1E7YA 4CMHA 4IJKA 1PR9A 3ZN2A 3ZV3A 3QSGA 4DLAA 4CMEA 5CAEA 3KYCB 4XGKA 1ZSYA 3PHGA 1ZSNA 1JWBB 5EIOA 1YDWA 1DLIA 5EESA 1UXHA 2FZWA 2IEBA 4GI2A 5IZCC 2OFPA 2VHVA 3DHEA 3JYOA 3ZW8A 3LT2A 3LLVA 4IQ8A 3RFXA 1VJTA 2HJSA 3MOGA 4ALJA 4DGSA 1LDMA 1MX3A 1VL0A 2FY8A 1ISIA 5IDWA 3GNTA 1RWBA 4PCVA 1RM3A 4E2XA 4XDYA 2AE1A 1V3TA 2W2LA 2X9VA 1IHYA 3ZNOA 5ICSA 5H81A 1OFGA 1GQ2A 1NNUA 4TMFA 5C3MA 2YDYA 2Y1GA 2CF6A 2YYYA 1IPEA 3E9QA 3EAGA 5KNLA 5JDCC 5CPBA 2RHRA 4AICA 2FPGA 5L4LA 3D4NA 1DRWA 4XCVA 5CDUA 5JPIA 3DBLA 1UR5A 1T4BA 3FBGA 1IULA 4EUFA 3RAJA 5DCYA 4K1LA 3LC2O 4KMSA 2VHXA 2VCYA 1B15A 1Y1PA 4TKMA 5C7IO 4BIIA 4Y67A 4MO2A 2Q2WA 3ANMA 3M1LA 2C20A 3V1TC 4I5GA 1Y9AA 2Y05A 4FC7A 1SOVA 2Q1TA 1Q0QA 1HF3A 1CETA 4E5MA 4R54A 3CXRA 2ZKLA 3E8XA 1ULSA 4KQWA 3WIEA 5ILGA 1P74A 3Q6IA 4J49A 3ROQA 2JKVA 1P0FA 4KOAA 4E6PA 1ML3A 4EUEA 2VUSA 4J1SA 2X86A 2P91A 2GN9A 3PPIA 3WMWA 3GVXA 4M89A 5JDCA 4LMPA 2D2IA 1LLDA 2SCUA 2AQKA 5T8KC 4HKTA 1MA0A 1YQGA 1QP8A 4CQMD 5L51A 3L4BC 3TPCA 4YPOA 1EQUA 3GUCA 4ALKA 1L7DA 3ZV5A 3WQRA 1C1DB 1WDMA 4NU5A 4ROSA 4JJIA 3QY9A 3PJDA 3GGGA 1M75A 4S3MA 3E5RA 3WX0A 1P45A 2XXBA 3DOCA 5GZ3A 4KDFA 2QRKA 3FPCA 1GV0A 1DAOA 1IE3A 3WTBA 4CV1A 1PX0A 1VKOA 2E82A 1EE9A 2C2XA 2X0NA 5DDIP 1X0VA 4B3IA 4XDZA 4YWJA 2D0IA 4L75A 1I0ZA 5I7SA 4Q9NA 1ADCA 4L4RA 3U62A 1RYDA 2CDAA 3ZWNA 4AJNA 3ZHXA 4R16A 2B83A 1AHIA 1KOLA 3QLJA 1NVMB 3KEOA 1ZJYA 4KTTE 2P4HX 3VDQA 5ITVA 1EMDA 1F12A 5ENDA 3E6AA 4DPKA 4BNGA 4PLWA 1T2EA 3GAFA 1WMBA 4Z9FA 3P7MA 1PR3A 3EGOA 3OECA 4RVHA 4GAEA 4JROA 2UUOA 2EKPA 1B16A 2C2YA 3UCXA 1TXGA 1PSDA 3JQFA 5BNTA 3CEAA 3W1VA 1H6BA 2PA3A 2Y0DA 3Q11A 3RUFA 4EUHA 1M67A 3NRCA 3ZU4A 1EK5A 1V3UA 3KXDA 1GQQA 4O1MA 1BRMA 1ID1A 3EMKA 4GGOA 3TF5A 1IOLA 4I5FA 3AI2A 3PWSA 2VYVD 2CSUA 3TNLA 1AUPA 3F3SA 4FDAA 4MVJI 2V6GA 3KETA 4PZEA 2X0JA 4AJEA 3OMLA 1KC1A 4DQUA 3DDNA 1G1AA 4CMEC 3HSKA 1F17A 4BV8A 1DIGA 2VYNA 4XD2A 1DC3A 4FIZA 6ADHA 1PJCA 4HADA 3ZV4A 3PIIA 5EMHA 3RFVA 3VH3A 2I5PO 5CEEA 3I6QA 3TZHA 2CZCA 4NK5A 2Z5LA 2QIOA 4HBGA 2AXQA 1VSVA 1QR6A 1YJ8A 2PD6A 4CLXA 3BMCB 5I9MA 1GAEO 2CY0A 1CYDA 5HA5A 1U2DA 3QVXA 4HUJA 3U4HA 5DOVA 4CLRB 2D3TA 5C37A 3HE3A 4FD3A 3K31A 3GG9A 1H94A 3O8QA 1X13A 4LISA 4EEZA 4K6CA 4D43A 2HUNA 5AXAA 1YXMA 2JD0A 1MXFA 1NX6A 1U8XX 4UREA 4EEXA 2IODA 1SEPA 1A4UA 1DB3A 3DQPA 1B0AA 3PWKA 1E77A 5ILOA 1B7GO 3H8VA 5TT0A 5LDGA 1YDEA 2QHXA 1DPGA 5KVSA 3F47A 4CUKA 4XQCA 2EF1A 1JLLA 1YBAA 3BMNA 3CH6A 3BMOA 2EP5A 4F6CA 4URFA 1VJ1A 4U5QA 4P38A 4WCDA 4I9UA 3P2YA 1QSGA 3ZU2A 2O3JA 2YZ7A 1U3WA 3F1LA 4O59O 4B7XA 5BSFA 2VTEA 3VZSA 1N92A 2FHSA 3H5AA 3PQEA 4J7XA 3MJCA 4U0KA 4DMMA 3IS3A 3GFGA 2WD7A 1T2CA 1AXEA 1N1GA 1C1XA 1MLDA 4J0FA 4LVCA 4E5PA 3KO8A 3RASA 3SXPA 3H9GA 2O50A 2VNSA 4CLEA 2Q50A 1GEGA 2VWPA 2YJZA 4TRNA 1X14A 3BYZA 4NR0A 1JTVA 5GMOA 4TVBA 3C85A 4E21A 1N9GA 3K2EA 2NVWA 2EG9A 4HWKA 3OP4A 5DOZA 4HNGA 4IXWA 3DOOA 1FDWA 4CMAA 4TWRA 4BO3A 1T2AA 1SOWA 4B8WA 3JQEA 5A1TA 5CP8A 4RPLA 1H5QA 3C7CB 2HCTA 4CM4B 2X9GA 1I3KA 1ZIDA 2AA3A 2NTVA 2HMWA 2IYPA 5T8KA 2B37A 1BMDA 1R6DA 1RM5A 2FMUA 4IXTA 4I9NA 3SEFA 1Y7TA 5FI5A 1GD1O 5CPFA 4NJMB 3FNFA 1MXHA 3UHAA 1EFLA 9LDBA 3L0DA 2GN4A 2HK9A 2OMEA 4DQVA 3HZZA 5TT1A 5THQA 3BMNB 3FWNA 1SC6A 1IYZA 1E1NA 5C7OO 2W98A 5DZSA 1XSEA 3N74A 4KTVE 3QVTA 1CRWG 2JCVA 1BSVA 4BO7A 2C07A 1LC3A 1B3RA 3W6UA 3V2HA 1ISFA 3ORFA 3S1LA 3PDJA 1AGNA 2P2SA 2GZ3A 4J4HA 1ZO8A 4XIJA 5FFFA 3RVDA 4AJ4A 4EW6A 3JD2A 1GZ6A 4CM7A 1H9BA 3ADPA 3IJRA 1UDAA 5G4KA 4YJFB 5FF9A 4WNIA 1GEEA 1XU9A 3PYMA 4JK3A 5EPOA 3JD1A 4JIGA 1ENPA 2PZMA 4AJPA 5C5IA 1U1IA 2B35A 1YBMA 4HX5A 2EW2A 2YQ5A 3DOJA 3G1TA 2VTDA 4N5LA 1YH3A 1PJ4A 3HB4X 3HNPA 4M54A 5CG2A 2UAGA 2VT2A 1P0CA 4OXNA 3IJPA 3QWBA 1ENZA 3STHA 3VKVA 5DNAA 2NVUB 3GC6A 5IN5A 3IP3A 5IZ4A 3HG7A 4XX0A 5BT9A 3C1AA 1HKUA 4BGVA 1PTJA 3WYCA 1S7CA 1LC0A 1UZMA 3WNQA 1ZFNA 4DVJA 3MZ0A 5JMPA 3K73O 4AJIA 1IZ0A 5U9CA 5KTKA 4HP8A 4XB1A 5CFZA 4D7AA 3A4VA 4DQXA 1R12A 2J5KA 2Z1MA 3AUTA 3H9JA 2Y1DA 4D42A 3LQFA 3TFQA 1DIAA 4B8ZA 2V6BA 2GN8A 1A7KA 1E5LA 1KEPA 2PH5A 5JW6A 3BIOA 3PGXA 5JCXA 2VWHA 1NQOA 5BSGA 1SO8A 1N8KA 4OKNA 1P31A 2FP4A 2V6MA 2AEMA 3Q3CA 3AFNA 2D59A 1CEQA 4N5NA 4BO8A 3K8ZA 5TIIA 3KSDO 1PS0A 4AVYA 2RIRA 4FR5A 4CLOB 2BFAA 4G81A 3PTZA 4FGWA 3U0BA 4GGPA 5JY1A 1HYHA 4J4TA 5EQFA 3W4IA 3ZI0A 1Y8QB 3GEDA 4A5OA 3OJLA 3FSRA 1DFIA 1J49A 1LDGA 5KJCA 3ZHBA 3I23A 4ALLA 3H9QA 4NBWA 2PGJA 2Y99A 4NK4A 1E1MA 3FNEA 4BNNA 4ZD6A 1GYPA 3PJGA 1L7EA 1E7MA 4FFLA 2DU8A 5KVVA 1GR0A 2VRCD 4JGBA 4OGWA 4LRSB 1TT5A 2DBZA 3WIDA 4ALMA 5DCUA 1BXGB 3PVZA 5ES3A 4DC0A 3NT5A 1M6WA 5IN4A 4Q3EA 3JD4A 1P33A 4I9HA 2IZ1A 1HDYA 4FFPA 2VZ0A 4IUYA 3EVNA 3PLNA 5I7FA 4LK3A 2RAFA 4TZKA 1P1FA 2NVUA 3RKUA 3JQAB 1EUZA 1J0XO 2C7GA 1ZXLA 3UFXA 4L0QA 1OMOA 1Z6ZA 4QT0A 4CQLA 3WB9A 1DAPA 4L9RA 3TWOA 2P68A 4AJHA 4O0LA 5GZ1A 3RI3A 1SCUA 3NTRA 3U3XA 3UOGA 5T57A 2Q1SA 2QQ5A 4IBOA 3QRWA 4N7RA 3L6EA 4ZN6A 4UVEA 1DRUA 1OOEA 1LU9A 5HTOA 1ZH8A 3IL2A 1E1LA 2TMGA 1LDEA 1EDOA 3ZHYA 1ZK2A 3SLGA 1ISHA 4CMIB 1DLJA 1NQAO 3VVBA 3GQVA 2JCYA 3DBHA 3I4FA 3KM0A 5JY6A 1R66A 3GUYA 1YBVA 4YAJA 1ISJA 2ET6A 4INAA 3VZRA 4TRJA 3DTTA 1I10A 4MJLA 3ZU5A 3WLEA 1A9YA 4UVGA 2X5OA 3V2UA 4E32A 5L4NA 4J1NA 2WJPA 1CIVA 4OHUA 2Q2QA 4YXFA 4YAIA 2ZK7A 1MV8A 1P3DA 4GBJA 1YQXA 5JSFA 4LCEA 1ZJZA 3OQ1A 4GWGA 3RBZA 1HLPA 1LLUA 5CEJA 2QX7A 1MP0A 4FB5A 4XIYA 3GDFA 3JQ6A 1XEAA 4ITUA 3TQHA 2W2KB 5A3VA 2FR8A 3ROMA 3PEFA 2VQ3A 3HDJA 1VSUA 3GR6A 5IDYA 5JDIA 4ND1A 3EK2A 3QWAA 4A27A 4MIEA 4CM4A 4M55A 4IMPA 3ZV6A 1R16A 4DBZA 3R3SA 2BI7A 1DO8A 1JW9B 1TLTA 4TRMA 3G17A 5JAIA 5JFOA 1YKFA 2AQ8A 1U4SA 3LLSA 2DVMA 5T6BA 4AJ1A 1P1RA 2P9EA 2OUIA 2Y1OA 4R1TA 3VPGA 1VI2A 1KVUA 2PKQO 4RQUA 1N9GB 1P1JA 3EZYA 4QQRA 1HDZA 3BTSA 4IM7A 2R00A 2AQIA 2A4KA 3W8EA 1YB1A 4FFOA 1O94A 4WUVA 5ER6A 4OSOA 1O89A 2VYND 5A04A 3OA0A 4JBIA 3U9LA 5TGDA 3B70A 2X5JO 4IJWA 1BVRA 4WLNA 3LT1A 2CDBA 3OEWA 1ADFA 4A2CA 1H6CA 5B4VA 4MVJH 4EJ0A 1B8UA 2DFDA 1ADGA 1JVSA 3DHYA 4QFDA 3H2ZA 3PZBA 4J3FA 4KUEA 3OIDA 2Z95A 2ZQYA 1EVIA 2X22A 2PKQP 3ENKA 3GEMA 2VHZA 2EJVA 5G0SA 4GSKA 4CLRA 1ZSVA 3WGGA 3OQBA 4MVJD 2H1SA 3A28A 4HFJA 4P4NA 5AYVA 3F1KA 1H6AA 1NTOA 2OHXA 5KIAA 4GVLA 4XQGA 4ZQHA 1K6XA 2BKAA 3Q9NA 3WS7A 3GPDG 3NJ8A 3JD0A 2QW8A 4D79A 2Q1WA 1QRRA 4WLOA 3WGQA 2ZB8A 2RH8A 3N7UA 1MC5A 3RBXA 2HRZA 4BNKA 1IZ9A 4TZTA 7MDHA 3DFZA 3FPLA 4XWYA 1MG5A
chains in the Genus database with same CATH superfamily
5LJIA 4IOLA 2YX1A 5ALRA 1Y3FE 4YUYA 4YQYA 2OSBA 1Q50A 2RB4A 2VPTA 3B5EA 4NBUA 3S7ZA 1AD2A 3QUCA 4I19A 1U3VA 1YZYA 4NATA 3MIZA 4OI0A 4QODA 4ZDIA 1Y34E 4ZOAA 1H4QA 2I4IA 3WSVA 2D54A 2DX7A 3I5MA 3CRW1 3TW4A 3I09A 5LLTA 4FNAA 3QXSA 2VO1A 4JC0A 4URYR 5FEUA 2HDOA 3FUWA 3MRVA 3OQVA 3AP2A 3C3EA 1KI6A 2R1ZA 4G0QA 4NS4A 4PGGA 3R3WA 4W5OA 5FTKA 1IJKA 3RTDA 4PG5A 2QP4A 3GLHA 2I34A 1YOVA 4ZAXA 5HIMA 4YJ2A 3W8FA 4ZOBA 3JQ7B 2H9AA 4YFYA 1NI5A 3SIRA 4BATA 4MVJE 3GT3A 2DPMA 2Q1XA 3M5PA 1WHTA 1BX0A 4GFDA 4MI3A 5IH3A 3NHWA 2JLSA 5JPDA 1DELA 5DP1A 3JYPA 3KE9A 2I6TA 1JTFA 5CJ2A 2AF3C 1OYOA 2GCNA 3X2EA 4EY6A 4CW7A 4EY3A 5KB3A 3JZIA 4MCIA 1E2DA 1QX4A 3NM6B 5JXGA 5FLYA 2B61A 1J24A 1O03A 3UJ7A 4RPHA 2ZE5A 4IQ4A 2Y1FA 3TLXA 2NYAA 3OOSA 4I6EA 4EYOA 1PW7A 1EXNA 1L4LA 1PWZA 2X5NA 3L18A 4W99A 5AESA 1EJ0A 4UAGA 2VJOA 3VR4H 1K88A 2CD7A 2O52A 5IC6A 4WOJA 4DHWA 2PUAA 3KTAB 4I4TA 4MHSA 1USKA 2YBDA 4N01A 4YDQA 3DBHB 4J91A 1CJUC 2EOAA 1FQWA 1VTKA 1RYHA 2IUSA 2Y9PB 3GN1A 4YMSA 9ATCA 1EVJA 3AKYA 4FC6A 5K3EA 2H7YA 2CT8A 1K8XB 2DTEA 2Q1YA 2XIJA 1V8BA 1VM6A 2P9HA 2OKGA 1GGHA 3VKHA 2QT9A 1C81A 4FWBA 1MT0A 2O1XA 5D2CA 4E7PA 1NUSA 1E3DA 1MF7A 2NPIA 1X8LA 1X1RA 2V7GA 2DERA 4LHZA 1Q5PA 3S7TA 3PHCA 3K32A 1G3IA 4R2XA 1WLSA 4BX9A 2Z6AA 1D6MA 2QMYA 5TQVA 1OF1A 2B5VA 2VFAA 2GF9A 2VP2A 3WRWA 1UXJA 2QE7D 4N6GA 3ISJA 1ZXXA 2E5LB 1FLDA 1E3EA 2NOAA 4P54A 4XYMA 1G17A 4KNVA 4TV9F 3KWFA 4NOJA 1WOYA 3N2YA 1Q0HA 4W1QA 4DZTA 1WG8A 3W2HA 4ZICA 3NFRA 2Y1LA 4JYAB 1LBEA 3ZX4A 5ICCA 2I67A 2LIPA 4Y8VA 4DR7B 3GN2A 5FUMA 1L5HA 1TMYA 3FKSD 2J0EA 4EW1A 5F33A 5FFNA 5HMMA 1WQ4A 3AZOA 4NOMA 5CYPA 5HUJA 2IITA 1YZVA 2O0KA 1AKNA 1XMQB 2OTCA 2XUZA 3PK0A 4LZPA 4XFDA 2AJTA 2NU9A 2REBA 2F43A 1AGYA 2I0FA 4OVKA 5BW8A 4C0LA 1DS6A 2V74B 3ML1A 1QIEA 2WNIA 4GPEA 4AIRA 2IZ0A 3G7SA 3BFXA 2Q6IA 3DCYA 3Q7QA 3TRDA 3VOAA 1KC3A 3D5EA 1BG6A 1YS4A 1MO6A 2W2PA 3JQ8B 4ZAYA 4RO0A 3GCDA 3IOMA 3RSCA 3ICCA 4G5QA 3C7TA 2BZSA 4Z7QB 2O8NA 3LA8A 3U19A 1WZ2A 4E12A 4PSKA 4WTOA 4M88A 4L02A 3SZRA 1SC1A 1KFCB 4Y6GB 3CH4B 1LW6E 3CMCO 2Z2IA 3E48A 3C3YA 4MS3B 3I28A 1WKBA 4E5YA 5EJ7A 1XBTA 2D5CA 1UDCA 5DK6A 2BOVA 2GPTA 1CR1A 3M6UA 4PZPA 4GS5A 3TK1A 5B57C 4C9BA 4E46A 2EDAA 2JAXA 3U26A 2B82A 2YV1A 3F6BX 1QWOA 2R5WA 5KDOA 2GI4A 5CVDA 4DR4B 2ZTUA 3TBHA 2IDJA 1E4EA 1YHNA 5GJBA 4TVSA 4RF5A 2IHTA 3GRVA 1Z68A 2YN2A 4EKEA 1NJ2A 1Z3CA 5K4AA 3ACCA 2BFCA 5C5EA 4QYSA 3ZXXA 2NU7B 4BV8A 3GNQA 1UWVA 1I94B 2LRHA 3GT0A 1E7SA 4TTRA 3ZGVA 4XM2A 4O3MA 2FFHA 3SJ7A 5KYXA 4MP6A 3LF1A 3HWWA 5BWBA 3Q0EA 2P2GA 5FBWB 2OV3A 4AP5A 2OO5A 1Z37A 3N87A 4HPXB 3BD7A 2BHRA 4YMHA 1FQJA 2QVXX 4BB9A 4IDAA 2UKDA 5BNIA 4LSWA 3VUFA 2ZYGA 2W0SA 1C4OA 2FWJA 3K6JA 5SV2A 4EZEA 2N46A 5BSRA 5L7TA 3TFOA 1HE2A 4EHDA 4ZJYA 1THGA 2P1DA 3BD9A 3UAZA 1YJQA 3RUIA 3CUYA 3PS9A 1XQWA 4JODA 5EUQB 1VG8A 3BVPA 2ZPTX 1DWQA 5H9VA 5JC8A 1KQOA 1SKYB 1V47A 2P6OA 2VDPB 3UUGA 3R5XA 3RFTA 1L5WA 1YA6A 2NSDA 4P98A 2XBMA 2HA6A 4WLUA 4RY8A 4WKNA 5ALEA 1WZIA 2H07A 1EWQA 1FRZA 1AZWA 3LWDA 4TSFA 2OORA 4PYRA 2J59A 4N54A 3GAAA 4Y2SA 3LG2A 4E0BA 5JLJA 1KAMA 3GUUA 2X0KA 2PWAA 4QX6A 1SQGA 3DZJA 3H11A 4PQFA 4D80A 2Q3MA 3T3DA 5I9SA 3RS8A 4BGIA 1CCWA 1P9NA 2AW5A 1X7WB 1QH8A 5L3VA 1C8VB 3M4JA 1MOQA 4R3UC 3TM5A 2NO1A 5K8TA 2Y9MB 5CNMA 3FZQA 3TQCA 4X90A 1KWKA 4BP8A 3MGCA 4XGNA 3NT2A 1RRVA 3TBFA 3SWWA 1QQ6A 2FZLA 1ZUWA 4IJ6A 1WW8A 3Q10A 5G0VA 4U7PB 7AT1A 3VJRA 3CEMA 1TYCA 2FX3A 4YCJA 4HAWA 3EUEA 2QAGA 5DE3A 1L5GB 3L6BA 4EECA 2XMPA 4BNFA 2PWZA 3RVLA 4OKIA 4AECA 4J0JA 5D3KA 4IUCS 4R41A 1X7GA 2FJPA 1JSXA 4YJ2B 1GARA 5EUCA 2O14A 3D4BA 4ECEA 3P2KA 1QDUA 3JU3A 4DYDA 5KPDA 1EDDA 3AUUA 2Q8QA 5EOVA 1J1UA 3QVKA 4E30A 4ZOLB 3UPTA 1PJAA 1XZHA 3ETEA 1RYNA 1MH9A 3QZUA 2CZQA 3CGWA 3N0TA 4RD6A 3ZCUA 4G5SA 3GDWA 1SUWA 4NBKA 3R7FA 5GIPE 1IXZA 2ZSJA 2V7EA 5LKAA 4O4LF 1F9EA 3QKWA 3A2MA 3R3XA 2IV3A 1VBKA 2MT9A 2O8CB 2FPGB 2JLRA 2Q0XA 1EDEA 3C5WP 4QOHA 4RS4A 4BO2A 2HLHA 3I42A 2PLNA 5KOHA 2B2NA 4WGFA 4MS1A 4FX5A 1EUDB 3QMWA 5EPEA 4V0OA 1Z2EA 4KB5A 2HNAA 1E5TA 4DIUA 3N8IA 3OFND 5EHZA 1D3AA 3TOCA 4CU5A 2P0AA 5IXSA 4C87A 3VJKA 1MOSA 1UEIA 2XBLA 1NI4A 4Q48A 4LHYA 3HB0A 3P0JA 4TTPA 2LCQA 3VYSB 2C82A 2PHZA 3TFWA 4HAXA 1LSJA 2C3MA 2XDAA 3QMMA 2C7PA 4LDZA 3AHHA 1XVVA 1O54A 2H57A 3O4GA 1TU3A 4O33A 1PJQA 3SIXA 3PR1A 2R00C 4US0R 5CURA 4XVCA 1DWOA 1EP9A 3G5AA 2UYYA 5HUQA 2FK8A 2WAYA 4R9UC 4MPDA 3UB2A 3AETA 3J81A 4HUQA 1C9MA 2EHDA 1BDMA 2I2AA 2I78A 1I2CA 5IAKA 4MYSA 1GDTA 3CKLA 2RBGA 1CP3A 2OXFA 2P2YA 4EYGA 4ZHQB 1VHWA 1M83A 1DT5A 1J8MF 2JFHA 1N7JA 1C2YA 3JD3A 4ZZ2A 2QG9A 4EA8A 4KXFB 3IAUA 1AQUA 4ARBA 3D7MA 2C5SA 1B42A 2VQDA 1CRLA 3H5RA 3KKPA 3QQ5A 4N3AA 4YRDA 2A92A 1BHJA 4C5AA 4EHNA 1IONA 4FE4A 4NL4H 3C3XA 1B6TA 2JFXA 4PZCA 5HTKA 4MWEA 1QO7A 2X4DA 4EO4A 2IXAA 2SKEA 3DBOB 1T4GA 5BPHA 1X6VA 2FVYA 3O4FA 1CZUA 2OOSA 4FW8A 4NH4A 4K0KB 1J70A 2O8EA 4FS8A 3WR5A 1L8OA 1REQB 2XUHA 2ZXEA 1V4BA 3KYJB 3V8PA 1UUFA 1Z39A 2O2HA 5F5NA 4G85A 2XGMA 4QRDA 4FX2A 3HCNA 4Y0AA 4WXMA 2NVBA 3P0IA 4KC0A 3PRYA 3JQGB 3HVIA 4TQUS 3I2FA 3PGVA 2HHAA 3SQOA 1E3WA 1W1IA 1FS5A 2WI8A 3QHQA 4JCOA 4NCHA 3RAPR 3V55A 4GXNA 4P7FA 1E8NA 4JLAA 3T41A 5KTNA 5A4DA 3U40A 2IEZA 1JNXX 3OOJA 5COBA 3VR6A 3RYIA 1Z2PX 3EQZA 4RKWA 3ABSB 3FNRA 1A9OA 4N18A 4NTZA 1XZGA 3JQAA 2G25A 3KJZA 3O3OB 3ZIUA 2ZR8A 3O4IA 3SM3A 2B99A 3HI4A 3NKVA 2EJTA 5AVXA 3H5VA 2HV8A 3O8BA 1GUDA 1Q7GA 1GG8A 2BKLA 3QOYA 3HB9A 4KXUA 3A1NA 3NIFB 4IQFA 2OXTA 4KWIA 3A7EA 1HSOA 1H4SA 4UBMA 5EMKA 3AY0A 3KHUA 4NIMA 4ZRDA 3STXA 4N76A 4UATA 3WP0A 3BKWA 3V4LA 3EDMA 3DTYA 5AW6A 4LDJA 1ZGHA 2BKUA 3TZBA 1XWWA 5GQSA 1XQ1A 4CG3A 2OCBA 2PH7A 3IA7A 2IXTA 4KQ9A 4DA0A 4PLYA 5FBKA 2HL6A 2R47A 5GADl 4DWVA 5LMCA 4G0WA 2D7CA 4RA9A 2GEJA 3E05A 3EHEA 3JAWA 1F0NA 3TCKA 5L3RA 3D8NA 3H13A 1M34E 4G07A 5LUBA 2ZB4A 1NBEA 1YS1X 4HGPA 4M8NE 4X84A 1U0EA 1UBJS 3C3PA 5L3QB 3BDAA 1ULHA 2HIMA 2WYHA 2A3RA 2FSSA 3EWSA 5AKEA 1KDVA 5DNCA 1D03A 2J3HA 5REQB 1ENYA 3LBNA 5FLEX 2MIIA 2XCSB 4IJUA 5HYVA 5FNVB 3OFKA 3QBJA 2NUTB 4JLWA 4UTRA 1H22A 2HH9A 4GYJA 4CL2A 5EC8A 2IF2A 2IVFA 1ZOOA 4FUTA 5BUCA 5HNKA 4L85A 1Y4UA 2YW9A 4BO4A 1DBQA 3VI4B 1QKJA 2FWMX 5ICEA 5BQ3A 2YR0A 2FG6C 3BHIA 1GO2A 5IVDA 4KWTA 5IM4A 4B3MB 3W6NA 2O05A 4ZVMA 1GTMA 4RVFA 1RU3A 4V0ME 3TJRA 4RYDA 3PYLA 5HKBA 1JFVA 4A10A 3EUWA 2JS7A 1WF6A 2H0AA 3FOZA 3UWPA 1ZOIA 3ZCPA 4L16A 4ZQIA 1YR9A 3QLUC 3QLEA 1GQOA 2XNDA 1RTKA 1VA4A 3RC3A 4FE3A 1YFZA 4NZNA 3LW7A 4Q19A 3H7IA 1C4KA 2OV8A 4GPBA 5L6LB 3AHEA 4E11A 1BX1A 1IN4A 1VE1A 5E1OA 1XJQA 3IBTA 4HLQB 1NV8A 4QDOA 2DAPA 2K7ZA 1ADYA 1HLFA 3ADKA 2LKDA 3FH0A 4NZ9A 4O8ZA 3S27A 5JV5A 2AS0A 5ADUS 4D9EA 1UXIA 5E9JA 5CEFA 1E9SA 4B82A 2VDRB 5BW6B 1BU8A 2ECOA 3SLRA 4B09A 5KYKA 1N32B 3AF0A 3EPLA 2AR0A 1MMFB 5ALYA 3OSUA 4KPFC 2YVKA 3ES9A 4HSGA 1MJFA 3L82B 1XWIA 1N7HA 2BPOA 2YHIA 3FGNA 4YGYA 1WZNA 2GYUA 2OL4A 3A1SA 3N1UA 3QHAA 1C7JA 4TXHA 4X3OA 5AOAA 4KSYA 2WG1A 2M6SA 3GJYA 2QRJA 3NT4A 1PI3A 3PZRA 3CIFA 4W7SA 1NYLA 3KFVA 5G2OA 3EA5A 5IHPA 1NXVA 1R37A 5CJPA 5AVUA 3F74A 1BS9A 3JWGA 2G17A 1HDEA 2PLWA 3KOUA 5F1KA 2R751 5HGXA 2QORA 3EVEA 3WB1A 4U2GA 4Z49A 3EMDA 3OOHA 2CXOA 4RF2A 1NFFA 4NICA 1Q7BA 1BMFA 2ZB7A 4IDGA 3F46A 5A05A 1NSTA 2I87A 3RQIA 3FWPA 2XNSA 3I0ZA 3CXUA 3MLAA 4QDXA 3T7CA 2VP0A 5D8DA 4ZEVA 2H5EA 2HGZA 3FTEA 2WYIA 5ALIA 2G06A 1Y3IA 1T25A 4YECA 3K9GA 1CRQA 3M33A 3R3ZA 4IIVA 2B0JA 4PC7A 5EMNA 5K0CA 1B43A 3TGPA 5K4HA 1NR5A 1R0BA 4ACBA 4BHTA 3ILYA 1JQDA 4IJVA 1SOAA 2OT3B 2XDYA 3DLIA 5IAGA 3QUTA 3NC1C 5EXEA 4MP8A 4RANA 5AW5A 5HKLA 1XLUA 4ENTA 4Z0TA 1E0AA 3NAZA 1DI0A 2VDQB 3M1AA 5ARDA 2ZSFA 4PSUA 4Q7JB 2R1VA 4NCKA 4MLPA 3B6ZA 2EGUA 4L2IA 1Z07A 5LP6B 1E92A 1NAHA 1DKLA 1RXIA 1W8IA 2FWIA 5IFKA 3HO8A 4D96A 1S2MA 3IIIA 4HDCA 1UBOS 3UAGA 5IJ9B 1FNDA 4N40A 2FCRA 4QBGB 4H7PA 3I9JA 4DJEC 3O75A 4TTIA 3S3TA 4G56A 2VF5X 3IHKA 1QRDA 4PWZA 4ZCPA 4C4SA 5U1PA 4OGFA 1SC3A 4HYYA 4O2BA 1DAFA 3BE8A 3L8YA 1FFGA 4F85A 1RIIA 3WOVA 3ZXSA 3FYTA 4BE4A 2RC6A 1I4EB 2OC9A 4WCFA 4CEIB 2R7LA 3U61B 2RKOA 2GTPA 1DGQA 5A3SA 3V4SA 621PA 3L7BA 3SVZA 1COWA 1PO7A 1SOUA 3LL4A 3N58A 3V42A 3ER9A 1ONBA 4BC1A 1NG1A 1CERA 1K7XB 4ML3A 4Q4LA 1UFVA 5D00A 5EWMB 1JA1A 2IU0A 4QGBA 2YRWA 1MJHA 3EXHA 3MN1A 5AQ1A 4MDYA 5LXTF 1V1JA 5CB6A 4MWZA 3ONVA 4RLHA 1SBHA 3SZOA 4DPLA 1SHZA 3V7YA 1GU1A 1YR6A 5G41A 1D6SA 4UBOA 1PQWA 1QO9A 3GJTA 4J3NA 1KJJA 1ZA2A 1XX6A 2RGRA 4LYHA 4M9QA 1V3QE 3HCBA 1AGXA 1G8MA 1O57A 2HB6A 5JJBA 4NYJR 4N5HX 1EI9A 4Z86A 2HK7A 2HWKA 2AMLA 4PSDA 1KHHA 4OQFA 4R2LA 4JI3B 1J2TA 4CMIA 1E6MA 2XA2A 1EFHA 1FFCA 1JKIA 3CH5A 4PSAA 4YRPA 1KVTA 2EQAA 2WSMA 3GP5A 4CKZA 1HURA 3BZUA 1M8JA 2DQKA 3OE5A 4CFSA 4OQQA 4Y2YA 4UHHA 3D4PA 2QXUA 4XDGA 2F1OA 2UZ3A 5DEIA 3HR8A 5G3ZA 1U7WA 3R7WA 1SD1A 2J1LA 4HAYA 3UXMA 1LSUA 1CJBA 4EPRA 2VXOA 1K98A 1QCZA 1UBRS 1XNHA 1ULBA 1W581 2R8RA 2ZWAA 3DEIA 4L51A 5DV9A 2NZVG 4FKZA 1YCFA 3EXIA 3HB7A 1IDOA 4UC0A 2JAHA 3VX4A 4EGQA 4TLCA 1ZZGA 3O7MA 4CL8A 2HXGA 3UMJA 1PLLA 3VHLB 1NOJA 1HM5A 3U4IA 2JL1A 4LWZA 4AZSA 4RWZA 3OOEA 1W94A 2EX4A 2WNSA 4B3JA 1RKVA 4OXIA 4RK6A 4MQLA 1XRQA 1RJ9A 1YBHA 2RHBA 4WLEA 2PNJA 2JHGA 3RHFA 5JSUA 5COQA 2R62A 2BGUA 2JGKA 2FZ4A 1SGWA 2WJ3A 2Q3BA 1CJSA 2ZRGA 5COAA 4C7XA 2YDXA 1KO1A 2XCIA 2BI8A 4E31A 3PFNA 1P7VA 2HWYA 2W8ZA 3BULA 4GQAA 3ZY3A 1L6RA 4LZZA 1HL7A 4QECA 4YR9A 2BEUA 1IZ8A 1K92A 1E5VA 3P5BA 4LNUB 3E1KA 4JT4A 5H68A 2Q6VA 3S8EA 3HBJA 4DG9A 1XQ6A 1JQEA 1NVWQ 1FFBA 2DTDA 2W43A 4DVGA 2CLLB 1BCSB 2CLDX 1LWOA 3C14C 4FQ7A 4JWKA 2ODTX 2H11A 2CVQA 3WGZA 3K35A 1GL6A 3ZTTA 1ADJA 4PAGA 2IOFA 3TNYA 3MINB 4Q15A 2HPHA 3GHYA 4QPDA 1NZJA 1J09A 4AU1A 2ZE7A 4RPIA 4CIAA 4WRRA 2CCGA 2I22A 1JFLA 1Z4IA 4ARZB 5AVTA 2J08A 2BRUC 1QX3A 2CNWA 1XHLA 1AE1A 1ZD9A 3AKEA 4NONA 4F60A 4OFBA 4Q4HB 2GA9A 1RJWA 3UC9A 4ZHSA 1UFRA 3MMNA 4EI7A 4UE6A 4QOEA 4R05A 4EZBA 2ZROA 3O38A 2G67A 4BVJA 3KAQA 2O5CA 4UEKA 3CZPA 2YTZA 5HF8A 4CL3A 5IDXA 4BU1A 4D4JA 1QF7A 1SVNA 1W4AA 3DEJA 3H2BA 1B2LA 3HN7A 3DCJA 3MT7A 2PK3A 4EL5A 4UDOA 1IH8A 2ACKA 1NKTA 1YVEI 4P53A 4BQFA 4R68A 4RIHA 3NX4A 4U00A 4EJFA 4XJSA 3UWKA 3F3MA 4IQGA 4UBLA 3S0JA 1RZRA 1ZBQA 5JS2A 4QSHA 3ZDFA 4CN8A 5JQGB 4MYUA 3V4VB 5AI9A 3GEHA 3M6AA 2GEVA 3CPSA 5KOIA 4J7CA 1G55A 2C3YA 2ZSUA 3DSRA 1TA4A 4BS9A 3K15A 1JDZA 1GZ4A 3GX1A 2QM8A 4IJMA 5K3BA 3OZAA 1M2FA 2UZAA 2HRQA 2IC5A 2RI0A 2YMPA 3D6NB 5FCDA 5IAEA 4DCSA 4TKUA 1IM5A 2G77B 2HJ9A 2ZREA 4S1TA 5JS8A 1HNZB 3OIGA 3MRTA 1TK9A 2BJVA 3Q3GE 4TMWA 1JHPA 1ZD2P 4H1VA 1CQJB 3CLSC 1E5DA 3FTQA 1TTPB 2OD9A 2QSYA 3RYTC 4KXQA 5AVSA 2Z43A 1G60A 1UXKA 2IXGA 4FJ2A 4JKIA 4JR1A 4XB6B 1PFYA 1G0OA 1XZKA 3IIEA 3L7NA 5K03A 1GTSA 3WRYA 1V8DA 1R88A 4FZRA 4L6CA 4Z9XA 2JG3A 2PUVA 3RKRA 4KE8A 4R4JA 3OU2A 5EJGA 3U9TA 1CWUA 1QHSA 4XB2A 1GTRA 2RHMA 3Q5EA 4HAVA 5AH0A 2ZSDA 3ZWQA 2UXDB 1P91A 1YIDA 1XYYA 2I4MA 4HJXA 3NBFA 4BO9A 3INNA 1FVOA 4ESOA 3QA3E 5K51A 3DP9A 5AVWA 1ZXBA 2PMBA 2G5GX 2CJXA 2JD2A 2AC2A 3KTOA 3NDJA 4LV8B 4Y2HA 5ELLA 4W5TA 2YWEA 4PO3X 4TS3A 4YRTA 2QRHA 1J8YF 1QIDA 3MD0A 1DFGA 3CF2A 4HDQB 1HEIA 1L5RA 2PRZA 5BORA 3H05A 1YE8A 5KOYA 1OHHA 1ZL0A 3FCSB 4OGLA 2P3SA 3S2EA 1M1ZA 4CQMB 2C92A 3UYLA 3G85A 1VHDA 2XKBA 5IWAB 2QRGA 3CUKA 3HB1A 1B41A 4DIFA 4YRNA 1M66A 1WMAA 4ZVRA 1P9WA 5GONB 3GRFA 2QTNA 2KI5A 2ZR0A 2Q3EA 1KETA 1PR1A 2W6CX 3FI0A 1JDBB 3IALA 2GA8A 2VUUA 4WNCA 5CW1A 3BWXA 1D2RA 2O2SA 1INLA 3NONA 2GB4A 3GMDA 4GZMA 1QZXA 1MB2A 1M0TA 4DAEA 1E1CA 4BNWA 2GEKA 2CK3D 3BICA 3EUFA 4W5NA 1AUQA 1LLQA 4WX2B 1A69A 3SI7A 4CUZA 4ENVA 3GLFE 3K0EA 1T1RA 4M83A 3IUMA 4O29A 3GI1A 1AXGA 4O4LA 2WVAA 4BFCA 2J0UB 5JCOC 4GKJB 3I2GA 3IEIA 4PO9A 1PQUA 3F73A 1D5WA 4UBNA 1XHEA 4NNJA 2VJCA 3G02A 3P0RA 4TTVA 2ZRJA 3RVJA 1P1HA 2Z6VA 3T7SA 5DGXA 4QWWA 3BRCA 3AR6A 1NXQA 1NLZA 1QCDA 4IIHA 3QBTA 4DIOA 2BF7A 3T35A 4PY2A 1PV4A 2WPDD 4L3WA 5BV2P 3HL0A 3ORRA 5LPNA 4K9MA 4GMFA 4Y2QA 5CDFA 3PEUA 2FX2A 4QXQA 1P77A 4B3FX 1L5HB 5DIZA 1NDHA 5L3QA 1JA9A 1T8SA 2QR3A 3GBSA 3PGJA 3Q0IA 4IVPA 4RA6A 3KYBA 4B4OA 1FTNA 1XPJA 1LLCA 4US1R 821PA 2XD9A 3KZ1E 5FOVA 3REFA 3WGVA 4RA9B 2WD7B 2C03A 1L8LA 3MYYA 3VA7A 1RABA 1TT7A 3IVAA 4NV0A 5DI3B 2EKZA 1G1MA 4P7GA 2DPLA 3UA4A 1ECJA 4E94A 3L0BA 4U7WA 4X3CA 5ALFA 3R7NA 1GUFA 4B7AA 4DNFA 1TVKA 1HUQA 1WVGA 2EGHA 2QL7A 2V5VA 3QFSA 1G9SA 2FUNB 1XLWA 2JEZA 2LVBA 3ETHA 1V6CA 2HQBA 4HPJB 3GT7A 1T8WA 4N8EA 3T38A 1RMTA 4ESHA 3EAFA 5F23A 3GK3A 3PT5A 2AV6A 4LGYA 2O19A 1VI5A 4ES6A 4R2WA 2GKSA 4EB6B 4E5NA 2VJBA 4UCXA 3EGDB 3GU3A 4LQDA 1B00A 4C20A 1AU9A 3U7HB 3IC5A 2GASA 2A9VA 1HDCA 4JQYA 2FEOA 4HZIA 1GSAA 1ORTA 2VNAA 4U4AA 4TSRA 3R7WB 1ESDA 2IEYA 5DIFA 2XNCA 1JDJA 4WZAB 1HEUA 4EDHA 1LD3A 2ZWOA 1DX4A 1JA0A 5D5PA 1EK6A 2V6IA 2V9PA 3CSDA 5KJ1A 2XMGA 3MCAA 4C2AA 4CKXA 1O3YA 3TI7A 4R40A 2I6XA 1CIJA 2OFWA 3A9UA 4YMIA 5FPTA 1NOKA 2LWIA 1A82A 5LZ7A 3VR5A 1L4EA 1LRJA 3GIWA 4OK3A 2CV0A 1MC8A 4DLBA 4PSCA 3Q3VA 4CTJA 5TJHA 1H0SA 3NB0A 3RK1A 4EY7A 3E27A 1GCIA 4RFLA 1U2GA 4M8IA 1TB4A 4C0JA 1N8SA 3Q3JB 1D2NA 1YJCA 3WNZA 3LMKA 3ZPXA 2CDCA 1ZK3A 5DYTA 4RY2A 3TLCA 3UK1A 2IHJA 5CDHA 3ADDA 1TYDE 1IC6A 4DLUA 4MCAA 1P44A 2ADOA 2NTNA 2PJDA 4BX2A 1YUNA 3I39X 3Q2OA 4QLAA 3HU2A 3AHFA 4IHKA 1ZBDA 5J5AA 1E5QA 3OM1A 4HNAA 3UW3A 1KSGA 4JJ4A 1RFLA 1IY8A 3T5GA 3T5CA 1Y5MA 4G0UA 1MEOA 1Q3KA 4RIGA 3W5UA 1Z5WA 1CF9A 3OWOA 3ZWAA 1WSDA 3JQGA 2FG5A 1FYXA 4A5SA 4MMYB 3WV5A 2QENA 4MRMB 5LBIA 4OXRA 4EY4A 4JSTA 4Q47A 1LGYA 2X8BA 3QENA 4EB0A 2Z58A 1OXSC 1EQ2A 4OLJA 4PICA 1CS0B 1BS2A 1XDGA 3GLIA 2AK2A 1TL7C 2Q4RA 4L8YA 4PS1A 4K05A 2X7XA 3ZQKA 4B7CA 4W5RA 1OT5A 3Q4GA 3IKTA 3OLQA 2C2KA 4QDJA 2OPHA 1Q2XA 1L7MA 2BFFB 2PXCA 4GL2A 3A3YA 1HV8A 1RD4A 1Z7BA 3LKDA 2C57A 3WK6A 2PNFA 5BSHA 3MTBA 4K87A 1OLOA 3S8YA 1AKVA 1L4YA 5AJZA 1RVDA 3AW8A 2ROQA 2QG4A 3BKXA 3MGBA 4KDCA 3GWZA 3KZXA 4BYGA 4RDXA 3J80A 1NIPA 3T7JA 1IHOA 3C41J 4BO1A 2HHHB 2X0RA 3GMSA 2J7PD 1ZD3A 3KKLA 3ZGNA 1WOMA 1G63A 1ZK4A 4YAEA 3J7AC 4DLSA 3OLWA 4JEUA 2ZI7A 1KEUA 2DFVA 1O0BA 1DEAA 2E4ZA 1P5JA 4IOMA 1JQ3A 3ZLBA 1EE1A 1XTJA 1I9CA 2BSAA 2KW5A 4BWYA 1DOHA 3PL5A 2ZZMA 1XALA 3PNBA 4P7JA 2OQRA 1ILWA 2Q27A 1PFKA 2CNKA 5EP1A 3WYAA 1FDTA 3BF8A 4CQNA 4YFVA 4Y1RA 2VZ8A 3P2OA 1ZN8A 4MI6A 3WI7A 3QHPA 1R3DA 3H0CA 4LZJA 1ZJWA 5T5QA 1Z8FA 2H1FA 3IOYA 3OQ6A 2QY6A 3N0VA 3P2JA 1DTEA 2V4MA 4KHPB 5F7OA 2V7PA 1EUDA 3F7NA 3FDJA 3P1JA 3PC8A 4BRSA 2EERA 1U7XA 3LKVA 4JUFA 4ENPA 2D5AA 3GARA 1YNSA 1CDOA 4MWDA 4PYKA 4MVCA 4IFBA 4QWMA 4ZZ0A 2IEGA 4U8HA 2IP4A 1EWVA 1GPUA 2H54A 1PT8A 1AKTA 1JE0A 2LZ0A 2XVZA 3DL7A 4BUZA 5KSYA 1I7QB 2IZOA 2JGFA 4EW2A 3RUPA 2FSVC 5ELXA 2W93A 4NDZA 4IMIB 2A7XA 4YT5A 4GM4A 3WWYA 5EP2A 3FR7A 3PG5A 1CUGA 1HYGA 3NHSA 1EYZA 4ZRMA 5FR1A 5FA5A 3B8EA 1YZUA 4BX8A 1Z29A 2EYUA 1IBSA 1OLXB 5KU7A 1HL3A 4B3DA 4K9DA 2UZ1A 5JADA 1UL1X 3USCS 1QVZA 3IAM6 2J7KA 2Q3JA 1KE1A 1W8DA 5EXTA 2C2OA 1IEXA 2JEOA 2KLHA 4JP1A 1PGJA 1SUIA 1HDXA 2H4JA 4RY0A 2WEKA 2GPNA 3AUSA 2J5RA 3CZ5A 3G6KA 3EZXA 3K9LA 4M1TA 4TUYF 4Y9TA 3UWOA 5BW4A 3I5XA 1GFWA 4XVHA 2VQFB 1PZGA 4LF5B 4RJTA 2A5JA 4CMBA 2RBKA 3LVQE 5JBQA 1U8UA 1P5HA 4MOWA 1C5KA 1WA5A 4ZQBA 3VX3A 4E33A 2RGXA 2O3QA 4ZI7B 2HV9A 3TPZA 4JCCA 1F6DA 1YACA 1YQQA 4IS3A 1F8GA 2AB0A 2BUAA 2YHIB 3OHPA 1WP9A 2GM5A 2P9YA 2PRIA 4FW9A 3TZCA 1NVAA 3N9IA 3RVQA 4H1WA 1PHRA 1U11A 2DCMA 3V3KA 2WM8A 1JVBA 1U1EA 3D5QA 1VIDA 3M4NA 2YUTA 3DO8A 2I62A 1E1QD 3N76A 3R4CA 4MYRA 5BQ5A 4E2ZA 1IL0A 3ESXA 2QJTA 5ANRB 5CAEB 4B4VA 4YV2A 3F9RA 1NG9A 1LI5A 2F7SA 2DECA 1HQDA 3F6PA 2OO7A 1R0SA 5TMDA 2Z1DA 5I9NA 1DINA 5LQMA 4O5OA 4BNIA 2Y1XA 3VU3A 2VJDA 1AC5A 1JEQB 2RE8A 1ZIOA 2JAQA 2PX4A 3KDPA 4XYBA 4F7WA 4KVZA 2NZUG 3IQWA 3QV2A 5DGDA 3TGLA 4TL9A 4RE5A 1HY3A 3K5HA 1OU4A 2OGUA 2XYHA 2XTAA 4M0FA 2W90A 4LXGA 4Q7LA 1C0IA 3JASA 3TSOA 3AVVA 3LF2A 3OTQA 1C3LA 1IY1A 3KB2A 3CWQA 3KT0A 3WDMA 2M32A 2ODWA 1Q1QA 1FLVA 3K16A 1Y1RA 2W6PA 2JJ1D 2ZYIA 3OKAA 4R81A 5J59A 1L7PA 4BNYA 2OHVA 1NF8A 3ABZA 2P9BA 3GFTA 3H2YA 3URKA 2FSGA 4QICA 2GNAA 2IYOA 3SHQA 1G38A 4J2TA 4ER3A 4J2HA 1DIBA 3OIYA 3OHMA 2OCAA 1G2PA 3OQOA 2PS1A 1GQRA 1U99A 1TLLA 3FHJA 3FPFA 3M9LA 3BMXA 4AF8A 5AVZA 3D4IA 2GSDA 4LXXA 3QI2A 1CJTC 4S2UA 2A9OA 3RGGA 5ICFA 4P4SB 1PAUA 2FDRA 3I6IA 5KDDA 5L4SA 2P6NA 4MAMA 1QPZA 1FU4A 1U9YA 3QM1A 1YZFA 2CGEA 2ZWMA 4CEHA 2HX1A 1L7XA 2WU1A 2WTBA 4NV3A 1K3UB 3UKOA 1T34A 4D3YA 4YCCA 2R4TA 2QRZA 2C8LA 4QOFA 2CUTA 4QNMA 1RPZA 5BRNA 1X7ZB 4R8RA 2JAUA 5IS2A 2D0OB 2EJWA 2BEWB 3UJAA 2E2WA 4AY6A 4X91A 4U5XA 3SYTA 1BQ4A 2P9TA 3CSSA 4KBGA 3SQXA 2ZZKA 1Y98A 1TUBA 3CLHA 3WYGA 1NFRA 4OEHA 2QX4A 3OQIB 3SZ3A 1QGOA 3LFTA 1XE3A 4BMPB 4Q9IA 4OQDA 1YL7A 3AHCA 4GLOA 2Y2UA 5K3CA 2BMEA 3R7DA 3JALA 3KUDA 4YDHB 5DYGA 3RJ5A 1CC1S 5JNSA 3GRAA 2J6IA 2ZVJA 3A6LA 4RD0A 4D44A 1Y1SA 2Y4NA 3C3KA 2VKTA 5TMPA 5TF0A 1A9PA 3B78A 1RWKA 2AFIE 3EW9A 2GJSA 3BCHA 4KO2S 3TTVA 4KSBA 3GROA 1MHTA 3MGKA 3W5DA 3IB6A 4ID9A 4AN1A 2O48X 2W0MA 2J46A 1ZY2A 1KBZA 2XZPA 4RVDA 5M34A 4PPQA 3DL4A 2NADA 4Q37A 1JQKA 1PUXA 3HI6A 4N03A 2ODPA 3TI9A 3AF6A 3EIXA 1QK5A 2V1XA 3UFXB 3GJ0A 4EITA 3NBQA 4HGZA 2X1HA 2JLCA 3MT8A 3NEYA 2WPNA 1UMDA 3SSMA 3FOBA 1NF9A 3A11A 1YUMA 4IVRA 4MK4A 1KVQA 5FX2A 2IOFK 2ES4A 3R1IA 3HXPA 1OYYA 4QFMA 5DCLA 2Q41A 1PR4A 1RXEA 2Q3CA 3PXBA 1NR1A 5CXUA 5EE0A 2W7TA 1COZA 1VBNA 5E6UB 3SQWA 2CVZA 4Z0PA 4BMCA 2VTBA 3QFTA 5AICA 1OA0A 1N7IA 2EL9A 3QEMA 3AI7A 4NNOA 1JPNA 3CLTD 5A9RA 3DLBA 3IVGA 4WVLA 4TS1A 5KX5B 1O5IA 2QVZX 4NOKA 1ZCFA 2A0UA 4KQJA 1EFRD 1MVNA 1QFJA 4HHEA 1JKFA 4O4LB 5LOVB 1QU2A 4W1SA 1DMSA 2B8JA 2BFOA 5DM1A 3SX4A 3CV3A 2ZCVA 3LYLA 2YWRA 3TIFA 3BHMA 1MG0A 1AKUA 1GYQA 3F8WA 5DO9A 3NMUF 3FKSA 1WCXA 3I92A 4JBYA 1G7RA 3E1SA 1RAIA 2JHPA 4HNUA 3GCZA 3HRHA 4ZZ1A 3RIEA 5M7EA 1K7EB 4DR2B 1KMMA 4MW2A 2QAIA 2P4QA 3BH7A 4RQAA 3BAZA 1O6FA 3Q1LA 4XJXA 4F4HA 2CL6X 1DTSA 5C53B 1D1SA 1JIVA 5HJ5A 3IBYA 3TX6A 1BXZA 4FWIB 1ZNZA 3M9XA 4KK4A 1QIGA 4BEVA 1GZ5A 1WU7A 5KYXB 1Q3HA 3KTDA 5MN4A 1UH5A 1DAMA 1GADO 2WUGA 2ZUWA 3OCWA 4II7A 3UJ8A 3UJCA 3V1UA 4ETMA 5ADHA 1A5ZA 5FOSA 5I8PA 2GAJA 4GC9A 4KQEA 3PHJA 3GVCA 4ONEA 5JCJD 4P0PB 3OZVA 5G4KB 1QH8B 1QANA 2YJ5A 3O2SB 3EDQA 4XZ3A 3GFSA 5BO5A 2NYVA 1QBGA 2JIPA 3ZJUA 2BE9A 2R5FA 2TMDA 4GX0A 3VNRA 4CE6A 1CY0A 3T9DA 3IDOA 1WD7A 1PZXA 3BJZA 3H5LA 3ITEA 2J31A 1PCXA 2W4QA 2GARA 3DEFA 2GTHA 1XO1A 1XTPA 4P22A 4KAXA 4YRAA 1A27A 1RKBA 3ND7A 4INZA 3RABA 1TKRA 3NCHA 4XKJA 3U1BA 3CLRD 1Q1BA 1Y6QA 2AMFA 3W90A 1QVAA 2AI1A 3JYHA 2WWWA 3VDRA 3VSAA 3WAGA 4GX2A 5EJ5A 1XR3A 3UV6A 4RJLA 3WTCA 3ODPA 4BB6A 5E6RA 3ZHSA 4Q12A 3OT5A 2H4ZA 2D8AA 3HYRA 5C8ZA 1G3QA 4RABA 3ASUA 4K03A 1X42A 1BVYF 1IMOA 1FVFA 1G18A 1OXMA 2KHZA 2V8BA 2ZE8A 3M4XA 1U9IA 3VM6A 4OUDA 4A26A 3BRSA 2E89A 1OWMA 4FEGA 4YNBA 1G66A 4DV1B 5DM2A 3UT0A 2A0KA 3L7OA 4LRUA 3ONNA 3ND5A 2OZLA 2XBUA 4PX3A 2JCSA 1QC5B 3MJVA 1B8PA 3NWPA 1U1FA 3HKDA 4LMRA 4JKYA 5EWLB 5B1HA 2DHEA 4JMLA 3DDUA 6LDHA 1OZHA 1BDBA 4MR9A 5D86A 2VP3A 5HKAA 3PFBA 1NUPA 3QJYA 1SBCA 2ZB2A 3HCRA 2R8EA 2OLKA 4DG5A 1UBKS 2VC2B 1K0FA 3ZI7A 1JKMA 5HQJA 5AOVA 4RGBA 2HKIA 1L5LA 3WWCA 4JLNA 4XWAA 4UXJA 2NO0A 3B9PA 5A02A 3HJCA 1SM4A 4M9SA 4YJ2F 5HM8A 2FWRA 1M2JA 5CGZA 4ZVPA 1FTGA 2VYQA 3CKKA 3OC0A 4OBEA 4BZZA 3PB3A 3GAZA 1A97A 5AVVA 2D1RA 1GPYA 4YDSA 5EN4A 1J99A 2GESA 5I01A 4LJ8A 1JF8A 2OM2A 2F2TA 5A4IS 1NSYA 2C4MA 3PXCX 1C9YA 3QEJA 1DC5A 3L2OB 3T99A 1IHUA 1ESEA 1FNNA 1MKYA 3ESQA 3T0FA 5ALJA 1TTTA 1JHVA 5CBKA 1YB4A 2IHUA 1TEHA 3OPMA 4YRZA 1THTA 1H2EA 2D74A 3K6KA 4Q3AA 2PL1A 4Q18A 4LOHA 3NEJA 3NDIA 3JWHA