3BNXA

Crystal structure of aristolochene synthase complexed with farnesyl diphosphate
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
305
structure length
296
Chain Sequence
SLEPPPSTFQPLCHPLVEEVSKEVDGYFLQHWNFPNEKARKKFVAAGFSRVTCLYFPKALDDRIHFACRLLTVLFLIDDLLEYMSFEEGSAYNEKLIPISRGDVLPDRSIPVEYIIYDLWESMRAHDREMADEILEPVFLFMRAQTDRTRARPMGLGGYLEYRERDVGKELLAALMRFSMGLKLSPSELQRVREIDANCSKHLSVVNDIYSYEKELYTSLCTSVQILAQEADVTAEAAKRVLFVMCREWELRHQLLVARLSAEGLETPGLAAYVEGLEYQMSGNELWSQTTLRYSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aristolochene synthase
publication title X-ray Crystallographic Studies of Substrate Binding to Aristolochene Synthase Suggest a Metal Ion Binding Sequence for Catalysis
pubmed doi rcsb
source organism Aspergillus terreus
molecule tags Lyase
total genus 122
structure length 296
sequence length 305
chains with identical sequence B, C, D
ec nomenclature ec 4.2.3.9: Aristolochene synthase.
pdb deposition date 2007-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3bnxA00
3N5JF 3LGKA 2E93A 3CC9A 1HM4A 1YHKA 3P41A 3LSNA 1JFGA 3KRPB 3AQBB 5ER8A 4LPGF 3LG5A 2AZLA 3TC1A 3WEFA 3LDWA 3KRAB 2PS6A 2J1PA 2FORA 3M00A 2FTZA 3MAVA 2E95A 3WJOA 4OMGA 4GAXA 3LOMA 1VG2A 1RTRA 4F6VA 4LA5A 4PVYF 3ACYA 4ZQ8A 3WSBA 3DYHA 3LLWA 5DGSF 1YYQA 1N1ZA 3P8LA 1YJ4A 5IK0A 3WE9A 3BNXA 3PDEA 3VJDA 4OGUA 1WL0A 3WCFA 3W7FA 3WCAA 2E8UA 1YYTA 5EASA 5E8LA 4NFJF 4WK5A 3VJAA 5DW7A 1RQJA 4H5DF 1DGPA 3M01A 4OKZA 3TS7A 5CG6A 2F9KF 3ASXA 4DI5A 1WL3A 5HN7A 3P5RA 4KQ5A 3BNYA 2Q58A 2ONGA 5A0KA 1VG6A 3QKCA 3V66A 5B02A 4F6XA 4KUXA 4MC0A 3N0FA 2ZY1A 5HN8A 2Z4XA 4Q23A 3N1VF 3N3LF 5AHUB 3LVSA 3KROA 4F62A 2I19A 1WKZA 3DYFA 5HN9A 3WJNA 3WCGA 5B03A 2Z52A 4KKMA 4E9UA 4DEMF 4KK2A 1UBVA 4RXCA 3APZA 5H9DA 2E8XA 4LXWA 2OA6A 3ZCDA 2Z4VA 5AELA 4JVJF 2EWGA 4LUUA 5C05A 4E9ZA 4JXYA 2ZCQA 1VG4A 2O1OA 5JUZF 3PYBA 3WCJA 4P0VA 2Z78A 2E90A 3QQVA 4KVDA 4LTVA 5ILIA 1N1BA 3KB9A 3ZMBA 1N21A 3ID0A 3WCCA 4LTZA 3SDQA 5IM1A 2F8CF 4L2XF 3NPRA 3G4FA 3OABB 5AYPA 5EATA 1YYUA 5B0KA 4EA0A 1N24A 2J1OA 3AQ0A 3LEEA 2E8TA 2ZEUA 1HX9A 3ADZA 3N3DA 4KPJA 5DHKA 3WJKA 3LMDA 5ILYA 5IMPA 3TFVA 3RBMA 1FPSA 4LFGA 3EGTA 4KVYA 5IN8A 4FJQA 3Q2ZA 5ILHA 4LZCA 3M9UA 5ILJA 1HM7A 2DH4A 3N1WF 2F92F 3PKOA 4OMHA 3Q1OA 5IL8A 4NKFA 4LLSA 5ILZA 1N22A 5B0MA 3WCEA 1ZW5A 4DWBA 3ICMA 5IK6A 1KIYA 4FP4A 1YHMA 2Q9ZA 1YV5A 2OGDA 1EZFA 5A0IA 5ERMA 3ICNA 3M0GA 2OPMA 3OACB 2Q9YA 3S9VA 5HNAA 3N0GA 4MC8A 4RXDA 1V4HA 3KROB 3ICKA 3P5PA 3CP6A 3M02A 4N1ZF 4EA2A 4K10A 2PS5A 5DJVF 5B01A 1PS1A 3NPKA 2AZJA 4LZ3A 1DI1A 3LK5A 3Q30A 5IMNA 1UBYA 2E92A 4NG6A 2Z7HA 3SDUA 5IK9A 2J5CA 3V1VA 3WCBA 4H5CF 4KPDA 5E8KA 3EFQA 4KVWA 5DJPF 4LIXA 2AETA 5B0LA 2ZCRA 3WCIA 3N6KF 4DHDA 5DGMF 3WCLA 5DIQF 2ZCSA 4NKEA 1YHLA 3ACWA 5B0IA 4RXAA 3WEKA 3RMGA 4QPFA 4NFKF 4E1EA 1HXAA 2ZEVA 4RYPA 3IPIA 3ZOUA 4GA3A 4RNQA 1V4KA 1HXGA 4KQUA 2F94F 5A0JA 4JZXA 1WL1A 3WC9A 2PS4A 2Z50A 3WCHA 4MC3A 3KRCA 3KBKA 4LA6A 3V1XA 3G4DA 3UCAA 2AELA 3NF2A 4LLTA 3LZ9A 3TFNA 1V4EA 3KRFA 5JV0F 3P8RA 5EROA 4LFEA 1VG3A 2PS8A 4PVXF 5CG5A 2E91A 1N23A 5IKAA 3OABA 3VJCA 5DJRF 4GP2A 3SDVA 5DZ2A 1N20A 3KRPA 3EZ3A 5DHIA 5IMIA 1YYRA 3RYEA 4KWDA 4OKMA 3RYWA 3KRAA 5I1UA 1WL2A 4JZBA 4LZ0A 4DZWA 4KVIA 4DXJA 3VJ8A 4XQSF 4H5EF 2H8OA 5B00A 5EAUA 4N9UA 4P0XA 3ACXA 5B0JA 3VJBA 3WCMA 4HD1A 3N5HF 4LFVF 4RXEA 3WEGA 2AZKA 3Q2QA 2E8WA 2F8ZF 4KFAA 4NFIF 5AFXA 4EA1A 3WEHA 1HXCA 3B7LA 1YQ7A 1RQIA 3N45F 2E4OA 2RAHA 5KSXF 5JV1F 5DGNF 5E8HA 2E8VA 3OACA 4JXNA 1YYSA 5IVGA 1V4IA 3LJIA 1UBXA 2OPNA 5ILKA 4KQSA 5JA0F 3WEJA 2AEKA 3N49F 3MZVA 2F89F 4LPHF 3WCDA 3VJEA 5ERNA 1KIZA 3IBAA 2E94A 2ZCOA 5IL3A 4QXSF 3PH7A 3PYAA 2QISA 3AQCB 2Z4ZA 3LGZB 3NRIA 2F7MF 3SDRA 5IKHA 1UBWA 3AE0A 2Z4YA 2P1CA 1VG7A 3DYGA 3ICZA 3ZMCA 4JYXA 4P0WA 1JFAA 1WY0A 5ILDA 2PS7A 3KRCB 3VJ9A 2VF6A 4UMJA 3SDTA 2Z7IA 4GP1A 4XQRF 4LOBA 3SAEA 4XQTF 3WSAA 2Q80A 4NUAA 1V4JA 3S4JA 2Z4WA 3KRFB 3WEIA 3CKEA 5JV2F 3ZL6A 3N46F 3OYRA 1WMWA 3TFPA 2ONHA 4DWGA
chains in the Genus database with same CATH superfamily
3N5JF 3LGKA 2E93A 3CC9A 1HM4A 1YHKA 3P41A 3LSNA 1JFGA 3KRPB 3AQBB 5ER8A 4LPGF 3LG5A 2AZLA 3TC1A 3WEFA 3LDWA 3KRAB 2PS6A 2J1PA 2FORA 3M00A 2FTZA 3MAVA 2E95A 3WJOA 4OMGA 4GAXA 3LOMA 1VG2A 1RTRA 4F6VA 4LA5A 4PVYF 3ACYA 4ZQ8A 3WSBA 3DYHA 3LLWA 5DGSF 1YYQA 1N1ZA 3P8LA 1YJ4A 5IK0A 3WE9A 3BNXA 3PDEA 3VJDA 4OGUA 1WL0A 3WCFA 3W7FA 3WCAA 2E8UA 1YYTA 5EASA 5E8LA 4NFJF 4WK5A 3VJAA 5DW7A 1RQJA 4H5DF 1DGPA 3M01A 4OKZA 3TS7A 5CG6A 2F9KF 3ASXA 4DI5A 1WL3A 5HN7A 3P5RA 4KQ5A 3BNYA 2Q58A 2ONGA 5A0KA 1VG6A 3QKCA 3V66A 5B02A 4F6XA 4KUXA 4MC0A 3N0FA 2ZY1A 5HN8A 2Z4XA 4Q23A 3N1VF 3N3LF 5AHUB 3LVSA 3KROA 4F62A 2I19A 1WKZA 3DYFA 5HN9A 3WJNA 3WCGA 5B03A 2Z52A 4KKMA 4E9UA 4DEMF 4KK2A 1UBVA 4RXCA 3APZA 5H9DA 2E8XA 4LXWA 2OA6A 3ZCDA 2Z4VA 5AELA 4JVJF 2EWGA 4LUUA 5C05A 4E9ZA 4JXYA 2ZCQA 1VG4A 2O1OA 5JUZF 3PYBA 3WCJA 4P0VA 2Z78A 2E90A 3QQVA 4KVDA 4LTVA 5ILIA 1N1BA 3KB9A 3ZMBA 1N21A 3ID0A 3WCCA 4LTZA 3SDQA 5IM1A 2F8CF 4L2XF 3NPRA 3G4FA 3OABB 5AYPA 5EATA 1YYUA 5B0KA 4EA0A 1N24A 2J1OA 3AQ0A 3LEEA 2E8TA 2ZEUA 1HX9A 3ADZA 3N3DA 4KPJA 5DHKA 3WJKA 3LMDA 5ILYA 5IMPA 3TFVA 3RBMA 1FPSA 4LFGA 3EGTA 4KVYA 5IN8A 4FJQA 3Q2ZA 5ILHA 4LZCA 3M9UA 5ILJA 1HM7A 2DH4A 3N1WF 2F92F 3PKOA 4OMHA 3Q1OA 5IL8A 4NKFA 4LLSA 5ILZA 1N22A 5B0MA 3WCEA 1ZW5A 4DWBA 3ICMA 5IK6A 1KIYA 4FP4A 1YHMA 2Q9ZA 1YV5A 2OGDA 1EZFA 5A0IA 5ERMA 3ICNA 3M0GA 2OPMA 3OACB 2Q9YA 3S9VA 5HNAA 3N0GA 4MC8A 4RXDA 1V4HA 3KROB 3ICKA 3P5PA 3CP6A 3M02A 4N1ZF 4EA2A 4K10A 2PS5A 5DJVF 5B01A 1PS1A 3NPKA 2AZJA 4LZ3A 1DI1A 3LK5A 3Q30A 5IMNA 1UBYA 2E92A 4NG6A 2Z7HA 3SDUA 5IK9A 2J5CA 3V1VA 3WCBA 4H5CF 4KPDA 5E8KA 3EFQA 4KVWA 5DJPF 4LIXA 2AETA 5B0LA 2ZCRA 3WCIA 3N6KF 4DHDA 5DGMF 3WCLA 5DIQF 2ZCSA 4NKEA 1YHLA 3ACWA 5B0IA 4RXAA 3WEKA 3RMGA 4QPFA 4NFKF 4E1EA 1HXAA 2ZEVA 4RYPA 3IPIA 3ZOUA 4GA3A 4RNQA 1V4KA 1HXGA 4KQUA 2F94F 5A0JA 4JZXA 1WL1A 3WC9A 2PS4A 2Z50A 3WCHA 4MC3A 3KRCA 3KBKA 4LA6A 3V1XA 3G4DA 3UCAA 2AELA 3NF2A 4LLTA 3LZ9A 3TFNA 1V4EA 3KRFA 5JV0F 3P8RA 5EROA 4LFEA 1VG3A 2PS8A 4PVXF 5CG5A 2E91A 1N23A 5IKAA 3OABA 3VJCA 5DJRF 4GP2A 3SDVA 5DZ2A 1N20A 3KRPA 3EZ3A 5DHIA 5IMIA 1YYRA 3RYEA 4KWDA 4OKMA 3RYWA 3KRAA 5I1UA 1WL2A 4JZBA 4LZ0A 4DZWA 4KVIA 4DXJA 3VJ8A 4XQSF 4H5EF 2H8OA 5B00A 5EAUA 4N9UA 4P0XA 3ACXA 5B0JA 3VJBA 3WCMA 4HD1A 3N5HF 4LFVF 4RXEA 3WEGA 2AZKA 3Q2QA 2E8WA 2F8ZF 4KFAA 4NFIF 5AFXA 4EA1A 3WEHA 1HXCA 3B7LA 1YQ7A 1RQIA 3N45F 2E4OA 2RAHA 5KSXF 5JV1F 5DGNF 5E8HA 2E8VA 3OACA 4JXNA 1YYSA 5IVGA 1V4IA 3LJIA 1UBXA 2OPNA 5ILKA 4KQSA 5JA0F 3WEJA 2AEKA 3N49F 3MZVA 2F89F 4LPHF 3WCDA 3VJEA 5ERNA 1KIZA 3IBAA 2E94A 2ZCOA 5IL3A 4QXSF 3PH7A 3PYAA 2QISA 3AQCB 2Z4ZA 3LGZB 3NRIA 2F7MF 3SDRA 5IKHA 1UBWA 3AE0A 2Z4YA 2P1CA 1VG7A 3DYGA 3ICZA 3ZMCA 4JYXA 4P0WA 1JFAA 1WY0A 5ILDA 2PS7A 3KRCB 3VJ9A 2VF6A 4UMJA 3SDTA 2Z7IA 4GP1A 4XQRF 4LOBA 3SAEA 4XQTF 3WSAA 2Q80A 4NUAA 1V4JA 3S4JA 2Z4WA 3KRFB 3WEIA 3CKEA 5JV2F 3ZL6A 3N46F 3OYRA 1WMWA 3TFPA 2ONHA 4DWGA
chains in the Genus database with same CATH topology
3N5JF 3LGKA 2E93A 3CC9A 1HM4A 1YHKA 3P41A 3LSNA 1JFGA 3KRPB 3AQBB 5ER8A 4LPGF 3LG5A 2AZLA 3TC1A 3WEFA 3LDWA 3KRAB 2PS6A 2J1PA 2FORA 3M00A 2FTZA 3MAVA 2E95A 3WJOA 4OMGA 4GAXA 3LOMA 1VG2A 1RTRA 4F6VA 4LA5A 4PVYF 3ACYA 4ZQ8A 3WSBA 3DYHA 3LLWA 5DGSF 1YYQA 1N1ZA 3P8LA 1YJ4A 5IK0A 3WE9A 3BNXA 3PDEA 3VJDA 4OGUA 1WL0A 3WCFA 3W7FA 3WCAA 2E8UA 1YYTA 5EASA 5E8LA 4NFJF 4WK5A 3VJAA 5DW7A 1RQJA 4H5DF 1DGPA 3M01A 4OKZA 3TS7A 5CG6A 2F9KF 3ASXA 4DI5A 1WL3A 5HN7A 3P5RA 4KQ5A 3BNYA 2Q58A 2ONGA 5A0KA 1VG6A 3QKCA 3V66A 5B02A 4F6XA 4KUXA 4MC0A 3N0FA 2ZY1A 5HN8A 2Z4XA 4Q23A 3N1VF 3N3LF 5AHUB 3LVSA 3KROA 4F62A 2I19A 1WKZA 3DYFA 5HN9A 3WJNA 3WCGA 5B03A 2Z52A 4KKMA 4E9UA 4DEMF 4KK2A 1UBVA 4RXCA 3APZA 5H9DA 2E8XA 4LXWA 2OA6A 3ZCDA 2Z4VA 5AELA 4JVJF 2EWGA 4LUUA 5C05A 4E9ZA 4JXYA 2ZCQA 1VG4A 2O1OA 5JUZF 3PYBA 3WCJA 4P0VA 2Z78A 2E90A 3QQVA 4KVDA 4LTVA 5ILIA 1N1BA 3KB9A 3ZMBA 1N21A 3ID0A 3WCCA 4LTZA 3SDQA 5IM1A 2F8CF 4L2XF 3NPRA 3G4FA 3OABB 5AYPA 5EATA 1YYUA 5B0KA 4EA0A 1N24A 2J1OA 3AQ0A 3LEEA 2E8TA 2ZEUA 1HX9A 3ADZA 3N3DA 4KPJA 5DHKA 3WJKA 3LMDA 5ILYA 5IMPA 3TFVA 3RBMA 1FPSA 4LFGA 3EGTA 4KVYA 5IN8A 4FJQA 3Q2ZA 5ILHA 4LZCA 3M9UA 5ILJA 1HM7A 2DH4A 3N1WF 2F92F 3PKOA 4OMHA 3Q1OA 5IL8A 4NKFA 4LLSA 5ILZA 1N22A 5B0MA 3WCEA 1ZW5A 4DWBA 3ICMA 5IK6A 1KIYA 4FP4A 1YHMA 2Q9ZA 1YV5A 2OGDA 1EZFA 5A0IA 5ERMA 3ICNA 3M0GA 2OPMA 3OACB 2Q9YA 3S9VA 5HNAA 3N0GA 4MC8A 4RXDA 1V4HA 3KROB 3ICKA 3P5PA 3CP6A 3M02A 4N1ZF 4EA2A 4K10A 2PS5A 5DJVF 5B01A 1PS1A 3NPKA 2AZJA 4LZ3A 1DI1A 3LK5A 3Q30A 5IMNA 1UBYA 2E92A 4NG6A 2Z7HA 3SDUA 5IK9A 2J5CA 3V1VA 3WCBA 4H5CF 4KPDA 5E8KA 3EFQA 4KVWA 5DJPF 4LIXA 2AETA 5B0LA 2ZCRA 3WCIA 3N6KF 4DHDA 5DGMF 3WCLA 5DIQF 2ZCSA 4NKEA 1YHLA 3ACWA 5B0IA 4RXAA 3WEKA 3RMGA 4QPFA 4NFKF 4E1EA 1HXAA 2ZEVA 4RYPA 3IPIA 3ZOUA 4GA3A 4RNQA 1V4KA 1HXGA 4KQUA 2F94F 5A0JA 4JZXA 1WL1A 3WC9A 2PS4A 2Z50A 3WCHA 4MC3A 3KRCA 3KBKA 4LA6A 3V1XA 3G4DA 3UCAA 2AELA 3NF2A 4LLTA 3LZ9A 3TFNA 1V4EA 3KRFA 5JV0F 3P8RA 5EROA 4LFEA 1VG3A 2PS8A 4PVXF 5CG5A 2E91A 1N23A 5IKAA 3OABA 3VJCA 5DJRF 4GP2A 3SDVA 5DZ2A 1N20A 3KRPA 3EZ3A 5DHIA 5IMIA 1YYRA 3RYEA 4KWDA 4OKMA 3RYWA 3KRAA 5I1UA 1WL2A 4JZBA 4LZ0A 4DZWA 4KVIA 4DXJA 3VJ8A 4XQSF 4H5EF 2H8OA 5B00A 5EAUA 4N9UA 4P0XA 3ACXA 5B0JA 3VJBA 3WCMA 4HD1A 3N5HF 4LFVF 4RXEA 3WEGA 2AZKA 3Q2QA 2E8WA 2F8ZF 4KFAA 4NFIF 5AFXA 4EA1A 3WEHA 1HXCA 3B7LA 1YQ7A 1RQIA 3N45F 2E4OA 2RAHA 5KSXF 5JV1F 5DGNF 5E8HA 2E8VA 3OACA 4JXNA 1YYSA 5IVGA 1V4IA 3LJIA 1UBXA 2OPNA 5ILKA 4KQSA 5JA0F 3WEJA 2AEKA 3N49F 3MZVA 2F89F 4LPHF 3WCDA 3VJEA 5ERNA 1KIZA 3IBAA 2E94A 2ZCOA 5IL3A 4QXSF 3PH7A 3PYAA 2QISA 3AQCB 2Z4ZA 3LGZB 3NRIA 2F7MF 3SDRA 5IKHA 1UBWA 3AE0A 2Z4YA 2P1CA 1VG7A 3DYGA 3ICZA 3ZMCA 4JYXA 4P0WA 1JFAA 1WY0A 5ILDA 2PS7A 3KRCB 3VJ9A 2VF6A 4UMJA 3SDTA 2Z7IA 4GP1A 4XQRF 4LOBA 3SAEA 4XQTF 3WSAA 2Q80A 4NUAA 1V4JA 3S4JA 2Z4WA 3KRFB 3WEIA 3CKEA 5JV2F 3ZL6A 3N46F 3OYRA 1WMWA 3TFPA 2ONHA 4DWGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N5J F;  3LGK A;  2E93 A;  3CC9 A;  1HM4 A;  1YHK A;  3P41 A;  3LSN A;  1JFG A;  3KRP B;  3AQB B;  5ER8 A;  4LPG F;  3LG5 A;  2AZL A;  3TC1 A;  3WEF A;  3LDW A;  3KRA B;  2PS6 A;  2J1P A;  2FOR A;  3M00 A;  2FTZ A;  3MAV A;  2E95 A;  3WJO A;  4OMG A;  4GAX A;  3LOM A;  1VG2 A;  1RTR A;  4F6V A;  4LA5 A;  4PVY F;  3ACY A;  4ZQ8 A;  3WSB A;  3DYH A;  3LLW A;  5DGS F;  1YYQ A;  1N1Z A;  3P8L A;  1YJ4 A;  5IK0 A;  3WE9 A;  3BNX A;  3PDE A;  3VJD A;  4OGU A;  1WL0 A;  3WCF A;  3W7F A;  3WCA A;  2E8U A;  1YYT A;  5EAS A;  5E8L A;  4NFJ F;  4WK5 A;  3VJA A;  5DW7 A;  1RQJ A;  4H5D F;  1DGP A;  3M01 A;  4OKZ A;  3TS7 A;  5CG6 A;  2F9K F;  3ASX A;  4DI5 A;  1WL3 A;  5HN7 A;  3P5R A;  4KQ5 A;  3BNY A;  2Q58 A;  2ONG A;  5A0K A;  1VG6 A;  3QKC A;  3V66 A;  5B02 A;  4F6X A;  4KUX A;  4MC0 A;  3N0F A;  2ZY1 A;  5HN8 A;  2Z4X A;  4Q23 A;  3N1V F;  3N3L F;  5AHU B;  3LVS A;  3KRO A;  4F62 A;  2I19 A;  1WKZ A;  3DYF A;  5HN9 A;  3WJN A;  3WCG A;  5B03 A;  2Z52 A;  4KKM A;  4E9U A;  4DEM F;  4KK2 A;  1UBV A;  4RXC A;  3APZ A;  5H9D A;  2E8X A;  4LXW A;  2OA6 A;  3ZCD A;  2Z4V A;  5AEL A;  4JVJ F;  2EWG A;  4LUU A;  5C05 A;  4E9Z A;  4JXY A;  2ZCQ A;  1VG4 A;  2O1O A;  5JUZ F;  3PYB A;  3WCJ A;  4P0V A;  2Z78 A;  2E90 A;  3QQV A;  4KVD A;  4LTV A;  5ILI A;  1N1B A;  3KB9 A;  3ZMB A;  1N21 A;  3ID0 A;  3WCC A;  4LTZ A;  3SDQ A;  5IM1 A;  2F8C F;  4L2X F;  3NPR A;  3G4F A;  3OAB B;  5AYP A;  5EAT A;  1YYU A;  5B0K A;  4EA0 A;  1N24 A;  2J1O A;  3AQ0 A;  3LEE A;  2E8T A;  2ZEU A;  1HX9 A;  3ADZ A;  3N3D A;  4KPJ A;  5DHK A;  3WJK A;  3LMD A;  5ILY A;  5IMP A;  3TFV A;  3RBM A;  1FPS A;  4LFG A;  3EGT A;  4KVY A;  5IN8 A;  4FJQ A;  3Q2Z A;  5ILH A;  4LZC A;  3M9U A;  5ILJ A;  1HM7 A;  2DH4 A;  3N1W F;  2F92 F;  3PKO A;  4OMH A;  3Q1O A;  5IL8 A;  4NKF A;  4LLS A;  5ILZ A;  1N22 A;  5B0M A;  3WCE A;  1ZW5 A;  4DWB A;  3ICM A;  5IK6 A;  1KIY A;  4FP4 A;  1YHM A;  2Q9Z A;  1YV5 A;  2OGD A;  1EZF A;  5A0I A;  5ERM A;  3ICN A;  3M0G A;  2OPM A;  3OAC B;  2Q9Y A;  3S9V A;  5HNA A;  3N0G A;  4MC8 A;  4RXD A;  1V4H A;  3KRO B;  3ICK A;  3P5P A;  3CP6 A;  3M02 A;  4N1Z F;  4EA2 A;  4K10 A;  2PS5 A;  5DJV F;  5B01 A;  1PS1 A;  3NPK A;  2AZJ A;  4LZ3 A;  1DI1 A;  3LK5 A;  3Q30 A;  5IMN A;  1UBY A;  2E92 A;  4NG6 A;  2Z7H A;  3SDU A;  5IK9 A;  2J5C A;  3V1V A;  3WCB A;  4H5C F;  4KPD A;  5E8K A;  3EFQ A;  4KVW A;  5DJP F;  4LIX A;  2AET A;  5B0L A;  2ZCR A;  3WCI A;  3N6K F;  4DHD A;  5DGM F;  3WCL A;  5DIQ F;  2ZCS A;  4NKE A;  1YHL A;  3ACW A;  5B0I A;  4RXA A;  3WEK A;  3RMG A;  4QPF A;  4NFK F;  4E1E A;  1HXA A;  2ZEV A;  4RYP A;  3IPI A;  3ZOU A;  4GA3 A;  4RNQ A;  1V4K A;  1HXG A;  4KQU A;  2F94 F;  5A0J A;  4JZX A;  1WL1 A;  3WC9 A;  2PS4 A;  2Z50 A;  3WCH A;  4MC3 A;  3KRC A;  3KBK A;  4LA6 A;  3V1X A;  3G4D A;  3UCA A;  2AEL A;  3NF2 A;  4LLT A;  3LZ9 A;  3TFN A;  1V4E A;  3KRF A;  5JV0 F;  3P8R A;  5ERO A;  4LFE A;  1VG3 A;  2PS8 A;  4PVX F;  5CG5 A;  2E91 A;  1N23 A;  5IKA A;  3OAB A;  3VJC A;  5DJR F;  4GP2 A;  3SDV A;  5DZ2 A;  1N20 A;  3KRP A;  3EZ3 A;  5DHI A;  5IMI A;  1YYR A;  3RYE A;  4KWD A;  4OKM A;  3RYW A;  3KRA A;  5I1U A;  1WL2 A;  4JZB A;  4LZ0 A;  4DZW A;  4KVI A;  4DXJ A;  3VJ8 A;  4XQS F;  4H5E F;  2H8O A;  5B00 A;  5EAU A;  4N9U A;  4P0X A;  3ACX A;  5B0J A;  3VJB A;  3WCM A;  4HD1 A;  3N5H F;  4LFV F;  4RXE A;  3WEG A;  2AZK A;  3Q2Q A;  2E8W A;  2F8Z F;  4KFA A;  4NFI F;  5AFX A;  4EA1 A;  3WEH A;  1HXC A;  3B7L A;  1YQ7 A;  1RQI A;  3N45 F;  2E4O A;  2RAH A;  5KSX F;  5JV1 F;  5DGN F;  5E8H A;  2E8V A;  3OAC A;  4JXN A;  1YYS A;  5IVG A;  1V4I A;  3LJI A;  1UBX A;  2OPN A;  5ILK A;  4KQS A;  5JA0 F;  3WEJ A;  2AEK A;  3N49 F;  3MZV A;  2F89 F;  4LPH F;  3WCD A;  3VJE A;  5ERN A;  1KIZ A;  3IBA A;  2E94 A;  2ZCO A;  5IL3 A;  4QXS F;  3PH7 A;  3PYA A;  2QIS A;  3AQC B;  2Z4Z A;  3LGZ B;  3NRI A;  2F7M F;  3SDR A;  5IKH A;  1UBW A;  3AE0 A;  2Z4Y A;  2P1C A;  1VG7 A;  3DYG A;  3ICZ A;  3ZMC A;  4JYX A;  4P0W A;  1JFA A;  1WY0 A;  5ILD A;  2PS7 A;  3KRC B;  3VJ9 A;  2VF6 A;  4UMJ A;  3SDT A;  2Z7I A;  4GP1 A;  4XQR F;  4LOB A;  3SAE A;  4XQT F;  3WSA A;  2Q80 A;  4NUA A;  1V4J A;  3S4J A;  2Z4W A;  3KRF B;  3WEI A;  3CKE A;  5JV2 F;  3ZL6 A;  3N46 F;  3OYR A;  1WMW A;  3TFP A;  2ONH A;  4DWG A; 
#chains in the Genus database with same CATH topology
 3N5J F;  3LGK A;  2E93 A;  3CC9 A;  1HM4 A;  1YHK A;  3P41 A;  3LSN A;  1JFG A;  3KRP B;  3AQB B;  5ER8 A;  4LPG F;  3LG5 A;  2AZL A;  3TC1 A;  3WEF A;  3LDW A;  3KRA B;  2PS6 A;  2J1P A;  2FOR A;  3M00 A;  2FTZ A;  3MAV A;  2E95 A;  3WJO A;  4OMG A;  4GAX A;  3LOM A;  1VG2 A;  1RTR A;  4F6V A;  4LA5 A;  4PVY F;  3ACY A;  4ZQ8 A;  3WSB A;  3DYH A;  3LLW A;  5DGS F;  1YYQ A;  1N1Z A;  3P8L A;  1YJ4 A;  5IK0 A;  3WE9 A;  3BNX A;  3PDE A;  3VJD A;  4OGU A;  1WL0 A;  3WCF A;  3W7F A;  3WCA A;  2E8U A;  1YYT A;  5EAS A;  5E8L A;  4NFJ F;  4WK5 A;  3VJA A;  5DW7 A;  1RQJ A;  4H5D F;  1DGP A;  3M01 A;  4OKZ A;  3TS7 A;  5CG6 A;  2F9K F;  3ASX A;  4DI5 A;  1WL3 A;  5HN7 A;  3P5R A;  4KQ5 A;  3BNY A;  2Q58 A;  2ONG A;  5A0K A;  1VG6 A;  3QKC A;  3V66 A;  5B02 A;  4F6X A;  4KUX A;  4MC0 A;  3N0F A;  2ZY1 A;  5HN8 A;  2Z4X A;  4Q23 A;  3N1V F;  3N3L F;  5AHU B;  3LVS A;  3KRO A;  4F62 A;  2I19 A;  1WKZ A;  3DYF A;  5HN9 A;  3WJN A;  3WCG A;  5B03 A;  2Z52 A;  4KKM A;  4E9U A;  4DEM F;  4KK2 A;  1UBV A;  4RXC A;  3APZ A;  5H9D A;  2E8X A;  4LXW A;  2OA6 A;  3ZCD A;  2Z4V A;  5AEL A;  4JVJ F;  2EWG A;  4LUU A;  5C05 A;  4E9Z A;  4JXY A;  2ZCQ A;  1VG4 A;  2O1O A;  5JUZ F;  3PYB A;  3WCJ A;  4P0V A;  2Z78 A;  2E90 A;  3QQV A;  4KVD A;  4LTV A;  5ILI A;  1N1B A;  3KB9 A;  3ZMB A;  1N21 A;  3ID0 A;  3WCC A;  4LTZ A;  3SDQ A;  5IM1 A;  2F8C F;  4L2X F;  3NPR A;  3G4F A;  3OAB B;  5AYP A;  5EAT A;  1YYU A;  5B0K A;  4EA0 A;  1N24 A;  2J1O A;  3AQ0 A;  3LEE A;  2E8T A;  2ZEU A;  1HX9 A;  3ADZ A;  3N3D A;  4KPJ A;  5DHK A;  3WJK A;  3LMD A;  5ILY A;  5IMP A;  3TFV A;  3RBM A;  1FPS A;  4LFG A;  3EGT A;  4KVY A;  5IN8 A;  4FJQ A;  3Q2Z A;  5ILH A;  4LZC A;  3M9U A;  5ILJ A;  1HM7 A;  2DH4 A;  3N1W F;  2F92 F;  3PKO A;  4OMH A;  3Q1O A;  5IL8 A;  4NKF A;  4LLS A;  5ILZ A;  1N22 A;  5B0M A;  3WCE A;  1ZW5 A;  4DWB A;  3ICM A;  5IK6 A;  1KIY A;  4FP4 A;  1YHM A;  2Q9Z A;  1YV5 A;  2OGD A;  1EZF A;  5A0I A;  5ERM A;  3ICN A;  3M0G A;  2OPM A;  3OAC B;  2Q9Y A;  3S9V A;  5HNA A;  3N0G A;  4MC8 A;  4RXD A;  1V4H A;  3KRO B;  3ICK A;  3P5P A;  3CP6 A;  3M02 A;  4N1Z F;  4EA2 A;  4K10 A;  2PS5 A;  5DJV F;  5B01 A;  1PS1 A;  3NPK A;  2AZJ A;  4LZ3 A;  1DI1 A;  3LK5 A;  3Q30 A;  5IMN A;  1UBY A;  2E92 A;  4NG6 A;  2Z7H A;  3SDU A;  5IK9 A;  2J5C A;  3V1V A;  3WCB A;  4H5C F;  4KPD A;  5E8K A;  3EFQ A;  4KVW A;  5DJP F;  4LIX A;  2AET A;  5B0L A;  2ZCR A;  3WCI A;  3N6K F;  4DHD A;  5DGM F;  3WCL A;  5DIQ F;  2ZCS A;  4NKE A;  1YHL A;  3ACW A;  5B0I A;  4RXA A;  3WEK A;  3RMG A;  4QPF A;  4NFK F;  4E1E A;  1HXA A;  2ZEV A;  4RYP A;  3IPI A;  3ZOU A;  4GA3 A;  4RNQ A;  1V4K A;  1HXG A;  4KQU A;  2F94 F;  5A0J A;  4JZX A;  1WL1 A;  3WC9 A;  2PS4 A;  2Z50 A;  3WCH A;  4MC3 A;  3KRC A;  3KBK A;  4LA6 A;  3V1X A;  3G4D A;  3UCA A;  2AEL A;  3NF2 A;  4LLT A;  3LZ9 A;  3TFN A;  1V4E A;  3KRF A;  5JV0 F;  3P8R A;  5ERO A;  4LFE A;  1VG3 A;  2PS8 A;  4PVX F;  5CG5 A;  2E91 A;  1N23 A;  5IKA A;  3OAB A;  3VJC A;  5DJR F;  4GP2 A;  3SDV A;  5DZ2 A;  1N20 A;  3KRP A;  3EZ3 A;  5DHI A;  5IMI A;  1YYR A;  3RYE A;  4KWD A;  4OKM A;  3RYW A;  3KRA A;  5I1U A;  1WL2 A;  4JZB A;  4LZ0 A;  4DZW A;  4KVI A;  4DXJ A;  3VJ8 A;  4XQS F;  4H5E F;  2H8O A;  5B00 A;  5EAU A;  4N9U A;  4P0X A;  3ACX A;  5B0J A;  3VJB A;  3WCM A;  4HD1 A;  3N5H F;  4LFV F;  4RXE A;  3WEG A;  2AZK A;  3Q2Q A;  2E8W A;  2F8Z F;  4KFA A;  4NFI F;  5AFX A;  4EA1 A;  3WEH A;  1HXC A;  3B7L A;  1YQ7 A;  1RQI A;  3N45 F;  2E4O A;  2RAH A;  5KSX F;  5JV1 F;  5DGN F;  5E8H A;  2E8V A;  3OAC A;  4JXN A;  1YYS A;  5IVG A;  1V4I A;  3LJI A;  1UBX A;  2OPN A;  5ILK A;  4KQS A;  5JA0 F;  3WEJ A;  2AEK A;  3N49 F;  3MZV A;  2F89 F;  4LPH F;  3WCD A;  3VJE A;  5ERN A;  1KIZ A;  3IBA A;  2E94 A;  2ZCO A;  5IL3 A;  4QXS F;  3PH7 A;  3PYA A;  2QIS A;  3AQC B;  2Z4Z A;  3LGZ B;  3NRI A;  2F7M F;  3SDR A;  5IKH A;  1UBW A;  3AE0 A;  2Z4Y A;  2P1C A;  1VG7 A;  3DYG A;  3ICZ A;  3ZMC A;  4JYX A;  4P0W A;  1JFA A;  1WY0 A;  5ILD A;  2PS7 A;  3KRC B;  3VJ9 A;  2VF6 A;  4UMJ A;  3SDT A;  2Z7I A;  4GP1 A;  4XQR F;  4LOB A;  3SAE A;  4XQT F;  3WSA A;  2Q80 A;  4NUA A;  1V4J A;  3S4J A;  2Z4W A;  3KRF B;  3WEI A;  3CKE A;  5JV2 F;  3ZL6 A;  3N46 F;  3OYR A;  1WMW A;  3TFP A;  2ONH A;  4DWG A; 
#chains in the Genus database with same CATH homology
 3N5J F;  3LGK A;  2E93 A;  3CC9 A;  1HM4 A;  1YHK A;  3P41 A;  3LSN A;  1JFG A;  3KRP B;  3AQB B;  5ER8 A;  4LPG F;  3LG5 A;  2AZL A;  3TC1 A;  3WEF A;  3LDW A;  3KRA B;  2PS6 A;  2J1P A;  2FOR A;  3M00 A;  2FTZ A;  3MAV A;  2E95 A;  3WJO A;  4OMG A;  4GAX A;  3LOM A;  1VG2 A;  1RTR A;  4F6V A;  4LA5 A;  4PVY F;  3ACY A;  4ZQ8 A;  3WSB A;  3DYH A;  3LLW A;  5DGS F;  1YYQ A;  1N1Z A;  3P8L A;  1YJ4 A;  5IK0 A;  3WE9 A;  3BNX A;  3PDE A;  3VJD A;  4OGU A;  1WL0 A;  3WCF A;  3W7F A;  3WCA A;  2E8U A;  1YYT A;  5EAS A;  5E8L A;  4NFJ F;  4WK5 A;  3VJA A;  5DW7 A;  1RQJ A;  4H5D F;  1DGP A;  3M01 A;  4OKZ A;  3TS7 A;  5CG6 A;  2F9K F;  3ASX A;  4DI5 A;  1WL3 A;  5HN7 A;  3P5R A;  4KQ5 A;  3BNY A;  2Q58 A;  2ONG A;  5A0K A;  1VG6 A;  3QKC A;  3V66 A;  5B02 A;  4F6X A;  4KUX A;  4MC0 A;  3N0F A;  2ZY1 A;  5HN8 A;  2Z4X A;  4Q23 A;  3N1V F;  3N3L F;  5AHU B;  3LVS A;  3KRO A;  4F62 A;  2I19 A;  1WKZ A;  3DYF A;  5HN9 A;  3WJN A;  3WCG A;  5B03 A;  2Z52 A;  4KKM A;  4E9U A;  4DEM F;  4KK2 A;  1UBV A;  4RXC A;  3APZ A;  5H9D A;  2E8X A;  4LXW A;  2OA6 A;  3ZCD A;  2Z4V A;  5AEL A;  4JVJ F;  2EWG A;  4LUU A;  5C05 A;  4E9Z A;  4JXY A;  2ZCQ A;  1VG4 A;  2O1O A;  5JUZ F;  3PYB A;  3WCJ A;  4P0V A;  2Z78 A;  2E90 A;  3QQV A;  4KVD A;  4LTV A;  5ILI A;  1N1B A;  3KB9 A;  3ZMB A;  1N21 A;  3ID0 A;  3WCC A;  4LTZ A;  3SDQ A;  5IM1 A;  2F8C F;  4L2X F;  3NPR A;  3G4F A;  3OAB B;  5AYP A;  5EAT A;  1YYU A;  5B0K A;  4EA0 A;  1N24 A;  2J1O A;  3AQ0 A;  3LEE A;  2E8T A;  2ZEU A;  1HX9 A;  3ADZ A;  3N3D A;  4KPJ A;  5DHK A;  3WJK A;  3LMD A;  5ILY A;  5IMP A;  3TFV A;  3RBM A;  1FPS A;  4LFG A;  3EGT A;  4KVY A;  5IN8 A;  4FJQ A;  3Q2Z A;  5ILH A;  4LZC A;  3M9U A;  5ILJ A;  1HM7 A;  2DH4 A;  3N1W F;  2F92 F;  3PKO A;  4OMH A;  3Q1O A;  5IL8 A;  4NKF A;  4LLS A;  5ILZ A;  1N22 A;  5B0M A;  3WCE A;  1ZW5 A;  4DWB A;  3ICM A;  5IK6 A;  1KIY A;  4FP4 A;  1YHM A;  2Q9Z A;  1YV5 A;  2OGD A;  1EZF A;  5A0I A;  5ERM A;  3ICN A;  3M0G A;  2OPM A;  3OAC B;  2Q9Y A;  3S9V A;  5HNA A;  3N0G A;  4MC8 A;  4RXD A;  1V4H A;  3KRO B;  3ICK A;  3P5P A;  3CP6 A;  3M02 A;  4N1Z F;  4EA2 A;  4K10 A;  2PS5 A;  5DJV F;  5B01 A;  1PS1 A;  3NPK A;  2AZJ A;  4LZ3 A;  1DI1 A;  3LK5 A;  3Q30 A;  5IMN A;  1UBY A;  2E92 A;  4NG6 A;  2Z7H A;  3SDU A;  5IK9 A;  2J5C A;  3V1V A;  3WCB A;  4H5C F;  4KPD A;  5E8K A;  3EFQ A;  4KVW A;  5DJP F;  4LIX A;  2AET A;  5B0L A;  2ZCR A;  3WCI A;  3N6K F;  4DHD A;  5DGM F;  3WCL A;  5DIQ F;  2ZCS A;  4NKE A;  1YHL A;  3ACW A;  5B0I A;  4RXA A;  3WEK A;  3RMG A;  4QPF A;  4NFK F;  4E1E A;  1HXA A;  2ZEV A;  4RYP A;  3IPI A;  3ZOU A;  4GA3 A;  4RNQ A;  1V4K A;  1HXG A;  4KQU A;  2F94 F;  5A0J A;  4JZX A;  1WL1 A;  3WC9 A;  2PS4 A;  2Z50 A;  3WCH A;  4MC3 A;  3KRC A;  3KBK A;  4LA6 A;  3V1X A;  3G4D A;  3UCA A;  2AEL A;  3NF2 A;  4LLT A;  3LZ9 A;  3TFN A;  1V4E A;  3KRF A;  5JV0 F;  3P8R A;  5ERO A;  4LFE A;  1VG3 A;  2PS8 A;  4PVX F;  5CG5 A;  2E91 A;  1N23 A;  5IKA A;  3OAB A;  3VJC A;  5DJR F;  4GP2 A;  3SDV A;  5DZ2 A;  1N20 A;  3KRP A;  3EZ3 A;  5DHI A;  5IMI A;  1YYR A;  3RYE A;  4KWD A;  4OKM A;  3RYW A;  3KRA A;  5I1U A;  1WL2 A;  4JZB A;  4LZ0 A;  4DZW A;  4KVI A;  4DXJ A;  3VJ8 A;  4XQS F;  4H5E F;  2H8O A;  5B00 A;  5EAU A;  4N9U A;  4P0X A;  3ACX A;  5B0J A;  3VJB A;  3WCM A;  4HD1 A;  3N5H F;  4LFV F;  4RXE A;  3WEG A;  2AZK A;  3Q2Q A;  2E8W A;  2F8Z F;  4KFA A;  4NFI F;  5AFX A;  4EA1 A;  3WEH A;  1HXC A;  3B7L A;  1YQ7 A;  1RQI A;  3N45 F;  2E4O A;  2RAH A;  5KSX F;  5JV1 F;  5DGN F;  5E8H A;  2E8V A;  3OAC A;  4JXN A;  1YYS A;  5IVG A;  1V4I A;  3LJI A;  1UBX A;  2OPN A;  5ILK A;  4KQS A;  5JA0 F;  3WEJ A;  2AEK A;  3N49 F;  3MZV A;  2F89 F;  4LPH F;  3WCD A;  3VJE A;  5ERN A;  1KIZ A;  3IBA A;  2E94 A;  2ZCO A;  5IL3 A;  4QXS F;  3PH7 A;  3PYA A;  2QIS A;  3AQC B;  2Z4Z A;  3LGZ B;  3NRI A;  2F7M F;  3SDR A;  5IKH A;  1UBW A;  3AE0 A;  2Z4Y A;  2P1C A;  1VG7 A;  3DYG A;  3ICZ A;  3ZMC A;  4JYX A;  4P0W A;  1JFA A;  1WY0 A;  5ILD A;  2PS7 A;  3KRC B;  3VJ9 A;  2VF6 A;  4UMJ A;  3SDT A;  2Z7I A;  4GP1 A;  4XQR F;  4LOB A;  3SAE A;  4XQT F;  3WSA A;  2Q80 A;  4NUA A;  1V4J A;  3S4J A;  2Z4W A;  3KRF B;  3WEI A;  3CKE A;  5JV2 F;  3ZL6 A;  3N46 F;  3OYR A;  1WMW A;  3TFP A;  2ONH A;  4DWG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...