3BNXA

Crystal structure of aristolochene synthase complexed with farnesyl diphosphate
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
305
structure length
296
Chain Sequence
SLEPPPSTFQPLCHPLVEEVSKEVDGYFLQHWNFPNEKARKKFVAAGFSRVTCLYFPKALDDRIHFACRLLTVLFLIDDLLEYMSFEEGSAYNEKLIPISRGDVLPDRSIPVEYIIYDLWESMRAHDREMADEILEPVFLFMRAQTDRTRARPMGLGGYLEYRERDVGKELLAALMRFSMGLKLSPSELQRVREIDANCSKHLSVVNDIYSYEKELYTSLCTSVQILAQEADVTAEAAKRVLFVMCREWELRHQLLVARLSAEGLETPGLAAYVEGLEYQMSGNELWSQTTLRYSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aristolochene synthase
publication title X-ray Crystallographic Studies of Substrate Binding to Aristolochene Synthase Suggest a Metal Ion Binding Sequence for Catalysis
pubmed doi rcsb
source organism Aspergillus terreus
molecule tags Lyase
total genus 122
structure length 296
sequence length 305
chains with identical sequence B, C, D
ec nomenclature ec 4.2.3.9: Aristolochene synthase.
pdb deposition date 2007-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3bnxA00
3IBAA 4RXAA 3ASXA 1YHKA 1JFGA 3WCJA 3SDVA 3WEHA 3N1WF 1EZFA 3G4FA 3LGZB 2E8VA 4N9UA 3RYWA 4NFJF 3WCMA 3M0GA 4FP4A 5DGNF 1YYQA 1DGPA 3N5JF 1N24A 4GP2A 4NFKF 4KVIA 3ZMBA 4LTZA 3KRPA 2E8UA 4XQRF 4DWBA 3KBKA 2PS4A 3DYGA 2Z4XA 2ZCOA 3WCAA 3Q2ZA 3NRIA 3VJDA 2F7MF 3TS7A 4XQSF 2Z78A 4DZWA 2EWGA 5HN9A 3ICKA 2E92A 4MC3A 4OMGA 5IKAA 3WJKA 3OABA 1WMWA 4RXEA 1V4JA 5A0IA 2FTZA 3ACXA 4KQUA 2H8OA 1N1BA 1WL0A 3IPIA 4P0VA 4P0WA 4H5EF 4DI5A 5B0KA 3M01A 5DJPF 5IL3A 5IMNA 1UBWA 5IVGA 3WE9A 3WCFA 3ADZA 3ZOUA 4RXDA 5DHKA 4F6XA 4OGUA 1UBYA 3QQVA 5DJRF 5ERMA 3WCDA 5IK9A 3G4DA 4JZBA 4LFVF 4LLTA 2I19A 4XQTF 3ACYA 2E93A 1YHLA 4KWDA 2Q9YA 2QISA 5DW7A 4JZXA 3KRPB 1N22A 2F8ZF 1WY0A 1VG3A 3S9VA 3ZL6A 5ILHA 4NKEA 3TFVA 3PYAA 3VJBA 4FJQA 3AE0A 3SDRA 3WSAA 2F89F 3BNYA 4GAXA 3ACWA 1HM7A 4OMHA 4JXNA 3KB9A 3W7FA 3KROA 3N6KF 5KSXF 5ILDA 2OGDA 1HXAA 3KRAA 5AHUB 4LXWA 2E8TA 4GA3A 2E4OA 3BNXA 3N46F 1YYRA 3QKCA 3ICNA 4KVWA 5JV0F 3APZA 3ICZA 4LLSA 5JUZF 1HX9A 1N20A 2Z4ZA 1DI1A 5IL8A 2OA6A 4P0XA 3LJIA 3RMGA 5B01A 2VF6A 3WCEA 2Z4VA 4DXJA 3SDQA 3WCGA 3ICMA 4Q23A 1UBXA 5JA0F 5AELA 4GP1A 4DHDA 5ER8A 1V4HA 3N49F 3VJAA 4F6VA 3WC9A 3N3LF 5E8LA 3VJ8A 1V4EA 5B0LA 2PS5A 2E94A 4LPHF 2ZCSA 5HN8A 3N0GA 2PS7A 2F8CF 2Q58A 2E95A 4KPDA 3WEIA 3WEKA 2E8XA 3V66A 1PS1A 5IMIA 4RNQA 4KK2A 3OACB 3ID0A 3KRCA 4OKZA 4RYPA 5DJVF 3WCIA 2ZY1A 5ILKA 3M9UA 4LOBA 5B0IA 4KQ5A 4LPGF 3PYBA 2F9KF 2Z4WA 3EZ3A 3KROB 1HM4A 1UBVA 5B00A 3ZCDA 4NFIF 2PS8A 3NPRA 4EA1A 3TFNA 3PKOA 5I1UA 5IMPA 5EATA 4RXCA 4NG6A 2AETA 3WEJA 2E8WA 2J1PA 5ILZA 5IK0A 5HN7A 2Z4YA 5B02A 1V4IA 3VJEA 1RTRA 1KIZA 5JV1F 3TC1A 4PVYF 3SAEA 4MC0A 4NUAA 4HD1A 3LK5A 1YYUA 2FORA 4H5DF 3RYEA 2J5CA 1RQJA 3M02A 3SDUA 3LZ9A 1VG4A 3WJOA 3Q2QA 5IK6A 1HXCA 3AQBB 3N0FA 3S4JA 1YYSA 3P41A 4E9ZA 5ILYA 4LFEA 2OPNA 5IN8A 3OABB 1VG2A 4QPFA 1YYTA 5C05A 2ZCQA 4DWGA 3KRCB 5E8KA 2Z7HA 1RQIA 5JV2F 5A0KA 3CC9A 2P1CA 4LFGA 4KKMA 4LTVA 3CKEA 3LG5A 4LIXA 5DIQF 3ZMCA 2ZEUA 1N21A 1WKZA 2Q9ZA 3N1VF 1V4KA 3EGTA 3Q1OA 3P8RA 3WJNA 3WCBA 5A0JA 4KVYA 1N23A 3V1VA 1ZW5A 4DEMF 2Z52A 3LDWA 1YQ7A 4MC8A 1HXGA 5EASA 3EFQA 2PS6A 3KRFA 5B0JA 1VG6A 3N45F 3MZVA 3LVSA 5DHIA 3MAVA 4JXYA 2Z50A 5EAUA 2AZLA 5DZ2A 3NPKA 5HNAA 4WK5A 2AEKA 4LA5A 1YJ4A 5IM1A 4JYXA 5ERNA 3V1XA 5ILJA 2OPMA 2DH4A 3AQCB 5IKHA 1YV5A 2ZCRA 2ZEVA 2ONHA 4PVXF 3VJ9A 3B7LA 4EA0A 3LOMA 5DGSF 1KIYA 2RAHA 3P8LA 3KRAB 4NKFA 2Q80A 4LZ0A 2O1OA 3WCLA 3WCHA 3WEGA 3WSBA 5ILIA 1WL2A 3LEEA 4JVJF 4F62A 2AZJA 4K10A 4ZQ8A 4KUXA 5B0MA 5DGMF 3SDTA 1N1ZA 3N5HF 4LUUA 4E1EA 4QXSF 3UCAA 3NF2A 1FPSA 5AYPA 3PDEA 5B03A 4KFAA 3AQ0A 4N1ZF 3CP6A 2E91A 2AZKA 3TFPA 1JFAA 2J1OA 3VJCA 3PH7A 4KPJA 5CG5A 3LLWA 5EROA 2E90A 4EA2A 3WEFA 1VG7A 5H9DA 3M00A 2ONGA 1WL1A 3P5RA 3RBMA 4E9UA 3LSNA 3P5PA 5CG6A 4KVDA 4H5CF 3N3DA 2Z7IA 3WCCA 2F92F 3Q30A 5E8HA 4LZ3A 1WL3A 4KQSA 3OACA 4L2XF 3KRFB 2AELA 5AFXA 3LMDA 4LA6A 3DYHA 3OYRA 4OKMA 4LZCA 1YHMA 3LGKA 2F94F 3DYFA 4UMJA
chains in the Genus database with same CATH superfamily
3IBAA 4RXAA 3ASXA 1YHKA 1JFGA 3WCJA 3SDVA 3WEHA 3N1WF 1EZFA 3G4FA 3LGZB 2E8VA 4N9UA 3RYWA 4NFJF 3WCMA 3M0GA 4FP4A 5DGNF 1YYQA 1DGPA 3N5JF 1N24A 4GP2A 4NFKF 4KVIA 3ZMBA 4LTZA 3KRPA 2E8UA 4XQRF 4DWBA 3KBKA 2PS4A 3DYGA 2Z4XA 2ZCOA 3WCAA 3Q2ZA 3NRIA 3VJDA 2F7MF 3TS7A 4XQSF 2Z78A 4DZWA 2EWGA 5HN9A 3ICKA 2E92A 4MC3A 4OMGA 5IKAA 3WJKA 3OABA 1WMWA 4RXEA 1V4JA 5A0IA 2FTZA 3ACXA 4KQUA 2H8OA 1N1BA 1WL0A 3IPIA 4P0VA 4P0WA 4H5EF 4DI5A 5B0KA 3M01A 5DJPF 5IL3A 5IMNA 1UBWA 5IVGA 3WE9A 3WCFA 3ADZA 3ZOUA 4RXDA 5DHKA 4F6XA 4OGUA 1UBYA 3QQVA 5DJRF 5ERMA 3WCDA 5IK9A 3G4DA 4JZBA 4LFVF 4LLTA 2I19A 4XQTF 3ACYA 2E93A 1YHLA 4KWDA 2Q9YA 2QISA 5DW7A 4JZXA 3KRPB 1N22A 2F8ZF 1WY0A 1VG3A 3S9VA 3ZL6A 5ILHA 4NKEA 3TFVA 3PYAA 3VJBA 4FJQA 3AE0A 3SDRA 3WSAA 2F89F 3BNYA 4GAXA 3ACWA 1HM7A 4OMHA 4JXNA 3KB9A 3W7FA 3KROA 3N6KF 5KSXF 5ILDA 2OGDA 1HXAA 3KRAA 5AHUB 4LXWA 2E8TA 4GA3A 2E4OA 3BNXA 3N46F 1YYRA 3QKCA 3ICNA 4KVWA 5JV0F 3APZA 3ICZA 4LLSA 5JUZF 1HX9A 1N20A 2Z4ZA 1DI1A 5IL8A 2OA6A 4P0XA 3LJIA 3RMGA 5B01A 2VF6A 3WCEA 2Z4VA 4DXJA 3SDQA 3WCGA 3ICMA 4Q23A 1UBXA 5JA0F 5AELA 4GP1A 4DHDA 5ER8A 1V4HA 3N49F 3VJAA 4F6VA 3WC9A 3N3LF 5E8LA 3VJ8A 1V4EA 5B0LA 2PS5A 2E94A 4LPHF 2ZCSA 5HN8A 3N0GA 2PS7A 2F8CF 2Q58A 2E95A 4KPDA 3WEIA 3WEKA 2E8XA 3V66A 1PS1A 5IMIA 4RNQA 4KK2A 3OACB 3ID0A 3KRCA 4OKZA 4RYPA 5DJVF 3WCIA 2ZY1A 5ILKA 3M9UA 4LOBA 5B0IA 4KQ5A 4LPGF 3PYBA 2F9KF 2Z4WA 3EZ3A 3KROB 1HM4A 1UBVA 5B00A 3ZCDA 4NFIF 2PS8A 3NPRA 4EA1A 3TFNA 3PKOA 5I1UA 5IMPA 5EATA 4RXCA 4NG6A 2AETA 3WEJA 2E8WA 2J1PA 5ILZA 5IK0A 5HN7A 2Z4YA 5B02A 1V4IA 3VJEA 1RTRA 1KIZA 5JV1F 3TC1A 4PVYF 3SAEA 4MC0A 4NUAA 4HD1A 3LK5A 1YYUA 2FORA 4H5DF 3RYEA 2J5CA 1RQJA 3M02A 3SDUA 3LZ9A 1VG4A 3WJOA 3Q2QA 5IK6A 1HXCA 3AQBB 3N0FA 3S4JA 1YYSA 3P41A 4E9ZA 5ILYA 4LFEA 2OPNA 5IN8A 3OABB 1VG2A 4QPFA 1YYTA 5C05A 2ZCQA 4DWGA 3KRCB 5E8KA 2Z7HA 1RQIA 5JV2F 5A0KA 3CC9A 2P1CA 4LFGA 4KKMA 4LTVA 3CKEA 3LG5A 4LIXA 5DIQF 3ZMCA 2ZEUA 1N21A 1WKZA 2Q9ZA 3N1VF 1V4KA 3EGTA 3Q1OA 3P8RA 3WJNA 3WCBA 5A0JA 4KVYA 1N23A 3V1VA 1ZW5A 4DEMF 2Z52A 3LDWA 1YQ7A 4MC8A 1HXGA 5EASA 3EFQA 2PS6A 3KRFA 5B0JA 1VG6A 3N45F 3MZVA 3LVSA 5DHIA 3MAVA 4JXYA 2Z50A 5EAUA 2AZLA 5DZ2A 3NPKA 5HNAA 4WK5A 2AEKA 4LA5A 1YJ4A 5IM1A 4JYXA 5ERNA 3V1XA 5ILJA 2OPMA 2DH4A 3AQCB 5IKHA 1YV5A 2ZCRA 2ZEVA 2ONHA 4PVXF 3VJ9A 3B7LA 4EA0A 3LOMA 5DGSF 1KIYA 2RAHA 3P8LA 3KRAB 4NKFA 2Q80A 4LZ0A 2O1OA 3WCLA 3WCHA 3WEGA 3WSBA 5ILIA 1WL2A 3LEEA 4JVJF 4F62A 2AZJA 4K10A 4ZQ8A 4KUXA 5B0MA 5DGMF 3SDTA 1N1ZA 3N5HF 4LUUA 4E1EA 4QXSF 3UCAA 3NF2A 1FPSA 5AYPA 3PDEA 5B03A 4KFAA 3AQ0A 4N1ZF 3CP6A 2E91A 2AZKA 3TFPA 1JFAA 2J1OA 3VJCA 3PH7A 4KPJA 5CG5A 3LLWA 5EROA 2E90A 4EA2A 3WEFA 1VG7A 5H9DA 3M00A 2ONGA 1WL1A 3P5RA 3RBMA 4E9UA 3LSNA 3P5PA 5CG6A 4KVDA 4H5CF 3N3DA 2Z7IA 3WCCA 2F92F 3Q30A 5E8HA 4LZ3A 1WL3A 4KQSA 3OACA 4L2XF 3KRFB 2AELA 5AFXA 3LMDA 4LA6A 3DYHA 3OYRA 4OKMA 4LZCA 1YHMA 3LGKA 2F94F 3DYFA 4UMJA
chains in the Genus database with same CATH topology
3IBAA 4RXAA 3ASXA 1YHKA 1JFGA 3WCJA 3SDVA 3WEHA 3N1WF 1EZFA 3G4FA 3LGZB 2E8VA 4N9UA 3RYWA 4NFJF 3WCMA 3M0GA 4FP4A 5DGNF 1YYQA 1DGPA 3N5JF 1N24A 4GP2A 4NFKF 4KVIA 3ZMBA 4LTZA 3KRPA 2E8UA 4XQRF 4DWBA 3KBKA 2PS4A 3DYGA 2Z4XA 2ZCOA 3WCAA 3Q2ZA 3NRIA 3VJDA 2F7MF 3TS7A 4XQSF 2Z78A 4DZWA 2EWGA 5HN9A 3ICKA 2E92A 4MC3A 4OMGA 5IKAA 3WJKA 3OABA 1WMWA 4RXEA 1V4JA 5A0IA 2FTZA 3ACXA 4KQUA 2H8OA 1N1BA 1WL0A 3IPIA 4P0VA 4P0WA 4H5EF 4DI5A 5B0KA 3M01A 5DJPF 5IL3A 5IMNA 1UBWA 5IVGA 3WE9A 3WCFA 3ADZA 3ZOUA 4RXDA 5DHKA 4F6XA 4OGUA 1UBYA 3QQVA 5DJRF 5ERMA 3WCDA 5IK9A 3G4DA 4JZBA 4LFVF 4LLTA 2I19A 4XQTF 3ACYA 2E93A 1YHLA 4KWDA 2Q9YA 2QISA 5DW7A 4JZXA 3KRPB 1N22A 2F8ZF 1WY0A 1VG3A 3S9VA 3ZL6A 5ILHA 4NKEA 3TFVA 3PYAA 3VJBA 4FJQA 3AE0A 3SDRA 3WSAA 2F89F 3BNYA 4GAXA 3ACWA 1HM7A 4OMHA 4JXNA 3KB9A 3W7FA 3KROA 3N6KF 5KSXF 5ILDA 2OGDA 1HXAA 3KRAA 5AHUB 4LXWA 2E8TA 4GA3A 2E4OA 3BNXA 3N46F 1YYRA 3QKCA 3ICNA 4KVWA 5JV0F 3APZA 3ICZA 4LLSA 5JUZF 1HX9A 1N20A 2Z4ZA 1DI1A 5IL8A 2OA6A 4P0XA 3LJIA 3RMGA 5B01A 2VF6A 3WCEA 2Z4VA 4DXJA 3SDQA 3WCGA 3ICMA 4Q23A 1UBXA 5JA0F 5AELA 4GP1A 4DHDA 5ER8A 1V4HA 3N49F 3VJAA 4F6VA 3WC9A 3N3LF 5E8LA 3VJ8A 1V4EA 5B0LA 2PS5A 2E94A 4LPHF 2ZCSA 5HN8A 3N0GA 2PS7A 2F8CF 2Q58A 2E95A 4KPDA 3WEIA 3WEKA 2E8XA 3V66A 1PS1A 5IMIA 4RNQA 4KK2A 3OACB 3ID0A 3KRCA 4OKZA 4RYPA 5DJVF 3WCIA 2ZY1A 5ILKA 3M9UA 4LOBA 5B0IA 4KQ5A 4LPGF 3PYBA 2F9KF 2Z4WA 3EZ3A 3KROB 1HM4A 1UBVA 5B00A 3ZCDA 4NFIF 2PS8A 3NPRA 4EA1A 3TFNA 3PKOA 5I1UA 5IMPA 5EATA 4RXCA 4NG6A 2AETA 3WEJA 2E8WA 2J1PA 5ILZA 5IK0A 5HN7A 2Z4YA 5B02A 1V4IA 3VJEA 1RTRA 1KIZA 5JV1F 3TC1A 4PVYF 3SAEA 4MC0A 4NUAA 4HD1A 3LK5A 1YYUA 2FORA 4H5DF 3RYEA 2J5CA 1RQJA 3M02A 3SDUA 3LZ9A 1VG4A 3WJOA 3Q2QA 5IK6A 1HXCA 3AQBB 3N0FA 3S4JA 1YYSA 3P41A 4E9ZA 5ILYA 4LFEA 2OPNA 5IN8A 3OABB 1VG2A 4QPFA 1YYTA 5C05A 2ZCQA 4DWGA 3KRCB 5E8KA 2Z7HA 1RQIA 5JV2F 5A0KA 3CC9A 2P1CA 4LFGA 4KKMA 4LTVA 3CKEA 3LG5A 4LIXA 5DIQF 3ZMCA 2ZEUA 1N21A 1WKZA 2Q9ZA 3N1VF 1V4KA 3EGTA 3Q1OA 3P8RA 3WJNA 3WCBA 5A0JA 4KVYA 1N23A 3V1VA 1ZW5A 4DEMF 2Z52A 3LDWA 1YQ7A 4MC8A 1HXGA 5EASA 3EFQA 2PS6A 3KRFA 5B0JA 1VG6A 3N45F 3MZVA 3LVSA 5DHIA 3MAVA 4JXYA 2Z50A 5EAUA 2AZLA 5DZ2A 3NPKA 5HNAA 4WK5A 2AEKA 4LA5A 1YJ4A 5IM1A 4JYXA 5ERNA 3V1XA 5ILJA 2OPMA 2DH4A 3AQCB 5IKHA 1YV5A 2ZCRA 2ZEVA 2ONHA 4PVXF 3VJ9A 3B7LA 4EA0A 3LOMA 5DGSF 1KIYA 2RAHA 3P8LA 3KRAB 4NKFA 2Q80A 4LZ0A 2O1OA 3WCLA 3WCHA 3WEGA 3WSBA 5ILIA 1WL2A 3LEEA 4JVJF 4F62A 2AZJA 4K10A 4ZQ8A 4KUXA 5B0MA 5DGMF 3SDTA 1N1ZA 3N5HF 4LUUA 4E1EA 4QXSF 3UCAA 3NF2A 1FPSA 5AYPA 3PDEA 5B03A 4KFAA 3AQ0A 4N1ZF 3CP6A 2E91A 2AZKA 3TFPA 1JFAA 2J1OA 3VJCA 3PH7A 4KPJA 5CG5A 3LLWA 5EROA 2E90A 4EA2A 3WEFA 1VG7A 5H9DA 3M00A 2ONGA 1WL1A 3P5RA 3RBMA 4E9UA 3LSNA 3P5PA 5CG6A 4KVDA 4H5CF 3N3DA 2Z7IA 3WCCA 2F92F 3Q30A 5E8HA 4LZ3A 1WL3A 4KQSA 3OACA 4L2XF 3KRFB 2AELA 5AFXA 3LMDA 4LA6A 3DYHA 3OYRA 4OKMA 4LZCA 1YHMA 3LGKA 2F94F 3DYFA 4UMJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IBA A;  4RXA A;  3ASX A;  1YHK A;  1JFG A;  3WCJ A;  3SDV A;  3WEH A;  3N1W F;  1EZF A;  3G4F A;  3LGZ B;  2E8V A;  4N9U A;  3RYW A;  4NFJ F;  3WCM A;  3M0G A;  4FP4 A;  5DGN F;  1YYQ A;  1DGP A;  3N5J F;  1N24 A;  4GP2 A;  4NFK F;  4KVI A;  3ZMB A;  4LTZ A;  3KRP A;  2E8U A;  4XQR F;  4DWB A;  3KBK A;  2PS4 A;  3DYG A;  2Z4X A;  2ZCO A;  3WCA A;  3Q2Z A;  3NRI A;  3VJD A;  2F7M F;  3TS7 A;  4XQS F;  2Z78 A;  4DZW A;  2EWG A;  5HN9 A;  3ICK A;  2E92 A;  4MC3 A;  4OMG A;  5IKA A;  3WJK A;  3OAB A;  1WMW A;  4RXE A;  1V4J A;  5A0I A;  2FTZ A;  3ACX A;  4KQU A;  2H8O A;  1N1B A;  1WL0 A;  3IPI A;  4P0V A;  4P0W A;  4H5E F;  4DI5 A;  5B0K A;  3M01 A;  5DJP F;  5IL3 A;  5IMN A;  1UBW A;  5IVG A;  3WE9 A;  3WCF A;  3ADZ A;  3ZOU A;  4RXD A;  5DHK A;  4F6X A;  4OGU A;  1UBY A;  3QQV A;  5DJR F;  5ERM A;  3WCD A;  5IK9 A;  3G4D A;  4JZB A;  4LFV F;  4LLT A;  2I19 A;  4XQT F;  3ACY A;  2E93 A;  1YHL A;  4KWD A;  2Q9Y A;  2QIS A;  5DW7 A;  4JZX A;  3KRP B;  1N22 A;  2F8Z F;  1WY0 A;  1VG3 A;  3S9V A;  3ZL6 A;  5ILH A;  4NKE A;  3TFV A;  3PYA A;  3VJB A;  4FJQ A;  3AE0 A;  3SDR A;  3WSA A;  2F89 F;  3BNY A;  4GAX A;  3ACW A;  1HM7 A;  4OMH A;  4JXN A;  3KB9 A;  3W7F A;  3KRO A;  3N6K F;  5KSX F;  5ILD A;  2OGD A;  1HXA A;  3KRA A;  5AHU B;  4LXW A;  2E8T A;  4GA3 A;  2E4O A;  3BNX A;  3N46 F;  1YYR A;  3QKC A;  3ICN A;  4KVW A;  5JV0 F;  3APZ A;  3ICZ A;  4LLS A;  5JUZ F;  1HX9 A;  1N20 A;  2Z4Z A;  1DI1 A;  5IL8 A;  2OA6 A;  4P0X A;  3LJI A;  3RMG A;  5B01 A;  2VF6 A;  3WCE A;  2Z4V A;  4DXJ A;  3SDQ A;  3WCG A;  3ICM A;  4Q23 A;  1UBX A;  5JA0 F;  5AEL A;  4GP1 A;  4DHD A;  5ER8 A;  1V4H A;  3N49 F;  3VJA A;  4F6V A;  3WC9 A;  3N3L F;  5E8L A;  3VJ8 A;  1V4E A;  5B0L A;  2PS5 A;  2E94 A;  4LPH F;  2ZCS A;  5HN8 A;  3N0G A;  2PS7 A;  2F8C F;  2Q58 A;  2E95 A;  4KPD A;  3WEI A;  3WEK A;  2E8X A;  3V66 A;  1PS1 A;  5IMI A;  4RNQ A;  4KK2 A;  3OAC B;  3ID0 A;  3KRC A;  4OKZ A;  4RYP A;  5DJV F;  3WCI A;  2ZY1 A;  5ILK A;  3M9U A;  4LOB A;  5B0I A;  4KQ5 A;  4LPG F;  3PYB A;  2F9K F;  2Z4W A;  3EZ3 A;  3KRO B;  1HM4 A;  1UBV A;  5B00 A;  3ZCD A;  4NFI F;  2PS8 A;  3NPR A;  4EA1 A;  3TFN A;  3PKO A;  5I1U A;  5IMP A;  5EAT A;  4RXC A;  4NG6 A;  2AET A;  3WEJ A;  2E8W A;  2J1P A;  5ILZ A;  5IK0 A;  5HN7 A;  2Z4Y A;  5B02 A;  1V4I A;  3VJE A;  1RTR A;  1KIZ A;  5JV1 F;  3TC1 A;  4PVY F;  3SAE A;  4MC0 A;  4NUA A;  4HD1 A;  3LK5 A;  1YYU A;  2FOR A;  4H5D F;  3RYE A;  2J5C A;  1RQJ A;  3M02 A;  3SDU A;  3LZ9 A;  1VG4 A;  3WJO A;  3Q2Q A;  5IK6 A;  1HXC A;  3AQB B;  3N0F A;  3S4J A;  1YYS A;  3P41 A;  4E9Z A;  5ILY A;  4LFE A;  2OPN A;  5IN8 A;  3OAB B;  1VG2 A;  4QPF A;  1YYT A;  5C05 A;  2ZCQ A;  4DWG A;  3KRC B;  5E8K A;  2Z7H A;  1RQI A;  5JV2 F;  5A0K A;  3CC9 A;  2P1C A;  4LFG A;  4KKM A;  4LTV A;  3CKE A;  3LG5 A;  4LIX A;  5DIQ F;  3ZMC A;  2ZEU A;  1N21 A;  1WKZ A;  2Q9Z A;  3N1V F;  1V4K A;  3EGT A;  3Q1O A;  3P8R A;  3WJN A;  3WCB A;  5A0J A;  4KVY A;  1N23 A;  3V1V A;  1ZW5 A;  4DEM F;  2Z52 A;  3LDW A;  1YQ7 A;  4MC8 A;  1HXG A;  5EAS A;  3EFQ A;  2PS6 A;  3KRF A;  5B0J A;  1VG6 A;  3N45 F;  3MZV A;  3LVS A;  5DHI A;  3MAV A;  4JXY A;  2Z50 A;  5EAU A;  2AZL A;  5DZ2 A;  3NPK A;  5HNA A;  4WK5 A;  2AEK A;  4LA5 A;  1YJ4 A;  5IM1 A;  4JYX A;  5ERN A;  3V1X A;  5ILJ A;  2OPM A;  2DH4 A;  3AQC B;  5IKH A;  1YV5 A;  2ZCR A;  2ZEV A;  2ONH A;  4PVX F;  3VJ9 A;  3B7L A;  4EA0 A;  3LOM A;  5DGS F;  1KIY A;  2RAH A;  3P8L A;  3KRA B;  4NKF A;  2Q80 A;  4LZ0 A;  2O1O A;  3WCL A;  3WCH A;  3WEG A;  3WSB A;  5ILI A;  1WL2 A;  3LEE A;  4JVJ F;  4F62 A;  2AZJ A;  4K10 A;  4ZQ8 A;  4KUX A;  5B0M A;  5DGM F;  3SDT A;  1N1Z A;  3N5H F;  4LUU A;  4E1E A;  4QXS F;  3UCA A;  3NF2 A;  1FPS A;  5AYP A;  3PDE A;  5B03 A;  4KFA A;  3AQ0 A;  4N1Z F;  3CP6 A;  2E91 A;  2AZK A;  3TFP A;  1JFA A;  2J1O A;  3VJC A;  3PH7 A;  4KPJ A;  5CG5 A;  3LLW A;  5ERO A;  2E90 A;  4EA2 A;  3WEF A;  1VG7 A;  5H9D A;  3M00 A;  2ONG A;  1WL1 A;  3P5R A;  3RBM A;  4E9U A;  3LSN A;  3P5P A;  5CG6 A;  4KVD A;  4H5C F;  3N3D A;  2Z7I A;  3WCC A;  2F92 F;  3Q30 A;  5E8H A;  4LZ3 A;  1WL3 A;  4KQS A;  3OAC A;  4L2X F;  3KRF B;  2AEL A;  5AFX A;  3LMD A;  4LA6 A;  3DYH A;  3OYR A;  4OKM A;  4LZC A;  1YHM A;  3LGK A;  2F94 F;  3DYF A;  4UMJ A; 
#chains in the Genus database with same CATH topology
 3IBA A;  4RXA A;  3ASX A;  1YHK A;  1JFG A;  3WCJ A;  3SDV A;  3WEH A;  3N1W F;  1EZF A;  3G4F A;  3LGZ B;  2E8V A;  4N9U A;  3RYW A;  4NFJ F;  3WCM A;  3M0G A;  4FP4 A;  5DGN F;  1YYQ A;  1DGP A;  3N5J F;  1N24 A;  4GP2 A;  4NFK F;  4KVI A;  3ZMB A;  4LTZ A;  3KRP A;  2E8U A;  4XQR F;  4DWB A;  3KBK A;  2PS4 A;  3DYG A;  2Z4X A;  2ZCO A;  3WCA A;  3Q2Z A;  3NRI A;  3VJD A;  2F7M F;  3TS7 A;  4XQS F;  2Z78 A;  4DZW A;  2EWG A;  5HN9 A;  3ICK A;  2E92 A;  4MC3 A;  4OMG A;  5IKA A;  3WJK A;  3OAB A;  1WMW A;  4RXE A;  1V4J A;  5A0I A;  2FTZ A;  3ACX A;  4KQU A;  2H8O A;  1N1B A;  1WL0 A;  3IPI A;  4P0V A;  4P0W A;  4H5E F;  4DI5 A;  5B0K A;  3M01 A;  5DJP F;  5IL3 A;  5IMN A;  1UBW A;  5IVG A;  3WE9 A;  3WCF A;  3ADZ A;  3ZOU A;  4RXD A;  5DHK A;  4F6X A;  4OGU A;  1UBY A;  3QQV A;  5DJR F;  5ERM A;  3WCD A;  5IK9 A;  3G4D A;  4JZB A;  4LFV F;  4LLT A;  2I19 A;  4XQT F;  3ACY A;  2E93 A;  1YHL A;  4KWD A;  2Q9Y A;  2QIS A;  5DW7 A;  4JZX A;  3KRP B;  1N22 A;  2F8Z F;  1WY0 A;  1VG3 A;  3S9V A;  3ZL6 A;  5ILH A;  4NKE A;  3TFV A;  3PYA A;  3VJB A;  4FJQ A;  3AE0 A;  3SDR A;  3WSA A;  2F89 F;  3BNY A;  4GAX A;  3ACW A;  1HM7 A;  4OMH A;  4JXN A;  3KB9 A;  3W7F A;  3KRO A;  3N6K F;  5KSX F;  5ILD A;  2OGD A;  1HXA A;  3KRA A;  5AHU B;  4LXW A;  2E8T A;  4GA3 A;  2E4O A;  3BNX A;  3N46 F;  1YYR A;  3QKC A;  3ICN A;  4KVW A;  5JV0 F;  3APZ A;  3ICZ A;  4LLS A;  5JUZ F;  1HX9 A;  1N20 A;  2Z4Z A;  1DI1 A;  5IL8 A;  2OA6 A;  4P0X A;  3LJI A;  3RMG A;  5B01 A;  2VF6 A;  3WCE A;  2Z4V A;  4DXJ A;  3SDQ A;  3WCG A;  3ICM A;  4Q23 A;  1UBX A;  5JA0 F;  5AEL A;  4GP1 A;  4DHD A;  5ER8 A;  1V4H A;  3N49 F;  3VJA A;  4F6V A;  3WC9 A;  3N3L F;  5E8L A;  3VJ8 A;  1V4E A;  5B0L A;  2PS5 A;  2E94 A;  4LPH F;  2ZCS A;  5HN8 A;  3N0G A;  2PS7 A;  2F8C F;  2Q58 A;  2E95 A;  4KPD A;  3WEI A;  3WEK A;  2E8X A;  3V66 A;  1PS1 A;  5IMI A;  4RNQ A;  4KK2 A;  3OAC B;  3ID0 A;  3KRC A;  4OKZ A;  4RYP A;  5DJV F;  3WCI A;  2ZY1 A;  5ILK A;  3M9U A;  4LOB A;  5B0I A;  4KQ5 A;  4LPG F;  3PYB A;  2F9K F;  2Z4W A;  3EZ3 A;  3KRO B;  1HM4 A;  1UBV A;  5B00 A;  3ZCD A;  4NFI F;  2PS8 A;  3NPR A;  4EA1 A;  3TFN A;  3PKO A;  5I1U A;  5IMP A;  5EAT A;  4RXC A;  4NG6 A;  2AET A;  3WEJ A;  2E8W A;  2J1P A;  5ILZ A;  5IK0 A;  5HN7 A;  2Z4Y A;  5B02 A;  1V4I A;  3VJE A;  1RTR A;  1KIZ A;  5JV1 F;  3TC1 A;  4PVY F;  3SAE A;  4MC0 A;  4NUA A;  4HD1 A;  3LK5 A;  1YYU A;  2FOR A;  4H5D F;  3RYE A;  2J5C A;  1RQJ A;  3M02 A;  3SDU A;  3LZ9 A;  1VG4 A;  3WJO A;  3Q2Q A;  5IK6 A;  1HXC A;  3AQB B;  3N0F A;  3S4J A;  1YYS A;  3P41 A;  4E9Z A;  5ILY A;  4LFE A;  2OPN A;  5IN8 A;  3OAB B;  1VG2 A;  4QPF A;  1YYT A;  5C05 A;  2ZCQ A;  4DWG A;  3KRC B;  5E8K A;  2Z7H A;  1RQI A;  5JV2 F;  5A0K A;  3CC9 A;  2P1C A;  4LFG A;  4KKM A;  4LTV A;  3CKE A;  3LG5 A;  4LIX A;  5DIQ F;  3ZMC A;  2ZEU A;  1N21 A;  1WKZ A;  2Q9Z A;  3N1V F;  1V4K A;  3EGT A;  3Q1O A;  3P8R A;  3WJN A;  3WCB A;  5A0J A;  4KVY A;  1N23 A;  3V1V A;  1ZW5 A;  4DEM F;  2Z52 A;  3LDW A;  1YQ7 A;  4MC8 A;  1HXG A;  5EAS A;  3EFQ A;  2PS6 A;  3KRF A;  5B0J A;  1VG6 A;  3N45 F;  3MZV A;  3LVS A;  5DHI A;  3MAV A;  4JXY A;  2Z50 A;  5EAU A;  2AZL A;  5DZ2 A;  3NPK A;  5HNA A;  4WK5 A;  2AEK A;  4LA5 A;  1YJ4 A;  5IM1 A;  4JYX A;  5ERN A;  3V1X A;  5ILJ A;  2OPM A;  2DH4 A;  3AQC B;  5IKH A;  1YV5 A;  2ZCR A;  2ZEV A;  2ONH A;  4PVX F;  3VJ9 A;  3B7L A;  4EA0 A;  3LOM A;  5DGS F;  1KIY A;  2RAH A;  3P8L A;  3KRA B;  4NKF A;  2Q80 A;  4LZ0 A;  2O1O A;  3WCL A;  3WCH A;  3WEG A;  3WSB A;  5ILI A;  1WL2 A;  3LEE A;  4JVJ F;  4F62 A;  2AZJ A;  4K10 A;  4ZQ8 A;  4KUX A;  5B0M A;  5DGM F;  3SDT A;  1N1Z A;  3N5H F;  4LUU A;  4E1E A;  4QXS F;  3UCA A;  3NF2 A;  1FPS A;  5AYP A;  3PDE A;  5B03 A;  4KFA A;  3AQ0 A;  4N1Z F;  3CP6 A;  2E91 A;  2AZK A;  3TFP A;  1JFA A;  2J1O A;  3VJC A;  3PH7 A;  4KPJ A;  5CG5 A;  3LLW A;  5ERO A;  2E90 A;  4EA2 A;  3WEF A;  1VG7 A;  5H9D A;  3M00 A;  2ONG A;  1WL1 A;  3P5R A;  3RBM A;  4E9U A;  3LSN A;  3P5P A;  5CG6 A;  4KVD A;  4H5C F;  3N3D A;  2Z7I A;  3WCC A;  2F92 F;  3Q30 A;  5E8H A;  4LZ3 A;  1WL3 A;  4KQS A;  3OAC A;  4L2X F;  3KRF B;  2AEL A;  5AFX A;  3LMD A;  4LA6 A;  3DYH A;  3OYR A;  4OKM A;  4LZC A;  1YHM A;  3LGK A;  2F94 F;  3DYF A;  4UMJ A; 
#chains in the Genus database with same CATH homology
 3IBA A;  4RXA A;  3ASX A;  1YHK A;  1JFG A;  3WCJ A;  3SDV A;  3WEH A;  3N1W F;  1EZF A;  3G4F A;  3LGZ B;  2E8V A;  4N9U A;  3RYW A;  4NFJ F;  3WCM A;  3M0G A;  4FP4 A;  5DGN F;  1YYQ A;  1DGP A;  3N5J F;  1N24 A;  4GP2 A;  4NFK F;  4KVI A;  3ZMB A;  4LTZ A;  3KRP A;  2E8U A;  4XQR F;  4DWB A;  3KBK A;  2PS4 A;  3DYG A;  2Z4X A;  2ZCO A;  3WCA A;  3Q2Z A;  3NRI A;  3VJD A;  2F7M F;  3TS7 A;  4XQS F;  2Z78 A;  4DZW A;  2EWG A;  5HN9 A;  3ICK A;  2E92 A;  4MC3 A;  4OMG A;  5IKA A;  3WJK A;  3OAB A;  1WMW A;  4RXE A;  1V4J A;  5A0I A;  2FTZ A;  3ACX A;  4KQU A;  2H8O A;  1N1B A;  1WL0 A;  3IPI A;  4P0V A;  4P0W A;  4H5E F;  4DI5 A;  5B0K A;  3M01 A;  5DJP F;  5IL3 A;  5IMN A;  1UBW A;  5IVG A;  3WE9 A;  3WCF A;  3ADZ A;  3ZOU A;  4RXD A;  5DHK A;  4F6X A;  4OGU A;  1UBY A;  3QQV A;  5DJR F;  5ERM A;  3WCD A;  5IK9 A;  3G4D A;  4JZB A;  4LFV F;  4LLT A;  2I19 A;  4XQT F;  3ACY A;  2E93 A;  1YHL A;  4KWD A;  2Q9Y A;  2QIS A;  5DW7 A;  4JZX A;  3KRP B;  1N22 A;  2F8Z F;  1WY0 A;  1VG3 A;  3S9V A;  3ZL6 A;  5ILH A;  4NKE A;  3TFV A;  3PYA A;  3VJB A;  4FJQ A;  3AE0 A;  3SDR A;  3WSA A;  2F89 F;  3BNY A;  4GAX A;  3ACW A;  1HM7 A;  4OMH A;  4JXN A;  3KB9 A;  3W7F A;  3KRO A;  3N6K F;  5KSX F;  5ILD A;  2OGD A;  1HXA A;  3KRA A;  5AHU B;  4LXW A;  2E8T A;  4GA3 A;  2E4O A;  3BNX A;  3N46 F;  1YYR A;  3QKC A;  3ICN A;  4KVW A;  5JV0 F;  3APZ A;  3ICZ A;  4LLS A;  5JUZ F;  1HX9 A;  1N20 A;  2Z4Z A;  1DI1 A;  5IL8 A;  2OA6 A;  4P0X A;  3LJI A;  3RMG A;  5B01 A;  2VF6 A;  3WCE A;  2Z4V A;  4DXJ A;  3SDQ A;  3WCG A;  3ICM A;  4Q23 A;  1UBX A;  5JA0 F;  5AEL A;  4GP1 A;  4DHD A;  5ER8 A;  1V4H A;  3N49 F;  3VJA A;  4F6V A;  3WC9 A;  3N3L F;  5E8L A;  3VJ8 A;  1V4E A;  5B0L A;  2PS5 A;  2E94 A;  4LPH F;  2ZCS A;  5HN8 A;  3N0G A;  2PS7 A;  2F8C F;  2Q58 A;  2E95 A;  4KPD A;  3WEI A;  3WEK A;  2E8X A;  3V66 A;  1PS1 A;  5IMI A;  4RNQ A;  4KK2 A;  3OAC B;  3ID0 A;  3KRC A;  4OKZ A;  4RYP A;  5DJV F;  3WCI A;  2ZY1 A;  5ILK A;  3M9U A;  4LOB A;  5B0I A;  4KQ5 A;  4LPG F;  3PYB A;  2F9K F;  2Z4W A;  3EZ3 A;  3KRO B;  1HM4 A;  1UBV A;  5B00 A;  3ZCD A;  4NFI F;  2PS8 A;  3NPR A;  4EA1 A;  3TFN A;  3PKO A;  5I1U A;  5IMP A;  5EAT A;  4RXC A;  4NG6 A;  2AET A;  3WEJ A;  2E8W A;  2J1P A;  5ILZ A;  5IK0 A;  5HN7 A;  2Z4Y A;  5B02 A;  1V4I A;  3VJE A;  1RTR A;  1KIZ A;  5JV1 F;  3TC1 A;  4PVY F;  3SAE A;  4MC0 A;  4NUA A;  4HD1 A;  3LK5 A;  1YYU A;  2FOR A;  4H5D F;  3RYE A;  2J5C A;  1RQJ A;  3M02 A;  3SDU A;  3LZ9 A;  1VG4 A;  3WJO A;  3Q2Q A;  5IK6 A;  1HXC A;  3AQB B;  3N0F A;  3S4J A;  1YYS A;  3P41 A;  4E9Z A;  5ILY A;  4LFE A;  2OPN A;  5IN8 A;  3OAB B;  1VG2 A;  4QPF A;  1YYT A;  5C05 A;  2ZCQ A;  4DWG A;  3KRC B;  5E8K A;  2Z7H A;  1RQI A;  5JV2 F;  5A0K A;  3CC9 A;  2P1C A;  4LFG A;  4KKM A;  4LTV A;  3CKE A;  3LG5 A;  4LIX A;  5DIQ F;  3ZMC A;  2ZEU A;  1N21 A;  1WKZ A;  2Q9Z A;  3N1V F;  1V4K A;  3EGT A;  3Q1O A;  3P8R A;  3WJN A;  3WCB A;  5A0J A;  4KVY A;  1N23 A;  3V1V A;  1ZW5 A;  4DEM F;  2Z52 A;  3LDW A;  1YQ7 A;  4MC8 A;  1HXG A;  5EAS A;  3EFQ A;  2PS6 A;  3KRF A;  5B0J A;  1VG6 A;  3N45 F;  3MZV A;  3LVS A;  5DHI A;  3MAV A;  4JXY A;  2Z50 A;  5EAU A;  2AZL A;  5DZ2 A;  3NPK A;  5HNA A;  4WK5 A;  2AEK A;  4LA5 A;  1YJ4 A;  5IM1 A;  4JYX A;  5ERN A;  3V1X A;  5ILJ A;  2OPM A;  2DH4 A;  3AQC B;  5IKH A;  1YV5 A;  2ZCR A;  2ZEV A;  2ONH A;  4PVX F;  3VJ9 A;  3B7L A;  4EA0 A;  3LOM A;  5DGS F;  1KIY A;  2RAH A;  3P8L A;  3KRA B;  4NKF A;  2Q80 A;  4LZ0 A;  2O1O A;  3WCL A;  3WCH A;  3WEG A;  3WSB A;  5ILI A;  1WL2 A;  3LEE A;  4JVJ F;  4F62 A;  2AZJ A;  4K10 A;  4ZQ8 A;  4KUX A;  5B0M A;  5DGM F;  3SDT A;  1N1Z A;  3N5H F;  4LUU A;  4E1E A;  4QXS F;  3UCA A;  3NF2 A;  1FPS A;  5AYP A;  3PDE A;  5B03 A;  4KFA A;  3AQ0 A;  4N1Z F;  3CP6 A;  2E91 A;  2AZK A;  3TFP A;  1JFA A;  2J1O A;  3VJC A;  3PH7 A;  4KPJ A;  5CG5 A;  3LLW A;  5ERO A;  2E90 A;  4EA2 A;  3WEF A;  1VG7 A;  5H9D A;  3M00 A;  2ONG A;  1WL1 A;  3P5R A;  3RBM A;  4E9U A;  3LSN A;  3P5P A;  5CG6 A;  4KVD A;  4H5C F;  3N3D A;  2Z7I A;  3WCC A;  2F92 F;  3Q30 A;  5E8H A;  4LZ3 A;  1WL3 A;  4KQS A;  3OAC A;  4L2X F;  3KRF B;  2AEL A;  5AFX A;  3LMD A;  4LA6 A;  3DYH A;  3OYR A;  4OKM A;  4LZC A;  1YHM A;  3LGK A;  2F94 F;  3DYF A;  4UMJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...