3BOVA

Crystal structure of the receptor binding domain of mouse pd-l2
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
104
structure length
104
Chain Sequence
LFTVTAPKEVYTVDVGSSVSLECDFDRRECTELEGIRASLQKVENDTSLQSERATLLEEQLPLGKALFHIPSVQVRDSGQYRCLVICGAAWDYKYLTVKVKASY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the complex between programmed death-1 (PD-1) and its ligand PD-L2.
pubmed doi rcsb
molecule keywords Programmed cell death 1 ligand 2
source organism Mus musculus
molecule tags Immune system
total genus 23
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2007-12-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bovA00
5C3TA 2NX5A 1DQLL 2N1KA 4E5XB 1TQCC 1GHFL 5K9QG 3PGCA 3ZYOA 1HYSC 3QXUA 1SMAA 4ONGH 3U46A 4XNYL 2YUVA 1VGKA 5HHOD 4TOYH 3LEYH 3KPQA 4GT7A 5B8CA 4NWUH 3B9EA 2AW2A 5C86A 3NCJH 3PWPB 1I8LC 2D7PA 2JK5B 3RDTC 3TA3B 3S35L 3F7YA 1V3LA 4WEUD 1ZHNB 3BP7A 1OTTD 5GISL 3TCXA 1JIBA 4K23L 1ZVSA 1K4CA 2WBKA 3QUZD 5C0BE 4OJFL 3F7QA 5CWSA 2NMSA 4XHJC 3RQ3A 4LSPH 4PV8B 3SOBL 3SQBA 3V5KA 1UH2A 3SE4A 4YR6B 4YO0B 4NP4H 4ZAKB 3UTTE 4JHZA 1QA9B 4WUUE 3G6DH 2W91A 4YEEA 3S5LA 5IP4A 4GKSA 2ZJSH 3OKEA 2ADJB 2NYYD 1RZ7H 1BZ7B 4JM2C 4JFQA 4PRBA 4F7TA 2XZQL 4LP4A 1A1MB 2VXSH 2WZPD 4D9QD 4MJ5B 5CMAA 2W0FA 2IPUK 4MA3A 3VRJA 3TF7C 3LN4A 1K6QL 4HUVB 1RULH 3ESVF 3TO4A 1ZEAH 4W70A 3EO1B 1IAOA 4B41A 1G9MC 3LRSA 3U9PH 2FSEA 3EFFA 5J4MA 2J2ZA 3F8UB 1M7XA 1DVFD 3JVGA 4M1CC 1T0MA 1UH4A 5CILL 3GB7B 4MJIB 1TQBB 5HVHC 3QULA 4OBSA 4I48B 3LKRB 3SDXF 4JO3H 2CH8A 3O3AB 5GZND 1D7FA 4L4VB 3H9ZA 5TPWL 3KJ6L 3S97C 1NBZA 3ARPA 1KPRB 1FZMB 4DW2H 1NCUA 1QBML 3EHBD 2QSVA 1KPVA 1KF9B 5D5MB 25C8L 5CP7B 4Y89A 1GOFA 5BW7C 1B0RA 3H6JA 3G6JA 1HCVA 5MEPA 4K8RL 1JP5A 4I1NB 5D70L 4ODWB 4DKEH 2R0KH 3PE9A 3VXRE 1RZFL 3CXHK 3ULVC 1YEFH 2EE6A 1YYML 4KK9D 3MV7E 2VLJA 2DQUH 4HWZA 2VLME 2XN9E 1D5ZB 4PLJC 3S3JA 1F4XH 4NQCD 3STZA 4U2ZA 3ZKSD 4OGZA 4Y4FC 1U8QA 4K7PH 3QXVA 2GJ6D 1A6ZB 4TOYL 3WS3A 1T4KA 2KL6A 2YMXH 3KPRA 4NWUL 2EKSA 1U3HD 1XGPA 4G6FB 3TIDA 4LARH 4YXLL 3TP4A 4H25A 1I8IB 2DWEA 3MRHA 4LCYA 3G5ZB 4GG6E 4LSPL 4LVNC 3CZFB 1Q94B 4TRPH 4DGIH 2PYEA 1L0YA 2YD9A 4XCEB 4QT5B 3WN5A 5EZOH 2RFXB 1DQJA 5FYJE 1IC4H 3MFGB 1RZ7L 1CIDA 1WIUA 3M45A 7FABH 1Z2KA 3THML 5L9DL 1AHWC 5IKCA 3TT1H 3FT2A 3I6KA 1I1FA 4M5YL 2OZ4A 3MYJA 1Z3GL 3JWOC 4XI5D 4HEME 2AKRA 5L2KB 3O3DA 2ESVE 1U8PB 1KXVC 2JIXA 5ICXB 2R2HA 5JPMA 1AR1D 1ZWIA 4BK5A 3WIFB 1OM3L 3NFSH 2VUYA 2MNUA 3FT4B 3UZQA 1QEWB 2JB6B 4M6OH 2HT3D 2DQGH 3QQ9C 4HK0B 4O5LL 2NY0C 5DK3A 1U3ZA 2I27N 2VLJD 2WIMA 4K7PY 1T6VN 4PB0L 2Z35A 4QRRE 4UU9B 1MPAL 2R15A 1NH6A 4XTRC 4HS8H 2P7TB 3VD4A 1KACB 5T1MB 5GZOC 1PBYA 4OIIL 4JVUA 1R5WB 1M1SA 3OKLB 1Q0YH 4LK4A 6FABH 4X7TB 1P4LB 1PG7L 3B9KA 2HTKD 1P4BH 3KPRD 4QYOB 4J23A 1NGQH 3PWVB 2YEZA 1PEZA 3BZEB 3TBTA 3P4LA 4JFEE 4FFVC 4FXGA 4ORGA 1A6TB 1YDPA 2X4UA 3GMRB 2Q86B 5I8EB 2R0KL 4EOWH 1CQYA 3JV4B 5L8JB 3FB8A 1UXWA 1IGFL 1HXMB 1OQXA 4M7JH 5E99H 1YEFL 4UT9L 2R8SL 5JW5A 1ZA3A 2C3XA 2ATKA 1FNLA 2PYED 3TA3C 5MHSE 1DUYB 1RV6X 3TJEL 3V0WL 1KJVB 1R3LA 1F4XL 3IDUA 2G60H 1MH5B 5IT2H 4LSQL 5CSZB 3QNYA 3QDJE 3RTQB 4AYFA 4YXHL 3O4OB 4ZAKC 1BVLA 3V0AC 3HB3C 4Z7VF 3QPQC 4JDZB 1XFPA 2ZUTA 1HH9A 2JIXD 4UT6H 4X83A 4XAKD 3CZJA 2HVKA 4QXUH 1MFDL 2ZKHH 2V7HB 1J1XH 4X8JA 1T6WA 5TFSH 3G5XA 3ILPB 3X17A 2XOTA 3RUGF 1ETZB 5F96L 3EO0B 4TUJB 1FFNA 3OX8A 5EZOL 2G9HB 3DVNB 4J4PD 1WZ1L 1RU9L 4G8IB 5E95B 2EECA 5H94A 1I8MB 3CXDL 3EOYG 4I9WE 2X4TA 1I3RB 1NFDA 3QXAA 1MCFA 1R3HB 2FGZA 1TQBC 3FO1B 4XGZA 4PY8I 3ZHKA 4QRUB 1PYWB 1S9WA 1YEGL 4UOW1 3B9KD 1UB6B 3BP4B 3VGGA 4ENED 1Z5LB 3QIUD 5B38B 4S1QL 5ISZE 4GUPB 4MB4A 4C59B 2XICA 5CS7A 2B8OT 4KI1A 1HI6B 3NFSL 5FGCE 4OGAC 1GZPB 3DXAA 3TPKA 5JMRA 5EORH 2EIEA 1G6RL 1SY6A 3F7YB 1G7JB 3QQNA 1UM4H 3NCEB 4OKDA 4M43H 1ZVSB 3HUJA 4Y4HA 2CMRH 5GGSB 4HS8L 5C0DB 2OL3L 1N6QL 5CZXD 1BJ1J 3L7FB 1RZKC 4R7NA 3KWWA 3MGAA 4R0LB 3KS0H 5GRYA 1JN6A 6FABL 3BMWA 1JPTL 3QWOA 2HKFH 1NGQL 4NQCB 1MHEA 3BWAA 4ZDHA 5IVOA 4GKSB 1MCHA 3EDFA 5JOFB 5FGBA 4CJ1A 3OKEB 3W82A 2GJ6B 5D7LE 2IGFH 4PRBB 4F7TB 4EOWL 4PGEB 1HHIB 5CMAB 3VRJB 2W0FB 1U3HB 4EJ1C 2FCBA 2AI0H 4KK6C 4M7JL 3UZVB 4Z7WF 3HI1B 3WO3B 2DBLL 2PO6A 5HHNA 1IAOB 1SHMA 3AU1A 5C07B 5JO5A 3EFFB 3G04B 1IAIH 4HQQL 3QFJA 3W81A 3L9RA 2G60L 5BQ7A 4OF7A 1Z9OA 5FA4A 1IGYA 4IHOA 4QOKE 4YUEH 2VE6B 4X0KA 3EDEA 4W81A 5CEYA 2HLAB 1NJ9B 4HZAA 3F6LA 2HP4A 3PGDB 1S7XB 4TSCH 1X5IA 4ZFOA 5D2LA 4UT6L 2BP3A 2AGJL 1BIIA 3K3QA 5F70A 4QXUL 2AXFA 2ZKHL 4Q2ZA 4LP5A 4EKXA 5E8NA 3IJSA 1OAYH 1ZOXA 2V9RA 2DQFB 1UZ8B 1WAAE 3G6JB 4FOMA 4YIQA 5GS0D 4JFHE 1CFSA 3RBSA 5M95B 3DHJA 3BN9C 5C0BB 4HSQA 2XQBL 4R4BB 4OZIA 4LHUG 2Y36H 4YHIA 1U8LB 4X4YA 2D7TL 1HXYA 4R96B 3C5SA 3U4EA 2C1PB 4Y5YA 1A7PH 1JF6A 5KG9B 2D9QB 1LP9B 2BVEA 5KSUA 3DUSB 5C9JB 3JSSA 1FL3A 4N9GA 3WS3B 1I1AA 5INCA 2W9EL 3B2UD 2GAZA 2ICWI 2W1NA 5CJBA 2EYRB 3CVHB 4A6YH 1XGPB 1DBKL 2O61B 1UM4L 4N90D 5IMOB 2BHZA 3LB6C 3TIDB 1JK8A 4M43L 3SO5A 5C0RH 4PB9L 2ATPB 4MQ7A 2YPLA 1GGCH 3OPZH 4KV5E 5DURD 5ESVB 3BW9A 4L9LB 4K3JH 3IJHB 3VFTA 1KJ2L 2PYEB 4QHUB 4G8FB 4ODUA 4GKZB 1N5YH 3SGJA 3TT3L 2XZCL 3JV5A 5I1GL 5ACZA 4GFTB 4WI2A 5D1XB 1JMZA 3CDYA 2R2EB 1BVZA 4H0GA 1GPOH 3DROB 4NHUA 5IKCB 1BZ9B 4OB5L 4P5MB 3FT2B 3RTQC 2PW2B 3MYJB 5TF1H 4X6DA 2AKRB 2MKLC 2OI9B 3O4OC 3N85H 4Z7NE 2NYYC 5FCUH 1AQDB 1QO3A 3TZVD 1DUZA 2CRYA 4H1LG 2HVJB 2UWEA 4W4NA 1M71A 3CX5K 3VXRB 4CVZB 3DSNA 4NKMA 1PQZB 3WFHB 4QO1A 3RWHA 1OTSD 4YUEL 4UILH 3DX9A 1NCAL 1S78D 2Z35B 3VFOB 1CCZA 3MRLB 3LZFH 2Y1VA 2FDBP 1AE6L 3I9GL 2EYSB 1K4DA 1R0AH 4YHLH 4CMMA 3PXHA 1I1AD 5EC1B 5BS0E 4IS6A 3QIUB 2KPNA 3NCBB 3AS0A 2MCPL 4NBZB 4RWHA 2H1PH 1FPTL 1G7LB 1XZ0A 3SCMB 1YPZF 1MVFA 3ARQA 3FB8B 1UXWB 4GG6B 2QQNH 3C9NA 1RUML 1UWGL 4XCFH 5L0QB 4ZD3H 5JW5B 1ZA3B 2L4OA 5BXFA 3L3KB 3GSNL 5DD3H 4Y19D 4UT7H 3HS0B 3U0TA 4WFED 2JELH 5L2JA 1S7WB 2APBA 3L3IA 5KS9E 1F8TH 4N5EC 2RHEA 3U0WL 3MRJA 2EDOA 4R0LC 4AMKH 2OJEA 3NIFE 5E8OA 5TE6H 1FVEA 4Q9RH 2I9LA 5HDLA 1KT2B 4DZBA 5A2IH 1BVLB 2ESVB 1P53A 2P8MA 5FYKL 3VFGL 1JGLL 1RJZA 1S3KL 4MNGE 5L6YH 4DTGH 5IGXL 5C0RL 2V7NA 1FH5L 3BP6A 5C7XH 2K7QA 3CPLA 4GAYB 3CFKB 1T3FA 1U3HC 3QCVH 1BGXL 5DRNA 2YPKB 3G08A 3HAEB 5LGJB 1HHHB 1NDMA 3S36X 2GYSA 4GBXB 5E00B 2BC4A 3IDGA 5D7SL 3OX8B 3NFPB 5CKGA 3V6ZB 1EHNA 4Y5VA 1U0QA 4HKZA 5T1DL 1Z0MA 4N5UA 4KZDL 4H20H 4XNXH 3GSVB 1X4ZA 1U93A 4PJFA 5FUCE 1OP3H 5CJOL 1UADC 4N9OB 3QWRA 3WHXB 5KVEH 3BKMH 2YPVH 5IB5B 1HEZB 5D1ZA 5FCUL 1Q9KB 2OTUA 4JFEB 1YECL 1DLHA 4OCRL 1UGNA 3RWFA 3OAUL 2W0PA 3FB7A 4NSKB 5I1KH 1IEBB 3VFSA 3G5VB 4KK8D 4UDUB 5MENA 2Q7YA 3MPCA 1JFQH 1L0QA 5EIQA 4HKXA 1ORSA 4RMSA 2BRRH 4Z77A 2ENSA 4KJYA 2VKXA 1CGUA 1N59B 4NNPH 4TSAH 2AJUH 3HUJB 3FMGL 4KVCH 2PYFA 1OCWL 5DTFA 4X8XA 1R0AL 4GJTB 1AO7E 3HI6L 1KENH 3W2DH 2G5BA 2AJ3A 4N0YH 5SWZE 1IQDB 3BWAB 4P99A 2CLVB 2IWGA 5HYQB 5FKAA 4L3EA 2IQAA 5CEZH 2HTLC 3MROB 4JPVH 2F54E 2MQCA 4NO5A 4P46B 1WWAX 1B4RA 2J4WL 3C6LA 5DD3L 5EU6A 5HHNB 4DJMA 4F7CA 3ULVF 4KQ3H 2EDYA 1WICA 4KWUA 2J8UA 3CFBA 1LDSA 3ARWA 4DOHE 5DURB 4CU8A 1LK2A 1CL7H 1N6VA 3Q3GA 1A3LH 3KLAA 3X3FH 2O93L 4HC1L 4MDJA 4L9LC 1MI5A 4GW1B 4MXWL 3S37H 1LE5B 2DYPA 5FA4B 1P7QB 4AMKL 1IGYB 5TE6L 3EFDL 1L9MA 1BOGB 5CEYB 3QWRD 5MERA 1U91A 5E8DH 1SM3H 5D1XC 3U4AA 5L6YL 4U6YB 5D2LB 1X5FA 3MA7A 4NQDA 2Z0BA 1RZGA 2DQEH 5FGCB 3MGOA 1SJHB 4HX1B 4MJ6A 1ZHBA 3LEVH 3KXFA 4HJGB 5HJ3A 2OI9C 2LABA 3QHFL 2YC1B 3NH7L 2N7AA 5MEND 3QHTC 2VN7A 4G6ML 3TZVB 4MNQD 3LQAC 2DQJL 1TVHB 2OJZL 3P73A 3VCLB 5D4QA 2V2WA 4H20L 4UQ2A 4XNXL 2D4FA 4BFIA 5JMOC 1RIHL 2IANE 3QFDB 2DQTL 3GSRB 5FKPA 1Q9LB 1UFUA 1MCWW 1U8MB 3EAKA 3N1GC 4Y5YB 4J4PC 3BKML 2YPVL 3RIAK 3F12A 2VKWA 5A16B 3VU2A 1I7TA 2HG5B 3PWNA 3QH3B 4L3ED 5A2LH 2HKHL 3KPPB 2GAZB 1KXTB 5I1KL 2DM2A 1F90H 4LPYA 5FM5M 1JFQL 4ENEC 3PP3H 1YEIL 3QIUC 3K8LA 2IBZY 4R26H 2BRRL 1T83C 3DX8B 1KIRA 1WBXB 2FECL 2FJHB 3C6LD 4PJIA 5EU6D 3CIQA 4ZUSA 3MLWH 1B2WH 4MJ4A 1JF5A 5GRUH 3MV8E 3T2NL 3WS6C 3HC4H 5IJVB 3SCMC 3BW9B 5FYKE 3VFTB 3OGCB 5L0QC 4Y19B 4PG9B 1BF8A 3QQ3B 1MI5D 4QOKB 1SEQL 2X9XA 2C3VB 5DRWB 3SE3A 4HCRL 1J5OH 1E0OB 1OAKH 3O8XA 5C0EB 5CZXC 1P9MA 2APFA 4KHTH 12E8H 4YC2B 2Z4QB 1MCOL 4NQDD 4PP2B 3CU7A 1Z9LA 5KANI 3BRDA 4WHYH 3GEWB 4X80L 3V6OA 1VKXB 3KXFD 4WRLA 1DBML 4Z8FH 3HE6D 2E9JA 1IVLA 5I17A 1CL7L 4XPAL 3WKNA 1YEKH 3V0VA 4D9RD 5MEQA 1IC5L 5J1AB 4YAQA 4WW1B 3GSQB 4AT6A 4YNYB 5T1KA 1E28A 4GBXC 2ICES 3ZSSA 5DGRA 4JDTH 3LIZH 3I75A 1BM3H 2XXMB 4Z7QF 3FOLB 1TZIB 3KNBA 3PHQB 5EBLA 1YMHA 5ICYB 1N8ZA 2IFGA 3TV3L 5M94B 4KRMB 1WWCA 5D71H 4IS6B 1OD7A 4U1KB 2RCSH 1I8KB 4FTVA 4K3DH 1FFRA 3JWNC 1FBIL 2AV1A 2OX5A 4CKVX 1JPSH 5JXED 1IT9H 4ODTL 4A6YA 1KCKA 4PJCF 5EBMB 4RAHA 4NNXA 2Z92A 4KUZH 3K0WA 1JGVL 3D48R 4K7PX 2WIIA 5D7IF 3P4NA 3UO1H 5IW1A 2CR3A 3PDOA 1SBBA 4PBVC 2V5TA 3FO2B 1JTPA 3HCVA 3L3IB 4EXKA 4FZ8L 1UJ3B 1U92A 1RUAL 3O8XD 3HZKA 5J7CC 3MUGB 5CIPH 1KGCE 2A6IA 2B0SL 3CFDA 2OJEB 1F90L 1ZANL 1C08A 1M4KA 2Y9RT 4BK4A 4R26L 3CDCA 1A5FL 5D5MF 5EU4A 1B2WL 3B9DA 3OGOE 3IS1X 2VZ1A 1KIQA 2QQLH 3L6FA 1AY1H 1RIVH 1UC6A 3HC4L 4LDEB 4GAGL 1WJ3A 2DQHH 1L6XA 4P46C 5DRNB 3NIGF 1KB9K 3LSOA 3QB7C 3IDGB 1A6VH 1M7IA 3QUXC 5T1KD 3SGEH 1A22B 2F8OA 4PJXE 1A1OA 4UDTB 2YZ8A 1G6RB 3WFZA 1N7ML 4GAJL 2XPGA 4PJFB 3IDMA 3VFRB 1MSPA 3HG1D 4K8RC 5CGMA 1EPFA 3MCKA 4P4RB 3QDGA 3H0TA 2OL3B 5ETUA 3D39E 2VSDA 3HMXL 1T5XB 3IDIA 4F7MB 3MJ8B 4Z8FL 2EZ0C 4M7LT 4F9LA 4Y7MA 1S7VA 1T1YB 1KFAL 5ICZA 1EV2E 3SGKA 2IC2A 2Q7YB 3W39B 1KCRH 3NZHH 4BA8A 1X5XA 1LO0H 3P30L 4MNQB 1NANI 2CK2A 1ORSB 2R4RL 3VE0B 1NAKL 4Z77B 2H9GA 4LPCA 3PL6A 1F58H 3TZVC 1D6VH 4RMWA 3RPIA 2XYCA 1CE6A 4LF3B 2PYFB 3ALXA 4LCUB 2XRAH 2EKJA 3EKCA 4UINH 3UYPA 4JPIA 2R1WB 5ERWA 3O11A 3SJVE 2NY7L 2DQCH 4BQBA 5D71L 4NOFA 4F58H 1CWVA 3WUWB 1Y0LA 3I3EA 3MNZB 2IPTH 5HXMA 1UM6L 4K3DL 3R0MA 4GSDL 2NZIA 5IQ7H 4LAQL 5I1LB 1PEWA 4MNGB 5IJKA 1IT9L 5A2FA 3GMOA 1N0XL 5JR1H 4MHHI 4G80A 4U1JB 2P45B 2J12B 4AIXA 2NY6D 2V2TA 4NO5B 3D85A 5EA0L 4MA7L 4AEIL 3QUMA 2J8UB 5L88H 4M1GL 2Y06L 1DSFH 4H8WH 4LKCA 2XKNB 3D2UD 3VD5A 5D7JB 1FVDA 5KOVC 4P23B 4WGWB 3Q3GB 2D03H 3UCRA 3KLAB 3UTOA 2DDQL 5SWQA 1F3DH 1ND0A 4XBEL 4RAUB 3CFJB 5E2UH 2AJXH 5HHVH 1N5AB 3SDYH 4ZTPL 4PJHE 2EDNA 1T5WA 1N2RA 1H5BB 2QQLL 1AC6A 1AY1L 1RIVL 4YC2C 4HS3B 4R3SB 5GRJH 2VXUL 1ZHBB 3KXFB 2BOBB 2V2XB 3QUYD 4BFEA 3HE6B 2EDEA 4NQXB 3PL6D 2FO4A 2ZUYA 3JV0A 3P73B 4FXKB 1JYVA 1BWMA 4UQ2B 1BFSA 2FX8H 2OXHA 2NNAB 4LLDB 2YD7A 43CAA 3LHPH 5K33A 3RKPA 2NY2D 1TJIL 3DMMA 1RUPL 2GITA 3H42H 5SWZB 1KTDB 4LBEB 2X09A 1OSZB 3ARGB 3PABB 4PRDB 4J3XA 1LDPH 5JNYA 1KJ2B 4CUCA 3EZ8A 4JAMA 3BXNB 3BISA 1OWWA 5FF6B 4PJ5E 4YWGH 2I60H 4I5BA 1NCCH 3G9AB 4HWBH 1FZJA 1WCBB 4LSTL 4RWYH 3QG6B 2AVGA 3D85D 4NC0B 2J6EL 1WZLA 1D6VL 4RGMB 1ONQA 3VFUA 4HWUA 4OZFH 4DOHB 2XRAL 4QF1A 4XCCL 4UINL 4KK8C 3EYSL 3ZE1E 5DMKB 3V5DB 1YMME 4F58L 4PJGA 4LU5H 4LIQE 4K55A 5IQ7L 5K93A 3O8XB 3OJMB 3QI9A 3P9WB 3FQUA 2EE9A 4U3CA 4FQQB 1UJ3C 4EUPA 1YQVH 4XC3H 5JR1L 2WQ8A 2EEBA 3V95A 3GBLA 2CPCA 4DZ8A 4NO0B 2ZCLH 3STBA 3GMMA 4G7YH 4HUXA 3RP1A 5TQ2L 4E0RB 3ARDA 1WIPA 3QQ4A 5L88L 3UPRB 3NABH 2OCFD 2ZUQC 4L8DA 3WFEH 1IEAA 4H8WL 3E2HB 5EZIH 4DVRL 5ENWB 3IAQA 5IB4B 4JQIH 4XVUD 5A2JH 1X6NA 3BVNA 1BREA 1FC1A 2H3NB 5B38G 2EH7H 4YHZH 2IANB 5JXAH 2AJXL 1BQUA 1KCVH 4ODXA 5T1KB 3F5WB 4NUJB 3DMMD 5EBGA 1HH6A 3I75B 2VABB 3BZDA 2Q8AH 4AY0A 1L7TH 2BVQA 2YWYA 3GSNB 5KSAA 3HG1B 1YMHB 1IAKB 4QHMA 2SEBA 5DMIH 3REWA 2YBRA 3SY0B 4JZJA 4X9FA 5EZLB 3WO4B 1X44A 3NCCB 1NAMH 4J3OC 4S0SD 2CSPA 5JDSA 1J0ZA 5IM7B 4I0CC 2PTVA 4RZCA 3T2QA 2FECI 3PQYE 5CEZD 3BDYH 2AV1B 1WC7B 5ID1B 3MV8B 4ZS6D 3E6HB 3RHWF 3S5LG 1B3JA 2FX8L 4NNXB 4X9IA 2Z92B 5IBLD 1A3RH 5HHME 1FZOB 3LHPL 3DVGB 5T33L 5GRWA 2Y72A 4MD0B 1MHCB 2GFBA 1OY3B 3R06B 5IW1B 4KXZI 2EE3A 4F33B 3H42L 1MCEA 3W11C 4F57H 3UTSE 5F7KC 3HCVB 3CDGA 1CG9A 3BGMB 1L6ZA 5DQ9A 4X6EB 4AQOA 1QBAA 5ID0B 4OCXL 4OIBA 2VL5B 1QACA 2YD2A 4RSVA 3QI9D 4YWGL 4C83B 2ZOLB 1CLYL 1NCCL 2ORBH 1C08B 2JJUA 3KHQA 3OJVC 3IYLW 2X4SB 3SKNB 4NCDA 3QCUH 1ADQL 3BX7C 3VGFA 2X1QA 3ARDD 1A9BA 2DTSA 3G6JF 1KIQB 1CL7I 1C8PA 1H3UA 4JRXA 1MLBA 4CL7A 3LSOB 4PJEA 1ERNA 4PGCB 3TYFA 1KJ3L 1VB9A 1WQVT 4ZO7A 5HVFB 4HFWA 5KSBE 1CFNA 5DJCB 3QAZB 5E8PB 3D2UB 1OP5H 3HC3L 4NBYB 5HDQH 2ICEB 5IBUB 5H2BA 5J57B 3T0DA 5EPMA 3K2MC 4U1SA 2EDFA 4U6VH 3V7AE 1WFUA 1P5VA 3UTTA 3T77A 5D7JC 5J0BA 4P23C 2NY3D 4WUUA 4XPGH 4POYA 3QEQA 5IOPA 5FUCC 3FAXA 4M6NH 4I18A 1VFBB 5I6XB 2DQIH 3NABL 1FORH 5EZIL 4XXCC 3LKOB 1S7UB 1RHHA 1H5BC 4HEPG 3VXOB 3WXWH 4WFGD 3DURB 2ENYA 3VRLE 2B2XH 3K2UH 3RIFF 4ETQA 1EO8H 2WWMD 2EH7L 3QUYB 3RX5A 1A6UH 3BH9A 4UTBH 4OFKA 3VXTB 5LGJA 2OMNA 1TJGL 5JXAL 5HDOA 1BQHA 4RMTA 1U8JA 3HE6C 4R97B 3QIBD 3K74B 1QFWL 3RPIB 1B88A 4HS6B 5HI3C 1CE6B 1IILE 3O3BA 4OLVL 3MRFA 2NY2B 4PTUB 5ERWB 1ZAGA 4U7KA 4P5TA 4HUUA 1Y0LB 5CHNB 5E2WH 3QNXA 4HPYL 4U7MA 3T4AA 3A67L 5IMMB 3ZKMD 3ARGC 3CFEA 3T08A 4E41A 4RMRA 2GSIA 3SKUD 1XCQB 1D6EB 2XACC 4WFFE 1WUNT 1AXIB 3UJIH 5EOTA 4Q9BA 1EHAA 4JRXD 4C4KT 3GJEB 2F58H 4KH2A 5F44A 2ZSWA 4IOSD 5JXEC 5AZEL 4RGMC 1IGTA 1FVDB 4CGTA 2Q1EA 4DQOL 2CDGA 3ROLB 2O5ZH 3QO0B 2XN9A 3RI5F 2BNQA 5BOZG 2X89D 1SYSB 4HUKB 4X7SH 3C08L 3MJGX 3SDCB 4LOUD 1WFNA 1MQKL 2BMKA 1QR4A 3QEQD 4GS7B 2EDXA 3GBMH 3P9MB 3B6SB 5C6TL 3D39B 3MLXH 2H32A 1G1YA 4LSVL 3O8XC 4CW1A 1SBSL 1MFBH 4LDOB 4QRQB 3CGTA 3ZTJH 4P0DA 3NACL 4CMHB 4ZQKA 2YZ1A 4LQ1A 1NSNH 1KIPB 5F7NC 5DVMA 5ACLA 1PKQE 3RZCA 3MJ9H 3OQ3B 2X4NB 5C0IA 3GIZL 1LEKA 1C5CL 3SGDI 2PKDA 5F71A 4F3FA 5IQ9A 2P49B 2VDNH 4K7FB 4XPGL 5DJAB 5HGAB 3H3PL 4LKXA 1JI2A 4N0CD 3WIHL 1LNUA 5B4MD 3HRZB 4AQ1B 2VNCA 4P5TD 3TM6A 4MGXA 4RRPG 3RNQA 5JNYB 4LGPB 1IGML 2HFEB 1U8IB 4OD2A 4JAMB 3BKYH 4HGWB 3AUVA 5E5MA 1W0YT 2XA8H 3HZMA 4OZ4A 3K2UL 3WO4C 1IKNA 4UTBL 3KYKH 2FYYB 2YK1H 3K4DA 4QY8A 4OI9A 4U1IB 3IFPA 3P4OB 1BJ1H 2J7LA 1ONQB 4G8GA 4YHNA 3OF6A 4HZLA 1Y18B 4LAJH 5F7EH 3REVB 1T66D 1HKLH 2W0KA 4HXBH 4XP4H 4QRRA 4EI5B 1RK1A 4G9FE 4LRNH 4HJJH 2BNQD 4ZUUB 3IB4A 2FHFA 1CXEA 2R1YA 4H88H 4I0KA 3RY6C 5E2WL 1NFDF 4PJHB 3CUPA 4X5XB 4DKDC 5HTSA 3HAEG 3QI9B 3FQUB 1NGPH 4ZPTA 4Z7OF 4TUKH 4QXTA 3VI3E 1X5LA 3VGAB 5E4IA 2IBZX 4IOFC 5C3LD 2D7NA 2VDRH 4KU1A 5I9QB 3S37X 2A74A 1A7RL 1AP2A 1M6OA 3ARDB 5A40E 3DV6A 2A9NL 3RZCD 3AS2A 1YNTB 4ONOA 4N0UA 5F72S 5C2BH 4I0PA 1QLEH 3UTZB 2O5ZL 3HUJF 4KTYA 1K8IA 4X7SL 4Z7UE 1HDMB 2ADFH 5F7DB 2ICWA 3TEUA 4TN9A 4KTDH 2CLZB 3GBML 3MYZA 1OARL 4JFZH 4MNHB 3MLXL 4NUGL 3QAZC 3QDJA 4JGJA 2NY3B 1JNHB 2QJDA 1RZIB 3R8BB 3DBXA 4XBGA 3ES6B 2A6KB 4D9LH 1NSNL 3NZ8B 2DM4A 1YQ2A 3M8OH 1TNNA 1FLRH 3PNWB 4Q74A 3KPTA 4OF5A 5HGGS 5C09E 3MJ9L 1UKQA 4L4TA 4OQTL 4JPWH 4CNIA 2BSSA 4M1DH 4JN1H 5I6XC 1BBJA 1WIOA 4PTTA 4HWBA 4UV4H 2I26N 4G8GD 1XR8B 2MHAB 5HPMA 3TO2B 3D25A 2VDNL 1J7VR 1NBVL 3QUYC 3RVTC 3LS4L 4D0CB 2VQUA 4M7ZB 2VXQL 4OZFA 1FVCB 3QIBB 1YMMB 4NQSA 1BLNA 4MZ2A 4H26B 2BNUB 4Y1AE 4NGHH 3DETC 3ULUF 2VZTA 3MLZH 4R97C 3D3VE 4N0FB 2DMKA 3I02B 3BKYL 1NCTA 3O3EB 1C12B 1QBBA 3RWIB 2E8ZA 1FQ9C 2NY2C 1ZT1B 3JWDL 3KAAA 1RZ8B 5D2LF 2EYTA 4WY7H 2AEWA 5KJRL 2YK1L 5ISZA 3D69B 4PLKD 3TNMA 4X7DC 1AJ7L 1PSKH 1I9IL 4LSSH 1S9YA 3TN0A 3BPNB 4QHKJ 1WTLA 4YBLB 5I30H 3VXPB 3P11H 3DUHA 1L9NA 2BNRD 3AGVA 4O2FA 4LGSB 2YRZA 1VACA 4I0PD 3VFNB 4JRXB 2YXMA 3VDCA 4XP4L 3FQRA 3CLFL 3BPCA 4HKJB 2AXGA 3MLUH 2F53D 3RWDA 4LRNL 4PJEB 2QR0A 4R9HA 2YKLH 3Q1SH 1TZHA 4HWEH 3DRTA 4KDTA 2W65A 2J8OA 3NN8A 1DBBL 1KJMA 3JTTA 3T77B 1U8KA 1F11B 4BM7A 1YN6A 3JUZA 3SDCC 3CVIH 1FFPA 2VDRL 5D7LA 5C1MB 4GS7C 2IH1A 1A8JH 3U6RB 1MFCL 3PQYB 4DUWA 4D8PB 4HK3N 4F2MB 2NW3B 1U9KA 1B4JH 1GAFL 1GIGH 1NAMA 4L4TD 4KMQA 4CN4A 2X9YA 2BSED 1QLEL 3L3HB 2NY1D 5EO9A 4ETQB 5E2JA 4Q9CA 5CZKA 4CMHC 2DB8A 5DUMH 1W8OA 5E8EA 4LCIL 4XMKH 3ZTNL 5CFHA 3V4VL 3INUL 3UTSB 4ZYKA 2C4XA 5D7KE 1I85A 1UZ6E 3RJDA 4U6HA 5E6IA 1EEZA 4ZFGL 5CJXA 3IXAA 3IFOB 4KROD 4HUUB 4D9LL 6CGTA 1T03H 5EIIB 1MAMH 3HZYB 2VLRE 1FLRL 3QNXB 4JB9L 1JWMA 4M02A 1CS6A 4PJ9C 4X6DF 5CIPB 3MUY1 4FZEL 2O5YL 4UNUA 4ONHA 4C57C 1Q1JH 3TN0D 4NT6B 4NKDA 5BV7H 1YJDH 4FABH 3KDMA 2UWEF 5EOTB 1FNEA 2F19L 3QO1A 2AJZB 3HRPA 1CIUA 2D0HA 4LEXH 1RZJL 1F3JB 4S11A 4FMFA 1IFHL 5J3HC 2KBGA 3EDDA 3L5JA 1NFKA 4JQVC 4ZNEA 4YFDB 4Y8AA 4EI5C 5DD0L 3GK8H 2WBJC 4HHAB 3MLSH 4B50A 1PSKL 2WWKT 1WLHA 43C9A 4LSSL 3OB0K 4PRAB 5IROA 5A2KH 1L4IA 4OCWH 5I30L 4OUUB 4AK1A 3P11L 4HF5H 1U8NB 1F00I 4U0RB 4XVJH 3HLAA 3VGAC 4AIZA 1FLTX 1G9NH 3O41B 5B3JF 3GMNB 4FS0A 3WKML 1AQKL 1FG2A 4Z76A 2XZAH 1QFWI 3Q1SL 4HFUH 3VWKA 1X4YA 4HWEL 3WLBA 4MQXD 1KSRA 4F3FB 5IQ9B 4MMZC 3I6LE 1VEMA 3AXLB 5E6ID 5FO7B 5DJ8B 4ZNCD 4LKXB 2H2SD 2CUMA 4OLZH 1I9JH 1OOAA 1MWAL 3HR5A 4KY1L 2FGWH 3MLYH 4CVXB 1T1WA 4KJWD 3GO1H 3O45A 5TQ0L 2R0WH 2EDBA 1GIGL 3U4BL 4LSRH 2YA2A 5DUML 4GMTL 2M8XA 3RA7L 3O2DH 4XMKL 5C0CE 1YY9D 3FO9A 4XXDA 1GZQA 5DLML 4ERSL 1JGDB 2KDGA 2WWMC 2OQJA 1MHPL 1MNUH 1E6JH 2HT2D 1JZ7A 4X6BA 3TLRA 2BDNH 5KVGL 5EN2B 3DECA 5DJZA 3HKFA 1T03L 3DHMA 4M7ZC 4GRWF 3QIBC 1N26A 4PJFF 5DJDB 1DLFL 2E9IA 3CCHB 3FQXA 2AK4A 5J89A 5ESAB 3CUPB 1CGSH 4XB8A 1YNLH 1TZGL 4P57B 5BS0A 4HLZH 2WWKO 1EJOL 4PD4K 2A9ML 3B4NA 1L7IH 3ZKMC 1PKQB 5FOJA 5TH2A 1M6OB 3NVQA 1QFPA 2BNRB 4U1NA 1CXIA 4LEXL 3AS3A 4YBLC 2V17H 4I0PB 5EOCJ 3VWKD 5DDHB 4N8VA 3KPOA 5IB2A 2F53B 3T4YB 3BEVB 5FA3A 2Q3ZA 1KN4L 5MI0B 1PLGH 4YDJA 5T1LD 2CJUL 3MLSL 5KVFH 3CMOH 3FO0H 4HF5L 1J0YA 1AI1H 3AS1A 4WU5B 3L7EB 2PW1A 3MRBA 2OSLB 3TBYB 1G9NL 4TTDC 3VWJA 1AXTH 1ZHLB 1HILA 2Q7NA 1REIA 2FO1A 1FGNL 1INQA 2NTFA 2EIDA 1AKJD 2XZAL 4IRJB 5F88A 2BSSB 5E7BA 3BKCH 3WUWG 2NY1B 1NLDH 2J8UF 4KTEH 1DCLA 5D93C 1NGXB 3MMEA 4LNRB 3DI3B 2I24N 2CK0H 3D87B 1CD1A 5FYLH 1GVIA 1HOCB 1NMAL 1XR9B 1CFBA 4PREB 2FGWL 3MLYL 1G1CA 2IH3A 1V5JA 5I74B 4OM0H 3F58L 2AK4D 3GO1L 5DD6B 4HLJA 4MCZA 5EU7E 2BJML 1QP1A 3GIVA 2ED7A 4KROB 1PW3A 1MY5A 1DN0A 4PGBB 1KN2H 3S4SB 4ONFH 3WIIL 5GXBB 2R1XB 4FHBD 5E03A 5F9JB 4WTWA 3WNNA 3WEXA 4XVTH 4HW6A 2NQCA 1TENA 4O2FB 3MFFB 1U41A 5L7XL 1MNUL 5EDXA 4Z7UB 5C8JA 2C3HA 3OR6B 5LQBH 2L7JA 2WSKA 3QRGH 5DZNA 3V52H 3DNKA 3BI9X 3O6MH 5SX5H 2IEPA 1TZHB 5C08A 4EDWH 3DRTB 5TE7H 3UTPE 1YNLL 5IFJB 5I71B 1U8KB 4X4ME 2VDMH 1HQ4A 4R4ND 2HJKB 5H35A 4U2YA 3FB6A 4EEEA 4EDXA 2R0ZH 3LKNA 5GGUA 1J11A 2AABL 3DTXA 4HBCH 2A0LD 3VWJD 3MR9A 3DPBA 5C09B 4JANA 2VDKL 3VW3H 3FAWA 1FFOB 3CFCL 5DRXA 2ZUXA 3R1GH 5DC0A 5HI4C 1H3PL 1NCWH 2VR5A 3BJLA 2QKIA 4CADA 4M8QA 4U0RC 4GRMB 5DEFA 4TQEH 5IB1A 2LQRA 1X7QB 5K9JL 4KUCD 4Y1AB 3SKJL 4NDMB 1AIFB 1TTUA 1BEYH 3D3VB 1R5IA 4GQ9L 2D9CA 4U6HB 3WFBH 5A3IC 3UAJD 2GUOA 3UMTA 1BFVL 5EU5A 4FG6C 2EDQA 2FJFB 4M9PA 1JNLL 4UMGA 3T1FB 3IXAB 1T20B 3U1SH 3QEUA 4Z7VE 1ZLVH 3VI4F 3FHQA 1GSMA 4LLMA 1JWMB 32C2B 1DR9A 4PRIE 2EXYD 1T80A 4GKNB 4D2NA 3IDYB 2WBWB 3TBVB 1NLDL 3RUGE 1LO5A 5FB8A 2X42A 4FP8H 3D5OF 5ANME 4HD9A 4MAUH 2FWOB 3MA9L 3WJJA 1R6VA 1RPQA 4LPTA 1G84A 3MJ6A 4NHCL 3L3DB 3QO1B 4OCLC 3WXVH 2VISA 4OM0L 4OGYH 3ABZA 1R3KA 3RL2A 5C08D 3VH8B 5BZWA 3RVVD 3UROR 1EX0A 1GGUA 4OZGA 4DAGH 1BQSA 4JQXC 4ALAH 2AEQL 4XMPH 4H8WC 1CT8A 4X5LA 5ITFA 1KN2L 5DFTA 4X7CC 3RNKA 3ARBA 4ONFL 1RJLB 2OK0H 4Y16A 3HR6A 3E8UH 4MWFB 4ODBD 5ABDE 4LSUL 2JJTC 3V8OA 2B1HL 5F93C 5I1DB 2O5XH 2HJFB 2OM5A 1YUHA 2AQ1A 4WWKA 4NRZB 1XF1A 3K8MA 4PLKC 4JFFE 2HA1A 1MCLA 3MGTA 2BXYA 2XG4A 1FG2B 3UJTH 3ZYZA 2X4QB 3O6ML 1NGWB 4P2QE 1W0VA 5DS8A 2CO7B 4WI8A 3TBSB 1J05A 5FOBA 3LN5A 4I0PC 3NAAL 3UX9B 4LFHD 4JFDD 4ZO8A 2C5DC 2QHLA 5T1LB 1FNGA 2VLRB 3PGFH 3TIEB 4HBCL 3BIKA 5MI0C 1ZT4B 3QA3B 2DQDH 3MBEA 3R1GL 3KPMB 1KBGH 5C71A 1BVKB 4MHHG 4Z7WE 3MACL 1GOHA 5KN5B 5KOMC 1C5BL 3VXMD 2A6JA 3HFMH 1ZMYA 3GRWH 1AKJB 5L8LB 4PJ8A 3I3BA 1TLKA 5BJTB 4IRJC 1EGJA 5GS2H 2LU3A 2N7BA 2NY1C 2XWTB 3L5XL 5DWUH 4FQLL 4LCWE 3O9WA 1P2CB 4XNMA 2I07A 4J1UA 4P2OD 4ZUTA 4Z6AT 1LE9B 3IDXL 2ZNWA 2GTZA 2PXYB 3FQXB 3BH8B 2YXFA 1QLFB 4LEOB 2AQ2A 2FBJL 1T22A 5DJ0B 1XGUA 1ACZA 1D5XA 2MJWA 5I74C 3ARBD 2Y5TB 3UXFA 4CAGA 3IGAA 2BERA 5T5NF 3RL1A 2FEEI 4KROC 5IBUG 1B0GA 5DD5H 4MAUL 1OPGH 3P0VH 2CIIB 1K5NA 3BP5B 3BESR 5D2NA 5TH2B 2I9TA 3O4LD 4WI4A 3MRRB 5TJWK 4U1NB 3VJ6A 3C2SA 4N8VB 1JRHI 5T5NG 4CN6A 4P2CG 3GSOA 3W9EA 5JLZB 4JDVB 4ALAL 3QBTB 4RX4A 5FA3B 1I3GL 4M7LL 2E7LC 4NYLA 1DDHA 2RJMA 5E4EB 2OK0L 2R0LH 1I4FA 5IEKB 2HJLA 1TCRA 3E8UL 4G42A 1VADA 4KDTC 5GGRB 1KOAA 3HE7C 5I71C 1PKOA 4PGJA 4V1DD 2Z8WC 4L4JA 3MRBB 3AAZB 1VFUA 3BHBA 5HGHB 1YEDA 3VWJB 1HILB 4U6TA 3SDAA 4I2XE 5C0CB 2NTFB 5JORA 5JOPE 1TPXB 5F88B 2XTJE 1BHGA 4FFYH 4M4PA 1A1NB 4PJ8D 3OAZH 3KPSE 5E94A 5FIEA 2DLEA 3KJ4B 4YBQC 3MRDA 3MMEB 5IMLA 3R8QA 3SDXB 1YYLH 2BK8A 2XWJA 2YUXA 2J88L 3AREA 5DQDL 5DJXA 1FYTA 4PJXA 5EO0A 4MQXC 5SX4I 1ZLWK 3ULVL 1SJEA 2VR4A 1FN4B 4YE4L 3SKMA 4G43B 1DFBH 1UVQA 3V6BR 1J1PH 2H2SC 5DR5H 1A3QA 1QFWM 3O6LL 4M48H 1LO4L 3I50H 1ORQA 4BH8B 1A4JA 2DIAA 2CR6A 3OKDA 4P4KA 3WEXB 5I1IL 1P7KA 2ZCHH 4W6WB 1W72H 3L5WB 3CJJA 5D72H 5DQJA 1XEDA 1S7TB 3ECBA 5E9DA 2MCG1 4DK6A 5HDBE 4KI5D 1HK6A 4U1MA 4AENB 1KCUH 4YDIH 2IMMA 3FOMB 4PRPD 1DBAH 2OMBA 4PS4L 1MLCB 5BMFH 2HT2C 3GJFA 4NQUA 3DIFA 2BOCA 3D0VB 4RGND 4WV1B 5BVJA 4NPYA 4O2EA 3BEWA 3MR9B 4YZFF 5D1QA 1A7NH 1YPZE 2VDQH 4QRTA 3SDAD 1WEJH 1XIWB 3U9UA 5DF0A 3JWOL 1YEJH 5IROC 5GS1B 1LD9A 3GMQA 1A7BA 2IMNA 3RJQB 5C0AE 4M8QB 2ARJQ 1KB5H 4RIRA 5JZ7D 4UAOB 1XF4B 1VENA 5DT1H 5ILTH 3FQTA 4AZ8A 3ARED 4Y2DA 1FYTD 3EOBB 4K94H 4QTHB 5ALBL 4ZUVA 1MJ7H 1UWEH 1VFAA 4PJGF 2GUOB 5KW9L 4JFDB 4K2UH 3V5HB 1JZ3A 1MCKA 3QEUB 3ILQC 4FQIH 3TCLB 4X99A 2P8LA 5GRZA 4LLMB 1WK0A 1FZKB 4QXGL 4JLRA 1FNSH 4M61B 3TJHD 2W9DL 4MAYA 1BBDH 4FFYL 2IF7A 3BGFB 4P4KD 4OLXL 1IRAY 3VXMB 2VQ1A 3EW3B 1CDBA 3GHBL 3RWCB 1UQSB 2B7DT 1YYLL 3FONA 4Z5RA 1MIEL 4OCNC 1AD9B 5E9DD 1TTGA 1VSCA 5C0NC 1FFQA 1MREH 4YJZL 2VISB 3C60D 5IVXE 2YD6A 3VRIA 5JW4N 4P2OB 3U82B 1DFBL 2EIZB 3C8KB 4OD1H 1OLZA 5DR5L 1JNNH 1H15A 4M48L 4NZUH 4UV7L 1U2CA 1JGEB 2BY2A 2PXYC 2L7UA 1T89A 4IBLT 1P1ZB 5E24E 3LS5L 4FQJL 3MJ7B 2ZCHL 1W72L 2UV3A 1MWAB 3QJFA 1IBGL 5CBAB 1ZA6A 3O4LB 3P0GB 1U8OA 3EYFA 1S5HB 2Z91A 1QVOB 2WUBL 4JM4H 2HWZH 2FH8A 2PR4H 2BY0A 2ZUSA 3IU3B 4JY6B 3T3MF 2P44B 5DS8B 4DKFH 5DO2D 4ODVH 2Y7QB 3LD8B 2W92A 3LN5B 4HIIA 2Z93A 5E56A 3DGGB 4BSVB 5IV2B 5FYLD 5B39B 4XCYB 4MCYA 4UUJB 4Z7VB 4XMLL 3GFUA 3OJDB 1V7ML 1NEZA 3BIKB 4LASH 4PRIB 1UM5L 2VDQL 1HKFA 4DN3L 3IKCA 4IRSD 4MMXC 4WCYH 5SWSE 2BSTB 4V1DB 4ZPVA 5KTEH 2E7BA 3PP4H 1QQDA 3RUGB 4M93B 5FHAH 4DN4L 4MS8D 1NKRA 3ULVE 1FIEA 4IIQA 5ANMB 5FXCH 5CGYC 3U2SB 3FRUA 2A6DA 1KB5L 2A0LC 4BZ2H 1EVTC 3DRQA 3DO7A 2HLFD 1UKSA 4FQXA 4TPRL 1S9XB 1TPXC 4K94L 4S2SB 4UOW0 3MRGA 3JWDC 4L1DA 4PJEF 5JQ6H 4Q6IB 4PYHA 2CRZA 4K2UL 3KJ4C 4ZSOB 3MO1A 1MCQA 3L1OH 2VDPL 4ZUTB 4WHYG 4KPHL 1H8SA 1O0VA 2QV2A 2D31A 2APVA 2ZUVA 1RFDL 1XGTA 4QWWC 5GGTH 5JW3H 1T22B 1GC1H 4UIKL 5A43C 1BBDL 1X5HA 3VXUE 3CH1A 3SQOL 3FFCD 4EN3A 3QNZA 5DK2A 2R69H 3RWGA 3X14A 5C6WH 1EH9A 4PRHA 1KLGA 2GIYA 4HULB 1BX2A 1K5NB 5C0AD 4JFFB 5D2NB 1ZSDB 1MREL 4P2QB 2YSSA 1B0WA 3K80A 4JJHA 3T0EE 3Q2CA 3WYRA 1UXSA 5FO8B 3IJYB 4XPTL 3BQUB 4HAGA 1NGYB 1JNNL 3KLHC 4JG0H 2AXHA 2Q8BL 2HMID 3VFWA 3QXDB 1G7MA 3L3JB 4PRPB 5IK3B 2HJLB 4LLVA 2ZSVA 1VADB 4NZRH 1JGUL 2MPAL 4QHNA 4ZUWB 4BZYA 3GBNL 1KTRL 3MNWB 4WV1C 2JLLA 4JM4L 4QRPE 2PR4L 2VXVL 4FQXD 1XIWC 4ODVL 1A7OL 3GRWA 4R8WL 1J8HE 2FJGA 3MRDB 5GS1C 1LO2H 5KSBA 4DKAA 2XWJB 5TDNA 1FYTB 4UAOC 5AZ2H 4QTIL 2VH5H 1FYHB 4OCYL 3FB5A 2NCMA 3VMNA 2ITCA 4JFYA 4WCYL 4U1LB 5KTEL 4RFOH 5EUKB 3PP4L 1ZS8A 5EU7C 1UVQB 3FCTA 4EVNA 5I76A 4GG8B 3BZFB 2BXZA 3LV3B 5I75B 1B9ZA 3SDDD 3JZ7A 4NKOB 4JZOB 3V7AG 4BZ2L 1ORQB 1RZJC 4LLQA 3OKOA 4PRHD 2UY7A 1A6AA 4JJ5A 4P4KB 5F1NA 5AD0B 4X6FA 5TGBB 5IIEB 5DHYB 2X9WA 4M4RA 3K81A 4NRXB 5JQ6L 3BGFC 3ZDXE 1FE8L 5BRZE 1S8DB 5LCVL 4FFZL 3EGSA 5CUSH 3BOVA 3JXAA 2VAAB 3ZT7A 1XGYH 1YN7B 4Z7QE 2VXTH 1CZ8H 1I1CA 2ARJA 3VG0H 2FLRT 2W59A 3UPCA 3C60B 1JUFB 2VAJA 3LPFA 1E4WH 1T0NB 5GIRA 2FIKB 4MA8L 4PG2A 2G2RB 4OD3H 1K8DA 3DIFB 4P2OC 2IFFH 4OV5B 3SE9H 5BVJB 3TH2T 4NPYB 4CVWA 4F7PA 3BEWB 1DQML 1O5DT 1G7IA 2OR9H 2CKBA 4PJCE 3U9UB 2FB4H 3I3DA 4Y4KD 1QSFE 3HNSH 4LHJB 3KPSB 4G3YH 1LD9B 3KLDA 2D0FA 5D7IE 3PWJA 2CGRL 2E8YA 4GW4A 4MJIE 1BD2E 2BCKA 1S7RA 1N3NA 3M1BA 1T1ZB 3FT3B 1I9RL 2UUDH 5GS2D 3G6AA 4ZUVB 2LE9A 4RFEB 1F6AB 2QBWA 2VIRA 1CDJA 4AG4L 2P8PB 3T3PF 1QG3A 3LD8C 5IVZA 2F8XC 1KC5H 1RURH 5E2VH 4X99B 3MRMA 3MRNB 5F3BA 5D5ME 1GJIA 3BGAA 4GMSL 4IRSB 3KHOA 1G0XA 3ZKQD 1G7PA 3ETBF 1SYVB 2P5WE 3CAFA 1PX4A 3KYAA 5E1HB 4M93C 2AEIT 1DBJL 5AZ2L 3O6FB 2VH5L 3KYOB 2P24A 3LEXB 4O51B 1YJDC 2VITB 4YXKL 4Q6IC 1R24A 4JY4B 3WFCH 5I1CH 1UA6L 3H9SA 5TE4H 2G75A 4C56A 4ETYA 1H15B 3T0BA 3L5HA 2FX9H 4MD4A 3F7RA 2COQA 5CEXA 2VERN 1XCTA 5ECJE 4DFHA 3QEHA 4Z0BH 1QRNA 1IM9A 3KYNB 1YPZB 4QGTA 3FFCB 4LGRB 5CSBA 2H6PB 2RB8A 4PR5B 2NXYB 2QSTA 2R2BA 4P3DA 1H3XA 4XCNB 4OFVA 3QJFB 5C0AB 5IWLA 1RUKH 4AM0B 3P9LA 4PJAA 1XGYL 2VXTL 3MRCA 3S3SA 3FTGB 3WJLA 4BQ9A 3VG0L 4YK4B 2IG2H 1U58A 1LO3H 5EWIL 1G9NC 2GK0A 4ZTOL 5FDWB 2Z93B 3L3GB 1JPGA 3ARSA 3VXQA 4I3SH 1MVUA 4XVSH 2R39A 3BQUC 3UDWA 2C9AA 3SE9L 1Q0XL 3HNVL 1JMXA 1PFCA 1CDHA 3OG4B 5CBEB 4NCC2 4DVBB 4OZFG 1WSST 5F89A 3HNSL 5HYJA 3U7WH 1QTYT 1QQDB 5EZJB 2C1OA 2FL5A 4HT1L 3D18B 5DK0A 4NWTH 2C7UB 4XPHH 3FRUB 4TNWF 3RKDD 1JYNA 1LEGB 1NDGB 4FQXB 1T04B 5D6CA 4XWGH 4NKIH 3S4SG 4KQ4H 2VMFA 3PV6B 5I0ZA 1S7QB 3QIWA 1H9VA 2VLKA 4GRLB 3UBXB 3H9SD 4C56D 4D3CH 2D31B 4Q9QH 4KAQH 4WTXA 3V4UH 1QRND 4G9DA 3CH1B 3EJYD 1IM9D 5HHOE 1JHKH 4QCIB 5HYSB 5CINH 1DEEA 2XFXA 3SDDB 1NKOA 5JW4M 1RD6A 5HVGB 1BX2B 1DL7H 4BZ1H 7CGTA 5I75C 5HHQB 1HZHH 1JPST 4PY8J 4IRZH 5FO9A 1IGJB 1FAIL 2AV7B 1EXUB 3RX7A 4RNRA 1MF2H 2GY5A 1UXSB 3TNNA 5KZCD 4IOIB 4APQA 1GGIH 5AEAA 5TE4L 1HYRC 1WTGT 3BUYB 3EYQD 5J6GA 4HIHB 3LMJL 3OAYK 4YPGA 1TJHH 3VFWB 1G7MB 4Z0BL 3S8WA 3C60C 1BF2A 4PBXA 2NR6D 3MV9A 4YH6A 4D9QE 2AK1H 3S96B 4TVPH 5HYJD 1CR9H 5IB3B 4E42A 2Y07L 3V6FA 4OM1H 5I2IB 3MV11 4JO4L 3CXHJ 1JWSB 3H9YA 4WNQA 4Y4KB 5I1HH 4JFOB 1ES0A 2R56L 1IQWH 2OZ4L 1HHKA 2XTJC 1F4WH 3MODH 4Z0XB 1H0DB 1CFTA 1RK0A 1VDGA 4NQEA 1G0DA 3QJHA 3BAEH 1MRCH 1P4IL 4I3SL 1E4XL 2DM7A 3MLTA 5TDNB 3QIWD 5JIPA 1MJUH 3CK0H 1FO0H 5DFWH 4PJBA 2GTWB 1G7HB 4PYGA 1BQLL 1DJSA 4JFYB 3KYMA 4FQ1H 2D7QA 1NC4A 4JKKA 3U7WL 5FUZL 4I3RH 3RWJB 1XF3B 8CGTA 3DYMA 5GGTA 2X4RA 5AAWA 1MHHB 1N64L 4XPHL 5ALCL 4KDVA 1J0KA 3GMLB 3I6GA 4ZXBD 3ZE0F 3MXVL 3VH8G 2BVPA 4ZOBA 4LLQB 2UYLB 4MX7A 1ZE3C 1QHOA 2WAHA 5EC2B 1OB1B 1WWWX 3AM8A 4IRSC 4YHPA 4BQ8A 3HNTH 2JCCA 3T0EB 1TMCB 4NKIL 3RHWK 4KQ4L 2RAMA 3LCYA 4G6JH 4KK5C 3JUYA 5IR1B 3EGSB 4APQD 4OKVA 2AEPH 1F4YL 2FATH 4MVBD 2W60A 3N1PC 1D5MB 5LAXA 1ODAA 3MOAL 4NQCE 4Q9QL 2M1KA 3O6FC 1EHLH 4OLUH 1P6AB 1R5VB 3J7HA 4HUWB 2GJ6E 4WTZA 1RMFH 4I8DA 3NA9L 3ARFB 1NEUA 3MV9D 1MJJA 3STLB 3WD5L 1LEIA 5FM5O 4ODSH 3TWCH 1CDGA 5I19L 4IRZL 3HC0A 4NC1E 2DL9A 5GS3A 8FABB 2R23A 2YD5A 5FM8A 3ULUH 4KVNL 5ESQB 1J8HB 2NXYC 4RQQA 3PWJB 3LQZB 4NQED 3S36L 2ICWJ 4M5ZH 1LWRA 1LQSR 2KQNA 2CDFB 5E6ZA 3DV4A 4ODHL 1INEH 1MFAH 5FUOL 5F7HA 3BD4A 5EFIA 4YK4C 3GHEL 1CBVH 2PF6A 3S88L 4AH2B 1NC4D 1ZGLB 1TTFA 5IFHH 2HMIC 2H8PB 3SPVA 3SE8L 5F3BB 4FQ2H 3G6JE 4GXUM 3P77A 2FZ3A 5I1HL 1DEDA 4LPUA 4OCSH 5D9SA 5JHLH 3WMSA 1EJ6A 3MODL 1F4WL 1G7PB 4F8QA 1T1XA 4OAWB 5HI5D 3VG9B 2BVOA 4WEBL 3RIFK 2XWBA 3BAEL 3BSZH 1MRCL 2GSGB 5AWNL 5BRZB 2YRLA 5IW6A 2ZPKH 2IAMC 1OAUH 2HH0L 1U95B 2VLJE 4WHDA 1MJUL 1J10A 1W72B 1A4KB 1W0WA 5DUPL 2P24B 1JWUA 4X98A 1LP9E 5F9OH 4TSBH 1SY6L 3OKKB 5GS0L 4I3RL 3ZTJG 2G75B 3PJSA 3U7AA 3IXTA 4G7VH 4GRLC 3KPRE 1MAKA 3NIFF 5GSVB 2CDEB 4UTAH 3QUKA 1T2QH 4N8VG 1FDLH 3B8YA 1U8HA 3QEHB 4JR9H 1QRNB 2D3VA 3WSQH 1IM9B 4PJCB 5DJYB 3N9GH 4NNYB 1QSFB 1QBLL 5T3XD 4F15B 4YDLB 5D7IB 1HINH 3SDDC 3P4MA 2MOVA 3K4ZA 3TFKD 1CXKA 2PYEE 3P9LB 4PJAB 4ZFFA 5J9PA 3W0WA 2CLRA 1BD2B 2NX5D 2WK2A 5DI8A 3MC0A 5FGSA 5IMKA 3QHZH 5HD8D 1OQOA 3CDFA 1IC1A 4XZUA 1EHLL 4KUCF 5KZCB 2W0LA 1KB5B 5FHBH 3MXWL 3H7BB 4WHCA 3RI5K 4NFBA 3VFVA 4OSUH 1TIUA 1Q8MA 2JJSA 5I18H 1HSBA 5E08H 4OFIA 4ODSL 5JW4Q 5DFVD 3V8CA 1GGBH 3ZE2F 1CTOA 3MRPA 4IMLB 4DGYL 4YPJA 3QEGL 2ZCKH 4YDVA 4Y5XA 4OLWL 5F3HA 3ULUL 4XAKE 1XF2B 4B7LA 5HYJB 1HQRB 4S1RL 3D0LA 4YFEA 3ELAT 2P5WB 1I7UA 1E4KC 5LXGH 4R4FH 5CD3B 3NFNA 5DJ6B 3QZWA 1KEGH 5JTWA 2EDTA 1UT9A 1CFVH 4M5ZL 4ZFOL 2AJSH 5D6CB 5HHXH 5F9DC 4Y4KC 1FCCA 5DSCA 4ONGL 3DX6A 2R4SH 1QKZH 4UNVA 4N8CH 1X9QA 3LEYL 1T21A 5IFHL 1RIUH 1X5YA 1EMTH 1N4XH 1JPFA 1E27B 2PTTA 5K9KA 3NCJL 5T3ZH 4NO3B 3WL9A 1R3IH 1P84K 3RY4A 5DD1H 3TO4D 3D6GA 4OCSL 3T8XB 4ZO6A 1U6AH 2ZG3A 2QADD 3CD4A 4ZXBB 1AXSA 1FV1A 4FQHA 2HFGH 4L1HA 1FCGA 1OAUL 5I15H 4NP4L 1XF5B 1F2XK 3V9FA 2DIBA 3W0WD 4LMQE 3G6DL 5GGQH 2P5EA 4FMKA 3PWUA 4JHBA 2CIKB 1C7SA 4HMEA 5F6IB 4XNUH 3U0PA 5F9OL 3T0EC 2ZJSL 1MJ8H 3GGWA 4TSBL 4KZEH 5H37H 1RJYB 2GJZA 3P0YH 5BZDA 1KNOB 3IAGC 2VXSL 4G7VL 1G9EA 4L29A 4JZNA 4UTAL 4O2CA 4HUMB 1RULL 1WBZA 4JR9L 1UKTA 1ZEAL 3RFZC 1VGEH 1EUTA 3S3PA 4NCC1 1KLUA 5DRZB 3U9PL 3CSBA 4LSDA 4P59H 5IESH 3ARFC 2NLJB 5DJ2A 4E42B 4ZS7H 2NW2B 1CK0H 1HHGA 1S7SB 4LFHG 5J06A 1FNFA 4QNPF 5BVPH 4WO4A 5HGDB 5FECB 3QHZL 5I1AA 4GRWH 1IM3A 4JO3L 1UJTA 2I5YH 5IF0B 5K9OB 5LKNA 1WT5C 4O9HH 3C6SB 4OSUL 5DUBB 1NCBH 3C5ZA 4DW2L 1NFDE 3H2WA 5E08L 3WBDA 4LCCB 3UTQB 1HN1A 4OZGF 4Z7OE 1G9MH 4JFPA 2X7LA 3MRKA 3D1MC 2ZCKL 2PN5A 1V8HA 3OKMB 5HHOB 3FFDA 3U36B 3PIQA 1SEBB 4IMKC 4O00A 4L3CB 4DKEL 1QSZA 2DAVA 1CFQA 5IEHA 2DLFH 2BVPB 4MX7B 1CFVL 2D0GA 2DQUL 4R7DA 4UIMA 3FN3A 3QUZB 5DVLA 1UYWH 2JCCB 3HUJE 2P5ED 2D2OA 3DYOA 4U1HA 4KRNA 4K9EH 3VG9C 2R4SL 2PCPA 4K7PL 3TVMA 1UWXK 5DYOB 3T0WA 2YMXL 3OKNA 5T3ZL 4LLWA 1FC2D 4HV8A 4DCQB 3JTSA 4MDIA 5DD1L 4W4OA 4LARL 1U6AL 2E27H 3H7LA 4O58H 3LKSA 2FX7H 3ISWA 2WUCH 3GNMH 3KPNB 4XRCA 4UOJA 2HFGL 1K2DB 5AYQA 1I7ZA 4TRPL 4DGIL 3CX5J 4JO1H 4N90E 4LVOB 4OV6F 2EO9A 3RVUD 4KKCD 5B39G 2ZOKA 1JBJA 1CICA 3GKWH 2R29H 1M7DA 2EDWA 4XNUL 5C0GA 4WDIA 4H0IA 1DVFB 3CC5A 1IC4L 1KEMH 4RQQB 4F15C 7FABL 1M05B 4YDLC 2NX5B 5F7YC 3CLEH 3C5JA 1E4XI 2QQKH 3RGVA 3TT1L 1NGZA 4J8RA 5CD5D 3C5ZD 1JHTA 1CE1H 3WJLC 3PGCB 3RWEA 5D2LE 4P59L 3EYQC 3U46B 1FO0A 1VGKB 5J11B 3KPQB 4OLYH 5B8CB 5HY9A 1F2QA 4M6OL 4K94C 1CK0L 3FQWA 1EBPA 2DQGL 4TUOA 2FZ3B 3BP7B 3RZWA 3B43A 1K4CB 4MZ3A 1Q9OA 4FA8A 4Q97A 5CWSB 5IW6B 3JV6A 3V5KB 1Q0YL 3TVMD 2E5EA 2YUZA 2Z31A 2AJYH 1P4BL 2Q76A 1HIMH 1LK3H 1Z9MA 1JWUB 3S5LB 4KI5F 4ELKA 2QLVB 3DUUA 4JFQB 4LMQI 1GRWA 1DQDH 4MA3B 1A21A 1CD8A 3LN4B 1IC7H 4HKBA 5E99L 1F97A 1OW0A 1W2KT 3TO4B 4TNVF 4Z7WA 5J1TC 3LRSB 2E7CA 4JRYA 2FSEB 1CN4A 4TVPD 5F9AC 1CICD 4K9EL 3EOAA 5IT2L 1I7RA 3BKJH 1A9EA 4ZXBC 4C55A 1JF1A 1T0MB 3G5YA 3HI5H 4Y19E 4BKLA 3OR7A 3QULB 3RGVD 4HIJA 4WFEE 3OWEA 4KDWA 2BFVH 4S1DD 3TPUA 2DKMA 1CLOH 5F6IC 2E27L 1NBZB 2V5SA 1YY8A 2ILLA 3IVKA 5GGVH 1QNZH 4D0DA 5EUOA 3VXSA 5GJSH 2JE8A 1J1XL 1KPVB 5IG7A 4X6DE 3WHE1 5TFSL 1TITA 4JO1L 5CJQH 4YDKH 1B0RB 3DSFH 3DXAD 4PV9A 2CO6B 5MEPB 2PETA 3MRIA 3VMPA 4PRNA 2UWEE 1I7UB 4Y4HD 4EXPX 3QZWB 5C0JA 1JZ8A 2R9HC 2VLJB 4HWZB 2V5RA 4JO2H 1RAMA 4X4ZA 3UYOD 4L5FH 2Z31D 5DSCB 5B3NA 3IU4H 3STZB 5FK9A 4NIKB 4HLZG 1U8QB 2QSCH 3ZYJA 2E7HA 1T4KB 3O2WH 3U30B 3KPRB 4OF0A 2EKSB 5EORL 1VPOH 1JZ5A 4JCMA 5LGHH 4LCCC 3NCMA 1FL5A 2A73A 3ROOA 4NRYA 4YHYB 2PO6D 1CXFA 4H25B 2CMRL 4JRYD 5B3JE 2DWEB 1J12A 1ZV5A 3MRHB 4LCYB 4U1GB 1ULVA 3W9DA 4XAWH 3QFJD 4I2XA 4P2RA 3WN5B 1OTTC 3ULUD 1LK3L 2HKFL 4LLYA 4WU7A 1DQJB 5GGVY 3QUZC 5AYUH 1EIBA 4F9PA 4LRIA 4P9HH 3UZEA 2IGFL 3DI2B 3F62A 4H1LA 4LL9A 3I6KB 2AI0L 5EG6C 1I1FB 4M3KB 1IC7L 4OF6A 3HZVA 2H26A 3VXSD 3O3DB 1FL6A 2WW8A 3BE1H 3U48A 4YGVA 3BZ4A 5HHPA 2GW5A 2JIXB 1KLUB 3KLSA 2R2HB 2YN5A 5JPMB 3PXJA 3UPAA 2ERJB 1IAIL 1ZWIB 5I66A 1A2YA 3NIDF 1D9KA 1UACH 3T0VA 3OHXA 3RX8A 3C8HA 1N0LA 5EU3A 3W5NA 1NC2A 4LVOC 5SV4A 5I1AB 1BJMA 3UYRH 3WNKA 5IFAH 2DMCA 4TSCL 1DVFC 1KTLA 2EDDA 4NZTH 4HIXH 5GGVL 1AGFA 4GRWE 4PJFE 2CXGA 2F5AH 5GJSL 2DD8H 4JKPH 1OAYL 3B9KB 3I2CH 5F6HJ 2R2CA 4YDKL 4AEFA 5GZNC 4HIEA 2Y4SA 2YEZB 5EOQH 4WFHD 1A14H 1A0QH 2VZUA 3TBTB 2E9BA 4ORGB 4FXGB 2X4UB 1YDPB 1MFNA 3T0XA 3PIQB 1B90A 3EHBC 4MD5A 2YPLD 5DFVC 5B8CC 2Y36L 5MENE 3IDJA 2ATKB 3B3IA 4MNQE 4P2RD 4JO2L 1F45A 2EEDA 3CMGA 1A7PL 1R3LB 2YA0A 4U1HB 1JHLH 1UB5A 1KG0A 4JN2A 3QNYB 4KK9C 4PJDA 4YQXH 3TBWA 3O2WL 2B1AH 3SE4C 1VPOL 1C1EH 4HV8B 2DI9A 4A6YL 3VFPA 4L3EE 1HH9B 5DHVA 3QUMH 5JIHA 1I8LA 2ITDA 3RDTA 3OPZL 1GGCL 2HVKB 3HPJA 3MCLH 4XAWL 4X8JB 1INDH 5E2TH 4K3JL 3FQNA 3G5XB 1N5YL 2C3WA 5EU6E 3TO4C 3OXRA 1OGTA 2JB5H 1FFNB 1WFTA 4MA1B 2J8UE 4NC1C 1JZ4A 4ISVA 5C0GB 3VGEA 3FL7A 4XBPA 5H94B 4P9HL 4JHWH 2AJVH 4XC1H 3JVGC 1GPOL 2X4TB 2XQYG 1MI5E 4P3CH 1OAZH 1NFDB 3QXAB 3GSWA 3RVXD 1EBAA 4XGZB 5TF1L 1LMKA 2KZ1B 4JM2A 3BE1L 3N85L 1S9WB 5IVXA 4O4YH 5FEBA 2NY5H 4B0MM 5B21A 3TC9A 5JPNA 2MFNA 1EUUA 4NQDE 3RAJH 5I1JH 2HT4D 5JHDA 4XI5C 5T3ZD 3DXAB 3KXFE 3ZHDA 3X11A 4X5WA 3UBXG 3BT2H 1C16A 4UILL 3S34H 3S6CA 4JHAH 4G6KH 2YD1A 1AR1C 1OSPH 4Y4HB 3LZFL 1OGAA 4XP9H 4NZTL 1QSEA 4D9RE 4HIXL 1NFIA 2HT3C 4R7NB 3KWWB 4YHLL 5MEOA 1QR1A 1JN6B 2DD8L 4HG4K 3I2CL 5HYSG 3QWOB 1MHEB 2VUOA 1PY4A 4X6CA 4ZDHB 4S0TD 1HYSD 5TDOA 1A14L 2H1PL 3IF1A 3SBWA 2BX5A 5BW7A 4UI2A 1VFMA 4HPOH 2QQNL 2HTKC 4XCFL 2WLZA 2QQQA 4ZD3L 2X4PA 5SWSA 3F7VA 4NO2A 2PO6B 1U2HA 4UT7L 2FR4A 3AU1B 1KB9J 5JO5B 4YHYC 2ADGA 4XHJD 2JELL 3QFJB 3L9RB 1JHLL 2DTMH 4OIAA 1KELH 3MREA 4U1GC 1F8TL 2YA1A 4YQXL 3G5YB 5BQ7B 3T1WA 3WNMA 4JG1H 2B1AL 3GSUA 4IHOB 4EUPH 5F21B 1CVSC 4Q9RL 5KSBF 4X0KB 3WN5C 4Y4FA 5GQBA 4OCMC 3H9HA 4JM2D 4PGDA 4DTGL 15C8H 1TVBA 5D8JH 4ZFOB 3L5IA 3VI4E 3QUML 5D1ZD 5DA0B 1IMHC 3IETA 1BIIB 5F7MC 5C7XL 2AXFB 3MCLL 4Q2ZB 5E8NB 5E2TL 3IJSB 3CSGA 3QCVL 5JHDD 5LJYH 3PHOA 1AFVH 3MLVH 2JB5L 3WNPA 3QDMA 4YIQB 1XGRA 1XH3A 1CFSB 5CGTA 3H3BC 1SJVA 3NOIA 2ERJC 2VL4A 1QYGH 4OZIB 2AJVL 1OGAD 3K1KC 4YHIB 3FN9A 1QSED 4P3CL 4X4YB 4XH2A 4KKCC 2CKNA 3L3OA 4OFPA 1HXYB 3C5SB 3U4EB 5KVEL 3VA2C 4XPBH 1AHWA 4O4YL 4Z9KB 2NY5L 5KSUB 3E3QE 4WJ5A 1FL3B 4G6AD 2ADIA 3HG1E 4Z78A 4N9GB 3RAJL 2QHRH 1I1AB 3CU1A 4PPTA 5INCB 3WDHA 5I1JL 1UENA 4BSWA 4ELMA 3B9KC 1VESA 4CU6A 1Q9WA 4JHAL 2OTWA 4NRYB 5DEGA 3FJTA 1JK8B 4NNPL 4TSAL 2AJUL 4MQ7B 2YPLB 4JFXA 4KVCL 1KPUA 4AEHH 4X9BA 1U42A 3GI9H 1PZ5A 1KENL 4ODUB 2Z9TA 4PLJD 3W2DL 1XAUA 1EAPA 2DL2A 4G5ZH 4N0YL 1C5DA 2DYPD 2QTEA 5ACZB 3GUTA 2G5RA 1HSAA 4N1CA 3Q6FA 1CGWA 4Y4FD 1J0HA 1WISA 5CEZL 4E5XA 4PUBH 4NHUB 4TULH 3MUJA 4JPVL 4LQFH 3HZVB 2H26B 4X6DB 1Q72H 3BZ4B 4KQ3L 1CLCA 1QO3B 3QDMD 1DUZB 3ESUF 5I66B 1A2YB 4J6RH 3QWQB 3PWPA 2UWEB 2JK5A 1M71B 3TA3A 1A3LL 3X3FL 3OHXB 4NKMB 1ZHNA 3S37L 4JRWA 4M7KH 5EU3B 3K4AA 3RWHB 4JG1L 3DX9B 4MA1C 5E8DL 3TH3T 1SM3L 4PV8A 4NJ9H 4YR6A 1MCIA 4YO0A 4ZAKA 1K4DB 4B7IA 1AGFB 1QA9A 3I84A 1DP0A 2DQEL 4CMMB 1MCPH 3BPLB 3LEVL 3CVHH 2ADJA 1BZ7A 2VSCA 1J1OH 1NCDH 3WE6A 1A1MA 1IKFH 1DN2A 1XZ0B 4HUVA 3ZL4H 1QYGL 4YEFA 3C9NB 3EO1A 1NMBH 5BXFB 5F8QC 3U7YH 5F1IA 5GS0C 4XTRD 3U0TB 4PJAF 3RU8H 5JA8B 5L2JB 2LVCA 3GB7A 4Y4HC 4KFZC 4I48A 2IALA 5J1SC 3LKRA 3MRJB 4YBHA 3O3AA 4L4VA 5E8OB 2UZIH 1FVEB 2I9LB 4DZBB 2HRPH 4FFVD 2YRPA 2P8MB 3OL2A 3UJJH 1KPRA 1RJZB 1FZMA 5FGBC 5ELIA 1H3GA 2V7NB 3MLWL 2MQ3A 1IAII 3BP6B 5GRUL 5D5MA 5CP7A 4EBQH 3B2UC 3EOTH 1OP3K 1FGVH 3CPLB 3WFDH 4AEHL 5JQHC 1T3FB 2DLHA 3PWPD 2B5IB 3TA3D 2VC2H 4KKAD 3G08B 4OZHA 1IL1A 1NDMB 4ODWA 4XP1H 2BC4B 2PO6C 2X70A 3GM0A 4Y5VB 4HKZB 4XB7A 4FNLH 1J5OL 1OAKL 1YEEH 5CZVH 4KHTL 12E8L 4U05A 3SEPA 1U93B 4GRWB 4ZAKD 1D5ZA 2H32H 3Q6GH 4ZOCA 3HB3D 3ULUC 1L0XA 1Q72L 3QPQD 1B6UA 2WLYA 4FTVD 5D1ZB 2OTUB 4KC3B 3NCYS 3IRPX 1X4XA 1DLHB 2IQ9H 4DFIA 5K59F 3RWFB 5JHDB 3FB7B 3AVEA 2J3SA 1YEKL 3VFSB 5MENB 4Y8DC 4HKXB 1JI1A 1C16B 1CDIA 4KJYB 4N1HB 3G5ZA 4JDTL 3LIZL 5FYJH 1BM3L 3CZFA 1Q94A 1NMCB 1KYOK 5DTFB 4XCEA 5HYIA 1QR1B 3Q6FB 5E1AA 4XPFH 1OTSC 2G5BB 2AJ3B 1MCPL 1S78C 2RCSL 4IDJH 4L4VD 1J1OL 2DM3A 1HHJA 1NCDL 3QYCA 1J9CT 4Y5YC 2LFGA 5FKAB 2OBGA 5LBSH 4L3EB 2IQAB 3BDXA 1JPSL 3ZL4L 5L2KA 2WM0A 5C0FA 1GHFH 1I1AC 1DTUA 1U8PA 4YZFE 3P2TA 4KUZL 1IAMA 2V6HA 5ICXA 1JCKA 3HAEH 5F6HI 3C6LB 5CEZE 5EU6B 3UO1L 3U7YL 4F7CB 3OXSA 3WIFA 2ZNXA 4XNYH 1WITA 4XNQA 3CFBB 3FT4A 3RU8L 1QEWA 2ADGB 2JB6A 1LK2B 5IHZA 2CQVA 4DGVL 4HH9A 4HK0A 3GM8A 3S35H 2HFTA 3IFNH 4MDJB 1MI5B 5GISH 1GL4B 2DYPB 4K23H 3SGJC 2PUQT 4PJGE 1QFOA 2UZIL 3OJ2C 2P7TA 4Y4FB 2KZWA 1ZHKA 2HRPL 4KRLB 4L8BA 3H9HB 4X9HA 5MERB 1U91B 3UJJL 3QDGD 5T1MA 1KLFA 1VEOA 1R5WA 4PJBF 4LRIC 3OKLA 4X7TA 1P4LA 4KK6D 3MA7B 4NQDB 4QYOA 4EBQL 1XGQA 4H0HB 1RZGB 4NFCA 3WFDL 3MGOB 3PWVA 4MJ6B 3BZEA 2DQHL 4JVPA 4G6FD 5HJ3B 1A6TA 3GMRA 4QKXB 2Q86A 2JKXA 5I8EA 1A6VL 3JV4A 3QP3A 1HXMA 4FNLL 1JYXA 4PJ7A 4IM8A 2V2WB 4Q0XH 2JCCF 4BFIB 1DUYA 3PP3K 4HXAH 1KJVA 4GKOA 5FKPB 1OD9A 4HK3J 3BN3B 3F12B 3MLPA 1CVRA 4XT1C 5CILH 1I7TB 4YHKH 3RTQA 3PWNB 1RJCA 4RA3A 4ZOAA 3RVXC 4FXLA 5TPWH 4JDZA 1KCRL 3NZHL 3KJ6H 4OI8A 1LO0L 3BPLC 3EO9H 2GI7A 1Q9WB 1KIRB 4PJIB 3BN9D 4ZUSB 1F58L 2V7HA 1QBMH 2DMBA 1VA9A 2X05A 4WFGE 2ZWLT 2HT4C 1F3RB 3ILPA 2X10A 1ETZA 3EO0A 4DUVA 4TUJA 4K8RH 3DVNA 2DQCL 5D70H 1EAPB 3T3ME 3T65A 5KBNC 2IPTL 1I8MA 3V79C 1RZFH 4U6XA 1A6PA 1YYMH 5LBSL 4ZMAT 1I3RA 1BIHA 1R3HA 3FO1A 4QRUA 1PYWA 4HWNA 1UB6A 3BP4A 3O6KH 1Z5LA 5B38A 3LB6D 4GUPA 5CSGA 1A64A 1HI6A 1URLA 2MSPA 1DSFL 3KGRA 1GZPA 4X4XA 3CFIC 5I17B 1OT1A 2D03L 1G7JA 3V0VB 3IFNL 4JRXE 5MEQB 2B5IC 4YAQB 4YXLH 5E2UL 2FRGP 3BFOA 4AT6B 5HHVL 4PJEE 1G7QA 5GGSA 1CGTA 5C0DA 4KMLB 1E28B 3SDYL 4PGZA 1KXQE 3L7FA 4Y5VC 3NMEA 4R0LA 3AMLA 3KNBB 2K1MA 3RTQD 5EBLB 3BYTA 1N8ZB 5JUEH 4NQCA 3QEQE 5JOFA 5GRJL 4OI7A 3B5HA 2GJ6A 3VGBA 4FTVB 1YZZA 3THMH 3WE6B 5L9DH 4PGEA 1HHIA 1U3HA 5D1ZC 3RY5A 2YD4A 4M5YH 1Z3GH 1OAQH 3O0RH 1HWGB 4A6YB 4Q0XL 3HI1A 4J3WA 4WI7A 5C07A 4HXAL 1E6OH 1FHGA 3G04A 2WIIB 3P4NB 5F1IB 1OM3H 3PDOB 4KJQD 1S9KC 3BRFA 4M6AA 1LDPL 3QDAA 4YHKL 1NMCC 1U92B 4O5LH 2IALB 3HZKB 3DOSA 4DGVH 2VE6A 4PB0H 2I60L 2A6IB 1MPAH 2HLAA 3CFDB 1NJ9A 3OZ9H 4HWBL 3QDHA 4FN0A 1D3CA 3PGDA 1S7XA 5EBWA 4RWYL 5IUSA 3EO9L 4K9EC 2Q6WA 4OIIH 4G6AC 5EU4B 4UNTA 4WGVB 4E41E 3SBWC 1PG7H 2DQFA 2NY6B 3L6FB 1UZ8A 4Z18A 4P48A 2JJVA 3OSKA 4OZHB 1IL1B 3C6LC 4LU5L 5C0BA 1M7IB 2X70B 3A0OA 4R4BA 4Y2OA 1IGFH 4RMUA 4N5ED 4UT9H 3WUZA 1A1OB 2R8SH 1U8LA 3I85A 4RDQF 1YQVL 2XPGB 4XC3L 3IDMB 4R96A 2BNQE 5KSAD 3TJEH 2C1PA 3V0WH 3O6KL 5KG9A 4K07A 1LP9A 3MCKB 3EYVA 3QDGB 3H0TB 3DUSA 2ZCLL 4M9OA 3QZWG 5C9JA 2GCYA 5ETUB 4G7YL 4LSQH 3ZLQC 3IDIB 5GRXG 4X7EC 4XX1E 2HYMA 4YXHH 5HYFA 3WFEL 3AB0B 2J5LB 2EYRA 1QZ1A 1S7VB 4JQIL 2F5BH 3CVHA 5ICZB 4RDQG 1T7YA 3EDJA 3N1FC 1T7XA 2O61A 2EE2A 2W9LA 5IMOA 4YHZL 1KCVL 2ATPA 2H9GB 5C07D 3PL6B 1MFDH 5ESVA 4L9LA 4XNZB 3IJHA 4P2YA 2Q8AL 1L7TL 4QHUA 3WV0A 2DWDA 4G8FA 4GKZA 3M07A 1OL0A 5F96H 4JPIB 5JUEL 3O11B 5DMIL 4M3JA 5E1AB 5D1XA 2A1WH 3NCYP 1WZ1H 2R2EA 1NAML 1RU9H 3HMWH 1HHJB 3CXDH 2Q87A 1NPUA 3DROA 4S1SH 2BVTA 3BDYL 5C70A 1BZ9A 4P5MA 2PW2A 2BHYA 1OAQL 5AG8A 3O0RL 3GMOB 5C0FB 4G80B 1YEGH 3BMVA 4GQPH 5E70A 2V2TB 1PAMA 1A3RL 3D85B 3IFLH 1P6FA 4S1QH 1AQDA 1E6OL 5I0DA 3QUMB 3OXSB 4XNQB 2HVJA 2CUIA 4G8GE 5C0BD 3VXRA 4F57L 4CVZA 4KGJA 4LKCB 5IHZB 1PQZA 3WFHA 4HH9B 1G6RH 3MV7A 5SWQB 1ND0B 4J4PA 4OUOA 3UTTD 2Y5EA 3VFOA 3MRLA 3OZ9L 3B5TA 4WUUD 2ORBL 1WBYA 1ZHKB 2OL3H 4L8BB 4LPXA 3T3PE 1N6QH 5IHLB 2EYSA 3SE3C 1MCWM 1T5WB 3QCUL 1N2RB 2HTLD 2XIDA 1JPTH 2UVEA 3KVQA 5EC1A 1XGQB 3BRGC 1P9MC 1BFOA 3QIUA 3LAFA 1T83A 3O3UN 2DRUA 4FRWA 1G7LA 3V6OC 3WS6A 3SCMA 2BNRE 4GG6A 2FO4B 5HDQL 4RRPA 4N0UE 1CF8H 3E2HC 4PJ7B 4U6VL 1ZVYA 3L3KA 2DBLH 4KKAC 3OMZA 3K8KA 2F53E 43CAB 3HS0A 3B83A 3DMMB 1Z0NA 1IAIM 3MZTA 2GITB 4HQQH 4M6NL 1MRFH 1S7WA 5D1XD 3E0GA 2DQIL 5JA9A 1FORL 3E3QC 2F5BL 1KT2A 4E41D 2ZG1A 4I5BB 3WXWL 2ESVA 2B2XL 1EO8L 1FZJB 1A6UL 2A77H 3MNVA 2AGJH 2BY1A 5DVNA 3NBNA 4L4TE 3VFUB 4GAYA 3CFKA 1EVUA 3VXRD 4U3HA 2YPKA 4QF1B 3FRPA 3HAEA 1HHHA 3ALWA 3MV7D 4GBXA 4TNWK 5E00A 3VD3A 3NFPA 3V6ZA 2A1WL 2VLMD 3T65B 2XN9D 5D96B 4PJGB 2XQBH 3HMWL 4WI6A 2FNBA 3GSVA 4U6XB 4S1SL 1QPPA 2I25N 1X5AA 2D7TH 4EUPB 3WHXA 5IW3A 2DS4A 1F6LL 3BJ91 5IB5A 1HEZA 4DZ8B 3UJIL 1Q9KA 3IFLL 4JFEA 4YLQT 4P9HC 3GMMB 4HUXB 4N1EA 3C8DA 3WDIA 3QQ4B 1T7VA 2F58L 2W9EH 4NSKA 4L8DB 1IEAB 2ED8A 1IEBA 3SCMD 3G5VA 3SGEI 4UDUA 4X4XB 2NY6C 1DBKH 1AD0A 3BVNB 1N59A 2CRIA 4BELD 4LVHB 4ODXB 4PB9H 4RGOH 1G7QB 5AAMA 5FYJD 1AGEA 1ACYH 1HH6B 1WFOA 1KJ2H 2OP4H 2BVQB 3TT3H 2XZCH 5KSAB 1MFBL 4QHMB 4F37F 1A7QH 5I1GH 1IQDA 4Q7DA 2SEBB 3REWB 2YBRB 4JZJB 4RMVA 3DGCR 4GAFB 2CLVA 3QPXH 5ACMA 4OTXH 5HYQA 2ESVD 5JDSB 2YHGA 1CGVA 4RZCB 3MROA 4OB5H 4P46A 3AB0C 2J5LC 1CF8L 4F9LC 3OF6D 3QUXA 2RGSA 3SGKC 2GFBB 4GBXD 1I9EA 4QRRD 4B5EA 1MRFL 4QLRA 3PL6C 4CBPA 3IDNA 1VCAA 5J13B 1S5IH 1QLRA 3CDGB 1CG9B 4GW1A 4XNZC 5DQ9B 1LE5A 4CRPA 1P7QA 2XA8L 3L95A 1FNAA 1NCAH 4HGMA 4XP5H 4LPWA 1BOGA 4OQ1A 5KSVA 1WVZA 3LKQA 2A77L 3KYKL 4U6YA 5DA4A 5EBWB 1OP5K 1AE6H 5EUOF 4PD4J 3I9GH 2Q6WB 4JFED 3MRQA 3B9AA 1A9BB 1SJHA 4HX1A 5IJKC 4XWOD 4HJGA 5F7EL 2QSQA 2MCPH 2YC1A 2E7MA 4QXWA 3TZVA 1HKLL 4HXBL 1ZLSH 1MLBB 4A2MA 5MHSD 4OZIF 1FPTH 4JPKH 4NKQB 4HJJL 3TYFB 1TVHA 4H88L 3VCLA 4HFWB 1CFNB 5DEZA 1RUMH 1UWGH 5H2BB 5I73B 5EPMB 3BO8A 4U1SB 1NGPL 3GSNH 3QFDA 1NANH 3QDJD 4TUKL 3GSRA 3UTTB 1Q9LA 4WUUB