3BOVA

Crystal structure of the receptor binding domain of mouse pd-l2
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
104
structure length
104
Chain Sequence
b'LFTVTAPKEVYTVDVGSSVSLECDFDRRECTELEGIRASLQKVENDTSLQSERATLLEEQLPLGKALFHIPSVQVRDSGQYRCLVICGAAWDYKYLTVKVKASY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death 1 ligand 2
publication title Crystal structure of the complex between programmed death-1 (PD-1) and its ligand PD-L2.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 23
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2007-12-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bovA00
3ETBF 3FO1B 1E6OL 1BAFH 5L88H 2YPVH 5E6IA 1IGFL 1DVFB 1MWAL 3FRPG 4U1IB 3LQAL 4YDLC 5L8KB 5L7XH 2ADGB 4OGXL 5F3BB 1DUZA 4OM0L 1MCCA 5ESVA 2N7AA 1I3VA 3MO1B 3HG1E 1MWAA 3CVHB 5TF1H 2YBRB 3NA9H 1AI1H 2NLJB 2ATPB 2E6PA 3S36X 2B1HL 1IGCL 5JTWA 1Y18B 1WBYB 2IH3A 4L4VD 2E27H 4QHLA 2H2SD 3VFOB 4FQXC 3QDMA 1OGAD 4U1NB 2G5RA 1LP9F 2DTSA 4R4FH 2F19H 3GSXA 3UPAA 5E95B 4J3WA 5B3JE 5L0QC 2RFXB 4IRZH 1ETZA 4P46B 4PJ9A 1YZZA 3RNKB 5C2BL 4JHAH 2YC1B 3HZYA 3GSRB 3NCEB 2PUQT 1JF1B 4MMXC 3DIFB 3HRPA 5JW3L 1IKNA 3EHBC 1J8HE 4PJ7F 3MTRA 3RJDA 4TVPH 4JPKL 2ZUVA 5HHMB 4OD2A 1DVFD 1IEBA 1RJZB 4BFEA 1QHOA 4PRID 5GZOD 1U8NB 4U1MA 1NMCB 2VLRE 3LOWA 3C08H 4LSTH 1AY1L 1ZLVK 4WU5A 4GRMB 3OR6B 4PG9B 3P9MB 5DK2B 5DYOA 1IAIL 4G8GB 4E0RA 1EV2E 1SEQH 4JDTL 1PZUB 5KVDL 3LEYL 1RZ7L 3CFCH 2VC2L 1BZQK 4JKPL 3QNYB 3LDBC 2IEPA 4MGXA 3RVVC 4K8RD 3F12B 4ONGL 5E03A 1NGWA 4JY6B 5CFHA 1RURL 5C7XH 1T04B 1NAMA 1MRDH 2VUYA 3ARXA 2JIXD 1II4E 1IGYA 4AQ1B 3FO0L 3EOBA 1VFBB 1ORSB 4P46D 5IVOA 4JO1H 4WFGD 4GKNB 5DR5H 5TDPB 2IPUG 4JLRB 3DX7B 2Q8BH 2FIRT 2IALB 3E6HA 2HT4C 1QVOB 3VWKB 3OF6A 3O9WA 1KEGL 3T2PA 4X6BA 4G6FB 4XVUD 3G6JB 3OB8A 1VFAB 2VXVL 5IK3B 5HHQB 3MLZL 3STZB 1W0VB 1OPGL 1ZVSB 1HDMA 4PJGF 1SBSH 1DJSA 2BVUA 3DI2B 1IC4H 4ZS6D 1G9NH 3QQ9C 4UB0H 4RMQA 5JXEC 1JHTA 1LE5A 4E41A 4UTAH 4LP4A 1QEWB 5CUSH 1YMMA 3I9GL 2P8LB 5FOJA 4FABH 4G8GD 2FH8A 1A3LL 4P5TB 3HZKB 4ONHA 2CPCA 1IBGL 2VL5B 3X12A 4BELD 2EYTB 5HDBF 1NFDA 1ODAA 1MHCA 3O3EA 4HV8A 4FTVB 4LAQL 1OAZL 4R4ND 4DZ8A 3N06B 3L95A 3QRFM 4OQTL 3RDTD 1CE1L 5TE7H 4ZNEE 4BQ9A 1FYTE 3RWHA 1LEGA 3MMEA 4QF1B 5JW4R 3QIUA 4UNTA 5DJ2A 1KJ3L 4OQTA 2QADC 5D7JC 5J1TC 3MV7D 1HZHH 5HI5D 4O4YH 3VWKD 1RULH 1KOAA 3CZFA 4S2SA 5I17B 5KSAB 4XZUB 5JIPA 5FGSA 1NCDH 3QEHB 4H25A 5HJ3A 5T1KA 4QWWC 5IESL 3O11B 5KW9L 3W9DA 1ACZA 1UCTA 3BP4B 4XP4L 4QHNB 1ZEAH 2LV4A 5DJYA 4H20L 3SN6N 3OTTA 3MLWL 1IQWH 4LK4A 3QCVL 1DANT 3ARGA 4WEMB 1XR9A 1WT5C 3GK8L 3D2UB 3V7AE 2B0SH 5FYJL 1K8IA 5CILH 2V6HA 2NY4B 3QNZB 5F8QC 1XCTA 5IJVB 4KY1L 4RMSA 5GZNC 3KGRA 1U0QA 4HHAB 3EOAA 5BRZB 5EBLB 4TSBH 5CSGA 3S35L 3RUGF 1WICA 5I1JL 4OTXL 3ZMRA 4UIKH 3GMNA 5E2JA 1JGEA 4Z95H 4DUVA 4H1LB 4WUUE 2W38A 1ZV5A 4QRTB 3PIQA 4Q97A 2ED9A 5ENWB 1EHXA 3CFBB 4PLKC 4P5KB 4LSRL 5JORA 4H0HB 3GSQA 3OXRA 2HMIC 2NR6D 2YK1H 1XIWD 4KDVA 5GGTH 1JZ8A 1FE8H 3T3PE 3CC5B 5DFWH 4HX1B 3C6LA 5IF0B 3QJFA 1CQYA 5KSAD 4R26H 5ACZA 1XT5A 3E3QE 1DE4A 1MH5A 4X9IA 1CFTA 1S7TB 3LCYA 1X9QA 4MNQD 3SKJL 3IFPB 2HLAA 5CEZH 3FQXB 2Z92A 4KK9D 4QRSA 4X5LA 3WLBA 3BKJL 3FFCA 2VDMH 3D2UD 4XMKL 4P49A 4JRWA 1CFSB 3VFVB 4HSQA 32C2B 1OSPL 2DQTL 3O2WH 1JNLH 3WKMH 4LLQB 3P4OA 4H1LH 2HTKD 3M1BA 1QR1A 1BLNB 1MFDH 1NGPH 3IU4H 2D31B 2FJHB 5T5NG 2JCCE 5E70A 1NPUA 4KAQH 1CGTA 1JFQL 2ZNWA 5BRZD 3VFRB 2PYFB 2HTLD 2LTQB 4X5WB 3V0WH 5ID1B 4Y89A 3QXDA 1RUML 3B8YA 3KPOA 4MXWH 1YNLH 1JPTH 1S78D 2CDGA 2RB8A 4HUKB 3B9AA 4PJ5D 1SVZA 1JWMA 2AP2A 5EC2A 5JOFA 5ISZD 4XNXH 5D1QA 4AJ0A 1M71B 1CBVL 1QPXA 1HHGA 1AP2B 4L4TE 1RFDL 2DQEH 3VI4E 1JZ2A 3ZHLA 2SEBA 1INDH 2AJ3A 4H26B 1QLEH 1EZVY 5TQ0H 3QUMA 5HD8D 5AZEL 4HK3J 4LLMB 1JRHL 5CBEA 3LKNA 4W4OA 2IANE 4I9WD 4FQJL 2X4UB 5MI0C 1K4DA 2BRRL 4N0UE 1IGJB 2VSDA 3RPIA 2NY6D 1W0YT 5IB1B 3SE4A 5E6ZA 1HWGB 4F2MB 2X4RB 3H7LA 2X44D 1X5FA 3MLVH 2MPAL 1PKQA 3UTTE 4Q58C 3QWRA 3ARWA 1JZ3A 3QEQE 1IFHL 3QJHB 4EN3B 1S7WB 4KVNH 4OLUH 3DYPA 3IAQA 4RGNB 3QUZC 1VADA 1C16B 3P77A 3MBED 2XZZA 4DKDC 1IQDB 4MD5B 4YQXL 3RVWD 2P47B 1CI5A 1ZS8A 1YYMH 2BP3A 2OL3H 4PY8J 4GW5B 4LRNL 1OY3B 5CGMA 1P2CA 2I9LB 3DXAE 5ANMB 2NY7H 4P5MA 1XGRB 3AAZA 5GGSA 5J6HB 1FV1A 3DV4A 2JKXA 3LKPB 3K4DA 4BFBD 1Y6NR 3HR6A 2R2EA 5JDJA 8FABA 4F8QA 2QEJA 3ARUA 1D5BB 4LLVB 3MRNA 1MLCA 4MJ6A 4APQC 3B2VL 4OGYL 3IS0X 1D5XB 4EI6A 4JQVA 5CZXD 4XAWH 1P4LA 2FB4L 1WZMA 1T0NA 1OTUD 2EDLA 2AV7B 3HPLA 3FT2B 5DK0A 3V7AG 1ZHKA 3HI1B 1YEIH 4F9PC 4PJAF 1LO5B 1DQQA 4M48L 1XGPB 4PRNA 5ICZB 3T8XA 4FP8H 1AHWC 1L9NA 2RIKA 1AGFA 1HSAA 3MRCA 4HJJH 3RI5F 2DWDA 1LEIB 3UYPA 4NOFA 1P1ZB 4DZBA 4UTBL 3FQRA 4MX7B 1KTDB 3QFJB 4WVRA 3NFNB 1M6OA 2AK1L 4NT6A 1FLRL 1E27B 5EO0B 1N3NA 5SX4H 5F70A 5IMKB 1XH3A 5SWSB 4DKEH 2XT1B 1KJ2L 1DBMH 4KK6D 1RIHL 4ODXB 5D2NB 5FYLD 5I1HL 5KSVA 2FATH 4ZXBB 3WL9A 1VSCA 3ES6A 4XPAH 3MUHL 1YEJH 4S1RL 5CMAB 4YDLB 1KJ2A 2A83A 4XWGL 1KB5A 2ENYA 1Z9SA 5B8CA 2Y5EA 1N26A 2V5TA 1CG9B 3L3HB 1HNFA 1TCRA 3B8SA 1WF5A 3AREA 2VITB 3FB6A 2GFBB 5IV2B 4P2QD 5ICXB 5E4EB 4Z7VE 1DQJB 4G9FA 4OV6F 4P4KB 4R96A 3LB6D 1P69B 4UDUA 1V3JA 4JANA 5SWQA 4I77H 2CRYA 1TVHB 1R0AH 4NKIL 4XAKD 3BW9B 1KCVL 1JGLL 3DV6A 4LFHG 1MFBH 4AEFA 4WW2F 1YNKL 5E6YA 1I4FA 4HKXB 3MACH 2R0KH 4BZ2L 4AEIH 5KJRL 1U8MA 4WHYH 3VXUB 2IWGA 4FMFA 3W9EA 3F5WA 3IFNL 2DQCH 4GKSB 3OKOB 1SY6L 4JPIA 3ZKNC 4Y19E 1BEYH 1ZT1A 2X6MA 3V6OA 2HLFC 4XGZA 4ELMB 5ACLA 3KXFD 3GUTA 5D4QA 4QXGL 3OJ2C 5IFAH 2DM4A 1A02N 1BQHB 4KJWD 4AEHL 1NCAL 4IS6A 5SV4A 2GIYA 1EVUA 3VXTA 5CZVH 4N1CA 3DSFL 1KJVB 4UIMA 3X11A 4FXLA 5KVEH 3HZMB 5AAWA 4GBXA 2ZUWA 4WJ5B 1JNHB 3CSGA 1MF2L 2FX7L 3HE7C 2KZ1B 1M7IB 4WO4C 4F58L 3EFFA 3EDDA 3WS6A 3MRKA 3OKDB 4H8WC 4QXTB 4LLUB 2PW1A 4YHKL 1N4XL 4LVHB 3O4OB 1PYWB 3QULA 4HK3N 1CR9L 1FG9C 4J3TA 1V8HA 5HYQB 1KXVC 2GJ6E 1EHLH 4P4KD 4PJHA 2APXA 4NQCE 4M5YH 3P4MB 2PN5A 1DQDH 2QR0B 3BXNA 1I3RB 3T77B 5L2JB 4JFFB 4YUEH 4OCWH 1RZJL 4LKXB 2QHRL 4GMSH 1T89A 3HKFA 2H2SC 2X9WA 3VXUD 5FK9A 3QYCA 2FL5B 4H0IA 1GGCL 2BVOB 5I6XB 1NFIB 2W9LA 5F7KC 4ZTPL 3PGCA 1NEZB 2E9WA 1EUTA 3IFLL 1INQB 1FNEA 2WLYA 1B3JA 2ZCHL 1D9KA 4K71C 1U8JA 5SWZA 5H94A 2ADJA 2WBJA 2MKWA 1TVBA 2VQ1A 5HHOE 4MJ2A 4WHCA 5T1DL 4OCXL 5K59F 2EIDA 5D7IF 4LIQE 3DO7A 1ADQA 1EEUA 2R39A 4G6AD 4GW4B 4XH2A 1HHJA 4C56E 1YEEL 2OZ4H 4G42B 3RWGB 5JHLL 1AR1D 4YNYA 4NBXB 1JPST 2YSSA 2YD7A 4HKJB 2NCMA 4TQEH 2NYYD 2Z91A 3KYNA 2P5ED 4HS8L 5KSUB 3GSUA 3BP6A 2QSCH 4ZDHA 5DFVD 4BH7B 3VE0B 4PRPB 2XA3A 4K3EL 4JFZL 2VXUH 5EO9A 3C60D 2VLJB 1MJUL 3V2AR 3MRLA 3H8NA 1PZ5A 1ZXQA 3H3PL 4ESKA 1J5OL 3CLFH 4M6NL 4JFFD 3LRSB 2R0LL 3KWWA 2Q8AL 1ZGLP 3O6KL 3LN4A 4O2FA 1I9IL 1T7XA 5DD1H 4CW1A 4JKMA 5IOPB 2DB8A 5JW4N 1CD1B 1IEAB 1MPAL 5D7JB 1JZ5A 4F3FB 3V4UL 2APFA 2WSKA 4IDJH 4P3DB 3L5XL 4D3CL 1DFBH 1JI2A 4RFOH 5DDHB 1KLGA 5LBSH 3G5VA 3SDCA 1TETH 1HHHB 1YPZA 5FOBA 2BY1A 5LGJA 4PJFF 1CLZH 3GMLB 1D5ZB 1RU9L 5BMFL 4KTEH 4WI6A 1QG3A 4FNLH 4WWKC 4X99A 2Z93B 4WHYG 5F3HB 3V79C 3VW3L 1LHZA 1LQSR 2BOBA 1UM4L 2OK0L 4UUJB 2JCCF 2HT2D 5EA0H 2CJUH 1W72B 4IJ3C 5DJDA 5EOCJ 3U6RA 2EEAA 5EU4A 5FYKH 3MXWL 4WW1A 4U49A 1AGEA 1EEYA 4JFQB 3UO1L 1BHGA 4PRPD 3MZTA 2AEPH 3TYFB 1H0DA 5C07B 4DAGH 4ZFZA 2CLVB 2MTPA 3JUZA 1IM3B 3CXHJ 3EYOB 2EDXA 3HUJA 4WFHE 2XNAA 5ITBH 3AXLB 4U1HB 1FBIH 3VI4F 4RDQG 2CDFB 2R2HA 2DYPB 1WZ1L 4W68A 2I60L 4ZPTB 5FHAL 5FO7A 4BA8A 2A1WL 4XCYB 5DVLA 2GITB 1IM9A 2C4XA 1PQZB 2NY3D 3GMMB 4DK6A 4KUCD 1G7PA 3UTPD 3SDDA 5B3NA 1F00I 1TXKA 3L5JA 1WIUA 1X6LA 4EDXB 3DX6B 4GAJL 1T20A 3VDCA 3HZVA 5DJCB 1XGYH 4R2GC 5E1HB 3K8MA 4NOBA 2HJFA 1QRKA 2C1OA 2VDRH 3W2DH 1IMHC 1NEUA 4KKLD 4YFEA 3VXRE 3JXAA 1BVKA 5J12C 5L6YH 1H15A 2F8XC 1F4WH 3QG6B 3ZYZA 2Z31A 2MHAB 4OD3H 3LV3A 4G9DB 4PRHE 1UB5A 1C08A 2XA8H 2W60B 3C5JA 1L4IA 2X7LA 3QIWA 4U1SA 2DQUL 1EBAA 3NACL 5KSBF 2GT9B 4JFPA 1AD0A 2PCPA 3LPFA 1ACYL 4TSCL 4LDLB 2Q86B 3Q3GB 4NKDA 1A6AA 3TCLB 5IWLC 3TO4C 3QA3A 4PJBE 5E2VH 5HHPA 5FHBH 5DJ8A 3TNMA 4Z6AT 4O51B 4IOSD 5IHUL 3BPCA 4LU5L 4NKMB 2HWZL 1SYSA 4PRAA 1NCCL 4FFYH 4D9LL 3CVIH 3NCBB 5F9JB 4ZUVB 5HDLA 5GSVA 1HHIA 3G5ZA 4NQDA 4FFWD 5KS9E 4PJ7A 3QXWA 2PYEE 3U9PH 1D5IL 3RWJB 4OCNC 3HAEG 5MI0B 4MZ3A 5K9KB 4M6OL 4OCSL 4M62H 4HIHA 2PXYA 2L0DA 2ATKB 1CGSL 4L29B 4YHNB 2CLRB 4OCYH 4QHMB 3P0YH 5FUOH 1AKJB 3KPSB 5D1ZC 1GGIL 1T6VN 2V2XB 3DUUA 2ILLA 5E08H 1X5GA 4KWUA 2YPKB 3P4NA 5BVJA 3TBTB 4L3AA 4OUUA 3SJVB 1MHPH 1SJEB 2ORBL 1T5XA 4KK9C 4G7VL 4HFWB 4Q6IC 3ORJA 3C2AL 1TQBB 5IMLA 3T4AB 5CJXA 1GAFH 4M03A 4L8CA 5HPOA 2KH2B 3RWIB 1RUAH 3OWEA 2J6EL 3IETA 4Q0XL 4JO2L 5I8KL 4EI5A 3BD5A 3VFUB 3FO9A 5I75C 5A3IC 4IRJA 1KBGH 4MA1C 2W0FB 4GJTB 4PY8I 4JPWL 1HIMH 2J6EA 1BWMA 1EUUA 5HGHA 1HI6A 5FYJD 4RNRA 2KPNA 3KS0H 1QLRB 1WTLA 3W81A 5C1MB 5H2BA 4JKWA 1JN6A 2A6KA 3QPXL 2OJEB 2B5IB 4YXHH 5EBGA 1Q9LB 1U93A 4TUJA 2I5YH 3F6LA 4YHIB 5JUEH 1ZT7B 1V5JA 3O6FC 3VFNB 5IKCB 5T1MA 5C86A 5FCUH 3L3JB 4WIQA 4HWUA 5C0AB 3NCFB 1MHEA 5HYJA 3WV0A 1AKJD 4FQQB 3ILQC 4MA7L 1R3HA 1TVDA 4LVOC 1BFVL 3V0VB 1Q1JL 4ODWB 1N6QL 4KRPD 2ESVB 1HXMB 3SCMA 4OKDA 3EOTH 1Q9WA 2HH0H 2GK0B 3S8WA 2RQ8A 2UY6A 3EZ8A 5I74C 2MJWA 1I3GH 1JWUB 5EZLA 4WDIA 1UJTA 5B39A 4FFZL 3U2SB 1GH7A 4XMPL 5DRWB 4A6YB 1HILA 4XCFL 2AABH 2BNRA 4HIIA 1PLGL 3KYKL 1MQ8A 1T2XA 4YEFA 3PP4L 3SDAC 3VA2C 4ZODA 1YN6B 3F7YA 4HXBH 3FRPA 1KEMH 1NMAL 1MCPL 2Y5TA 1OM3L 3GMRA 1X44A 4YHOL 1L0YA 1HSBB 4JM2F 5IIEB 3VGAC 2DJSA 3W5NA 4Z7UB 1S3KH 3CU7A 4LSPL 3UZVB 2K3TA 4OCRH 4QRPE 3BZEB 1J1OL 4QXWA 2VE6B 4MMZC 1N0XH 3G04B 1NCBL 4EJ1C 1LEKB 2HVJB 4X4ZA 1F4XL 3QG7L 4EZMA 3R4DA 5E56A 1MCEA 4XPHL 3QXUA 2VERN 3QFDB 3S88L 3OKLA 4ZOEA 1G7JB 1T1XB 3HFMH 4U6YA 1IGIL 2IQAA 4OB5H 4U1JB 2BDNL 1CICB 1VPOH 3AMLA 1UACL 3BGMA 5DEFA 1OCWL 4JRYE 1MCNA 4K23H 4QTIH 4WHTA 1JMZA 1I7ZB 4DKFL 5IHZA 1R3IH 1U42A 1WQVT 2ESVD 4LASL 1YNTA 4HCRL 1PG7X 2Y4SA 1OW0A 4NUJB 1I1YA 3QDGB 5CZXC 5DRXA 3RUGA 5IB2B 3LPGA 1MFAH 3B5GA 2YXMA 1GOHA 5I1CL 4DGIL 1BZ7A 1QP1A 1CFQB 2YA2A 2FDBP 2MOVA 4GAFB 4P48A 3J8F7 4N9GA 3OXSB 4P2RE 4QLRA 3TZVA 3BT2H 3D0VA 5DZOA 2XPGB 3D69A 2EIEA 3VA6A 4UINL 1EEZB 4GG6B 4HUVA 1U2HA 4QOKE 3QCUH 4WRLA 5E5UB 3D25A 1WISA 4ZSOB 2ZCLL 3BX7C 1BBJA 3FQWA 1MJ8H 4KPHH 5EPMA 3L3KB 1MCBA 2GKIA 2FHFA 4GQ9H 4J23A 3ZKSD 1A47A 4HGWA 4ELKA 5IBLC 4YK4C 4D8PB 3LVEA 2GSIA 1NBZB 1U8IA 5KZCB 1GJIA 1T1WA 1MHHA 2ZSVB 1CZ8H 4K9EH 2VLLA 6FABL 5DTFA 3ROLA 1RUQH 4HWZB 4L3EA 1YEDB 1EFXA 1F97A 1CICD 3ZDYF 5T3XH 1N8ZA 4EUPB 5DMJB 4PJ8B 1VFOA 2R0ZL 4ORGA 4DJMA 1SM3L 1F3RB 3Q5TA 1G7HB 1OAYH 2PTTA 5CHNB 2AJVL 2EECA 3QDGD 4P59L 5H35A 4XP6L 1O7VA 2CUHA 2HA1A 4L4VE 1ED3B 4ZPVA 3TVMD 1TFHA 2X9YA 5C0BD 5JW5A 1J1XL 1Q38A 1OGAE 1FFPB 3IVKB 1U91A 1G6RB 2AV1B 5DQJB 1QA9A 3UP1A 3VMOA 3CCHA 2DIBA 4R8WH 5I30H 1H8NA 2V5SA 3MZGB 4RBPK 3TH2T 3V6ZA 1OARH 3QEUB 2FJGB 2CIIA 3WIHL 4M61A 4P3CL 4H8WH 1YQVH 4MAYA 1IAMA 3FN0L 4XTRC 4NFCA 2NX5B 4K71B 1TNMA 4EUPH 2J5LB 2PR4H 5TQ2H 5KZCD 3VXSB 3WIHA 3EFDH 2XZAH 4OI7A 3CDGA 5D5ME 3LKSB 3NZ8B 4OF5A 1NGYB 3V5DA 3O45A 4CDGC 3ULVD 3PQYB 4LSVH 1JYNA 3LRHA 5TDOB 2OSLB 2YD4A 4PGBA 2F54B 3V0AC 1BVLA 4PRIE 4PJ8D 3MRPA 4XBPB 5J9PB 4HD9A 1A6ZB 4WV1C 1G6RH 2R56H 4P57A 4QY8B 3RI5K 3OG4B 5D93B 1F6AB 2CO7B 1MIML 5GJSL 1CD9B 1UENA 3L9RA 5CP7B 3S3JA 3KNBA 1GHFH 2C1PB 4HF5H 3ZHKA 1FG2A 3BHBB 4FHBD 1I1AD 3TA3C 3B2UD 3HI6H 2WK2A 1I1FB 4EQ2A 4ODTH 1K8DA 1GZPA 3INUH 2JLLA 5IEKB 2DBLL 4V1DB 1RK0B 1N5AA 1RIVL 4XCNA 1KNOB 1J11A 5F1IA 3OV6A 1CDBA 2MQCA 2Q7YB 4WFGE 3HG1A 3O6LH 3MOBH 4WWKB 3R0NA 1CU4L 3F7QA 5E8NA 1MSPA 5JHDD 3VXSD 1QFWL 3BDBA 1JE6A 3X3FL 2EO1A 3DECA 3PQYD 2YD2A 4W6WB 1A1MB 1L6XA 3G6AA 4CVUA 3FB7B 3RZCB 4PV9B 1I7RB 2AJSH 1RUPL 4CU6A 4HWEH 5FA3A 1JUFB 5J1AB 2HN7A 1WEJH 4JZJB 1Y0LB 1AC6A 1XFPA 3QIBD 5SX5K 3SE9H 1WITA 1AR1C 4X80H 5GISL 1WBXA 4WI4A 5AZ2H 4G8GE 2LFGA 3EYSL 3NPSC 4HJ0C 3TBWA 3B9KC 5FYKU 1AO7D 2FD6L 1OT2A 4ODHL 4XMLH 5DFVC 4OLZH 3QUYB 4L4JA 3S4SB 5C0DB 2NY5C 4G8FB 1KTLB 3OAYK 3D6GA 1J8HA 3MRMA 3QO0B 2VWEE 5E6IC 5EUKA 1D6EA 1WJ3A 5C70A 3OGCA 4TUKL 1FVCB 1U3ZA 4MHHG 4EVNB 1AXSB 3DX9A 3MOQA 4V1DD 5CD3B 1JK8A 5J4MA 2VLRA 5GS2D 3LQAC 3VFPB 4Y5YB 1XCQB 2AERT 3DOSA 4Q9RL 3MV7E 2BSTA 1NC4B 1ZLWK 2MNUA 3VG9C 2ITCB 3Q0HA 2AEQL 4D2NA 2LAGB 1AFVL 4H5SB 4YR6B 5JA8B 4S0TD 5MEOB 2C7UB 4PTUB 3CFDB 2IADA 3S5LG 3RZCD 1R24A 2AGJH 5FV1L 2R9HD 4G43B 3MJ6A 3BZ4A 5E8EA 4PJ9C 4I4WA 4ZAKB 4AL8L 4F7MB 1MCHA 3VRIA 4LF3B 3IDYC 3H9ZA 3EBAA 3SEPA 1DQLL 1L7IL 3O0RL 4PJEF 1HHKA 1IKNC 2ZOLA 4BFIA 3TO2B 4LOUD 4U7KA 2VZVA 3PL6A 2BY0A 1CL7H 2NTSP 4POYA 3KPLB 5BO1H 2R4RH 1OSZB 3PWJA 1XMWA 2X4OA 5CEYA 1P7KA 4OJFH 4NO0A 3ZZ1A 3LS5H 3FRUB 3VH8A 4HBCH 1FDLH 3PUCA 3MC0A 1NC4D 3PDDA 3PWUB 3CD4A 4OLYH 2VZTA 1YDPA 2CDEB 4U1KB 3WHE0 5F93C 3OJDB 1B2WH 1OTTD 4P2OA 1MCRA 3VGGA 4PJDB 1GPOL 1KACB 4WNQA 1HK6A 4MNQE 3K2UH 4ZNEA 1FYTA 4PP2A 2UVEA 1A4KB 1JV5B 1C5BL 3MRJA 3JBG7 4ZAKD 1S9XB 1HINL 3LHPH 2P8MA 5C8JB 5FB8A 3UYRL 5DMIH 2VDKH 4LCWB 4Y5XB 3CSYB 1D6VL 1MJJB 2X70A 4JRXB 3JV0A 1FGNL 1D7FA 1N7MH 5HYFA 1FZKA 5F1NB 4ODUA 5BRZE 1X7QB 2XXCB 4UT9L 4L8BA 3I6KA 1EIBA 2CRMA 4XC1H 4DW2H 4XVTH 2R2BB 5ID0A 3I75A 3UMTA 1HXYA 1BFOB 1S7UB 1QSZA 3ZDZF 4X0KB 3PDOA 3QHFH 2XG4A 4BZ1H 5J3HD 4PJ5E 3P9LB 2QQLL 5DD5L 5IW6A 5ISZE 2IPTL 3T1FB 1X3DA 5CLTA 5GPRA 3GRWH 2K7QA 4KRLB 2F53B 4CU8A 4OFIA 3CH1A 3NIDE 1M05A 2A74A 4WHDA 4ZTOH 2DS4A 5CJQL 4AG4L 4L1HA 1JWSA 5EWIH 1UQSB 3GMOB 5I66A 3TT1H 4S11A 4I9WE 1JPFB 3EYUL 1A64A 4N8VG 3MRGA 2V5MA 1VKXA 4LVOB 3P30L 5F72S 1DLHA 1S9VA 1L9MA 3QIUC 1IAIM 2GUOB 5I74B 3QSKB 1GZQB 3BPLC 1NAKL 3DVGA 1P84J 3V6BR 1KENH 1X5AA 3MRFA 4YPGB 3GSWA 3SDAB 1B0RB 1UWXH 3UZEA 1F3JB 3IB4A 5T1LB 2HVKA 4OZFB 4K94L 1KIRA 1U8LB 4RAHA 1ZANL 3GMQA 5I1EL 5FM4A 3TM6A 1EO5A 4OLEA 2JELH 4TULL 3ARGC 5CIPH 1W0WB 2RBLA 1QFHA 3E6FB 5CJ8A 4K7FA 4WI2A 3GIVB 5AAMA 4FQ1L 3IDIA 5DJAA 4UOJA 2YS4A 2A6IA 4MCZB 5HYSA 3IDUA 4ONFL 2EDNA 4JVPA 2XTJD 3NBNA 4IHOB 1NFKA 2JCCA 4NFBA 5F7FA 1EAPB 4EXKA 2VIRB 4BKLA 1NDMA 1F2QA 3PHSA 1I9RH 1P9MA 4ZUTB 3WLWD 1EX0A 5EORL 1IT9L 1TJHH 3QRGH 4D94A 5I1LB 2IH1B 2J8UF 5J0BA 5C0IA 3MLTB 3Q6GL 3LKOB 3O4LB 4DK3A 2CIKA 4ZD3L 5JPNB 1PG7H 3CFKB 2OJZH 3BPOC 4L4TA 2OQJA 3EJYD 2D4FA 4QNPE 4ZQKA 3C6LC 4KRPC 3S34H 2H6PB 5AWNL 3GIZL 1MQKL 5DEGA 3U0TA 1AXIB 4KI5F 4X98A 5T1LD 2WQ8A 4PGEB 3EYVB 4Y4FD 3PGFH 3B6SB 1RD6A 2IANA 3A6BL 5BV7L 3QZWA 4CUCA 1JGUH 4N0UA 2XN9B 3AVEA 3I02A 3MGAA 2BY2A 3P9WB 1KELL 3ARBA 5A2IH 3VFSB 3H42H 1J05A 4M7ZC 4HQQL 5HHXH 4TN9A 4Y2DB 1IGMH 4K3JL 3FO2A 4MSWB 1SJHB 3EO9H 2VZUA 3C8KA 1B0GB 3UTTA 4HEPG 5FYLE 2YWYA 4UV4L 2K9UA 2B4CL 5F9OH 4WUKL 5FIEA 3QEQA 3UC0L 4OZGB 4JJ5A 4XWOD 4KROC 3WIIH 7FABH 1F13A 1FRGL 5GGQH 3K46A 1MJ7H 3DPBA 1A14H 5ABDE 4I0PA 3OKMB 3U4BH 1HOCA 3N1FC 5D1QC 3HC0A 2XKUA 3O4LD 3BQUB 3MRRA 1JHKH 4P2QE 3D48R 1G7MB 1D5MB 3F7PC 5T3ZD 4HJGB 3RA7L 4MWFA 3CX5J 4WY7L 3KYOA 3DXAA 4LL9A 2FZ3A 2W07A 5HPMB 4XAKE 3K1KC 4LSQL 5KVGH 4W4OC 4ZNCD 4KC3B 3MUZ1 1NJ9B 2BCKB 3JWDH 3O81A 3LMJH 2D7TL 4GS7C 1WUNT 1CWVA 3CMOL 4XBGB 4PB9L 1MVUA 1S5HA 5CBAA 4HS3A 4OM1L 1YY8B 3ARDB 3GB7A 4YBLC 3A6CL 3KXFE 1IGTA 4BSWA 4B5EA 5I0ZA 5JXAH 5DO2D 4MXQC 4JVUA 3AUVA 1FGVH 4U1GB 1YQ2A 2X4QA 3MLXH 3I3EA 5GGVL 2VDLH 3P73B 1BBDL 1YEFL 2E9IA 1R3KB 2FWOB 1BX2A 5E8PA 1BREA 1A6UH 2N56A 5D7SL 5DJZA 5HGBA 2XG5A 4WV1B 2GAZA 3OJVC 4G8EB 3HNSH 2AJYH 2XWTA 3VDAA 5D7LD 4XNZB 2Y7QA 1HWHB 3I2CL 2F74A 5CGYC 3LKQA 4HDIA 3DRQB 4PJXB 4MNHB 4NN5C 3TA3B 4F37F 1XR8A 3U7AA 5FM5O 3DRTA 1J0JA 4TVSa 4CU7A 1U3HA 2ZCKH 2CKNA 3X17A 4YX2H 3G08B 5E1AB 5GRUL 3FB5B 4JFDB 2R1YA 1FL6A 1LD9B 3VXUE 5EZJA 3G6JF 3O8XD 4MD4A 2FSEB 3KYAA 1P7QB 4JQVC 3IAPA 4JAMB 4TNWF 3JTTA 4X4YA 3OAZK 3ARDD 1NSNH 2C3VA 3CLEH 5A16B 4CN4A 4JN2B 4ELME 4LMQE 2JJSA 2ZUQB 4Z7VA 1MCFA 3MA9L 1MVFA 3WSQL 3CUPB 4NO3A 4L8DA 5CJOH 2VZ3A 3EGSB 5FDYA 4X5XA 2OMNA 1QR4A 1WCBB 1UA6L 2HFFB 2EDRA 2X4PA 4P9HC 1T1YB 1UM6L 2FBJL 2ITDB 4QHUA 5EZIL 4CADB 4NSKB 4Y19A 4FXGB 5AYUH 4XNQB 4POZD 5HI3D 2P5EE 1S7VB 4ETQA 2AJUH 1GC1L 5INCB 5EFIB 2VLMD 3L6FB 2X41A 3B9KB 4HC1H 4KGJA 3EDFA 1RPQA 3F65A 4P9ML 4NNPL 1QRND 1EO8L 4YAQA 5LCVH 3U36B 4JFFE 2DOCA 4JM2A 1MCJA 3RVUD 3UBXB 3B5TA 1T4KB 4JFDD 5CEXA 4NKOB 5AG9A 1ZHLA 3CK0L 4O02H 4OI9A 1YEGH 1AJ7L 1OVZA 1C5DA 1AC0A 3HE6D 3TJHC 4JCLA 4C59B 4LDOB 2GJ6A 1CIDA 4QHLB 1TZHA 5DJXA 1UH3A 4K3DH 5IVZB 2WUBL 3UCRA 4PGDB 4NQCA 1CTNA 1EVTC 5K9OA 1F02I 2ZUUA 4O9HH 3GSXB 2IAMA 4TOYL 4OQ1A 4YIQA 1G1YA 3BP5A 4YHZH 3MYJA 1TQCC 4FS0A 1ETZB 3MGTA 1KPRB 3X3GH 2NY5H 1AXTL 3HC3L 3BGFC 3PWLB 4W81A 1CLYH 4M7JH 4F7PB 5KN5A 3WJLA 4EQ3A 5I15L 1OOAA 2IBGA 5E2UL 4AYFA 1FL5A 4PRPE 2BHUA 1P5UA 4LIQL 1IGFH 1MWAH 2KDGA 4AENA 3HAEA 4MJ5A 4OIIH 1J0ZA 5BZWA 4OGXH 3SY0B 5C0ND 1JGVL 4GBXC 4YHYC 4OM0H 1GGUA 3KPRD 5HHOA 2DQDL 1IEBB 4M3KB 4LNVA 4U1MB 4GRLA 4N5ED 3WS6C 4UAOB 2BOCB 3ARVA 1UM5L 4C56A 4WU5B 1GSMA 5E7BA 5F21B 3UTPE 1QBLH 4NN7B 1IGCH 4LPTA 5DYOB 4UNVA 2Z35A 4E0RB 1MCIA 3MJ7A 2W65B 4MZ2A 3K8LA 5L2KD 1FVEB 3P0VL 2E5EA 4KJPC 1CFNA 4Y88A 1JGDB 5AUMA 2NW3A 3CXHK 2GTWB 3IGAB 3T08A 3F7VA 2DAVA 1J12A 1NGWB 3MRIB 1IZJA 4D0DA 2ICWA 3L3IA 1NAMB 4JFOA 1IGYB 1KLFA 1T89C 5DXWA 5C2BH 3EOBB 1HE7A 1CXHA 1RZJC 1KYOJ 1VB9A 1I8MB 2YXFA 3E6HB 5JW3H 4TSAL 2YZ1A 4JHBA 2XQYK 3O9WB 4X6BB 1RZ8A 4ZO9A 4PB0H 1D9KC 3C09B 4PTTB 4YHLL 1Z5LA 4IRSB 5F89A 2EYRA 3K74B 3HR5B 2WBJC 1ONQA 3O3UN 3UTZA 2AAVA 3MR9B 3ULSA 3VD4A 2NZIA 2GCYA 1AY1H 2CKBB 1HDMB 5EOCL 5EBWA 3NMEA 4R4BA 4YE4L 3SBWC 2C4FU 4HUXA 4F7EA 4Z76A 1JHTB 4JDTH 5KVDH 2DM3A 1G7LB 2KUTA 3LEYH 3TBYB 4E41B 2CK0L 4LOUC 3QI9A 4CMMA 1NAMH 4JKPH 1VGKA 5C0FB 43C9A 4CGTA 2H1PL 5DF0A 2CR3A 4ONGH 2FECI 1K9TA 2QL1A 3RY5A 4J6RL 1MHCB 1DBJH 2H26A 4HV8B 1RURH 1UGNA 3FO0H 3DARA 2Z9TA 2NW2B 4GXVL 3K81A 2AQ1A 3ZE0E 3RWHB 2LQRA 3MMEB 2MCPL 1XF3B 3CGTA 3G5YB 3WS3A 4JQIL 1NBYA 3QDJB 1U41A 1KEGH 2GHWB 4CNIA 2DI8A 3SDCC 2VXVH 5FUCC 1A7OH 3IJYB 3STLA 3MLZH 3CZFB 2XZQH 2H45A 4LLYB 2YOCA 4M7LH 4S2SB 4H25B 2DQFA 5T1KB 4QGYA 1OPGH 4IRSD 5J6GB 1XF2A 5DHVA 3W9DB 5IMMA 2JK5A 4M9PA 5DJYB 3VXRA 3TFKD 1INEH 5CCKH 4LCCB 3B3IB 3SO5A 2O5YL 5LWYL 3IDGA 5B38A 1K8IB 3MCKB 3WUWG 4XPGL 1IBGH 3DROA 2HJLA 3OKKA 4GSDH 4PRHA 4Y4KB 1UZ6F 1XCTB 43CAA 3RX7A 4WI9A 1TJGH 3QPQC 2EYSB 2F15A 3DMMB 5FYJE 4LAQH 1I7UA 3RL1A 3TWCL 3OB0H 1N6UA 4OQTH 5D71L 4OI8A 3EOAB 3IT8D 1CE1H 2X89D 1MRFH 4XVJL 4W6YB 3RAJL 3BSZL 1DBBL 4NJAH 3EIFA 4X6EB 3KS0J 4LHUB 5T5FL 4KVCL 3OSKA 3M17A 1FNGA 4WU7A 3T0XA 4PJBA 3PIQB 3T0EB 1U8HA 5JORB 1PBYA 5FA4A 5DLML 2BFVH 3QDJD 5HVHB 2ARJQ 2RAMA 1NUDA 1N5YL 1QHPA 2GW5A 2VN4A 1H3XA 4YDJA 4QXUL 1U8OA 5IESH 4NWUL 1ZGLB 3C6LB 1G0DA 3QJFB 3L1OL 2VLKB 5KW9H 4TTDC 4XP4H 1DE4B 5KS9A 1WCQA 1YY9D 1MH5B 2DMBA 4PGCA 4UV7L 3MLWH 4NQSA 1B4RA 2PYEA 4I18C 3GK8H 5C0EA 4BSJA 1UVQA 1UZ8A 4LHQB 3MCG1 3TCXA 2HRLA 4QRSB 3WLBB 4NRZA 2Z31C 3FFCB 4XP1L 2ZWLT 3GSVA 2BXYA 1KGCD 3U1SL 1OF2A 4KY1H 3OKNA 2IPKB 4Y4KD 3QIWC 3M1BB 3DMMD 1QR1B 4PJCE 2V7HA 3S37X 4OTXH 5I1JH 2DL9A 2D4DA 3ZKXC 2P24A 4X8JA 1E4KA 4OF3A 2VDPL 5SX4I 1WWWX 5I1DA 3KPOB 1A9EB 5F7MC 4BJLA 3VWJB 4LSRH 4LHUD 2I9TA 2CDGB 2XTJC 3FQUB 4QT5A 1JWMB 5D9SA 5F7LB 1S8DB 3T0ED 4B53A 5I18H 3MREA 3T2NL 1HHGB 1A6TB 3FONA 4HAFA 2A2QT 3OKEB 1F11A 3FT3B 2SEBB 1E4XH 1DQTA 2AJ3B 2ESVE 4MJ4A 3FOLB 3ARRA 4J1UA 5JZ7C 1P5VA 3QUMB 4RX4D 2VLKD 4P23B 4UT7L 1OP5H 1EJOH 2Z4QA 4ELMF 1V7ML 3LQZB 5DWUH 1W2KT 3MNZA 3FOMA 4WUUD 2PXYC 4WTXA 4XMKH 3W0WD 1B4JL 2DQTH 3RPIB 5IROC 5J8OA 3UAJC 3NCJH 4RA3A 4Y4FC 2FYYA 1SEBB 1ZHNB 4R97C 4YBLB 4XB7A 3WEXB 1RQ5A 3BEVA 4UNUA 1VCAA 4Z7UE 1PKQB 2J88L 1HQRA 1VEMA 3ARZA 3GHBL 3D85B 1ULVA 5CJXC 3SKUD 1NLBL 5HSFA 4XRCA 1MY7A 3NCYP 3UZQA 1FL3A 3P77B 4EI5C 3QUMH 3VWJD 4IRJC 1CBVH 2EH8H 5D70L 2QSVA 2CXGA 3H9SD 1ZS8B 3U46B 3O3DA 1F58L 4U6TA 5F6IC 1P2CB 4EIZC 3B4NA 2NXZC 1HNGA 5AZEH 1VHPA 3GO1L 3W82A 1JRHH 2AEWA 3AAZB 4P5MB 5GGSB 1FV1B 3TPUA 4P23D 4PP1D 5HBBA 3QDGE 2BRRH 5FO9A 3ZDXE 1A1OA 4J2XA 8FABB 3WFCL 5C0BE 3GMPA 4KGLA 2X2YA 3MRNB 1MLCB 4JFEB 3CDYA 4MJ6B 1LDPL 5JPMA 2YKLL 4LMQI 5FKAA 4BFGA 4EI6B 3LS4H 4GG6E 2UZIL 5HYIA 1VA9A 3V4PL 1TJIL 4ZSOE 3HPLB 4JRYA 2YHGA 1ZHKB 2DLEA 1IFHH 5TH2B 2IBZY 3BPNC 3T8XB 5I1KL 4UILH 3W39A 1QFUH 4Y16A 2W9EH 2BHZA 3D85D 3UPRA 1AGFB 1HSAB 1Q72L 1XF4A 1LILA 1T7YA 2X4NA 3MRCB 3C5ZB 4N0YH 4YQXH 2DWDB 4J4PA 1T22A 1VERA 2VISB 3LRGA 4P2RA 3ULVE 4DEPB 3ALPA 3P40A 4OFYA 4LRNH 2GJJA 3DX8A 1M6OB 4NT6B 4QOKA 2V2WB 5AG8A 1C5CH 1N3NB 4HT1L 4HBQA 4MNGB 8CGTA 4MJID 5BVPH 1XH3B 4OZ4A 2V2TB 1YMHA 5DMGC 5HDQH 3HCVA 4MYWB 4X7SL 2A0LD 5FXCH 4YBQC 4JPVL 4MCYA 4UDTA 4ZFFA 3LZFH 4XB8A 1UJ3A 2CH8A 1F2XK 1NLDH 1KB5B 2OR9L 5DI8A 5B8CB 3VXOA 1CD8A 2X4SA 4JFED 3S5LA 3T0AA 3SKNB 1TCRB 3AREB 3FB6B 4P4RA 3TNNA 4P9HH 4U1LA 4MA3A 2YRLA 4HK0A 4LEOA 3V6FB 3WO3B 2YPVL 4R96B 3RIFF 1KB9K 4NPYA 4XBEH 1T2JA 3V4VL 5SWQB 1R5VA 3PJSA 4PPTA 3RTQB 2BSRA 3RY6A 3QB7C 4UTBH 4JFHD 5JHDE 3QH3A 3VXSE 3BDXA 1I4FB 3C5ZD 4FRWA 3R8QA 4L4VA 1LNUA 3TZVC 5EU5A 2AK1H 1TQCB 1UB6A 3W9EB 5C0JA 1FLRH 1OGAA 2YPLB 3PQYE 4JPIB 1FNLA 4OGAC 3LN5B 2E9JA 3BN9D 5LJYH 3BKCL 1KJ2H 3TBVA 1FNSL 1CDGA 1RIHH 5I1HH 1KB5H 3R06B 4R4FL 2R8SH 2F19L 3PABA 2O26U 4IS6B 3SDXE 2P49B 4UIMB 4IRZL 4XWGH 2HFEB 4YHYB 2CUMA 1T7ZA 2J4WL 2V7NB 4YDIL 1AO7E 1KPVA 5HI3C 4LCIH 4JN1H 2XIDA 4RFEA 5D5MA 5ILTL 2Q76A 4IDLA 1A7PL 5I8CA 3FO1A 3S3PA 4JZNA 1I9EA 4X7TB 2W59A 1MI5D 1QFPA 1DVFA 1U36A 3CVHL 5DD3H 4F7TB 4NNXA 4BYHA 3ZE0F 4Y4HB 2ADGA 3UJTH 5F3BA 4PRIA 4NKIH 1KTRL 4V1DE 3RVUC 1DQML 3MV9B 1KCVH 1JGLH 1HYSC 5ERWA 3RGVD 3MO1A 3MA7B 5I71C 1YNKH 3CVHA 2YBRA 3RTQD 1OB1B 2NLJA 3LEVL 1A1NB 3HE6C 5ADOL 2ZUYA 3MPCA 1Y18A 4AEEA 2QTEA 5FK9B 3C5SA 4OIAA 5FM5M 4KKAC 2EH7L 4U1NA 2YPLD 4QXGH 4RIRB 1JPSL 4F37K 4WWID 3PGCB 1JHLH 3QUXB 2JIXA 5IVXB 1NCAH 1FNEB 5DMKA 4HGMA 4MAYC 5C2UB 2LAAA 1BM3L 3NGBB 4L5FL 4P46A 4D9RD 2D7OA 3FHQA 3RNKA 1MF2H 3ARFB 1U8JB 2FX7H 5SWZB 4MA8L 5H94B 2ADJB 4KFZC 1CXKA 1TVBB 4YDKH 3WNNA 3PWVA 2YC1A 3CIQA 4JO1L 4HWBL 3GSRA 4TNWK 35C8L 2PO6B 3DO7B 5C0CB 3T4YB 1HHJB 4YHKH 5ELIA 1FIGL 1WZKA 3FJTA 4PRDA 4RGMB 2YSSB 2Y6SD 3ZTJH 2OR7A 1FO0A 4HWBA 4TRPL 3T0DA 4F15C 1EFQA 1RJZA 5I76A 5FGBC 3BP6B 4Y4HD 4NWTL 5DC4B 5EULV 4L1DA 3MV9D 3TEUA 4RQQB 2Y07L 4X7CC 3P9MA 4HGKC 1RZJH 4OGZA 3MRLB 4G8GA 5IM7B 4F9LA 1GOGA 4C83B 2Y23A 4NYLA 4DOHE 1GGCH 3Q5OA 3LN4B 3MJ8A 4KH2A 2ADIB 3MRDA 4PBWD 4CW1B 4MQXC 4GLRH 3IFLH 3F12A 2EXWD 5GHWL 2ZCHH 3RDTA 1T04A 3QUXD 1ADQH 3QHZL 3G5VB 3SDCB 1YPZB 5FOBB 5LQBH 3RBGA 3WUZA 5T1DH 3RVTC 2VL4A 4OCXH 4AH2B 3ARFD 4X99B 5GGSY 1I8IA 4JLRA 4XP9L 2XTLA 5E7FA 3MV7A 4FG6C 1YEEH 2IALA 4YDVB 3TT3L 3VWKA 5B4MD 2PO6D 5C0CD 2OS7A 4KHTH 1R6VA 4PD4J 5DJDB 3RRQA 3U6RB 1ES0A 1VFAA 4O4YL 5EU4B 4HS8H 1RULL 1A2YA 3ULUD 4U0RB 1W0VA 3DYMA 1I9JL 1X4ZA 1BZ9B 3KPPB 1EEYB 1ZVSA 1MJUH 3B5HA 4O2CA 5J57B 3QXAA 4NN6B 1J5OH 5E24E 4ZG1A 4M6NH 3HUJB 2R0LH 2XNAB 4KV5E 5J7CC 3O6KH 4DTGH 1I9IH 2B0SL 3SPVA 2FX9L 3HZKA 1PX4A 2EIBA 5CILL 5FO7B 2E7LA 1X5YA 1SYVB 3V4UH 3AS2A 1WAAF 1IM9B 1MLBA 1A4JA 4M7LT 1G7PB 3SDDB 1DUYA 5CKGA 4OV5B 2HT3C 4KDTA 4PJDE 1N59B 5BMFH 5FO8A 1RU9H 4TSBL 4CVWA 2P42B 1YECL 1T20B 1TITA 3HZVB 2DF3A 4QF1A 3FAWA 1DEEB 1NGQL 1PVHA 2W91A 2C1OB 4HH8A 3TBSA 5D1XD 2YD5A 1UM4H 2OK0H 1XIWA 5ACMA 3VI3F 2NXYC 5E2WH 3RVXD 4Z7UF 2YK1L 3REVB 3BJLA 4OBRA 4Z8FL 5I17A 5KSAA 4XZUA 5GGTL 1FE8L 4JFXA 1PJ9A 2V5YA 2Z31B 1X4XA 3LV3B 3N1MC 3UO1H 1WZLA 4R26L 4X83A 3BP4A 1YJDC 5DZNA 4RAVA 4MNQA 2GY7B 4RMWA 2G60L 3TFKC 1LP9E 1ZMYA 1XF1A 1P84K 2BSSA 1AD0B 3D2UA 3ZKXB 2X1PA 2CQVA 3UDWA 1WZ1H 4YXKL 2I60H 5FHAH 2A1WH 4WW2C 2VDML 5D96C 4Z5RB 1A6AB 4KQ3L 5IJVA 1JNLL 1MNUL 1CT8A 2NY2B 3QA3B 3ZSTA 5JMOC 5HHPB 2FLBT 2P1YA 4PLJC 5BRZA 3TNMB 1NGPL 5EBLA 3PL6C 3WHXA 3ZDXF 1RUKL 4X8XA 3EOYG 1SYSB 4PRAB 5MEQA 3IYLW 5C09D 3K1DA 4PJ5A 3HB3D 2BHYA 4QRTA 4NQDB 5D72L 5ISZA 5ENWA 3O41A 3CFBA 4I1NB 4ISVA 2H3NB 2N7BA 4GG6F 4P5KA 5F7NC 2F5AL 4RA0C 2FECL 4XNXL 4XXDB 3L5WB 1PFCA 5L8LB 4HIHB 4HX1A 1ZA3A 4OSUL 1Q0YH 2DQEL 1INDL 3GHEH 4HW6A 1FQ9C 3UXFA 1QLEL 4WFED 5TQ0L 1QBML 2DQUH 3NACH 4G5ZL 2D9CA 4HFUL 2QKIB 4OUUB 2P4AB 5CD5D 1ACYH 1PEWA 4BK5A 2IGFL 5JR1L 1T5XB 2B7DT 4JEGB 2B2XL 2AEIT 5IMLB 1XGUA 3VFVA 2VR9A 3CPLA 1BLNA 2D31A 4EI5B 1I1RA 5C3LD 3N1QC 2HWZH 5EC1B 3WFBL 1NH6A 3ZHDA 4D9LH 4GW1A 4NZRL 2XICA 4X5WA 5MENB 4HG4J 4WGVB 2FIKB 1JYXA 1ZHBA 3TYGH 1HI6B 5HHVH 5EIQA 3QQNA 5F6IB 5HGHB 4G80A 3MBEA 4HPOH 4NC2B 4ZUSA 1D5IH 3O4LE 4WTWA 1M71A 2A6KB 2F5BL 3T2QA 3STBA 2ZG1A 4M6OH 4OCSH 3WKNA 5T3ZE 1AP2A 4PJGE 3WFZA 1S9WA 2P5WD 4XHJC 1CGSH 5DUML 1YYML 5T1MB 4H26A 1AQDB 3VXQB 4U3HA 1GGIH 1UT9A 4MHHI 4R9HA 4A2MA 1CDIA 3VXPA 4LLMA 2AI0H 4FQCL 5IW3A 2ORBH 5GQBA 2I25N 4G7VH 1WBZA 4PJEB 5DZLA 5LG1A 3U9UB 3SCMB 2PF6A 1IGJA 3C2AH 2IFFL 3D9AH 3B9DA 4WDIB 2WIIA 3O3AA 5B39B 3VXNA 5I8KH 2J6EH 4Q0XH 3S96B 1HILB 4JO2H 3CX5K 2BNRB 4F2MA 1OAQL 4HIIB 2D7NA 1RMFL 5GS0D 3F7YB 3E3QC 3FZUD 2Y5TB 3LN9A 1NCUA 3QJHA 2E7MA 1S7WA 5MEND 4FP8L 2D2OA 1RZFL 3NPZB 3MV8D 1C16A 1H5BB 3QPXH 4K94C 5F9DC 1IQDA 1TMCB 1E28B 1UG9A 5DRZA 4H0GA 3IJHA 5D7LE 3AGVA 3KLAB 5FYLL 2D9QB 3K2MC 1QSED 4GW5A 4K2UL 2I9LA 1KJMB 4Q2ZB 1XGRA 4U6YB 5J6HA 5IEHB 1BFVH 1Q1JH 4M6ML 4I2XE 1N6QH 3QCTL 3PWNB 1A3RL 5J11C 3BGMB 5DEFB 4GO6B 4JG1H 1DBML 3MJ9A 3CSBA 2WWMD 4WHTB 4FFZH 4XMPH 1J7VR 3OKYA 3NIGE 2IG2L 4FQIL 1PLGH 4X4XB 1D5XA 2DI7A 1I1YB 3PP4H 4U3CA 5DRXB 2EDEA 4P2QA 3OGOE 3T0BA 3QNXA 3OBAA 3FT2A 3VFTA 4AIXA 1NMAH 1MCPH 2D7MA 4JY4B 1OM3H 3TZVB 1LO5A 4YHOH 3D0VB 5ICZA 5IB5B 5KANI 2C9AA 3S36L 4HUVB 3MNWA 3MGOA 2Q3AA 4I77L 1CD0A 3D25B 3K3QA 4RZCA 1UKQA 3FQWB 4UQ3B 4LSPH 1LEIA 1Q0XL 2NY1C 3EO0B 4LPYA 2VABA 4N0CC 3T3ME 1J1OH 3ARBC 4ZFOB 3PGDB 4MX7A 3FAXA 2R69L 1YYLL 1F4XH 5BV7C 3HMWL 4ELKB 5LGHH 3NFNA 4XPHH 2GSIB 3DGGA 3KLHC 3S88H 2VLME 1E27A 3KXFA 4EEEA 5DJ6A 1IGIH 2DLIA 1MHHB 1VACA 2BDNH 1BEYL 3W5MA 1FN4B 5A2KH 5DD6B 2VLLB 1PAMA 4KU1A 4YGVB 3ROLB 1AGCA 1UACH 4PFEA 1QRNE 4ODXA 4L3EB 4L3CA 3PHOA 1EFXB 3SKMA 4UT6L 4DKFH 5IFAL 4FQ2L 4BQBA 1N8ZB 3TLRA 1EPFA 3DNKA 5CZVL 2B4CC 4I0PC 4JFDE 1LO2H 3GJFB 4S1QL 4QRPD 1ROWA 1V7NL 5I1CH 4DGIH 1N0LA 2VITA 2J1KA 5ICXA 2A73A 4NRYA 1MFCL 2IMNA 4P4KA 4ZPVB 5GIRA 5JW5B 1UKSA 4Q7DA 1U91B 1TVHA 2ZCLH 1QA9B 4JB9L 1R5WB 1B6UA 1EHLL 4PJIB 1LDSA 3W11D 1OP3H 3V6ZB 2ADFL 2UYLB 4KKNA 4DFIA 5I8OL 5EZOL 5IJKA 2L7JA 4M61B 3VXUA 3D3VB 5JDSB 5JOPD 3AM8A 3OKOA 4GMSL 2V9TA 4LLWB 3BN9C 4ELMA 2OTUA 1U58A 2IF7A 5HVGB 2FH6A 5IT2H 3HLAA 3CDGB 1FSKC 4BH8A 1HH6B 3V5DB 1AQKL 4Q9CA 5FAAA 4FZEL 4XXCA 2R0ZH 1BD2D 1KJVA 1SM3H 3KPRE 2OYPA 4FQHA 4KV5F 4O2EA 4PGBB 4WJ5A 2VOTA 5MHSD 2MMXA 3IXTB 4LVNB 2H8PA 2JTDA 1NBVL 2AJVH 4P59H 3OKDA 4QXTA 4LLUA 4XP6H 1Q94A 1CL7I 1H9VA 3GSOB 5B39G 1ZTXL 1PYWA 3MLUL 1J1XH 5L2KE 5CAYB 2P5EA 1FG2B 4QKXB 5HYQA 3FMGH 4TQEL 2XRAL 3SOBL 4MB5A 1U3HC 3C60A 3EO1A 4S1DD 3P4MA 4G6JH 1IE5A 2HP4A 2NQCA 2QR0A 3WIHH 2EXYC 4P3CH 4JFFA 2VB5A 1J88A 3FN0H 4LKXA 3WUWA 1N5AB 1ZWIB 4J3VA 5IB4A 3D3VD 3HG1B 1NFIA 2J8HA 5GRVL 2JJSC 5DD1L 5E8NB 2C3WA 4G6MH 1NEZA 2P7TA 1FZOA 4OF0A 1H3GA 5CSZA 4CKVX 1DFBL 2UVFA 3TN0D 3DWTA 2VR4A 1EK3A 3RIFK 2YMXL 2EKJA 4G6KL 3CFJA 4XHQA 2VH5H 4PJAE 3NZHL 3FTGA 2ICEB 2RCSH 1X6NA 4KI5D 3RWGA 1MIMH 5GJSH 5JW4M 1KYOK 2VQUA 3Q6FA 3CU1A 2H2PC 4KHXL 4HKJA 3AB0C 4YBHA 1LWRA 1AIFA 4KXZH 5F71A 3WHE1 5KSUA 4G7YL 2CLZB 3ARQA 4E5XA 4ENED 4KK5D 4X6DB 3VE0A 3KHOA 4PRPA 4V2BA 4M7KH 1MCLA 4RBPH 1J8HB 3MRMB 1GC1C 2DBLH 3EDKA 5C0GB 1T0MB 1RIVH 3BN3B 3OGCB 4JM2C 4BQCA 4RFNB 1VFMA 3EYFB 2VLRB 4TUOB 2PKDA 4EOWH 4PS4L 1CU4H 1OHQA 1KCRL 4TVPD 1T66D 3MUY1 1QPPA 1QFWH 2BXZA 2EXWC 2IQ9L 4C55A 3N85H 4HXAL 2OTWA 4XI5D 4CMHC 4U0QB 2AXJA 3GMLA 1D5ZA 3VD9A 4URTB 1RUPH 3TH3T 2Z93A 5HI4D 2IAMC 5F3HA 1W72L 4M93C 4JZOB 2CGRH 3QXVA 1IC7L 1XGYL 1R24B 4L8SB 4NHUA 2VDRL 4M4PA 1JZ6A 3NCYS 4I13B 1W72A 3EYSH 2EZ0D 1YUHB 3VRIB 2FD6H 1BQUA 4NBZB 2VR5A 1ZA6A 3WJLC 3LEXB 4OAWB 3IJSA 3EJJX 2BNQB 5D96B 1CCZA 4J8RA 1KV3A 3VD3A 1BOGA 4JFQA 5FKPB 3MJGX 5EUOB 2ZOLB 1DR9A 1QYGL 2FCBA 4TUKH 5HHMD 5TE6L 2VDQL 1IM3A 3EYOA 3WFDH 4ODSL 4U1HA 1G6VK 4X4ME 2CDFA 4GRLC 4ZPTA 3L3GA 3PWJB 4JDZB 2X4OB 1PQZA 4NO0B 4QTHB 2Z8RA 4UQ2B 1N2RB 3QDJE 2E8YA 2O61A 4XX1E 1YJDH 2AEQH 3QUKB 5E5MA 1AFVH 3WN5C 4M1CD 1YDPB 4EDXA 3DX6A 2KBGA 4OT1H 5DUBB 4X7EC 1FPTH 5DJCA 3H9YA 3IFOA 5B21A 2FO4A 4MDIA 3FCTA 2LU3A 1OD9A 4P2OB 1VDGA 3U30C 2APVA 5D1XC 5J13C 4WNQB 4AL8H 1FYTB 1YC8A 5EU3A 1DQLH 1KGCE 4OZGF 1KSRA 2P8MB 2MHAA 1L7IH 3VXMB 3O0RH 3BH9A 2VQTA 4G9DA 4IIQA 4AM0B 5IB3A 3SGJC 1OAXL 1U3JA 4G6FD 2BNQD 1FZKB 4ZOBA 4ODUB 3I6KB 1IJ9A 3BOVA 2A9NH 3H0TB 3UJIL 1WFNA 3I75B 4LVEA 1A9BA 1HXYB 4ZYKB 4PGZA 5I8EB 3TCLA 3MOAL 5IW6B 3T0EE 4M6AA 3DETD 1BPVA 3H2WA 4WTZG 3WXWL 1C8PA 3SE3A 3I50L 1WSST 3QI9C 3NFSL 1W8NA 3F62A 5K59E 5F44A 4P5TD 5D7IE 4NKMA 1KBGL 2VYRE 3DHMA 2Q7NA 3CH1B 1M05B 2NY0C 1LO0L 2A74B 1P6FA 5I1IH 4ZUVA 1RSFA 2GYSA 4FTVD 2VLKE 3PXHA 5BW7C 3NIGF 4GMTH 1GPOH 2JJTA 4Z7NF 5ALBL 4YC2B 1VKXB 3MRGB 1C5BH 2AKRA 3VD5A 1DLHB 3MLYH 3OX8B 4ZOAA 3O2VL 4QCIA 1HINH 3W0WE 5IGXL 2ZOKB 1I8KA 2I5YL 4MDJA 3UYRH 4L29A 4XNUL 4C54A 5FCUL 1AKJA 4D0CA 3DVGB 1FGNH 5JO5A 5GS1B 4M8VA 3VXMD 3H9HA 4HIJA 4N5UA 2XWJB 2YPKA 5KG9B 3MRFB 3GSWB 1F42A 1C12B 3T3MF 4UT9H 2QQKH 1SJEA 1G84A 1QO3B 5L9DL 4B7LA 4HFWA 2HVKB 3HNVL 3PWPB 3SO3B 2Z8VC 4GKZA 2HH0L 4LAJH 3P11L 3VGFA 1IC5L 1KIPA 3GMQB 3T4AA 1I3GL 2QQLH 4PJXF 3PXJA 5DD5H 1U8KA 2X5PA 2IPTH 4PJFE 5EB9A 2AABL 4MD0B 1AGBA 3H9SE 4NQEB 1HYRC 4G3YL 2CSPA 3RZWA 5TGBA 2NY4D 4XPFH 4ZUWB 3KYMA 5B22A 3NOIA 3IDIB 4NRXA 5DJAB 5CJQH 1KEML 2A6IB 3AS3A 4AG4H 3BAEL 3MODH 1QTYT 2QV2A 4XNYH 4PJCA 3D0LA 5CEZD 1KN4H 2J12B 3EYUH 1BIIB 2DDQL 1TPXC 4DGYL 5CINL 2XWBB 3P30H 3HMXL 4BKLB 1NDMB 2OJEA 5J11B 1CXFA 4YHIA 5IKCA 4K55A 1KIQA 4ZUUB 4I3SL 1S7QA 5C0IB 4UOW1 3HMXA 3GBNH 3MCLL 4FQQA 3FB8B 3HFML 1XZ0B 4A6YL 1WWAX 4ODWA 3N1GC 2ESVA 2AXHA 1HXMA 2FGZA 3GNML 4ZQKB 4K94H 2GK0A 1ZANH 5DEGB 3U0TB 3UROR 5I1EH 1JWUA 2OL3B 4X98B 5C6TL 1DP0A 3U2SA 4X7DC 3PWPD 4TULH 4A6YA 1MAML 1PSKL 4UBDD 3QZWB 5GRZA 2C26A 3C2SA 4N0UB 3I02B 1RZKC 2JB6A 4Z7QE 4FQ1H 3PP3H 1QBAA 4NQED 1IILE 1NC2B 1J05B 4ONFH 3FZUC 4HPYL 3BT2L 3VH8G 3FO2B 2BRQA 5IIEA 4MJIE 3C8KB 4Z7UA 3VRJA 3UTTB 2ZJSL 1JTPA 4LFHD 1E4KC 3LD8C 3VMNA 4KPHL 3QEQB 1A6VL 5EORH 3RKDD 1IT9H 4H88H 2VE6A 3G04A 4KK8D 1F4HA 1LEKA 1X5KA 4YFDB 5KSBE 1KLUA 3HNTL 3C8DA 5D2LB 1FAIH 3MRQA 4JFEE 4F8TA 4EDWH 1G7JA 4WEBH 2JB5H 1LE9B 4OLXL 4U1JA 2FNBA 3Q48A 4K9EL 1CICA 3WCYA 4MWFB 5AWNH 3GIZH 1MQKH 2FEEI 2WWMC 4LNRB 1K85A 1F45A 2FZ3B 1DBKL 15C8L 5EU7E 3T65B 3RWEA 3NCCB 4LPUA 5BV7H 2AQ3A 4LSUL 4Y0GA 4D0BB 3H6JA 3QDGA 5IB2A 4JFHE 4KTDL 5DHYB 1KELH 4C4KT 4POUB 1CFQA 3TVMA 2DQIL 1ZVHA 5C0BA 3ZKMC 4HUUA 4JDVA 1K6QL 4HQQH 1SQ2N 3OXSA 1L0QA 1MVUB 5AYQA 2XPGA 4K3JH 1NC2D 5AD0A 1Z3GL 1EEZA 4GG6A 3GB7B 1G7IA 4BSWB 1IGTB 3L3OB 3C8HA 4ZSOA 4NQXB 4JFYA 4MNGE 4UV4H 1P4IH 2F8OA 4WUKH 3L3KA 5I30L 2XY1A 4Y8DC 1WV7T 4ERSH 5I1GL 1FRGH 4EN3D 2YUXA 2X4QB 3UBXI 4D8PA 5EN2A 3ULVL 2W9DH 1J9CT 1NBZA 1YQVL 4RGND 5LKNA 5F9WB 4FXKA 2PR4L 1BX2B 2BVPB 4F33B 1KCSH 5DJZB 1R3JB 5HGBB 4GH7B 2GAZB 2DICA 5ESAA 3RA7H 3REWB 1EMTL 2XWTB 4KUZL 4WY7H 2Y7QB 1ZT4B 4WI7A 1MI5E 2F74B 3LKQB 2YA0A 1BIHA 4HDIB 4LSVL 4PGJA 4PJ8A 2GQHA 3QP3A 5FDWA 4YHPB 2R23A 2R1WA 3I6LD 1NGXB 2D7TH 3CMOH 3K4ZA 5CHNA 1F8TL 1G6RL 4HMEA 1SJVA 2I27N 3KG5A 3ROOA 1I1AA 3MLRL 4OM1H 3QQ4A 4U6VH 2AJZB 2R1YB 4WEUD 5EZJB 1GHFL 4HF5L 3IDXH 2ZPKL 2YPLE 5DQJA 1HN1A 1NUNB 3JTTB 2C3VB 2OI9C 3Q1SL 3EJZD 4Z7VB 4QHKJ 1OWRM 3GEWB 3TESA 1IAKA 4L8DB 5HYSG 4FQXB 5JNYA 3INUL 2P45B 3VJ6B 4D9RE 4X5XB 5GGVH 1OAUL 4Y16C 2BVQB 1YEFH 2E6JA 3DUSB 2X4PB 1UEMA 2ICCA 5D7SH 1FP5A 4J4PC 1MEXH 2WWKT 5JHDA 1C1EL 3O6LL 3VXSA 4WCYL 1A7NH 3MOBL 5L0QB 3QFJD 1NANI 4PBVC 1OP9A 4OZHB 3I3BA 1NGYA 4K7PX 3VFWB 1A5FL 3PQYA 5DJ0B 3MBXL 4FFVC 2OSLA 3AB0B 4ETQB 1SY6A 2NZ9D 1FH5H 5SWSD 5DHXB 1OLLA 5J9PA 3MV9E 4CVXA 3QIBA 4ZXBD 3SDXA 4I8DA 3VFGH 1WEJL 5CP7A 5F96L 2C1PA 1UJ3C 1AO7A 3BHBA 3VRLF 5AZ2L 1ZLUH 4B7IA 2V5RA 3QZWG 1ZHLB 4DQOH 1NCNA 3MA9H 1K4CA 3WSQH 4OLZL 1K3IA 2FO1A 1R5IB 4MQ7A 5IVXE 2F58H 5HHNA 1UA6H 2GSGA 5DJXB 2L4OA 4O5LL 2UWEB 4V1DA 4FQXD 1KNOA 3LDBB 1CF8L 2JJVA 4LPXA 1A8JH 4NQCB 2Q7YA 1UM6H 4JREC 3MLSH 2XKSA 3RY6C 2FBJH 2IAMB 5EZIH 3BP5B 3GJEB 4N68A 5C0CE 3MYJB 4JGUA 3PV6A 1NMBH 2VDNL 3ULUE 5JLZA 4NZUL 3FB7A 3RZCA 5KN5B 1K5NA 5C92A 2AVGA 1I7RA 4P9MH 2D0FA 4NNPH 6CGTA 1FL5B 1JUFA 5J1AA 5EG6C 3LAFA 1Y0LA 3HAEB 1X5HA 5BZWB 4Y8AA 4JGMA 1WFUA 5HGAB 1MCWM 3ZTNH 1RZGB 5BZDA 3NIFF 1H3PH 3SBWA 3MFFA 1S9YB 4PD4K 1TENA 4GRLB 1REIA 1AJ7H 3BIBX 4MAUL 3S4SA 1F5WA 2X40A 1KTLA 1OGTA 4JGJA 2PNDA 1S7SB 1DVFC 1MIEL 2Z35B 1A7QL 1PW3A 5KBNC 5GZOC 2ZG3A 1YA5A 3UTQB 4EVNA 2WINA 3HRZB 1AXSA 1CFNB 4UU9B 5CD3A 3SGKA 5AUMB 5FGCE 3PV7A 3RVVD 3ARTA 5BO1L 3ZDYE 1IRAY 2Y72A 1YN7A 2J3SA 4D0DB 1NC4A 3U30B 1KPUA 3L3IB 4YXLH 4BQ6A 3WFEL 5J13B 5I2IB 3HC3H 2ITCA 1FDLL 4HBCL 5F7HA 4WI3A 1KULA 1U6AL 3HAEH 3ARSA 4K8RC 3SGDH 2QADB 3FQNA 4OLYL 4N8CH 4H5SA 4YR6A 5I15H 5E2UH 1NCWH 3BISA 2HT4D 3G9VA 4LIQH 3OMZA 2CXKA 1X5IA 5CWSA 3VFMA 4DKAA 4P46C 5IR1B 1YC7A 1Z5LB 4ZAKA 4F7MA 5F89B 4GKOA 2DQDH 4LF3A 3UTZB 3L7EB 3IDNA 2CD0A 2EDWA 5DEZA 2GCYB 1UM5H 4YO0B 4Z77A 2V17L 3FHAA 2FR4A 4XVUC 2VDKL 5IBUG 4Z76B 5JXED 4M8QA 3R0MA 4FZ8L 5DSCA 3TO2A 1N7ML 3X14B 5CKAA 5TPWL 1UWXK 3V7MA 4AT6A 2IC2A 5EH1A 3PG2A 2O5ZL 3KPLA 4JR9L 4HLZH 5H37G 1NMCC 3KJ6H 5C09E 2WBKA 4ZS6C 4XVTL 4QGTA 3QBTB 3JWOL 1AD9A 2VLJD 2AXFB 3UJJL 1SHMA 5FYKD 3B9VA 3QHFL 4NGHL 4ALAH 4I0CC 1DLFL 3VG0L 1E4XI 4F9LC 3BH8B 2WAHA 1I7TA 2CDEA 3GRWL 4TPRL 4U1KA 4R4NC 2OBGA 2QADD 5D7JD 2VWEC 3TV3L 1A0QL 4WFEE 4PG2A 4X6CB 5E9DB 4TSAH 1BQLL 3RDTC 3CFEB 2RGSA 5GGVY 1DEDA 4PJDA 4YHLH 3X13A 4NP4L 3U7WH 1A4KA 4PY7B 4OD1H 1JV5A 4Z7QF 3F8UB 1S9XA 2OP4L 3E8UH 5MERA 5DHVB 5IMMB 4Y5XA 3CSYA 4HUWB 4I18A 1MJJA 4RGOL 5HI5C 2JK5B 3VWKC 3HTLX 3VXRB 1U3YA 5A2FA 4NHCL 4NM4L 4ODBD 5DA0B 2CK0H 2EC9U 5F1NA 3IDGB 5B38B 3IDMA 5GGUA 2HJLB 3V5KA 3DYOA 3OKKB 4PRHB 1Q9OA 2Q6WA 2R2BA 3OPZH 5GZND 3RL1B 2NMSA 2OXHA 3A67H 4Y2OA 5C07D 4LARL 1LP9A 2F8VA 4R90L 4GXVH 5MP6H 3DETC 3T1FA 3QXTA 1LK2A 2DMKA 2P5WE 1EXUB 4XPBL 4P5TC 2DYPD 3NN8A 3UTOA 1DBAL 2E7LC 3NABL 4JQIH 1BJMA 1IL1B 3M17B 1FNGB 4WU7B 4NZJA 4HIEB 1ITCA 4PJBB 4PLKD 2E9BA 1UQSA 5DHVH 3ILPA 5E9DD 2HMID 4KDTC 2CUIA 4M1GL 5BXFB 1I9RL 1U8OB 3HS0A 1PG7W 3QT2A 1RZIA 2GUOA 1I85A 3LIZL 5KS9B 1GZQA 5E8DL 3NH7L 2NR6C 1XIWC 2PYEB 4DVBB 1WFOA 2UZYB 2BERA 5IVNA 1T2QL 2O5YH 4YPGA 1UVQB 5LWYH 1PG7L 4HIXL 2OJZL 5KSAC 4XPGH 5BQ7A 1U8QA 1F3JA 4NRZB 5IROA 4GAGL 4LCYB 5T1LA 3DURB 3GSVB 4OZFA 4C58B 5EIIA 4Y4FA 1OF2B 3D87B 5MENE 3TWCH 1DL7H 3MV8E 5D71H 2PTVA 3DHJA 3PGFL 3B9EA 2V7HB 3DO3A 4XVJH 1W0WA 1DBBH 1OL0A 3UDWC 1JGUL 5CJBA 2NY4C 5T5FH 1QSEE 4KVCH 3BKYL 3QUZB 4MCZA 3BZDA 2HTKC 3H42L 4U6XA 4TTGA 4IHOA 1IGML 4HZLA 5DLMH 3ALXA 5BJTA 4HLZG 5ECJE 1NDGB 2HTLC 1EAPA 1N5YH 1T1ZA 1G7QB 5E4IA 3MREB 4QXUH 1MCKA 3GI8H 4NWUH 5IQ9A 1F11B 5F9OL 2YD8A 3L1OH 4PJEE 3O6ML 1S78C 5T3ZL 7FABL 3ZYJA 1BF8A 1PDKA 3WDJA 2IH1A 1RZKH 3KJ4C 5GGQL 3MLTA 4CAGA 1CGXA 4CJ1A 3O4LA 1CFVH 5JPNA 3U4BL 3CNKA 4M00A 1GL4B 4PJGA 3RY4A 3FOMB 2AS5M 4XP1H 4OCMC 1FFQA 2OTPA 3U1SH 2NTFB 5HD8C 4APQB 1KG0B 3NTCL 4R7DB 3KPSD 3L5IA 4BM7A 1TTFA 4PGEA 3EYVA 3QAZC 2FYYB 5EBMA 5C6PB 3BEVB 3SJVD 3KHQA 1L7TH 3LH2H 3JWDL 2NY6C 3QQ3A 1AHWB 1EAJA 1LO3L 3VFSA 5JOEA 2YRZA 2DIJA 3U4AA 1S5IL 3HPJA 3QUZD 2GY5A 4OF7A 1FL3B 5FUZL 2VSCA 1B0GA 1QQDB 3T2NH 2E7HA 3O3DB 3MRBB 2LTQC 3FQTA 2X1WL 3VGHA 12E8H 1DDHB 3MBEC 4UT7H 5I9QC 3RVWC 3BRDA 4DGVL 4Z7WB 4RISL 1XGTB 2CMRL 3LKRA 4WFFD 3U0WL 1EO7A 5D7LA 1A1OB 1G7MA 1FFOB 4HJGA 3ZDZE 5IVXF 3DUHA 5C0AD 5HPMA 3ZSSA 4APQD 1J1PH 1LVEA 5K9JL 5FKAB 1UXSA 5HY9A 1FLTX 4I2XA 4JHWL 5HDOA 1NJ9A 2YUVA 5B38G 2J88H 2OI9B 3S9DB 5JOPE 1NLBH 3O8XA 3S98A 3WNKA 3W39B 3D39B 2XZCL 3ULUF 1YY8A 3ARDA 5E2TH 1OTUC 2EKSA 4LQ1A 2YEZA 2FX8L 2KKQA 4LEXH 4HCRA 4RCAA 2XV6B 1IEHA 1M1SA 3CLEL 5E00B 2GJZB 4EIGB 1F58H 5J89A 1DSFL 3DX8B 1BD2E 2COQA 5D8JH 3ZYIA 2C5DC 4KZEH 3H7BA 4K7PH 5CJOL 3UTSB 4QOKB 4AMKH 3K0WA 2D3VA 5MHSE 3P73A 2FJFB 4J12A 5FCSH 3TIDB 5IG7A 2FWOA 3KVQA 3M8OL 3GI9L 3RWFB 3HCVB 4G8EA 4PBXA 4LBEA 1HH9A 1IKFL 3U0PA 5JA9A 3HE7B 4WO4B 4MCYB 4UDTB 1LDPH 4EXPX 2VUOA 5TE4L 1CLOH 1YPZF 5AYUL 3ABZA 5DI8B 2UZIH 4KK6C 2OR8A 3HHRB 3VXOB 1RJLA 3V4PH 2AJUL 1TJIH 3S5LB 1QRNA 5LAXB 4PJIE 3TNNB 3N0PB 4RAUB 1AR2A 3THML 4LEOB 5I1KH 3G08A 2DRUA 4NPYB 1XGQA 4JFDA 1CXIA 5LCVL 1LD9A 4GLRI 5IBTL 3D3VE 4O00A 1Q72H 3PJSB 4JAMA 3D39D 3IXAB 2ZUSA 2FEEL 5T3XD 3QO1A 4JN2A 3HE6A 3MUGB 3LB6C 2J8UE 4O02L 4YGAB 2D0HA 1LNUB 2VKXA 3D18B 4NFDA 4PUBL 1OGAB 3ZKND 4HT1H 4YWGL 4P2CG 2HFFA 3HUJF 2HLFD 4K3DL 4YPJA 3BDYL 3UTSD 3TBVB 4DN3H 3TP4A 4OF8A 1HCVA 4O9HL 4X7SH 1NGZA 4KI5E 3JV5A 5E8OB 2AJXL 5DUPH 4QRRB 4JPVH 2LU7A 2E7CA 4CADA 2XQBL 3BZFA 1TZGH 3HE7D 4WO4D 4DCQB 5GXBB 2NZ9C 1UH2A 1QSFB 4M7JL 4KJWC 4RFEB 5D2NC 5D5MB 2Q76B 4UZGA 4ZXBC 1SJXA 4F57H 5I8CB 4JZNB 3WFHA 3KPRA 1QSVA 1G1CA 3U36A 5FGBA 4OIIL 4NNXB 3V4VH 4JJHA 3UBXA 4PRIB 4Q9QH 1T4KA 3CXDL 4ONOA 5ERWB 4NKOA 1UFUA 2XXMB 4TVPE 5HGDA 2PW2A 1EHNA 1FZJA 5E4EC 4I3RL 5L2KA 4P4KC 2VXQH 1QBLL 4M9OA 5DQ9A 1ND0B 3BKCH 5IVZA 3C5SB 5C0RH 4PGDA 4Z0BH 1FNSH 3VGEA 2RHEA 4ODVL 1O5DT 2JIXB 1PX3A 3ZT5A 4WTZA 1FFNA 1HQ4A 5DMKB 5IJKC 1BFSA 3AM8C 3U82B 4P3WA 2NX5D 1KPRA 4DUXA 2J4WH 4YDIH 4QRRD 3PWLA 5K93A 2DWEB 1HEZA 3PWVB 3KDMA 3SDYH 4X9FA 4HS6B 4F7PA 3LSOA 5ILTH 2WLZA 1A7PH 3ZE2F 1QSFD 4IJ3B 4X6DE 1XF5A 4N8VB 3CVHH 4XXCC 5HHME 2GTZA 4PRDB 5F1OB 3SY0A 1FO0B 2F54D 4PB0L 2WM0A 5DVOA 1DQMH 3JZ7A 5I76B 4G6AC 3BUYB 4PJAA 3JTSB 1GYAA 1F4YH 2BOCA 3FT4B 4K8RH 3LEVH 1VEOA 5INDB 4V2CB 3RL2B 1EBPA 5ADOH 2NYYC 4LVHC 25C8L 3O4OC 3PNWA 3MYZA 4L9LA 1EGJL 4NYLB 2W65A 1FVEA 2EH7H 2H9GB 1NAML 1JPSH 1JGDA 3MJ8B 3MRDB 3C60C 2GTWA 3IGAA 5F88A 1EGJA 2QQNH 1DBJL 3MRIA 2Y9RT 3OB0K 5D7KE 2AQ2A 3RDTB 5MEPA 1F4AA 1BM3H 4L5FH 4U6HA 4MA8H 1GIGL 1X5XA 4R2GB 5J56B 5I6XC 4WWKD 3BD4A 2HRPL 1FO0H 1T80A 1TNNA 4HWBH 2DMCA 35C8H 2MFNA 1I8IB 3MV7B 2X4TB 1I8MA 1FIGH 1QNZL 5J12B 2BNQE 3G6JE 1VGEH 3CAFA 4K7PY 2CKBL 3DBXA 3BFOA 3ME0A 4TRPH 4PTTA 5EUOE 1ES0B 4IRSA 3CDFA 1A7OL 2ZKHH 2K7PA 3HR5A 2A6JB 2XZQL 4M7LL 1A2YB 4NWTH 1WWBX 4IOIB 3MR9A 5C08B 4RMVA 3ZL4L 2IBBA 2CKBA 2Y07H 2HT2C 4O2CB 1BECA 3QXAB 1ZSDB 3BKMH 1H3UA 2VRAA 5I1AB 3ALWA 4R3SA 4I48B 3TBYA 1G7LA 1INEL 5CCKL 5M7QA 4WW2A 2YD1A 3MNVB 3SPVB 5C0FA 5IUSA 2MSPA 3QUYD 3TO4B 3OHXA 4FTVE 4GSDL 5GHWH 1TJGL 2EE6A 4BSVA 1MLBB 3RNQA 1A4JB 1AGDB 2X89A 2X05A 3C9NA 5EU6B 2G5BA 3QHZH 1OTSD 1DUYB 4QYOA 5ALCL 2NW2A 5FO8B 3RWCA 2Y25A 4L9DA 5IFJB 4X4MA 2I07A 1MRFL 4B0MM 1V3KA 3WNOA 4NJAL 2NY3C 2VDOL 1DANU 1XF3A 4XP9H 4KZDL 4R2GD 3G5YA 4U7SA 3TT3H 3VXME 3R8BB 3TBSB 3QDJA 5T33L 1XIWB 4GG8B 5LXGL 5DQDH 2O5XL 2YWZA 2XACC 3IJYA 2BFVL 4Z78B 1NL0L 4LLYA 2AK4B 1OQOA 4JFXB 2ARJA 1I9JH 5D1ZB 4DFHA 5J6GA 4KKLC 4QRUA 2FHCA 3AU1A 1RK1A 5DVMA 5C08D 4RAVB 4MNQB 1OP5K 3GM8A 1QLFB 3IRPX 3JV4A 5HYEA 4I3GA 4K07A 4LCCA 3B3IA 2BSSB 4Q6IB 3L7FB 2FX9H 4P2YA 3MCKA 2JJUA 1J10A 5KTEL 4Y4KA 4NQTA 4NM8L 2EYSA 3DMMA 1CK0L 5CEZE 3MUJA 5I75B 1KT2A 3TO4D 1JF6A 1CT8B 1DTUA 5DT1H 2R4SH 4MA1B 1FVDB 1NQBA 3WHXB 1CS6A 5EU6D 1YECH 2A6DB 5HXMA 2A77H 5MEQB 3OG6B 4XPTH 4X6EA 3BWAB 1NGQH 4LHUA 2VMFA 3MRHA 4PJ5B 1XAUA 5JIIA 3KJ4B 5ISZB 3T0EA 4ETYA 4LPCA 3O41B 1A7BA 4ISVB 3RJQB 3O6FB 5D7IA 4F7CB 4Z8FH 4GUPA 5I18L 5CIPB 3EZJB 1JCKA 3H3BC 1ZA3B 1ZGLA 4RX4A 4FFWC 1FZMB 2VLKA 2AK4D 1E4XL 3SGEH 3PWPE 3MROA 5D1ZD 5EOQL 2G60H 3WDIA 1UXWB 3QAZB 3CFIC 3V8CA 4WUUA 1I8LA 1J0IA 3W0WA 1EJOL 1LO4L 4YXKH 1WC7B 2DTML 5DWUL 4NQEE 2NY6B 2WBWB 5F7EH 2AXGA 4LCWD 4KQ3H 4IIQC 1XGUB 4JRXD 1GOFA 2IPKA 1MNUH 4LQFL 4PRBB 2P44B 5ESQA 3CPLB 5FF6A 3NCJL 5A3ID 2IBZX 3WNLA 1RUKH 2BC4A 5I16B 3BO8A 4GW1B 2LVEA 1PD6A 3VGAB 4XT1C 4GXUN 1ZHBB 5D72H 1A9EA 4G80B 3MBEB 4PJFA 5I9QB 3G9AB 3VWJA 4ZUSB 3FQUA 2X9XA 3QEGL 3H9SA 4LLDA 2F5AH 3SE3C 1KF9B 1S8DA 4PJIF 2P8PB 5HVWA 3QUML 5FECB 2EH8L 2APTA 1A6TA 2F53D 3WIFB 4OSUH 1S9WB 3O6FD 3OKEA 3FT3A 4PREA 3PDGA 4FOMA 3T04D 1J86A 4N9OB 3FOLA 4ZFGL 4Y1AB 1QBMH 4PYGA 3BIKA 2JJTC 1KN2L 3FFDB 4G5ZH 4P23A 3VXPB 5ICYA 4HFUH 4D9QE 2DQHH 5F7DA 3ILQD 4DWHA 2DJ4A 1ZOXA 2IGFH 3LQZA 5JR1H 1G9ML 1WBZB 1FAKT 1T21B 2Y06L 2B2XH 5EO1A 1T6WA 4LSSL 4NJ9H 3T0WA 5GRWA 2WIIB 3O3AB 1LK3H 3VXNB 4CVZB 4LPVA 3V52L 3O2DL 5KOVC 3BYTA 1SEBA 1ZHNA 2DQJH 3SDAD 3KR3L 3LS4L 5FM8A 3WEXA 1TZIB 3WFBH 4RSVA 2HJKB 2ZSWA 4TNVF 4OZIB 1MREL 4NZRH 4RRPG 3RU8L 3I6GB 3O2DA 3P4LA 4AZ8A 1TQBC 3D85A 4RGNE 3FL7A 4ACPA 2DLFL 3ESUF 1R3LA 4UILL 4M1DH 1QFUL 2W9EL 5DRNA 4U33A 4WGWB 4Y5VA 2F5BH 5D2LE 3HI5H 4N0YL 5IW1B 2WNGA 5DRZB 4AK1A 3IJHB 1CGYA 2QJDA 4YK4B 3OR7B 5DUMH 3IU3A 3U46A 1FORL 1CE6A 1FNAA 3OAUH 1MFNA 3S35X 5KAQG 1NBQA 5ANME 4MJIA 4OCLC 3B83A 2Q1EA 3I6LE 1C5CL 4XP5L 4Y1AD 4FQCH 1T5WA 5C71A 2GK2A 5BVPL 1UZ6E 2B5IC 3DSNA 5HDQL 2BZDA 1DN2A 2IFFH 5KVMC 1V05A 2QBWA 5KSBA 2WUCL 4JO4H 4S10A 1AE6L 4JFEA 2L7UA 4Q9BA 1OAQH 3LZFL 4M02A 4XCCL 1LMKA 1NLDL 1F6FB 1RMFH 1F90L 4P2QB 1MRCL 1Q9KA 3QNXB 2YN3A 3VFTB 5B3JF 4XNMA 5E5RB 1BP3B 4DVRL 4P9HL 1BGXH 1ERNA 5TH2A 5K9QG 1NUFA 1RZFH