3BP3A

Crystal structure of eiib
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
81
structure length
81
Chain Sequence
TGTSEMAPALVAAFGGKENITNLDACITRLRVSVADVSKVDQAGLKKLGAAGVVVAGSGVQAIFGTKSDNLKTEMDEYIRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analyses of Mlc-IIBGlc interaction and a plausible molecular mechanism of Mlc inactivation by membrane sequestration.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Glucose-specific phosphotransferase enzyme IIB component
total genus 16
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature ec 2.7.1.199: Protein-N(pi)-phosphohistidine--D-glucose phosphotransferase.
pdb deposition date 2007-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00367 PTS_EIIB phosphotransferase system, EIIB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.60 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Glucose permease domain IIB 3bp3A00
1O2FB 3BP8C 1IBAA 3IPJA 3BP3A
chains in the Genus database with same CATH superfamily
2E2JK 1WQHA 1DCHA 1HQMA 3GIRA 3A8JA 3I4MC 1B4AA 2D6FC 3HOUC 2NVTC 2NVQK 1V5VA 3S15K 1TWAA 2O5IA 4WILA 5C3EK 3Q3QA 2FQTA 1C0AA 1X31C 5C4JK 1USOA 2JA6K 5C4XC 3FOEA 2PA8D 2ZFZA 3S0XA 1IL2A 2VUMC 5IYDK 2JA6A 1ZYRA 5FLMK 4BLAA 1ISEA 3G4AA 4A3IK 4A3JC 1I50A 1JQWA 3IPJA 5C44K 4WJ4A 4P5BA 4G7HA 3GTKC 3T01A 4A3KC 4XLPA 2GSOA 3S2HK 1VJEA 3AD7C 1HI9A 3SZZA 2JA7K 3BUEA 4ILDA 3PO2C 4NOIA 1SFOC 2E2HK 2RGRA 4AYBL 5IYBC 1J6VA 4C3IK 4BBRC 4AH6A 4BXXK 2XCOA 4KB2A 4A3DK 1O28A 3HOYC 1J6XA 5TMCA 4A3BC 4BBRK 5IYBK 4FZBA 4OIPA 2E2HC 3GTLA 3TFHA 2B63K 1SFOK 1TWFK 1I6VA 2WAQL 1WOOA 1WSVA 2RH6A 4KATA 4KM8A 4KN7A 1WQFA 1O24A 2WAQD 5CHPA 1EK8A 3CQZA 5TJ3A 4C3JK 3LAJA 5CJ9A 3HOXK 2E2IA 1IW7A 3GTOA 3HKZD 1R9TA 4C45A 3SZYA 1BGWA 3PO3K 1IE0A 5L46A 4KASA 3FKIK 2BE5A 3S1NC 5HL8A 2JA5A 4A3IC 3V4GA 1GE9A 1Y1WA 4KAWX 3HOZC 4BLBA 2R92C 4ZH4A 5IYDC 2VUMK 4GTFA 4A3DC 5JVOA 1F7UA 1WCMC 4G7ZA 4BXXC 4QIWL 1INNA 5C4XK 1YNJA 3N0CA 5IP7C 3A8IA 2FQOA 3TFJA 4MEXA 4OINA 4A3LK 2E2HA 1BDFA 2JA7C 3H3VD 1IS1A 4A3KK 3L4JA 1G51A 5TMFA 3CQZC 1EFWA 4BY1K 2NVTK 1TWGK 1Y1VC 4LK0A 2KWAA 2PA8L 4Y7NC 1J98A 1TWHA 2E2JC 2E2IK 2V6UA 4KMHA 3S16C 1TWAK 2CW0A 2CFAB 3HOWK 3K7AC 3BP8C 1KQ4A 4PAAA 4X6AC 1Y1VA 3HOVC 2JA6C 5C4JC 1YCLA 1Y1WK 1I50K 4AYBD 4P5AA 4KM9A 4LJZA 1TWFA 4A3FC 3RZOK 3S2DK 2A69A 3TFIA 4Y52K 4C3HC 4GTLA 2YU9K 5IP9C 1PJ6A 2A6EA 4XLNA 1I6HK 4GTEA 3S14C 1R9TK 4GTBA 3GTQC 3S1RC 4GTDA 3GTPC 1O2BA 3H0GK 1XZPB 3N3YA 1DCOA 4A3CK 3AQPA 2R7ZA 3GEHA 4OIOA 1YX2A 3GSIA 4P9SA 3VA7A 3LPXA 2ZUFA 4BBSC 4PABA 3T02A 3I4NK 4GZYA 4C3HK 4Y52C 2R7ZK 4KB4A 1PJ5A 3AD8C 3GTGK 3GTOC 2JA8C 1F9NA 4KARA 3GEEA 3GTMC 4A3MC 3GTGC 3GTOK 4G0VA 4A93C 3OREA 4QJVA 5IOSA 2R7ZC 1WORA 3N0BA 2R93A 3I4NC 4BBSK 4BKWA 4Q4ZA 1RU0A 4LQYA 1TWHK 1B4BA 3S17K 3GTPA 1XZQA 4LLGA 2NVYK 1XXCA 4A3CC 3S1QK 3S16K 4FM9A 3GTPK 2E2IC 3GTQK 2R93C 1R9TC 2R92A 3ADAC 3S14K 4Y7NK 1K83K 2GSUA 3H3VL 2YU9C 4BY1C 3L4KA 4LOWA 3CQZK 3RZDC 3JSTA 4A3FK 3RZOC 3S2DC 4WJ3M 3G4CA 4QIWD 3GEIA 3CAGA 3T00A 1DCPA 2CFAA 2EBBA 1AB4A 5M3MK 2P5MA 2Y0SL 3S1MC 1USMA 3FKIA 5JFEA 3M4OK 4RMFA 3GTJC 2PMZL 3AD9C 5IYCC 2V6TA 3FHZA 2GAHC 4XCHA 1WCMK 4OIRA 3K7AK 3MMLB 3LAPA 3HOWC 2NVXA 4YG2A 1I3QC 5D4DA 5M5YK 3HOZK 4C2MC 3HKZL 3M3YK 4YFNA 1VLOA 3FKIC 3S1NK 4A3GC 1Y1VK 3H0GA 1TWGC 3PO3C 2JH3A 1TWCC 4LR2A 1UV7A 1F93A 4KDDA 1DD5A 1TWCK 4G0WA 3HOXC 5FJ8K 3ERED 4A3LC 1TWFC 5IP7K 1XZQB 1O2FB 3HXAA 4KMUA 1WOPA 1I3QK 1BS2A 1ZXOA 5EGEA 2R92K 1EH1A 5IYCK 1XXAA 1O2AA 4Q5SA 3GTJK 1I3QA 5IORA 3M4OC 3S1MK 4G0UA 3PO2K 4MQ9A 4LK1A 1WCMA 4OIQA 3S2HC 1EI6A 1L0WA 1ZVUA 3NUHA 3GTKK 3GTMA 3RZDK 3GTGA 4C3JC 5C44C 1XZPA 4A3GK 1O29A 2PPBA 2R93K 1O25A 3M3YC 2B63C 2PHCB 4C2MK 4GTCA 5FLMC 1TWGA 4A3BK 1BJTA 3HOYK 1XPPA 3WODA 2NVYC 2JA7A 3OPFA 4C3IC 1SFOA 2V6SA 1TWHC 1VGXA 4XSXA 5E68A 4A93K 4GT9A 2O5JA 4DDQA 5M5WK 4YFKA 2PMZD 2JA8K 3DXJA 4O2DA 5M5XK 4KC6A 3S15C 1O27A 2Y0SD 4KMDA 2A68A 2GSNA 4MEYA 1K83C 4KMAA 1WOSA 4A3JK 5M3FK 1IQ0A 5IOTA 2WB1L 3EQLA 4M1XA 1JOEA 1XXBA 2NVYA 2NVXC 2A6HA 2YU9A 3AQOA 2B63A 1IBAA 3S1QC 4GTAA 3GTJA 2ZUEA 3S1RK 2Y3PA 3GDZA 1PJ7A 2GAGC 1WIHA 1F7VA 3S17C 3AH5A 3GTQA 1I6HC 1VRQC 2JA5K 3GTLC 2W7VA 3OEPA 5IP9K 4JK1A 4BY7C 1K83A 4GFQA 3A8KA 4A3EK 4KN4A 1YNNA 2XCRB 3BP3A 4A3MK 3GTMK 4XSZA 5C3EC 5EGHA 1I50C 1Y1WC 4A3EC 2P8TA 1TWCA 1SMYA 3TTGA 1ZBSA 1WSRA 3QX3A 1EQRA 2NVQC 3HOUK 1JVIA 2WB1D 4J3NA 4BY7K 3HOVK 3FOFA 1ZQ1C 3GTLK 2JA5C 3I4MK 2VUMA 4YFXA 4X6AK 1VH2A 3GTKA 4QJVB 1TWAC 1O26A 3H0GC 1J6WA 1WQGA 2NVXK 4G7OA 2XCQA 5IOQA
chains in the Genus database with same CATH topology
1O2FB 3BP8C 1IBAA 3IPJA 3BP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O2F B;  3BP8 C;  1IBA A;  3IPJ A;  3BP3 A; 
#chains in the Genus database with same CATH topology
 2E2J K;  1WQH A;  1DCH A;  1HQM A;  3GIR A;  3A8J A;  3I4M C;  1B4A A;  2D6F C;  3HOU C;  2NVT C;  2NVQ K;  1V5V A;  3S15 K;  1TWA A;  2O5I A;  4WIL A;  5C3E K;  3Q3Q A;  2FQT A;  1C0A A;  1X31 C;  5C4J K;  1USO A;  2JA6 K;  5C4X C;  3FOE A;  2PA8 D;  2ZFZ A;  3S0X A;  1IL2 A;  2VUM C;  5IYD K;  2JA6 A;  1ZYR A;  5FLM K;  4BLA A;  1ISE A;  3G4A A;  4A3I K;  4A3J C;  1I50 A;  1JQW A;  3IPJ A;  5C44 K;  4WJ4 A;  4P5B A;  4G7H A;  3GTK C;  3T01 A;  4A3K C;  4XLP A;  2GSO A;  3S2H K;  1VJE A;  3AD7 C;  1HI9 A;  3SZZ A;  2JA7 K;  3BUE A;  4ILD A;  3PO2 C;  4NOI A;  1SFO C;  2E2H K;  2RGR A;  4AYB L;  5IYB C;  1J6V A;  4C3I K;  4BBR C;  4AH6 A;  4BXX K;  2XCO A;  4KB2 A;  4A3D K;  1O28 A;  3HOY C;  1J6X A;  5TMC A;  4A3B C;  4BBR K;  5IYB K;  4FZB A;  4OIP A;  2E2H C;  3GTL A;  3TFH A;  2B63 K;  1SFO K;  1TWF K;  1I6V A;  2WAQ L;  1WOO A;  1WSV A;  2RH6 A;  4KAT A;  4KM8 A;  4KN7 A;  1WQF A;  1O24 A;  2WAQ D;  5CHP A;  1EK8 A;  3CQZ A;  5TJ3 A;  4C3J K;  3LAJ A;  5CJ9 A;  3HOX K;  2E2I A;  1IW7 A;  3GTO A;  3HKZ D;  1R9T A;  4C45 A;  3SZY A;  1BGW A;  3PO3 K;  1IE0 A;  5L46 A;  4KAS A;  3FKI K;  2BE5 A;  3S1N C;  5HL8 A;  2JA5 A;  4A3I C;  3V4G A;  1GE9 A;  1Y1W A;  4KAW X;  3HOZ C;  4BLB A;  2R92 C;  4ZH4 A;  5IYD C;  2VUM K;  4GTF A;  4A3D C;  5JVO A;  1F7U A;  1WCM C;  4G7Z A;  4BXX C;  4QIW L;  1INN A;  5C4X K;  1YNJ A;  3N0C A;  5IP7 C;  3A8I A;  2FQO A;  3TFJ A;  4MEX A;  4OIN A;  4A3L K;  2E2H A;  1BDF A;  2JA7 C;  3H3V D;  1IS1 A;  4A3K K;  3L4J A;  1G51 A;  5TMF A;  3CQZ C;  1EFW A;  4BY1 K;  2NVT K;  1TWG K;  1Y1V C;  4LK0 A;  2KWA A;  2PA8 L;  4Y7N C;  1J98 A;  1TWH A;  2E2J C;  2E2I K;  2V6U A;  4KMH A;  3S16 C;  1TWA K;  2CW0 A;  2CFA B;  3HOW K;  3K7A C;  3BP8 C;  1KQ4 A;  4PAA A;  4X6A C;  1Y1V A;  3HOV C;  2JA6 C;  5C4J C;  1YCL A;  1Y1W K;  1I50 K;  4AYB D;  4P5A A;  4KM9 A;  4LJZ A;  1TWF A;  4A3F C;  3RZO K;  3S2D K;  2A69 A;  3TFI A;  4Y52 K;  4C3H C;  4GTL A;  2YU9 K;  5IP9 C;  1PJ6 A;  2A6E A;  4XLN A;  1I6H K;  4GTE A;  3S14 C;  1R9T K;  4GTB A;  3GTQ C;  3S1R C;  4GTD A;  3GTP C;  1O2B A;  3H0G K;  1XZP B;  3N3Y A;  1DCO A;  4A3C K;  3AQP A;  2R7Z A;  3GEH A;  4OIO A;  1YX2 A;  3GSI A;  4P9S A;  3VA7 A;  3LPX A;  2ZUF A;  4BBS C;  4PAB A;  3T02 A;  3I4N K;  4GZY A;  4C3H K;  4Y52 C;  2R7Z K;  4KB4 A;  1PJ5 A;  3AD8 C;  3GTG K;  3GTO C;  2JA8 C;  1F9N A;  4KAR A;  3GEE A;  3GTM C;  4A3M C;  3GTG C;  3GTO K;  4G0V A;  4A93 C;  3ORE A;  4QJV A;  5IOS A;  2R7Z C;  1WOR A;  3N0B A;  2R93 A;  3I4N C;  4BBS K;  4BKW A;  4Q4Z A;  1RU0 A;  4LQY A;  1TWH K;  1B4B A;  3S17 K;  3GTP A;  1XZQ A;  4LLG A;  2NVY K;  1XXC A;  4A3C C;  3S1Q K;  3S16 K;  4FM9 A;  3GTP K;  2E2I C;  3GTQ K;  2R93 C;  1R9T C;  2R92 A;  3ADA C;  3S14 K;  4Y7N K;  1K83 K;  2GSU A;  3H3V L;  2YU9 C;  4BY1 C;  3L4K A;  4LOW A;  3CQZ K;  3RZD C;  3JST A;  4A3F K;  3RZO C;  3S2D C;  4WJ3 M;  3G4C A;  4QIW D;  3GEI A;  3CAG A;  3T00 A;  1DCP A;  2CFA A;  2EBB A;  1AB4 A;  5M3M K;  2P5M A;  2Y0S L;  3S1M C;  1USM A;  3FKI A;  5JFE A;  3M4O K;  4RMF A;  3GTJ C;  2PMZ L;  3AD9 C;  5IYC C;  2V6T A;  3FHZ A;  2GAH C;  4XCH A;  1WCM K;  4OIR A;  3K7A K;  3MML B;  3LAP A;  3HOW C;  2NVX A;  4YG2 A;  1I3Q C;  5D4D A;  5M5Y K;  3HOZ K;  4C2M C;  3HKZ L;  3M3Y K;  4YFN A;  1VLO A;  3FKI C;  3S1N K;  4A3G C;  1Y1V K;  3H0G A;  1TWG C;  3PO3 C;  2JH3 A;  1TWC C;  4LR2 A;  1UV7 A;  1F93 A;  4KDD A;  1DD5 A;  1TWC K;  4G0W A;  3HOX C;  5FJ8 K;  3ERE D;  4A3L C;  1TWF C;  5IP7 K;  1XZQ B;  1O2F B;  3HXA A;  4KMU A;  1WOP A;  1I3Q K;  1BS2 A;  1ZXO A;  5EGE A;  2R92 K;  1EH1 A;  5IYC K;  1XXA A;  1O2A A;  4Q5S A;  3GTJ K;  1I3Q A;  5IOR A;  3M4O C;  3S1M K;  4G0U A;  3PO2 K;  4MQ9 A;  4LK1 A;  1WCM A;  4OIQ A;  3S2H C;  1EI6 A;  1L0W A;  1ZVU A;  3NUH A;  3GTK K;  3GTM A;  3RZD K;  3GTG A;  4C3J C;  5C44 C;  1XZP A;  4A3G K;  1O29 A;  2PPB A;  2R93 K;  1O25 A;  3M3Y C;  2B63 C;  2PHC B;  4C2M K;  4GTC A;  5FLM C;  1TWG A;  4A3B K;  1BJT A;  3HOY K;  1XPP A;  3WOD A;  2NVY C;  2JA7 A;  3OPF A;  4C3I C;  1SFO A;  2V6S A;  1TWH C;  1VGX A;  4XSX A;  5E68 A;  4A93 K;  4GT9 A;  2O5J A;  4DDQ A;  5M5W K;  4YFK A;  2PMZ D;  2JA8 K;  3DXJ A;  4O2D A;  5M5X K;  4KC6 A;  3S15 C;  1O27 A;  2Y0S D;  4KMD A;  2A68 A;  2GSN A;  4MEY A;  1K83 C;  4KMA A;  1WOS A;  4A3J K;  5M3F K;  1IQ0 A;  5IOT A;  2WB1 L;  3EQL A;  4M1X A;  1JOE A;  1XXB A;  2NVY A;  2NVX C;  2A6H A;  2YU9 A;  3AQO A;  2B63 A;  1IBA A;  3S1Q C;  4GTA A;  3GTJ A;  2ZUE A;  3S1R K;  2Y3P A;  3GDZ A;  1PJ7 A;  2GAG C;  1WIH A;  1F7V A;  3S17 C;  3AH5 A;  3GTQ A;  1I6H C;  1VRQ C;  2JA5 K;  3GTL C;  2W7V A;  3OEP A;  5IP9 K;  4JK1 A;  4BY7 C;  1K83 A;  4GFQ A;  3A8K A;  4A3E K;  4KN4 A;  1YNN A;  2XCR B;  3BP3 A;  4A3M K;  3GTM K;  4XSZ A;  5C3E C;  5EGH A;  1I50 C;  1Y1W C;  4A3E C;  2P8T A;  1TWC A;  1SMY A;  3TTG A;  1ZBS A;  1WSR A;  3QX3 A;  1EQR A;  2NVQ C;  3HOU K;  1JVI A;  2WB1 D;  4J3N A;  4BY7 K;  3HOV K;  3FOF A;  1ZQ1 C;  3GTL K;  2JA5 C;  3I4M K;  2VUM A;  4YFX A;  4X6A K;  1VH2 A;  3GTK A;  4QJV B;  1TWA C;  1O26 A;  3H0G C;  1J6W A;  1WQG A;  2NVX K;  4G7O A;  2XCQ A;  5IOQ A; 
#chains in the Genus database with same CATH homology
 1O2F B;  3BP8 C;  1IBA A;  3IPJ A;  3BP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...