3BP3A

Crystal structure of eiib
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
81
structure length
81
Chain Sequence
b'TGTSEMAPALVAAFGGKENITNLDACITRLRVSVADVSKVDQAGLKKLGAAGVVVAGSGVQAIFGTKSDNLKTEMDEYIRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucose-specific phosphotransferase enzyme IIB component
publication title Analyses of Mlc-IIBGlc interaction and a plausible molecular mechanism of Mlc inactivation by membrane sequestration.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 16
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature ec 2.7.1.199: Protein-N(pi)-phosphohistidine--D-glucose phosphotransferase.
pdb deposition date 2007-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00367 PTS_EIIB phosphotransferase system, EIIB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.60 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Glucose permease domain IIB 3bp3A00
1IBAA 3BP3A 1O2FB 3BP8C 3IPJA
chains in the Genus database with same CATH superfamily
2JA6A 2JA7K 4BY1K 3S1QK 4A3DC 4WJ4A 4KN4A 1O2AA 4A3GK 2A6EA 4KAWX 3FKIK 3FOEA 2NVYC 4XCHA 3HOXC 4Q4ZA 3A8JA 4G0VA 3L4JA 3RZDC 5IP9C 4C2MK 1XZQB 1O26A 4YFXA 4WJ3M 4A93K 1WCMA 4C45A 3HOVK 4AH6A 3LAJA 1YNNA 2P8TA 2JA7C 2R93A 1TWGK 3S1NK 1IS1A 1L0WA 1KQ4A 3S1QC 3GTGK 5C4JK 4C3JK 2A6HA 3CQZA 3HOUK 2WB1L 4LK1A 5IOTA 3FKIC 1IW7A 1TWHA 4LK0A 2JA8K 4G7ZA 5FLMK 2EBBA 1Y1WC 4OIRA 4C2MC 3TFHA 4Y7NK 4BY7K 1DCOA 1HQMA 4A3CK 4BXXC 1WSVA 1IBAA 4A3JC 1XZQA 2FQTA 4LQYA 2A69A 3S1NC 1O29A 4A3LC 3GTGC 5C4JC 1EH1A 4ILDA 1ZXOA 4C3JC 1J6XA 1TWAK 5JFEA 3HOUC 2WB1D 1ZVUA 1WOSA 1AB4A 4QJVB 5FLMC 3GTPC 4Q5SA 3GTLC 2RGRA 4BY7C 3TTGA 4A3CC 1I6HK 2VUMA 2PA8D 4KMUA 2GSNA 4KM9A 3AD8C 3RZOC 3A8IA 1YX2A 2R92A 3VA7A 2XCRB 1G51A 5IYDK 4A3EK 3GSIA 2JH3A 3GDZA 2JA5A 2CFAB 4LLGA 5FJ8K 4BKWA 1I3QC 2JA6K 4GTEA 3I4MK 3HOWC 4QJVA 1J6WA 1WQHA 2E2IK 3PO2K 4GTBA 3SZYA 1VJEA 1F93A 5HL8A 5IYDC 1USMA 2WAQD 4A3EC 1SFOA 4BBRK 1EI6A 5CHPA 1JOEA 3H3VD 2PHCB 2R7ZA 2JA6C 3I4MC 3SZZA 2R93K 1DCPA 2CFAA 1Y1VA 4KM8A 3QX3A 1XZPB 5M5WK 3TFJA 1TWHK 1XXAA 3HKZL 1TWFA 5IYBK 4GT9A 3GTQA 1WCMC 1BJTA 1YNJA 1O2FB 5C44K 1EQRA 4DDQA 1JQWA 5CJ9A 4KMHA 3BP8C 3CQZC 5TMCA 2D6FC 1B4BA 3GTMA 3S2HK 2YU9C 1TWHC 3S14C 4MEXA 3H0GA 3MMLB 1GE9A 1XZPA 1PJ6A 1J98A 2ZFZA 3BP3A 5M3FK 5C44C 2VUMK 3OPFA 4OIPA 4A3KK 2R92K 4FM9A 5IOQA 4OINA 2RH6A 4GTDA 3S15C 5IYCK 1HI9A 3FOFA 3A8KA 1XPPA 1Y1WK 3S2HC 3LAPA 2NVXA 5C4XK 2JA5K 1EK8A 4BXXK 4C3HC 3GEHA 2ZUEA 1ISEA 2ZUFA 4A3JK 3GTOC 4XLNA 3HOZC 3L4KA 2Y0SD 4BLAA 2VUMC 4A3LK 1BGWA 3AQPA 4A3KC 2XCQA 2R92C 2E2HC 2YU9A 1O25A 4PAAA 4XSXA 5IYCC 3S2DC 3GTPK 1SFOK 3GTLK 2JA5C 5C4XC 1WORA 4AYBD 1F7UA 2R7ZK 5IOSA 2PA8L 1XXCA 1WSRA 3RZOK 1Y1VK 1F7VA 4NOIA 4GTCA 1IL2A 2NVTK 3S0XA 2P5MA 2XCOA 1O24A 1SFOC 1TWFK 4LR2A 3ERED 1I3QK 3GTQK 3HOWK 3GTOA 2R7ZC 2BE5A 1Y1VC 3S17K 2E2HA 2NVTC 4YFNA 2E2JK 2WAQL 3GTMK 1EFWA 3LPXA 3I4NK 3S1RK 1IQ0A 3NUHA 3H0GK 2PMZL 3H3VL 4YFKA 4GFQA 1TWFC 1INNA 3GTQC 2B63A 1JVIA 5IYBC 4KDDA 3V4GA 3GTKA 4PABA 3S17C 3M3YK 3WODA 4JK1A 4P9SA 4OIOA 2E2JC 5M3MK 3GTMC 2GSOA 2NVXK 4LOWA 3S1RC 3I4NC 3H0GC 2PMZD 4KB4A 4OIQA 1WCMK 1ZQ1C 1R9TA 4KC6A 5EGHA 1J6VA 4GTAA 4XLPA 3AQOA 4KATA 1TWGA 2A68A 3CQZK 4GTLA 2YU9K 4GTFA 3M3YC 3S14K 4YG2A 1K83A 4P5AA 4MQ9A 5EGEA 1TWCA 2NVXC 4BBSK 3G4AA 4KN7A 4KB2A 4A3FC 1UV7A 4GZYA 1I50A 3GTJA 3S15K 1TWAA 1BDFA 3GEIA 1XXBA 2GAHC 1YCLA 3DXJA 1O2BA 4BBSC 4C3HK 4A3IK 1USOA 3OEPA 3GTOK 3HOZK 2Y0SL 3S1MC 4QIWD 4C3IK 3G4CA 3TFIA 3IPJA 2E2HK 3AD7C 2PPBA 3S2DK 3HOYK 2FQOA 3K7AK 4AYBL 4BLBA 1VH2A 3GIRA 1SMYA 4A3IC 4A3BK 1C0AA 1RU0A 5TJ3A 4C3IC 2GSUA 2E2IA 3GTKK 4Y52K 4KMDA 1VRQC 5IORA 3N3YA 1I6VA 3AD9C 3HOYC 4M1XA 3T00A 3K7AC 3S16C 5D4DA 3T02A 4X6AC 3OREA 1R9TK 3N0BA 1ZBSA 2B63C 3AH5A 4A3BC 4O2DA 4FZBA 4BY1C 3ADAC 3GTKC 2V6TA 4Y52C 3Q3QA 5E68A 3FHZA 4A3GC 1K83K 1TWCK 4J3NA 3PO3K 5M5XK 3GEEA 4A93C 1R9TC 4KASA 3HOVC 1X31C 4XSZA 1I50K 4KARA 1TWGC 3GTJK 4G0UA 2NVYA 1O27A 1V5VA 2Y3PA 1K83C 5TMFA 2JA8C 1TWCC 3PO3C 1O28A 4Y7NC 1WOPA 2JA7A 2O5JA 3T01A 2GAGC 2V6UA 1PJ5A 1I50C 3BUEA 3GTJC 3FKIA 4G0WA 1TWAC 1PJ7A 1Y1WA 1WQGA 4A3FK 3N0CA 3M4OK 4A3MK 5JVOA 2KWAA 1I6HC 3GTGA 2NVQK 3HXAA 1VLOA 1VGXA 3GTPA 4KMAA 2CW0A 3GTLA 3S1MK 1IE0A 4QIWL 3M4OC 1WIHA 1B4AA 1DCHA 4A3MC 5IP7K 3CAGA 4P5BA 1DD5A 5C3EK 4ZH4A 2E2IC 1ZYRA 3PO2C 2NVQC 1WOOA 3JSTA 1BS2A 4G7HA 5M5YK 4BBRC 4MEYA 1I3QA 2O5IA 1WQFA 3EQLA 2V6SA 2W7VA 4A3DK 5IP7C 4G7OA 4RMFA 2R93C 5C3EC 2NVYK 3HOXK 3RZDK 4WILA 3S16K 5IP9K 4LJZA 1F9NA 4X6AK 5L46A 3HKZD 2B63K
chains in the Genus database with same CATH topology
1IBAA 3BP3A 1O2FB 3BP8C 3IPJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBA A;  3BP3 A;  1O2F B;  3BP8 C;  3IPJ A; 
#chains in the Genus database with same CATH topology
 2JA6 A;  2JA7 K;  4BY1 K;  3S1Q K;  4A3D C;  4WJ4 A;  4KN4 A;  1O2A A;  4A3G K;  2A6E A;  4KAW X;  3FKI K;  3FOE A;  2NVY C;  4XCH A;  3HOX C;  4Q4Z A;  3A8J A;  4G0V A;  3L4J A;  3RZD C;  5IP9 C;  4C2M K;  1XZQ B;  1O26 A;  4YFX A;  4WJ3 M;  4A93 K;  1WCM A;  4C45 A;  3HOV K;  4AH6 A;  3LAJ A;  1YNN A;  2P8T A;  2JA7 C;  2R93 A;  1TWG K;  3S1N K;  1IS1 A;  1L0W A;  1KQ4 A;  3S1Q C;  3GTG K;  5C4J K;  4C3J K;  2A6H A;  3CQZ A;  3HOU K;  2WB1 L;  4LK1 A;  5IOT A;  3FKI C;  1IW7 A;  1TWH A;  4LK0 A;  2JA8 K;  4G7Z A;  5FLM K;  2EBB A;  1Y1W C;  4OIR A;  4C2M C;  3TFH A;  4Y7N K;  4BY7 K;  1DCO A;  1HQM A;  4A3C K;  4BXX C;  1WSV A;  1IBA A;  4A3J C;  1XZQ A;  2FQT A;  4LQY A;  2A69 A;  3S1N C;  1O29 A;  4A3L C;  3GTG C;  5C4J C;  1EH1 A;  4ILD A;  1ZXO A;  4C3J C;  1J6X A;  1TWA K;  5JFE A;  3HOU C;  2WB1 D;  1ZVU A;  1WOS A;  1AB4 A;  4QJV B;  5FLM C;  3GTP C;  4Q5S A;  3GTL C;  2RGR A;  4BY7 C;  3TTG A;  4A3C C;  1I6H K;  2VUM A;  2PA8 D;  4KMU A;  2GSN A;  4KM9 A;  3AD8 C;  3RZO C;  3A8I A;  1YX2 A;  2R92 A;  3VA7 A;  2XCR B;  1G51 A;  5IYD K;  4A3E K;  3GSI A;  2JH3 A;  3GDZ A;  2JA5 A;  2CFA B;  4LLG A;  5FJ8 K;  4BKW A;  1I3Q C;  2JA6 K;  4GTE A;  3I4M K;  3HOW C;  4QJV A;  1J6W A;  1WQH A;  2E2I K;  3PO2 K;  4GTB A;  3SZY A;  1VJE A;  1F93 A;  5HL8 A;  5IYD C;  1USM A;  2WAQ D;  4A3E C;  1SFO A;  4BBR K;  1EI6 A;  5CHP A;  1JOE A;  3H3V D;  2PHC B;  2R7Z A;  2JA6 C;  3I4M C;  3SZZ A;  2R93 K;  1DCP A;  2CFA A;  1Y1V A;  4KM8 A;  3QX3 A;  1XZP B;  5M5W K;  3TFJ A;  1TWH K;  1XXA A;  3HKZ L;  1TWF A;  5IYB K;  4GT9 A;  3GTQ A;  1WCM C;  1BJT A;  1YNJ A;  1O2F B;  5C44 K;  1EQR A;  4DDQ A;  1JQW A;  5CJ9 A;  4KMH A;  3BP8 C;  3CQZ C;  5TMC A;  2D6F C;  1B4B A;  3GTM A;  3S2H K;  2YU9 C;  1TWH C;  3S14 C;  4MEX A;  3H0G A;  3MML B;  1GE9 A;  1XZP A;  1PJ6 A;  1J98 A;  2ZFZ A;  3BP3 A;  5M3F K;  5C44 C;  2VUM K;  3OPF A;  4OIP A;  4A3K K;  2R92 K;  4FM9 A;  5IOQ A;  4OIN A;  2RH6 A;  4GTD A;  3S15 C;  5IYC K;  1HI9 A;  3FOF A;  3A8K A;  1XPP A;  1Y1W K;  3S2H C;  3LAP A;  2NVX A;  5C4X K;  2JA5 K;  1EK8 A;  4BXX K;  4C3H C;  3GEH A;  2ZUE A;  1ISE A;  2ZUF A;  4A3J K;  3GTO C;  4XLN A;  3HOZ C;  3L4K A;  2Y0S D;  4BLA A;  2VUM C;  4A3L K;  1BGW A;  3AQP A;  4A3K C;  2XCQ A;  2R92 C;  2E2H C;  2YU9 A;  1O25 A;  4PAA A;  4XSX A;  5IYC C;  3S2D C;  3GTP K;  1SFO K;  3GTL K;  2JA5 C;  5C4X C;  1WOR A;  4AYB D;  1F7U A;  2R7Z K;  5IOS A;  2PA8 L;  1XXC A;  1WSR A;  3RZO K;  1Y1V K;  1F7V A;  4NOI A;  4GTC A;  1IL2 A;  2NVT K;  3S0X A;  2P5M A;  2XCO A;  1O24 A;  1SFO C;  1TWF K;  4LR2 A;  3ERE D;  1I3Q K;  3GTQ K;  3HOW K;  3GTO A;  2R7Z C;  2BE5 A;  1Y1V C;  3S17 K;  2E2H A;  2NVT C;  4YFN A;  2E2J K;  2WAQ L;  3GTM K;  1EFW A;  3LPX A;  3I4N K;  3S1R K;  1IQ0 A;  3NUH A;  3H0G K;  2PMZ L;  3H3V L;  4YFK A;  4GFQ A;  1TWF C;  1INN A;  3GTQ C;  2B63 A;  1JVI A;  5IYB C;  4KDD A;  3V4G A;  3GTK A;  4PAB A;  3S17 C;  3M3Y K;  3WOD A;  4JK1 A;  4P9S A;  4OIO A;  2E2J C;  5M3M K;  3GTM C;  2GSO A;  2NVX K;  4LOW A;  3S1R C;  3I4N C;  3H0G C;  2PMZ D;  4KB4 A;  4OIQ A;  1WCM K;  1ZQ1 C;  1R9T A;  4KC6 A;  5EGH A;  1J6V A;  4GTA A;  4XLP A;  3AQO A;  4KAT A;  1TWG A;  2A68 A;  3CQZ K;  4GTL A;  2YU9 K;  4GTF A;  3M3Y C;  3S14 K;  4YG2 A;  1K83 A;  4P5A A;  4MQ9 A;  5EGE A;  1TWC A;  2NVX C;  4BBS K;  3G4A A;  4KN7 A;  4KB2 A;  4A3F C;  1UV7 A;  4GZY A;  1I50 A;  3GTJ A;  3S15 K;  1TWA A;  1BDF A;  3GEI A;  1XXB A;  2GAH C;  1YCL A;  3DXJ A;  1O2B A;  4BBS C;  4C3H K;  4A3I K;  1USO A;  3OEP A;  3GTO K;  3HOZ K;  2Y0S L;  3S1M C;  4QIW D;  4C3I K;  3G4C A;  3TFI A;  3IPJ A;  2E2H K;  3AD7 C;  2PPB A;  3S2D K;  3HOY K;  2FQO A;  3K7A K;  4AYB L;  4BLB A;  1VH2 A;  3GIR A;  1SMY A;  4A3I C;  4A3B K;  1C0A A;  1RU0 A;  5TJ3 A;  4C3I C;  2GSU A;  2E2I A;  3GTK K;  4Y52 K;  4KMD A;  1VRQ C;  5IOR A;  3N3Y A;  1I6V A;  3AD9 C;  3HOY C;  4M1X A;  3T00 A;  3K7A C;  3S16 C;  5D4D A;  3T02 A;  4X6A C;  3ORE A;  1R9T K;  3N0B A;  1ZBS A;  2B63 C;  3AH5 A;  4A3B C;  4O2D A;  4FZB A;  4BY1 C;  3ADA C;  3GTK C;  2V6T A;  4Y52 C;  3Q3Q A;  5E68 A;  3FHZ A;  4A3G C;  1K83 K;  1TWC K;  4J3N A;  3PO3 K;  5M5X K;  3GEE A;  4A93 C;  1R9T C;  4KAS A;  3HOV C;  1X31 C;  4XSZ A;  1I50 K;  4KAR A;  1TWG C;  3GTJ K;  4G0U A;  2NVY A;  1O27 A;  1V5V A;  2Y3P A;  1K83 C;  5TMF A;  2JA8 C;  1TWC C;  3PO3 C;  1O28 A;  4Y7N C;  1WOP A;  2JA7 A;  2O5J A;  3T01 A;  2GAG C;  2V6U A;  1PJ5 A;  1I50 C;  3BUE A;  3GTJ C;  3FKI A;  4G0W A;  1TWA C;  1PJ7 A;  1Y1W A;  1WQG A;  4A3F K;  3N0C A;  3M4O K;  4A3M K;  5JVO A;  2KWA A;  1I6H C;  3GTG A;  2NVQ K;  3HXA A;  1VLO A;  1VGX A;  3GTP A;  4KMA A;  2CW0 A;  3GTL A;  3S1M K;  1IE0 A;  4QIW L;  3M4O C;  1WIH A;  1B4A A;  1DCH A;  4A3M C;  5IP7 K;  3CAG A;  4P5B A;  1DD5 A;  5C3E K;  4ZH4 A;  2E2I C;  1ZYR A;  3PO2 C;  2NVQ C;  1WOO A;  3JST A;  1BS2 A;  4G7H A;  5M5Y K;  4BBR C;  4MEY A;  1I3Q A;  2O5I A;  1WQF A;  3EQL A;  2V6S A;  2W7V A;  4A3D K;  5IP7 C;  4G7O A;  4RMF A;  2R93 C;  5C3E C;  2NVY K;  3HOX K;  3RZD K;  4WIL A;  3S16 K;  5IP9 K;  4LJZ A;  1F9N A;  4X6A K;  5L46 A;  3HKZ D;  2B63 K; 
#chains in the Genus database with same CATH homology
 1IBA A;  3BP3 A;  1O2F B;  3BP8 C;  3IPJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...