3BP3A

Crystal structure of eiib
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
81
structure length
81
Chain Sequence
TGTSEMAPALVAAFGGKENITNLDACITRLRVSVADVSKVDQAGLKKLGAAGVVVAGSGVQAIFGTKSDNLKTEMDEYIRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analyses of Mlc-IIBGlc interaction and a plausible molecular mechanism of Mlc inactivation by membrane sequestration.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Glucose-specific phosphotransferase enzyme IIB component
total genus 16
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature ec 2.7.1.199: Protein-N(pi)-phosphohistidine--D-glucose phosphotransferase.
pdb deposition date 2007-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00367 PTS_EIIB phosphotransferase system, EIIB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.60 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Glucose permease domain IIB 3bp3A00
3IPJA 3BP3A 1O2FB 1IBAA 3BP8C
chains in the Genus database with same CATH superfamily
5FJ8K 5HL8A 4G7OA 4LQYA 1EH1A 5FLMK 5M3MK 3AQOA 3S1RC 2R92K 4BLBA 4A3JK 4YG2A 2NVYC 4OINA 1INNA 4KMDA 3S2HK 3LAPA 1WSRA 4C3JC 5IP9C 4QIWL 2WAQD 3FKIK 3GTJC 1PJ6A 2ZUEA 2GSOA 2NVQC 3BP3A 2VUMC 3TFHA 1K83C 1PJ5A 1I50A 2E2HA 3WODA 1Y1WA 4FM9A 2XCQA 1DCPA 3TFJA 4XCHA 1TWAK 3S0XA 5IP9K 2P8TA 3I4MC 3HXAA 1DD5A 3GEHA 4C2MK 3A8KA 1EK8A 4A3DC 1YNNA 3CQZA 5IOTA 4A3GC 1ZBSA 1JVIA 2JA6C 3A8JA 3GTGC 1G51A 2O5JA 5E68A 3AD8C 3I4MK 4KMHA 4A3EK 2JA7K 5M5XK 1IL2A 3GTLC 2GSNA 1WIHA 5IOSA 1XXAA 4LR2A 3M3YK 1O25A 5IYCC 3GTJK 5C3EC 3S1QK 4QJVA 4KMUA 5IOQA 2JA5A 5CHPA 3T01A 2JA7C 3GIRA 1TWFC 4GFQA 1L0WA 4WJ4A 1XXCA 1SFOK 2R92C 2YU9A 2R7ZC 2PHCB 3S1RK 1TWAA 1XZPB 1VH2A 2CW0A 1O27A 2B63C 3S1MK 1UV7A 4LJZA 2A6HA 4J3NA 3AD9C 1J98A 3RZOC 3HOZK 3GTQC 1EI6A 1XPPA 4XLNA 1WQGA 4PABA 1F9NA 4C2MC 4GTEA 4A3IC 2E2IK 3GEIA 2R93K 1XZPA 1TWHA 3GSIA 4A3GK 4Q5SA 2NVXA 2W7VA 2FQTA 3CQZC 4WILA 1O24A 5IP7C 1TWHK 1JOEA 3HOYK 2GAHC 1IBAA 2VUMK 4C3IK 2WB1L 3S17C 5IORA 3FKIC 1Y1VA 1IE0A 1O28A 3FHZA 1O26A 4Y52C 2E2IA 1BS2A 3QX3A 4OIPA 3HOVC 4M1XA 4A3JC 1ZYRA 1AB4A 1I6HK 1I50C 3S1NK 4DDQA 3GTMK 1O2BA 3GTPK 1ZXOA 4BBRK 2PPBA 4Y7NK 3V4GA 4GTFA 4OIQA 2KWAA 2V6UA 4KM8A 3LPXA 3HKZL 1I3QK 4C3HC 1YNJA 3TFIA 3L4KA 3AD7C 2A69A 4QIWD 3S2DC 1TWGC 4A3MK 5CJ9A 3H3VL 3GTOC 4X6AC 1O2AA 2NVTC 4XSXA 4BY1C 1TWFK 4GTAA 4MEXA 1O2FB 1WQFA 1TWCC 3S15K 1SFOA 1IS1A 5C44C 5D4DA 1R9TA 2JA5K 1BJTA 4ILDA 2PA8L 5C3EK 3M3YC 3GTPA 4Y52K 4OIRA 1XZQB 2XCRB 3IPJA 3HOWC 3GTKA 4KATA 4C3IC 4KASA 3S17K 3PO2K 4A3KK 1WSVA 4GZYA 2NVXK 1BGWA 3GEEA 3CQZK 3ERED 1ISEA 3N3YA 4LK1A 3L4JA 3PO3K 3FOEA 3OREA 2YU9K 4MEYA 4AYBL 1VRQC 1Y1WK 3GTQK 2VUMA 4A3LK 2R93A 4GTLA 1C0AA 2WB1D 5IYBK 5IYDC 1ZQ1C 3H0GK 3S1MC 4BLAA 5EGHA 2CFAA 2ZFZA 3SZYA 1B4AA 3HOWK 3S14K 1XXBA 4A3KC 2E2HK 2JA8C 2JA5C 4KB2A 2JA7A 1Y1VK 4GTCA 5C4XK 5C44K 3N0CA 3S2HC 3FKIA 3S15C 2JA8K 3AH5A 3S1QC 4KARA 4KM9A 3A8IA 5TMCA 4A3CK 5TJ3A 2WAQL 3Q3QA 3S14C 3S16K 2E2JC 5FLMC 2P5MA 4G0UA 3GTOK 1ZVUA 3H0GC 1KQ4A 3S2DK 4BKWA 4BY1K 3M4OK 2D6FC 3K7AK 3M4OC 4A3LC 4X6AK 1RU0A 4KC6A 3GTGK 1Y1WC 1V5VA 3CAGA 3GTMA 4G0VA 3I4NC 1WOSA 3S16C 3OPFA 5EGEA 5C4JC 1I6HC 1SMYA 2PMZD 2RH6A 2ZUFA 4BBRC 1TWFA 1WCMK 4AYBD 1VGXA 1Y1VC 5C4XC 5TMFA 1GE9A 1TWAC 1XZQA 3HOVK 4A3FC 3HOUK 4LOWA 3VA7A 1WOOA 3H3VD 4BXXC 1WCMC 2RGRA 1K83A 1F7VA 5IYDK 2PA8D 1WOPA 4GTDA 1J6XA 1TWHC 4A3IK 3NUHA 4KN7A 1IQ0A 4KDDA 2NVYK 3ADAC 3GDZA 1DCHA 1USMA 1HQMA 3G4CA 2CFAB 1F7UA 5C4JK 1TWGA 3PO3C 3T02A 4P5AA 1DCOA 1WORA 2PMZL 4BBSC 3RZOK 1J6VA 3HOXC 2FQOA 4A93K 1HI9A 1EQRA 3T00A 2R92A 4C3HK 1I3QC 3K7AC 2R7ZK 1SFOC 3PO2C 2O5IA 1J6WA 1WQHA 4P5BA 1B4BA 3H0GA 1R9TC 2B63K 4A3CC 4MQ9A 4LK0A 2Y0SD 5JFEA 4Y7NC 1VLOA 4C45A 3BP8C 2V6TA 2E2JK 4KN4A 1I6VA 3LAJA 3GTQA 2Y3PA 4YFNA 3S1NC 2V6SA 4KMAA 1YCLA 5M3FK 4RMFA 2E2HC 4LLGA 3FOFA 3N0BA 1USOA 1F93A 4BY7C 3HKZD 5IYCK 5L46A 1VJEA 2BE5A 4A3EC 4KB4A 5IYBC 4AH6A 4YFXA 3MMLB 4FZBA 1JQWA 4OIOA 2NVTK 5IP7K 3SZZA 1IW7A 3OEPA 4P9SA 2GSUA 3GTLK 4A93C 2Y0SL 3GTKK 2YU9C 2R7ZA 3HOXK 4XSZA 3RZDK 2NVYA 1TWCA 2JA6K 4G7ZA 4XLPA 4BBSK 2E2IC 4O2DA 3GTGA 2B63A 1YX2A 3EQLA 3DXJA 4A3BC 4A3BK 4GT9A 3GTJA 1O29A 2GAGC 3TTGA 3BUEA 3GTPC 3GTMC 1I50K 3RZDC 4WJ3M 4PAAA 3GTKC 4Q4ZA 4A3DK 2NVXC 4BXXK 5JVOA 5M5WK 4QJVB 4GTBA 1K83K 1PJ7A 3G4AA 4A3FK 2NVQK 3HOUC 3GTOA 4BY7K 1I3QA 4C3JK 3HOYC 2A68A 4G7HA 1X31C 5M5YK 1TWCK 2JA6A 4YFKA 4ZH4A 1WCMA 4KAWX 2EBBA 2R93C 3AQPA 3I4NK 1R9TK 4A3MC 3GTLA 1TWGK 1BDFA 2XCOA 4G0WA 3HOZC 2A6EA 2JH3A 4JK1A 4NOIA 3JSTA 1EFWA
chains in the Genus database with same CATH topology
3IPJA 3BP3A 1O2FB 1IBAA 3BP8C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IPJ A;  3BP3 A;  1O2F B;  1IBA A;  3BP8 C; 
#chains in the Genus database with same CATH topology
 5FJ8 K;  5HL8 A;  4G7O A;  4LQY A;  1EH1 A;  5FLM K;  5M3M K;  3AQO A;  3S1R C;  2R92 K;  4BLB A;  4A3J K;  4YG2 A;  2NVY C;  4OIN A;  1INN A;  4KMD A;  3S2H K;  3LAP A;  1WSR A;  4C3J C;  5IP9 C;  4QIW L;  2WAQ D;  3FKI K;  3GTJ C;  1PJ6 A;  2ZUE A;  2GSO A;  2NVQ C;  3BP3 A;  2VUM C;  3TFH A;  1K83 C;  1PJ5 A;  1I50 A;  2E2H A;  3WOD A;  1Y1W A;  4FM9 A;  2XCQ A;  1DCP A;  3TFJ A;  4XCH A;  1TWA K;  3S0X A;  5IP9 K;  2P8T A;  3I4M C;  3HXA A;  1DD5 A;  3GEH A;  4C2M K;  3A8K A;  1EK8 A;  4A3D C;  1YNN A;  3CQZ A;  5IOT A;  4A3G C;  1ZBS A;  1JVI A;  2JA6 C;  3A8J A;  3GTG C;  1G51 A;  2O5J A;  5E68 A;  3AD8 C;  3I4M K;  4KMH A;  4A3E K;  2JA7 K;  5M5X K;  1IL2 A;  3GTL C;  2GSN A;  1WIH A;  5IOS A;  1XXA A;  4LR2 A;  3M3Y K;  1O25 A;  5IYC C;  3GTJ K;  5C3E C;  3S1Q K;  4QJV A;  4KMU A;  5IOQ A;  2JA5 A;  5CHP A;  3T01 A;  2JA7 C;  3GIR A;  1TWF C;  4GFQ A;  1L0W A;  4WJ4 A;  1XXC A;  1SFO K;  2R92 C;  2YU9 A;  2R7Z C;  2PHC B;  3S1R K;  1TWA A;  1XZP B;  1VH2 A;  2CW0 A;  1O27 A;  2B63 C;  3S1M K;  1UV7 A;  4LJZ A;  2A6H A;  4J3N A;  3AD9 C;  1J98 A;  3RZO C;  3HOZ K;  3GTQ C;  1EI6 A;  1XPP A;  4XLN A;  1WQG A;  4PAB A;  1F9N A;  4C2M C;  4GTE A;  4A3I C;  2E2I K;  3GEI A;  2R93 K;  1XZP A;  1TWH A;  3GSI A;  4A3G K;  4Q5S A;  2NVX A;  2W7V A;  2FQT A;  3CQZ C;  4WIL A;  1O24 A;  5IP7 C;  1TWH K;  1JOE A;  3HOY K;  2GAH C;  1IBA A;  2VUM K;  4C3I K;  2WB1 L;  3S17 C;  5IOR A;  3FKI C;  1Y1V A;  1IE0 A;  1O28 A;  3FHZ A;  1O26 A;  4Y52 C;  2E2I A;  1BS2 A;  3QX3 A;  4OIP A;  3HOV C;  4M1X A;  4A3J C;  1ZYR A;  1AB4 A;  1I6H K;  1I50 C;  3S1N K;  4DDQ A;  3GTM K;  1O2B A;  3GTP K;  1ZXO A;  4BBR K;  2PPB A;  4Y7N K;  3V4G A;  4GTF A;  4OIQ A;  2KWA A;  2V6U A;  4KM8 A;  3LPX A;  3HKZ L;  1I3Q K;  4C3H C;  1YNJ A;  3TFI A;  3L4K A;  3AD7 C;  2A69 A;  4QIW D;  3S2D C;  1TWG C;  4A3M K;  5CJ9 A;  3H3V L;  3GTO C;  4X6A C;  1O2A A;  2NVT C;  4XSX A;  4BY1 C;  1TWF K;  4GTA A;  4MEX A;  1O2F B;  1WQF A;  1TWC C;  3S15 K;  1SFO A;  1IS1 A;  5C44 C;  5D4D A;  1R9T A;  2JA5 K;  1BJT A;  4ILD A;  2PA8 L;  5C3E K;  3M3Y C;  3GTP A;  4Y52 K;  4OIR A;  1XZQ B;  2XCR B;  3IPJ A;  3HOW C;  3GTK A;  4KAT A;  4C3I C;  4KAS A;  3S17 K;  3PO2 K;  4A3K K;  1WSV A;  4GZY A;  2NVX K;  1BGW A;  3GEE A;  3CQZ K;  3ERE D;  1ISE A;  3N3Y A;  4LK1 A;  3L4J A;  3PO3 K;  3FOE A;  3ORE A;  2YU9 K;  4MEY A;  4AYB L;  1VRQ C;  1Y1W K;  3GTQ K;  2VUM A;  4A3L K;  2R93 A;  4GTL A;  1C0A A;  2WB1 D;  5IYB K;  5IYD C;  1ZQ1 C;  3H0G K;  3S1M C;  4BLA A;  5EGH A;  2CFA A;  2ZFZ A;  3SZY A;  1B4A A;  3HOW K;  3S14 K;  1XXB A;  4A3K C;  2E2H K;  2JA8 C;  2JA5 C;  4KB2 A;  2JA7 A;  1Y1V K;  4GTC A;  5C4X K;  5C44 K;  3N0C A;  3S2H C;  3FKI A;  3S15 C;  2JA8 K;  3AH5 A;  3S1Q C;  4KAR A;  4KM9 A;  3A8I A;  5TMC A;  4A3C K;  5TJ3 A;  2WAQ L;  3Q3Q A;  3S14 C;  3S16 K;  2E2J C;  5FLM C;  2P5M A;  4G0U A;  3GTO K;  1ZVU A;  3H0G C;  1KQ4 A;  3S2D K;  4BKW A;  4BY1 K;  3M4O K;  2D6F C;  3K7A K;  3M4O C;  4A3L C;  4X6A K;  1RU0 A;  4KC6 A;  3GTG K;  1Y1W C;  1V5V A;  3CAG A;  3GTM A;  4G0V A;  3I4N C;  1WOS A;  3S16 C;  3OPF A;  5EGE A;  5C4J C;  1I6H C;  1SMY A;  2PMZ D;  2RH6 A;  2ZUF A;  4BBR C;  1TWF A;  1WCM K;  4AYB D;  1VGX A;  1Y1V C;  5C4X C;  5TMF A;  1GE9 A;  1TWA C;  1XZQ A;  3HOV K;  4A3F C;  3HOU K;  4LOW A;  3VA7 A;  1WOO A;  3H3V D;  4BXX C;  1WCM C;  2RGR A;  1K83 A;  1F7V A;  5IYD K;  2PA8 D;  1WOP A;  4GTD A;  1J6X A;  1TWH C;  4A3I K;  3NUH A;  4KN7 A;  1IQ0 A;  4KDD A;  2NVY K;  3ADA C;  3GDZ A;  1DCH A;  1USM A;  1HQM A;  3G4C A;  2CFA B;  1F7U A;  5C4J K;  1TWG A;  3PO3 C;  3T02 A;  4P5A A;  1DCO A;  1WOR A;  2PMZ L;  4BBS C;  3RZO K;  1J6V A;  3HOX C;  2FQO A;  4A93 K;  1HI9 A;  1EQR A;  3T00 A;  2R92 A;  4C3H K;  1I3Q C;  3K7A C;  2R7Z K;  1SFO C;  3PO2 C;  2O5I A;  1J6W A;  1WQH A;  4P5B A;  1B4B A;  3H0G A;  1R9T C;  2B63 K;  4A3C C;  4MQ9 A;  4LK0 A;  2Y0S D;  5JFE A;  4Y7N C;  1VLO A;  4C45 A;  3BP8 C;  2V6T A;  2E2J K;  4KN4 A;  1I6V A;  3LAJ A;  3GTQ A;  2Y3P A;  4YFN A;  3S1N C;  2V6S A;  4KMA A;  1YCL A;  5M3F K;  4RMF A;  2E2H C;  4LLG A;  3FOF A;  3N0B A;  1USO A;  1F93 A;  4BY7 C;  3HKZ D;  5IYC K;  5L46 A;  1VJE A;  2BE5 A;  4A3E C;  4KB4 A;  5IYB C;  4AH6 A;  4YFX A;  3MML B;  4FZB A;  1JQW A;  4OIO A;  2NVT K;  5IP7 K;  3SZZ A;  1IW7 A;  3OEP A;  4P9S A;  2GSU A;  3GTL K;  4A93 C;  2Y0S L;  3GTK K;  2YU9 C;  2R7Z A;  3HOX K;  4XSZ A;  3RZD K;  2NVY A;  1TWC A;  2JA6 K;  4G7Z A;  4XLP A;  4BBS K;  2E2I C;  4O2D A;  3GTG A;  2B63 A;  1YX2 A;  3EQL A;  3DXJ A;  4A3B C;  4A3B K;  4GT9 A;  3GTJ A;  1O29 A;  2GAG C;  3TTG A;  3BUE A;  3GTP C;  3GTM C;  1I50 K;  3RZD C;  4WJ3 M;  4PAA A;  3GTK C;  4Q4Z A;  4A3D K;  2NVX C;  4BXX K;  5JVO A;  5M5W K;  4QJV B;  4GTB A;  1K83 K;  1PJ7 A;  3G4A A;  4A3F K;  2NVQ K;  3HOU C;  3GTO A;  4BY7 K;  1I3Q A;  4C3J K;  3HOY C;  2A68 A;  4G7H A;  1X31 C;  5M5Y K;  1TWC K;  2JA6 A;  4YFK A;  4ZH4 A;  1WCM A;  4KAW X;  2EBB A;  2R93 C;  3AQP A;  3I4N K;  1R9T K;  4A3M C;  3GTL A;  1TWG K;  1BDF A;  2XCO A;  4G0W A;  3HOZ C;  2A6E A;  2JH3 A;  4JK1 A;  4NOI A;  3JST A;  1EFW A; 
#chains in the Genus database with same CATH homology
 3IPJ A;  3BP3 A;  1O2F B;  1IBA A;  3BP8 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...