3BP3A

Crystal structure of eiib
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
81
structure length
81
Chain Sequence
TGTSEMAPALVAAFGGKENITNLDACITRLRVSVADVSKVDQAGLKKLGAAGVVVAGSGVQAIFGTKSDNLKTEMDEYIRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucose-specific phosphotransferase enzyme IIB component
publication title Analyses of Mlc-IIBGlc interaction and a plausible molecular mechanism of Mlc inactivation by membrane sequestration.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 16
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature ec 2.7.1.199: Protein-N(pi)-phosphohistidine--D-glucose phosphotransferase.
pdb deposition date 2007-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00367 PTS_EIIB phosphotransferase system, EIIB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.60 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Glucose permease domain IIB 3bp3A00
3BP8C 3BP3A 1IBAA 3IPJA 1O2FB
chains in the Genus database with same CATH superfamily
4XLNA 1J6WA 5EGHA 2NVQC 3GTKC 4ZH4A 4BXXK 2E2IC 3HOUK 3S2HC 1L0WA 1K83A 4LK0A 1I50C 3GEHA 3AD8C 5IP7C 4G0WA 2ZUFA 3HOVC 2YU9K 1O2FB 2RH6A 2WAQD 3GTQK 5IP9C 1TWAA 4KB4A 3PO3K 1O2BA 2JA7A 5CHPA 3FOEA 4BY1C 2RGRA 1WIHA 3I4MC 4C3JC 4A3FK 4ILDA 3FKIC 1O28A 1SFOC 4WJ3M 3V4GA 2A6HA 5IYBC 1KQ4A 3HKZD 4XSXA 2JA8C 4C3IK 4MQ9A 4KN4A 3RZOK 3A8JA 3HOWK 2A68A 1J98A 2Y0SD 1VRQC 4KMHA 3SZZA 1I6VA 3GTPC 3BUEA 4LR2A 5JFEA 3ADAC 2PMZD 3PO2K 1YCLA 4QIWL 4MEXA 4AYBL 4A3MK 1VGXA 5TMFA 3S16C 4A3BK 4YFXA 1DCHA 1C0AA 3S1MK 4PAAA 1XPPA 4XSZA 4A3CK 2PHCB 1JOEA 4G7ZA 2E2JC 3H0GC 3LAPA 3CQZK 3S2DC 4FM9A 1ZXOA 3WODA 4A3EK 5FLMC 3JSTA 5M5YK 4KAWX 1UV7A 4KMDA 3GTLK 1BS2A 4KMAA 1TWHC 5CJ9A 2ZUEA 2R93A 1I3QC 3K7AC 3HXAA 4A3IK 1HQMA 4M1XA 2P8TA 1INNA 2JA5K 4X6AK 4A93C 4WJ4A 2E2HA 4GZYA 3HOZK 1Y1WA 5C3EC 5D4DA 5C4XK 3GTMK 1WCMK 3GTGK 4Y7NC 3M3YK 4A3LC 1R9TK 1O25A 4GT9A 3RZDC 3HOYK 2WB1L 3L4JA 5JVOA 2NVXC 3GTMA 3GEIA 3GSIA 5IOTA 2CFAA 1R9TA 4BBRK 4KMUA 2NVQK 1K83K 2E2IK 2NVYC 5IOSA 1XZQB 3S2HK 1V5VA 4Y52K 2JH3A 2R92A 4GTAA 3H3VL 5TJ3A 2VUMC 4KN7A 3I4NK 3GTKA 3GTJC 2E2IA 1ZVUA 3M4OC 3TFHA 4A3DC 4AH6A 2V6TA 1TWCC 4BBSC 1TWAK 1I50A 1WSRA 4O2DA 2JA7K 2A69A 3DXJA 1DCPA 4XLPA 4BLAA 1IW7A 4A3KK 5C4JK 2GSOA 3I4MK 4KM9A 3S14C 2B63C 4QJVB 1VH2A 1JVIA 1SFOK 4BXXC 5IYBK 2A6EA 5E68A 1XXCA 2JA8K 4KC6A 3S15K 2NVTK 5FJ8K 4LK1A 3FKIA 5C44K 1SFOA 1TWFC 5EGEA 2YU9C 4P9SA 1F93A 4OINA 3GTQC 1EK8A 3S1QK 4A3JC 1O26A 1USOA 3S1RK 2JA6C 2GAHC 4C3HC 2R7ZC 3GTPA 1XZPB 1IL2A 2XCQA 4AYBD 4KDDA 3T00A 1ISEA 5IYCK 4J3NA 4DDQA 1WQFA 3CAGA 2FQTA 1DCOA 1YNNA 5IORA 3GTOC 2PA8L 2E2JK 1XZQA 4C3IC 1HI9A 3S2DK 5L46A 1PJ6A 3HOXK 3Q3QA 5FLMK 1EQRA 3H0GA 4OIOA 3N0CA 4G7HA 1VLOA 3FOFA 2R93K 1TWHK 2KWAA 3VA7A 3PO2C 1X31C 1XXAA 1BDFA 1I3QK 5TMCA 4KATA 4OIRA 2E2HK 1I6HK 4BY7C 1F9NA 1TWHA 1Y1WK 4JK1A 3T01A 3GEEA 3S1NK 1O29A 1J6VA 4KM8A 5IYDC 4YG2A 3S1MC 3GIRA 4QJVA 1JQWA 4A3GK 5C3EK 4A3CC 3AH5A 1I3QA 1EFWA 3GDZA 4FZBA 4Y7NK 4A3LK 3L4KA 4GTEA 3S17K 2BE5A 3CQZC 4KARA 1VJEA 1WOOA 2GSUA 4P5AA 4C2MK 1WORA 3TTGA 1B4AA 1IBAA 3LPXA 4KB2A 4PABA 3GTLC 1TWGC 2R92K 2NVXA 3GTKK 1PJ5A 4A3IC 2VUMK 4G7OA 3H3VD 1XZPA 4GTDA 3EQLA 2NVYA 3GTJK 1I50K 4GFQA 4LLGA 2JA5C 3M4OK 4X6AC 1TWCK 1BJTA 4Q5SA 3BP3A 3A8KA 2W7VA 1PJ7A 5IP7K 3HOZC 5C4XC 2VUMA 1WCMC 3GTGC 3HOVK 1Y1VC 3GTJA 3A8IA 3IPJA 3HOYC 1TWCA 5IP9K 1G51A 3MMLB 1WQHA 2V6SA 4BY1K 1K83C 4C3JK 3TFJA 2Y3PA 3AQPA 3FKIK 4Y52C 2B63A 4P5BA 4YFKA 3HOUC 2V6UA 5M5XK 3I4NC 2XCOA 1TWFK 4LJZA 4LOWA 4RMFA 1SMYA 1TWAC 4A3JK 3GTPK 2JA7C 2JA6K 2WAQL 4C3HK 1F7VA 1TWFA 2R7ZK 3LAJA 2EBBA 2YU9A 4XCHA 4A3KC 1B4BA 1O24A 1BGWA 3GTQA 3PO3C 5C4JC 4BLBA 4MEYA 2JA6A 4QIWD 2R7ZA 2XCRB 3GTOK 5M3MK 3S16K 2PA8D 4A3FC 4OIPA 3S15C 2NVTC 3HKZL 1ZYRA 5M3FK 1WOSA 5C44C 4NOIA 2CFAB 3GTOA 1WOPA 3H0GK 2O5JA 2Y0SL 3RZOC 3HOWC 4G0VA 2FQOA 3S1QC 4Q4ZA 3S1RC 2PMZL 3TFIA 4YFNA 1USMA 4BY7K 5IYCC 2PPBA 3K7AK 1YX2A 1O27A 5IYDK 1RU0A 5IOQA 4A3MC 3SZYA 1EI6A 4A3BC 1ZQ1C 1IS1A 3NUHA 4A93K 4LQYA 1IQ0A 1ZBSA 2P5MA 3OPFA 4GTLA 3AD7C 2ZFZA 3HOXC 1IE0A 3T02A 2CW0A 3RZDK 5M5WK 4BKWA 1YNJA 2WB1D 4G0UA 3CQZA 2NVXK 4A3EC 1TWGK 2R93C 3N0BA 3N3YA 4GTCA 3OEPA 2NVYK 3FHZA 3BP8C 3OREA 2E2HC 1TWGA 3GTLA 1I6HC 1DD5A 4KASA 1Y1WC 3S1NC 1WSVA 3QX3A 4A3GC 5HL8A 4WILA 4A3DK 4OIQA 1Y1VK 3AD9C 4C45A 1GE9A 4BBSK 1AB4A 2GSNA 1WQGA 2JA5A 3S17C 3S0XA 2D6FC 3GTMC 3M3YC 1EH1A 1R9TC 1J6XA 1WCMA 3GTGA 3AQOA 4C2MC 3G4CA 1Y1VA 1F7UA 4GTBA 4GTFA 3ERED 1XXBA 3S14K 2R92C 2B63K 1O2AA 2GAGC 3G4AA 4BBRC 2O5IA
chains in the Genus database with same CATH topology
3BP8C 3BP3A 1IBAA 3IPJA 1O2FB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BP8 C;  3BP3 A;  1IBA A;  3IPJ A;  1O2F B; 
#chains in the Genus database with same CATH topology
 4XLN A;  1J6W A;  5EGH A;  2NVQ C;  3GTK C;  4ZH4 A;  4BXX K;  2E2I C;  3HOU K;  3S2H C;  1L0W A;  1K83 A;  4LK0 A;  1I50 C;  3GEH A;  3AD8 C;  5IP7 C;  4G0W A;  2ZUF A;  3HOV C;  2YU9 K;  1O2F B;  2RH6 A;  2WAQ D;  3GTQ K;  5IP9 C;  1TWA A;  4KB4 A;  3PO3 K;  1O2B A;  2JA7 A;  5CHP A;  3FOE A;  4BY1 C;  2RGR A;  1WIH A;  3I4M C;  4C3J C;  4A3F K;  4ILD A;  3FKI C;  1O28 A;  1SFO C;  4WJ3 M;  3V4G A;  2A6H A;  5IYB C;  1KQ4 A;  3HKZ D;  4XSX A;  2JA8 C;  4C3I K;  4MQ9 A;  4KN4 A;  3RZO K;  3A8J A;  3HOW K;  2A68 A;  1J98 A;  2Y0S D;  1VRQ C;  4KMH A;  3SZZ A;  1I6V A;  3GTP C;  3BUE A;  4LR2 A;  5JFE A;  3ADA C;  2PMZ D;  3PO2 K;  1YCL A;  4QIW L;  4MEX A;  4AYB L;  4A3M K;  1VGX A;  5TMF A;  3S16 C;  4A3B K;  4YFX A;  1DCH A;  1C0A A;  3S1M K;  4PAA A;  1XPP A;  4XSZ A;  4A3C K;  2PHC B;  1JOE A;  4G7Z A;  2E2J C;  3H0G C;  3LAP A;  3CQZ K;  3S2D C;  4FM9 A;  1ZXO A;  3WOD A;  4A3E K;  5FLM C;  3JST A;  5M5Y K;  4KAW X;  1UV7 A;  4KMD A;  3GTL K;  1BS2 A;  4KMA A;  1TWH C;  5CJ9 A;  2ZUE A;  2R93 A;  1I3Q C;  3K7A C;  3HXA A;  4A3I K;  1HQM A;  4M1X A;  2P8T A;  1INN A;  2JA5 K;  4X6A K;  4A93 C;  4WJ4 A;  2E2H A;  4GZY A;  3HOZ K;  1Y1W A;  5C3E C;  5D4D A;  5C4X K;  3GTM K;  1WCM K;  3GTG K;  4Y7N C;  3M3Y K;  4A3L C;  1R9T K;  1O25 A;  4GT9 A;  3RZD C;  3HOY K;  2WB1 L;  3L4J A;  5JVO A;  2NVX C;  3GTM A;  3GEI A;  3GSI A;  5IOT A;  2CFA A;  1R9T A;  4BBR K;  4KMU A;  2NVQ K;  1K83 K;  2E2I K;  2NVY C;  5IOS A;  1XZQ B;  3S2H K;  1V5V A;  4Y52 K;  2JH3 A;  2R92 A;  4GTA A;  3H3V L;  5TJ3 A;  2VUM C;  4KN7 A;  3I4N K;  3GTK A;  3GTJ C;  2E2I A;  1ZVU A;  3M4O C;  3TFH A;  4A3D C;  4AH6 A;  2V6T A;  1TWC C;  4BBS C;  1TWA K;  1I50 A;  1WSR A;  4O2D A;  2JA7 K;  2A69 A;  3DXJ A;  1DCP A;  4XLP A;  4BLA A;  1IW7 A;  4A3K K;  5C4J K;  2GSO A;  3I4M K;  4KM9 A;  3S14 C;  2B63 C;  4QJV B;  1VH2 A;  1JVI A;  1SFO K;  4BXX C;  5IYB K;  2A6E A;  5E68 A;  1XXC A;  2JA8 K;  4KC6 A;  3S15 K;  2NVT K;  5FJ8 K;  4LK1 A;  3FKI A;  5C44 K;  1SFO A;  1TWF C;  5EGE A;  2YU9 C;  4P9S A;  1F93 A;  4OIN A;  3GTQ C;  1EK8 A;  3S1Q K;  4A3J C;  1O26 A;  1USO A;  3S1R K;  2JA6 C;  2GAH C;  4C3H C;  2R7Z C;  3GTP A;  1XZP B;  1IL2 A;  2XCQ A;  4AYB D;  4KDD A;  3T00 A;  1ISE A;  5IYC K;  4J3N A;  4DDQ A;  1WQF A;  3CAG A;  2FQT A;  1DCO A;  1YNN A;  5IOR A;  3GTO C;  2PA8 L;  2E2J K;  1XZQ A;  4C3I C;  1HI9 A;  3S2D K;  5L46 A;  1PJ6 A;  3HOX K;  3Q3Q A;  5FLM K;  1EQR A;  3H0G A;  4OIO A;  3N0C A;  4G7H A;  1VLO A;  3FOF A;  2R93 K;  1TWH K;  2KWA A;  3VA7 A;  3PO2 C;  1X31 C;  1XXA A;  1BDF A;  1I3Q K;  5TMC A;  4KAT A;  4OIR A;  2E2H K;  1I6H K;  4BY7 C;  1F9N A;  1TWH A;  1Y1W K;  4JK1 A;  3T01 A;  3GEE A;  3S1N K;  1O29 A;  1J6V A;  4KM8 A;  5IYD C;  4YG2 A;  3S1M C;  3GIR A;  4QJV A;  1JQW A;  4A3G K;  5C3E K;  4A3C C;  3AH5 A;  1I3Q A;  1EFW A;  3GDZ A;  4FZB A;  4Y7N K;  4A3L K;  3L4K A;  4GTE A;  3S17 K;  2BE5 A;  3CQZ C;  4KAR A;  1VJE A;  1WOO A;  2GSU A;  4P5A A;  4C2M K;  1WOR A;  3TTG A;  1B4A A;  1IBA A;  3LPX A;  4KB2 A;  4PAB A;  3GTL C;  1TWG C;  2R92 K;  2NVX A;  3GTK K;  1PJ5 A;  4A3I C;  2VUM K;  4G7O A;  3H3V D;  1XZP A;  4GTD A;  3EQL A;  2NVY A;  3GTJ K;  1I50 K;  4GFQ A;  4LLG A;  2JA5 C;  3M4O K;  4X6A C;  1TWC K;  1BJT A;  4Q5S A;  3BP3 A;  3A8K A;  2W7V A;  1PJ7 A;  5IP7 K;  3HOZ C;  5C4X C;  2VUM A;  1WCM C;  3GTG C;  3HOV K;  1Y1V C;  3GTJ A;  3A8I A;  3IPJ A;  3HOY C;  1TWC A;  5IP9 K;  1G51 A;  3MML B;  1WQH A;  2V6S A;  4BY1 K;  1K83 C;  4C3J K;  3TFJ A;  2Y3P A;  3AQP A;  3FKI K;  4Y52 C;  2B63 A;  4P5B A;  4YFK A;  3HOU C;  2V6U A;  5M5X K;  3I4N C;  2XCO A;  1TWF K;  4LJZ A;  4LOW A;  4RMF A;  1SMY A;  1TWA C;  4A3J K;  3GTP K;  2JA7 C;  2JA6 K;  2WAQ L;  4C3H K;  1F7V A;  1TWF A;  2R7Z K;  3LAJ A;  2EBB A;  2YU9 A;  4XCH A;  4A3K C;  1B4B A;  1O24 A;  1BGW A;  3GTQ A;  3PO3 C;  5C4J C;  4BLB A;  4MEY A;  2JA6 A;  4QIW D;  2R7Z A;  2XCR B;  3GTO K;  5M3M K;  3S16 K;  2PA8 D;  4A3F C;  4OIP A;  3S15 C;  2NVT C;  3HKZ L;  1ZYR A;  5M3F K;  1WOS A;  5C44 C;  4NOI A;  2CFA B;  3GTO A;  1WOP A;  3H0G K;  2O5J A;  2Y0S L;  3RZO C;  3HOW C;  4G0V A;  2FQO A;  3S1Q C;  4Q4Z A;  3S1R C;  2PMZ L;  3TFI A;  4YFN A;  1USM A;  4BY7 K;  5IYC C;  2PPB A;  3K7A K;  1YX2 A;  1O27 A;  5IYD K;  1RU0 A;  5IOQ A;  4A3M C;  3SZY A;  1EI6 A;  4A3B C;  1ZQ1 C;  1IS1 A;  3NUH A;  4A93 K;  4LQY A;  1IQ0 A;  1ZBS A;  2P5M A;  3OPF A;  4GTL A;  3AD7 C;  2ZFZ A;  3HOX C;  1IE0 A;  3T02 A;  2CW0 A;  3RZD K;  5M5W K;  4BKW A;  1YNJ A;  2WB1 D;  4G0U A;  3CQZ A;  2NVX K;  4A3E C;  1TWG K;  2R93 C;  3N0B A;  3N3Y A;  4GTC A;  3OEP A;  2NVY K;  3FHZ A;  3BP8 C;  3ORE A;  2E2H C;  1TWG A;  3GTL A;  1I6H C;  1DD5 A;  4KAS A;  1Y1W C;  3S1N C;  1WSV A;  3QX3 A;  4A3G C;  5HL8 A;  4WIL A;  4A3D K;  4OIQ A;  1Y1V K;  3AD9 C;  4C45 A;  1GE9 A;  4BBS K;  1AB4 A;  2GSN A;  1WQG A;  2JA5 A;  3S17 C;  3S0X A;  2D6F C;  3GTM C;  3M3Y C;  1EH1 A;  1R9T C;  1J6X A;  1WCM A;  3GTG A;  3AQO A;  4C2M C;  3G4C A;  1Y1V A;  1F7U A;  4GTB A;  4GTF A;  3ERE D;  1XXB A;  3S14 K;  2R92 C;  2B63 K;  1O2A A;  2GAG C;  3G4A A;  4BBR C;  2O5I A; 
#chains in the Genus database with same CATH homology
 3BP8 C;  3BP3 A;  1IBA A;  3IPJ A;  1O2F B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...