3BP4A

The high resolution crystal structure of hla-b*2705 in complex with a cathepsin a signal sequence peptide pcata
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B-27 alpha chain
publication title Structural basis for T cell alloreactivity among three HLA-B14 and HLA-B27 antigens
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 79
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2007-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bp4A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3bp4A01
1EEZB 2XQYG 3D39E 4H5SA 3IVKB 5JXEA 4P48A 4RDQG 1ZS8B 3N1QC 1MQKL 1UWGL 2A74B 3Q5OA 3VW3H 4WHCA 2X4RB 3VFOA 5E6ZA 3ZZ1A 3RWCB 5T5FH 4DK3A 5F1KC 4M8QB 4PRHB 3GSWA 1FFRA 4AIZB 3MCKA 5BO1H 4X6BA 3CVHL 5DVKA 1A4JA 3FO2B 2PTUA 1KPUB 1T21B 3IJSB 2IFFH 3K2MC 1S9WB 4MWFA 4D9QE 3VH8G 1JWMA 3G08B 3QUXC 3ME0A 3U0WL 3PV6B 3U6RB 4X7FC 5IBUG 5GRWA 3W0WD 1INDL 3BP6B 1HOCA 3H7BA 4ERSL 1CF8H 2AAVA 2VKXA 2IWGA 4YHMH 5HHNA 3SN6N 1P2CA 1X5YA 3UPRB 1MIEL 3L3JA 5JW5B 4GXUM 4M1CD 3HPLB 3D25B 4QHNB 5C6TL 3HFMH 2D7TL 4YHPB 5JHDD 2JCCB 2WINA 5L88H 4HT1H 2K7PA 4PPTA 1EIBA 4KHXH 3ZO0A 4MCZA 3CXHJ 5JOPD 2NYYC 3GSVB 2OQJA 5ENWA 1MVFA 5CEZE 4M6OL 4JY5H 1GHFH 5HI5D 4PJ7E 1KCKA 1NAMB 4XPFH 2OTWA 1VFOA 3KYOA 1IE5A 4DVBA 4HC1A 3FB6B 4QCIB 2JIXD 3EO0A 3CFBB 1SEQH 2FWOB 4CAGA 1YYMH 2F54B 3ZYIA 3SDXA 1GZPA 2EKJA 5FOJA 1OAXH 1R3JB 1MFAL 2BNQA 3QXAA 2P5EE 1U3JA 4HHAA 3UO1L 1BQSA 5CEZH 1PLGH 3MPCA 4NN6B 5FCUH 4F33A 1N64L 5FKAA 4UINH 5GJSH 5TGBA 4RMSA 4Y4HD 5D6CA 5TH2B 2GK2A 5FYKH 2RBLA 2FIKA 3C9NA 3SQBA 4UB0H 1QBAA 3EDJA 4J2XA 2Q7NA 3HE7D 4PRPE 3T0EE 4Q9CA 1QTYT 4J3XA 5C0GB 1U8OB 4JVPA 5GSVA 1QSEE 3U0PB 1NCBH 2NQCA 4UT6H 1Q38A 3DLQR 3FAWA 4XP4L 5I1DB 1ES0A 1JGUH 3OAZK 4G7VL 4RZCB 4EQ2A 1DL7L 1P6FA 3LKNA 1UKSA 3M17B 4IBLT 1DSFL 1TCMA 5L2KE 1KJ2H 4WWKB 4ZTOL 1T20B 3BKYL 2BNUA 4M7LL 2ID5A 5GZOD 4TVPE 1X5LA 1S7VA 5BOPA 1DTUA 5E2WH 4B0MM 4C55A 3CVHB 1JJUA 3BPCB 1AGCB 3D85B 4K3EL 1JBJA 3NFPA 3ARGC 5CP3H 2AV1A 4ZOAA 3TPUE 3HG1A 5DQDL 5H8DA 2Y23A 2HRLA 2FX9L 3MLWH 5HYJB 5B8CC 2E27L 3HB3D 2M2DA 3RWIB 1JPFB 1XF3B 2CXGA 4FMKA 4K9EH 4ODBD 2GCYB 4BELD 3V4PH 2IG2H 1OW0A 4RWYL 4NM8L 4PJCE 3CDYA 4F80A 4WI2A 3WEXA 5DEFA 4HIEA 1CGTA 3BYYA 4HKBB 1DN0B 1QKZL 4WEBH 4P2QD 3BKCL 1IM9A 5I2IA 4R3SA 2G9HB 2W0FB 2ICES 2JJVA 1AD0A 2X9XA 2QSCH 1NJ9A 4ZUSB 5JR1H 1L9NA 1WFTA 3QA3A 4IDJH 4X7SL 3V6OC 3VD7A 1MF2H 3PQYE 2JTDA 3H42H 5JW4N 4ZPVB 3JWOC 3TVMB 1BIHA 5J6HB 1DBAL 3DVFA 2DLIA 2ICEB 4OF5A 3DSFH 1KTLB 3DUSA 4DKEH 5DRZB 3BN9D 4F9LA 4X99B 4YDIH 1HHGB 1UZ8B 1A7RH 3MSPA 1NDMA 3OPZH 1HHKB 5KVGL 1UA6L 1OAYL 2UYLB 5HHVL 4HC1L 3FMGH 3MODH 2AXGB 1G7QA 5ITBH 1RMFH 1Q0YL 4PJBA 1BJ1H 1MCLA 4YX2H 2VC2L 5L6YH 2A83B 1W72B 4LRIA 1OSZA 4ZUTB 4UTBH 5D70L 4UAOC 1FGVH 5B39A 4JQVA 5FYJL 2E6JA 4UI2A 3BGFB 3TBTA 1QBLH 2DQGL 1AIFA 2YA0A 4RFOH 3F12B 2G75B 4L8DB 2YRLA 1SY6H 2CLZB 4EXKA 1JE6A 4KZDH 3QG6A 4PJ8A 2C1OA 3NACH 1YEHL 1TIUA 2JB5L 3F58H 4Z0BH 4G8IB 4QRPE 3QB7C 4PGJA 1T1ZB 2B0SH 2DQIH 4I48B 2VQTA 3LQAL 5IEHA 4H5SB 3H2WA 3IDNA 3RJDA 3SDYL 4XBPB 4YDVA 4LPWA 5FYLE 1KLUA 3JUYA 5IJKC 1MI5B 4R2GC 3WXVL 3VFOB 2OK0L 2FGWH 5JW4M 3MROB 4UNVA 3GSWB 2ARJB 1ZVYA 4X6BB 4JFDD 1A4JB 3MRLA 2W65A 3VCLA 2EDNA 4YHOH 4Z6AT 3B9VA 3L3DA 4EN3C 4LEOA 3E8UH 1NANI 2G5RA 3U36A 2A0LD 4M1DL 1I1AC 1CL7H 5E4EB 5E5RB 4G7YH 4FN0A 3K4DA 1CR9H 4X4YA 3E6HA 5ERWA 1MPAH 3MUJA 3I3DA 4P9HC 1HOCB 5HHNB 3WS6C 3TM6A 1I3GL 3L3JB 1WC7A 1NBVL 3Q1SL 4Y89A 1HKLH 1NQBA 2WINB 3T4AB 4P5MA 4KY1H 2VZVA 3R06A 2Q76B 4MCZB 2HKHH 4R4FH 3FOLA 2GFBB 1QLEL 2OQJB 3QHFL 1WWCA 5LBSL 3O6LL 1JZ4A 1KXTB 5K9QI 2OTWB 3KYOB 3V79C 5TPWH 2JJUA 2GJZB 3EO0B 2CRMA 5F1IA 4PRIB 3SDXB 4P23A 1A64A 4WFFE 2GAZA 2IH3A 5E03A 3DUUA 3Q6GH 2VWEE 4ZXBD 3SDDC 2BNQB 3QXAB 1QUNA 4ZD3L 4PJFA 4N1CA 3QUXA 3KPRD 3D3VE 1CDCA 2I25N 3UZVB 1FORH 3KDMA 4F33B 2X1OA 3OJVC 5HHMD 4LRNH 5TGBB 1JZ8A 2UY6A 3E6FA 1IM3B 4ZO6A 4Q2ZA 5D6CB 1UB5A 4Z8FL 2FIKB 3C9NB 1DQQA 2JKXA 2OZ4A 3M1BA 4ZOBA 5CJXA 1FIEA 2P5WE 4XB7A 1KIRA 3WFCL 4MS8D 1B6DA 1ES0B 3DUHA 2BVEA 1IZKA 2DLTA 4F57H 1D6EA 1MHEB 3RIAF 5FB8A 1GGIL 3EW3B 4O9HH 1RIHL 1I75A 5KAQG 2V2XA 3H0TA 4NQEB 2FRGP 2KL6A 1B2WL 3RUGF 2NY5H 3HAEH 1S7VB 3UYPA 4ZMAT 5AD0A 3WE6A 5CZKA 4OAWA 3BEVA 1XGPB 3CU1A 3IFNH 5SX4H 3NFPB 1CLZH 2BSTA 2ZCHH 4JJ5A 3T4YA 3GBMH 2NY0D 3GO1H 1NFDA 4OLVL 1ED3B 5J8OA 1KG0A 4XPAL 4JPWH 3RU8H 1IEHA 1L4IA 1IBGH 2GJ6D 3WFBL 4ZNEE 3WEXB 1ORSA 1J1XL 4HUNB 4HIEB 3IDUA 4NNYB 1DANU 2VLRD 3CZJA 1CFVL 2Q8BL 1OP5H 4YAQA 5JXAH 2ADIA 4JG1L 2AQ2A 5EWIH 4UBDD 3IRPX 1MCDA 1IM9B 4LPVA 3EYOA 3CUPB 4ODUB 5I2IB 2AP2A 1NC2A 4R3SB 1MCHA 3MOBL 4RISH 1AD0B 3KLDA 2HH0H 2WWKT 5C08D 5MP6L 3QA3B 2V2WB 3ZE0E 1F58L 3MC0A 4BZ2L 3GM0A 5I75C 1T66C 3RTQB 1CGSH 4XGZA 3DUSB 1AHWC 1J87A 4MJIE 3SE9L 4UILL 1XFPA 1FN4B 1FC1A 3V52L 1MOEA 4HIHA 1NDMB 1FAIH 3LKRA 3ARGA 3VXRA 1J0JA 3H3PH 4I3SL 4JN2A 3RVWC 3CCHA 4DFIA 1CT8A 1G7QB 5I8OH 4JFHE 4HWEH 4M02A 3O6FC 1CFSA 2X05A 4PJBB 4PY8I 2HRPL 3QEHA 2F5AH 3ALPA 3MYZA 3R1GH 3DV6A 5B8CA 3D1MC 1U3ZA 2YSSA 3HC3H 4X98B 4P5TD 3AAZA 2ITCA 3QUYC 1LO0H 1MCCA 3VRIA 4WW2F 2XY2A 4TUOB 1RUPL 1AIFB 4F2MA 5LGJB 3O2WH 8CGTA 5F9DC 5D7SL 4LBEA 1W2KT 1OAZH 1FYHB 4JLRA 4PJ8B 2C1OB 1JNLH 2EC9U 4ZFOB 4JGJA 2QADB 2OZ4L 3U9UA 1OGAD 2QSVA 4GQPH 4KROD 1OCWH 4G6AC 5F96L 1YY9D 2B2XH 2FEDD 4JR9L 1LO3H 3V6OA 2W0LA 2OL3H 1JF1A 4OZFA 3IDNB 1A7OH 3EDKA 4JFYB 4D8PA 1AC0A 4S1SL 3EGSA 3D69A 2VL5A 1VESA 4XWGH 4Z7WF 3L3OB 4CNIA 4G42B 4DGVH 1FNHA 4HH9A 1IAKA 2NCMA 1ADQH 2V5SA 1YN6B 1JNNL 5E8DL 4CN6A 2W65B 4IS6A 3VCLB 3VXUB 4K23L 3DBXA 3E0GA 3QDJE 1SJHA 2D9QB 4JANB 4CVZA 3L3DB 2GQHA 2W9EL 3PGDA 4XBEL 2EH8H 2KKQA 4KXZH 4LEOB 4TSCL 2PKDA 1MELA 3GMRA 3VMOA 1IZJA 5BRZA 4MQ7A 3VFSA 4F7CA 1IAIH 4YWGH 2VXQH 4W6WB 1IGJA 4X4YB 1AO7E 5D1XC 3DI2B 5ERWB 3W5NA 3S37L 3WLBA 3GI9L 1OQXA 3S5LG 1EERB 1WC7B 3O4LB 4EI5D 1PGRB 4HS3A 5T1DL 5K9QG 1HH9A 3OHXA 1X5HA 4P5MB 1GGYA 1ZMYA 3R06B 4CN1A 1T5XB 3REVA 5DF0A 1Q1JL 3MXVH 1U91A 4GKOA 1OM3H 4ZO7A 3SKJH 3KLHC 3C6LC 5IJKA 1IEBA 5D1QC 5IROA 4ODSL 4BH8A 3ZT6A 3JTTA 5GGRA 1ZE3C 2MCPH 5KW9L 4R96A 1RUKH 5E99L 3PUCA 5BVPL 2ZSVA 5F1IB 3VDCA 1RZJC 2ZKHL 2JCCF 3L5HA 4P23B 4EN3A 2GAZB 2XZQH 5DJAB 3DUUB 3GSOB 5I1LA 4AMKL 4KMTH 2O61A 3QFJA 3JWNC 1I1AA 4PJFB 1T2QH 4RGNB 5JHLL 3QUXB 1VPOH 3BWUC 5LXGH 4CGTA 4P2RD 3RZWA 5T1KA 3UDWC 3E6FB 4Q2ZB 5EFIB 3BIKA 4PJXA 1Q9WB 3B43A 5FUZH 3WS6A 5H94A 4XCFL 2XWTA 1DQQB 4FTVA 3U7WH 1HINH 3M1BB 3SGEI 3JV5A 5GHWH 1AKJA 4N90D 1WVZA 3KXFD 3ZTNH 5ITFA 1RJLA 1BVKA 4NJAH 3VD4A 3DRQB 3CFJA 5SWSA 5D7JC 32C2A 3BSZL 3QDGE 4NZRL 2WMPA 1PAMA 5HHOE 4FABH 5FB8B 3VJ6B 1S7UA 4X9GA 3U79A 4DKFL 3LB6D 3BKJH 2HT2D 3H0TB 3DMMD 3VXNA 3JWOL 5CD3B 5KSVA 2R0LH 3WE6B 3ARBC 4OAWB 1MJ8H 4JRYB 3J8F7 4GQ9L 2BSTB 4K8RD 4FQHB 4JJ5B 5KOVC 5DA4A 1MCQA 4PD4J 1NFDB 4KDTC 4HMEA 5CUSH 5AUMA 4N9OB 5TE6L 3SDDA 2EIZA 2PW1B 3O4OC 1A47A 4JO4H 1NL0L 2WAHA 3BO8A 1TETH 3GRWA 1I1RA 3HI1B 1ITCA 3VFPA 5F7MC 1BGXL 3OKKA 4JO3H 4NRZA 5FA4A 2ADIB 4O2FA 2UZIH 4HUWB 1KCRH 1I7UA 2NXYC 1NC2B 5ACMA 4DKDC 5I18L 2J8UA 3A6BH 3OAYH 3I02B 3OB0K 3EYQD 2RQ8A 4RBPK 2DL2A 2I9LA 2W92A 3EOYG 2GITA 2NXZC 5TFSL 1TJIH 1WAAA 2BMKA 3S35L 1QPPA 2FB4L 4P3CH 4HIHB 1NKOA 1FE8H 3GMPA 1OAUL 3LKRB 4Y4FC 5HYQB 1MCBA 3VXRB 1HE7A 5IIEA 3L95A 3CCHB 3FO9A 1CT8B 3AVEA 3MNVA 3MBXH 3NZHL 2ED8A 3QEHB 1HDMA 4KDWA 1OWRM 4O02L 1BOGB 4LPTA 4Q58C 3DV6B 1KB5A 5GRJL 2AEPL 4KAQL 5CGMA 2YSSB 3HS0A 3TT3H 3V4VL 5I9QC 5LKNA 4UV7L 5FYJD 2ZG1A 3ARVA 1EBPA 3MFGB 3AAZB 2O5YH 2ITCB 3FO1B 1UH4A 4J8RA 5J3HC 3VFGH 2FCBA 2YUVA 4F2MB 3RDTD 2MCG1 4ZO8A 2QHRH 5IQ7L 1L7IH 1PG7W 4JLRB 2B5IC 4PJ5D 3HNTH 2BOCB 4PJEF 2R15A 3AMKA 5F71A 1JPTH 5EBMA 5L7XH 4IEFB 1VEOA 2R0WH 4UT7H 3ES6A 3W0WE 4H0GA 3EGSB 3QH3A 1AHWA 2VL5B 4Z7NE 2R56L 1NDGB 3FQNA 3CZFA 4HG4J 2H8PB 4CNIB 2AVGA 2E7LE 2F19H 1IAKB 5JHDE 3U4EA 1OHQA 1QFPA 2UWEE 4IS6B 1S9YA 3O6FA 3DBXB 1SJHB 3OZ9L 3HG1D 3H9YA 5EO1B 5JOPE 1I9EA 5JW4Q 2ZSWA 3PGDB 3CPLB 3OG6B 1U8HB 5FDWA 5T33L 1RZ7H 4UAOB 5BRZB 4MQ7B 4TTDC 3VFSB 5CIPH 3BH8A 4F7CB 5ILTL 5BS0D 5IFAL 3QUYA 4RGMB 2X2YA 1YY8A 3FCTA 3HHRB 5CBAB 4M62L 2JE8A 3GRWL 4TUJA 3DVIA 3VGHA 2HT4C 4HS3B 4Q0XH 3ARXA 1IM9D 1HH9B 1I7ZA 3HUJE 3K2UL 3QT2A 3UTTA 3TWCL 1FVCA 3BDYH 4NZUH 1LMKA 4LHUB 3REVB 5DO2C 2ZJSL 4FQIL 5EU5A 4X9IA 2PNDA 3KPSD 4P59L 4EIZC 4R2GB 5LGKA 2W60A 1IEBB 4LAQL 4BH8B 1WFOA 3JTTB 5F7LB 1UG9A 5GGRB 1CYGA 1ERNA 1E6OH 2VKWA 4YHLL 4OV5A 5I1HH 3P73B 4R96B 4RX4D 3EO1A 4N0FA 1BQHA 1PSKH 2ZSVB 4UTAH 2YR3A 1YDPA 4WTXA 3DJ9A 5I1IL 4QWWC 2F8VA 3QXTA 4QY8B 2V17H 5ESVA 2WQRA 3QFJB 3F7PC 4HKJB 3MRRA 1I1AB 1SM3H 4PJIA 3OKMA 3TCLB 4LHQB 1KB5L 3DGCR 5KSAB 1R0AH 2EXWC 2ZG2A 5D1XA 5I74B 5T1KB 5ICYA 3OXSA 3EJZD 3BIKB 4PJXB 1EVUA 2C5DC 5H94B 2YK1H 4NNXA 4FTVB 2PF6A 4JO2H 5D2NE 1AKJB 1D3CA 1P9MC 1DQDH 5ITFB 2NNAA 3I9GL 3CLEH 1AD9A 3AUVA 2I60L 1NGPH 4M48L 3ARDC 3CFJB 5SWSB 4MDIA 1BX2A 32C2B 2NY7L 3IJYB 3RVVC 4FP8L 5DEZA 2DIAA 5HI4C 5DRNA 4OLZL 3GJFH 1BMGA 1S7UB 3C6LA 4LKXA 2Z92A 1XF5A 5D1QA 4HJ0D 2EE9A 1K4CA 5C0DA 2DQTH 1LHZA 4P2QE 1RD6A 2H41A 1YPZF 3NGBC 5KSVB 4NM4H 1RIUH 4XNXL 2AK4A 1EHNA 2DBJA 4OLUL 2E5EA 4HWUA 2CDGB 4HWBA 2X1QA 3KGRA 2NY6D 3MGOA 4W81A 1S7SA 4WW1A 3UXFA 1HCFX 3INUH 3SDDB 3QBTB 2IMMA 1CDBA 1W0WA 2Y9RT 5D5MA 1R3IL 1HILB 1IARB 3BO8B 4RQQB 1I8MA 4AJ0A 5GISH 3UDWA 2VLJA 4NRZB 5FA4B 2Q87A 2P42B 1FRGH 4YLQT 5GGTH 4O2FB 2Z8SA 5IK3A 1I7UB 4Y19D 4OT1L 1KSRA 1CXEA 4I9WD 3GSQA 2Y1VA 4JZJC 2J8UB 5DJYB 4QTIH 4L8CA 5D7JA 1SYVB 2QR0A 2UY7A 2CDEB 1MAKA 4G6KH 3LRSB 3T0VA 2GITB 4HSQA 1CICC 1DE4B 3ZYZA 2CPCA 2A38A 4F58L 4GG6B 4OZIA 2BMKB 1U8NA 3T3MF 4R90H 4EIGB 3ARBA 3WS3A 2CKBH 1MLBA 2A73B 3VG0H 2C9AA 2J6EH 3L95B 1NCAH 3FO9B 3PJSB 4HJJH 1GGCL 5CCKH 3TBYB 2R0ZH 4L3ED 5ESQB 4M7JH 5L9DL 2ESVB 5I6XB 1HDMB 3NCYP 1REIA 5D93C 4K3JH 3CSPA 3TEUA 1KB5B 1WWWX 3QQ9C 1EA9C 4E42B 3HS0B 4F7PA 2WUCL 2EDFA 3PP3H 5E2UL 3QQ4A 4AEHL 5HGBB 3ULVH 4DVRH 3SBWC 4P3DB 4JFDE 1JF5A 5KS9A 1MH5B 1UQSA 1OWWA 4Q9RH 3FQTA 1PG7H 1OF2B 4JAMA 3VDBA 2GEEA 5MEPB 4Z7UA 3V2AR 1A5FH 5CFHA 2CR3A 2CUMA 4WTWA 1ZGLP 1OOAA 1XGRB 5I75B 3F7QA 2NYYD 3X3FH 4EVNA 1HN1A 3TBSA 1P4IL 4V2BA 3UBXI 2E8YA 3DIFA 5AZEH 3FQNB 3ARFB 1KCUH 3CZFB 4LEXL 4Y4FA 5B21A 1VFAA 43CAA 3V6FA 1LK3H 4KUZH 1FFOB 4LLWB 4P4RA 3O6FB 5BJTB 3P2TA 1G9NH 1JPST 4Z7VF 4WNQB 4PGEA 4HIXL 2ZSWB 4OB5L 1RZJL 3QPQC 4HWBL 3MBEC 4WWID 2BFVH 3U4BL 4OLYL 3D9AH 4LCUA 2BXYA 5T5NF 5A3IC 1E4XH 2XXMB 4CVXA 3QUYB 3HMWH 2O5ZH 1A6ZA 5DMJB 3TN0D 1JYWA 1YY8B 2EDWA 4KH2A 4G3YH 4X6CE 3OR7B 4BKLB 5IG7B 3SOBL 4TUJB 1T83A 2ZPKH 1FVEA 2OBGA 1CGUA 2P48B 3BDBA 5DUPL 5E8EA 1JGDA 4P9MH 3TF7C 2XY1A 1I7ZB 2ZNWA 3DVNA 5GRVK 1JP5A 1GXEA 4EOWL 3QUZA 2EXYC 1JGEA 5DK0A 2AJYL 3B9KD 1ZHKB 1FVCB 3KPRE 3B2VL 1B6UA 3G6DL 4YQXL 5HHME 4ZFZA 3P0VH 2AS5M 1DJSA 3P0YL 2D03H 4XXDA 3OG4B 3MRFB 1QFWH 3QCVL 1NH6A 2FO4B 3S36X 3TH2T 1LGVA 4CBPA 5GXBB 1NSNL 3PXJA 5D8JH 3EO1B 3MLVL 3QEQD 4FXLA 4KQ3H 2VXVH 4MLIA 4N0FB 3F6IA 1BQHB 3DPBA 2QV2A 4JN1L 1CFTA 2FJHB 3ARGD 1A21A 4F15C 1YDPB 4IRJB 3VFNA 2DD8L 2DKSA 4U4BA 2UVEA 3OGCA 3F7RA 3LEYH 4N9GA 4IHOA 4XBGA 5ESVB 1IGFH 5GPRA 1CE1L 2APWA 1CI5A 1UH3A 1SBBA 4PJIB 3OKMB 3GHBL 3V0WH 3WHE1 5C0CE 1HEZA 5JQ6L 1N6UA 5ICYB 2D7PA 1DUYA 3WIIH 2LAAA 1FDLL 3TJEH 4HKZA 4NNXB 3CX2A 1F4XL 2W9DH 2PXYC 4PJHE 1I1YA 1A3LH 3G5XA 4QXUL 2NNAB 2QTEA 4M5ZH 1AD9B 5F7EL 3AREC 5MI0C 3LH2H 3RVTC 3OKLA 1DCLA 4MDIB 4FFZH 3MRPA 4XMLL 5IJVA 2GJ6E 4XVTH 1D5ZA 5DJZB 2Y25A 1EH9A 2P8MA 5IBTL 5EU6A 2PYEA 2VLRE 4QRTA 5D7LD 1JYXA 4NQDD 2Z92B 2DQDH 3FN9A 5B3JF 5D1QB 1NGQL 1K4CB 4TOYL 2Y72A 5TF1L 5C0DB 1XGQA 4FS0A 4MQSB 1SYSB 4LOUC 1T0PB 2AK4B 4K9EC 3CMGA 1K3ZA 4YXKL 5C08E 2OP4H 5DFTA 4PJDA 4LLAA 1S7SB 1N0LA 4WW1B 3QEGH 1N5YL 3MLRL 2OXGA 3FAXA 4MJ2A 3TZVD 4Z76A 4MXVE 1B0RA 3MRBB 1HHIB 1W0WB 2P4AB 3QAZB 4WI8A 4X80H 5ADPL 2D3VA 3D0VA 4FXKA 5F3HA 1L6ZA 2VLJB 2O5XL 3AU1A 4HWZA 5FIEA 4QRQA 4LP5A 3MOAL 4URTB 5C0BA 5I1JL 4XVSL 4QF1B 3CFCH 1P9MA 3F5WA 3GSQB 5D4QA 4M43L 3ZKXB 4AIOA 3ARDA 3NMEA 4APQB 4L8CB 1D6VH 4IDLA 4PFEA 5D7JB 2QR0B 3MRCA 4MB5A 3VI3E 4XPGL 1N4XH 5DHXB 3EYFA 3ZYJA 3OAUL 3W2DL 4TULH 2F5BH 4ZG1A 5KSBE 5L2JB 1O7SA 1F3DJ 4I18B 1U3HC 5JIIA 4B50A 4RMTA 3KPLA 4LLYA 1KXQE 2YKLL 4R2GD 5GRZA 7FABH 1MJUH 3WS3B 1DLFL 1MLBB 5F7WC 3CMOL 3AB0C 4MJ5A 1IL1A 1OGAE 1WK0A 1S3KH 3WFDH 1ZHBA 4BQ9A 1Z3GH 2CIKB 4WI9A 2AEQH 4HK0A 4EN3D 2VDPH 4KKAD 5GS2H 4F7PB 4O2EA 4XP6L 1A02N 2X40A 3QQ4B 2B7DT 4Y2DC 3ESVF 3MLYL 2BCKB 4XAWL 4YUEH 5FM8A 4MLSA 4Y16D 1J11A 4Y88A 1JTOA 1RUQH 4MB4A 1P4BH 1F6LL 2NXYB 3FQWA 1IC5L 1CXHA 5IBLC 3P4LA 1J1PL 4ORZC 3UBXG 1GRWA 4JAMB 1CD9B 4JJHA 3DECA 4JZJA 4XP5H 3OGOE 5KG9A 2Q3AA 2I26N 4Y5YC 2EH7L 5TJWK 4P2OC 1B4JL 1CXKA 5FM5O 3T8XB 2XZAH 3CXDH 3MZGB 1KJ3H 2NXZB 3DHJA 3O8XA 3KNBA 2A9NH 3GSRA 3TNNB 1Z9SA 2XPGA 3UTPD 1FG2A 2B1HH 1G9EA 4Y4FB 2X9WA 3W81A 5JPMA 4P4RB 3QDMA 3FN0H 2VDKL 1UZ6E 4NDMA 5T3ZD 1RUMH 4NHCH 3D18A 1TITA 2VXTH 5E2VL 5I9QB 1PDKA 5CLWA 3B5HA 4LCUB 3QIWD 4CVXB 1F4WL 5C7XH 4UZGA 4ETQA 3VWJC 4IOSD 1OTTC 2R29L 3SBWA 1IGCL 2A77H 2VRAA 2ICCA 2R4RL 3B9DA 4XPBH 3FQRA 5E7FA 3HMXA 4U1NB 1FVEB 4JRXB 2WWKO 5I30H 4HS6A 1JGDB 1J0ZA 2VIRA 4PUBH 3DVNB 4W6XB 4L5FH 5GSRA 1F4YH 3QUZB 2DQJL 5DK0B 5LVEA 1RU9L 1RZKH 3RL2B 4LVNB 5C1MB 1YMMA 4P2RE 2OX5A 2ED7A 5CHNA 3BFOA 2YWYA 4GH7B 5IB1A 2VDMH 1TLKA 4N1EA 4OCWH 5J7CC 2VDNH 3D39A 4N90E 3KXFE 4YC2B 3RP1A 3CX5K 1MFCL 4PB0L 3VFNB 1GOFA 2DMBA 4JFEA 5HDOA 5HD8C 1RZGA 2KQNA 3MBEA 4XBGB 3T77B 1UM6H 2KZWA 3MRMA 1JUFA 4LPCA 1FL6A 1ZLSL 3L6FB 1M71B 1TVHB 3DXAB 4G6FB 4NFCA 4JFXB 2FL5B 5JOFA 1U58A 3RFZC 2VQUA 3ULSA 4C54A 1GIGH 3VD3A 5FF6A 4HKZB 3LKPB 2GSIA 5EPMB 3TF7A 1H8SA 1I1YB 2CSPA 4FQXC 5CJQH 3G5XB 1C5CL 3G9VA 5GS3A 5IVXE 4LIQH 5FGRA 3LS4H 2YBRB 3MRPB 4JHZA 2WM0A 3KYKL 1V5JA 1JHLL 2J3SA 2VZUA 3VDAA 3SKNA 2YZ1A 2OJZL 1V3MA 4XH2B 3P11L 5K9OB 5CJOH 1TCRA 3DRTB 4PGDA 3TO2A 1YQVL 4JM2C 2XZCL 3EFFA 4R8WH 3ARQA 4MD5B 3RVWD 3PWJA 4PJ7A 3PNWA 5LQBH 1QNZL 4Z76B 5T3XD 5SWZD 4ZAKB 3FO0H 1YNKL 3D0VB 3IFPB 4S2SA 4PTUB 3ARUA 5HHXL 1A4KA 2A6IA 2IANA 3AU1B 4HWZB 1PQZA 1S9XA 5I8KH 3GBNH 2P5EA 3DX7A 1YNLL 3D6GA 3BESR 5C0BB 1RSFA 3QIBB 2IBGA 1T3FB 2PXYA 1KJ2A 5CSZB 3BEWA 3F5WB 3HMXL 2AERT 3AREA 4OI8A 5EOCH 3ARDB 3V7MA 4OKVA 4H25B 2DQCH 5FYJE 3RZCD 3UTTD 4ZODA 3LN4B 3VW3L 1Q9KB 1YEDA 5T5FL 4PRPA 1RI8A 3U7YL 4U1GC 4XI5C 1QSEA 5JDJA 1JGVH 1FP5A 5BO1L 3NGBB 1CBVL 1J5OL 4PJ5E 3MLZL 3GK8H 4MJ5B 3WYRA 3TYFA 2XICA 5L2KA 2RAMA 3MRGB 1ZHBB 4LSUH 1T04A 4KI5C 5HVGB 4TSAH 3TO4C 4PTTB 2YD8A 4YO0A 3ZHLA 4C59B 4XRCA 4S1RL 4J3WA 2A6KB 1D5MA 3V5KA 4O2EB 3TPUA 5HVHC 5E2TH 5ANMB 1CF8L 1XCQB 2D4FA 4KVCH 4LGSB 4WO4C 4YHML 3BZDA 4GG6F 4Q7DA 5FEBA 3MOQA 4ZQKA 3HFML 1S7WA 4KGJA 3B8SA 5D1XD 3CXHK 4NIKB 4HGKC 1HH6A 3HG1E 3GI8H 4PLOB 4U6XA 1AGFA 2ZUWA 3VH8B 4FFYH 5KG9B 3T65A 4O5LL 5BS0E 4NC0B 1GHFL 3BHBB 3UTQB 2XA3A 5E6IB 4F7TB 5IBUB 4NO0A 4R0LB 1KC5L 4KK8C 5ICXA 3O8XB 1U3HA 3H7LA 3GSRB 3KLHD 3C6LD 5IT2H 4E41E 1SEQL 1VCAA 1WBYA 3HC4L 1FG2B 3A0OA 3PQYA 3L1OH 1KENH 4LKCA 2BJMH 4HBCH 1OAXL 1U2HA 2NX5A 4UUJA 4A6YB 1UWEH 3QDMB 5CEZL 1UB6A 1YECL 4GRLB 4LQFL 4NDMB 5ESAB 3KPSE 3D18B 4MA8L 2WANA 3LQMA 4MA7L 4QHKI 3ZE1F 5I66B 1SY6A 5BOZG 3TYGH 3SGJC 5FYKL 5DMKB 4ETQB 4Y2DA 3FT2A 4U2YA 1CQKA 4YNYA 5I17A 5DRWA 1NCBL 4P2CG 4PJ9C 4UT6L 1MCKA 1JGUL 4HS6B 3HR6A 2CRIA 2VIRB 3MYJA 4G43A 1X5XA 4PB9H 2V5MA 3B9EA 4Y5YA 15C8H 5GSRB 3DROA 4FFWC 4DGYL 5I1AA 4JPVH 3EZJB 1T89C 2V2TA 4P2OA 1QP1A 2YOCA 2ZCKL 1C7SA 2X1PA 1YMMB 1MQ8A 3F7YA 3MTRA 5E2WL 4E0RA 4XHJC 1H3PL 5T1MA 3MRKA 4GG8B 4KDVA 1CS6A 4PP2B 4WUUD 3E2HC 1M7DA 5F9WC 4NZTH 1CFNA 1J86A 3QEUB 3ARBD 5F89A 3MLWL 5SV3A 3SE3C 4KU1A 2NY2C 3NFSL 3A6CH 4K9EL 4JREC 1UWXK 5D7IE 3QXDA 2YEZB 1RZGB 2R1WB 1Q72H 1A3RH 3SY0A 2F8XC 3MRMB 3UMTA 4CVUA 1JUFB 4TVPL 1C1EH 4JE4B 1FL6B 1CIDA 2EDXA 3MV11 1C08A 4LVHB 3VWJA 3N50A 1X5GA 3NN8A 4Y8DC 1Q9LB 4PLJC 2OR7A 2E7HA 5JOFB 5I71B 4NWTL 2H32H 3ULSB 4YFLI 5FF6B 3C5ZC 3S96A 4UIKL 5JR1L 3O3EB 5TDPA 3DGGB 4QRUB 3QUMH 2NXYD 3MV9A 5DT1L 3H42L 3X13B 1Z5LB 3CFIC 1RZ8A 3QNZB 4MA1B 1WBZB 2EEAA 1CWVA 3PWPD 3IU4H 4KJWC 4YDIL 4OBRA 2EYTB 1C7TA 2XFXA 4PGZA 4JB9H 3SKNB 3D2UA 4X4ZA 4XX1G 3MR9B 4OSUH 2EE3A 5IOPA 3MODL 1BD2D 1A6WH 2ZUYA 2Y5TB 4Y19E 5AYUH 1RMFL 4NN5C 5LWYH 3ARWA 4I9WE 1TCRB 4D3CH 3TO2B 5DD6B 1E28B 2ZUXA 5DI8A 2R2HB 4NRXB 3SGKC 4XCNA 3EFFB 1FNSH 5L6YL 1BFOB 3FT3A 4OF0A 4F15B 1XH3A 3PWJB 4PJ7B 3PNWB 3P4NA 4UTBL 3B2UC 3MO1A 5JW4R 2Z91A 4NGHL 1FGVL 3V8OA 4QTHA 4ETYA 2YUZA 2R8SH 1QBLL 4RFOL 4DZBA 3OAZH 1KEGL 4S2SB 3MLUH 1Z2KA 3NFNB 1ZANL 1SY6L 4NKIL 5I73C 2OMBA 4KZDL 2A6IB 1WZ1L 1PQZB 1S9XB 5J3HD 3NACL 3B83A 3P9LB 2P5EB 2VABB 3DX7B 1OPGH 4L3EE 2B0SL 3SKOA 4ENEC 2PXYB 1BJ8A 3BEWB 1RUAH 2NR6C 3AREB 4H0IA 2OTPA 5B39G 3HAEA 2YUWA 4OKVB 3CFKA 1BVZA 4KKLD 5HI3D 3BZ4B 4RMWA 3TBWA 4OIIL 4K7PY 3HC0B 1HI6A 4JFQA 2CJUH 2FGWL 2NTSP 4U1HA 1JHKH 4PRPB 3T0EB 2P5WA 3EYSH 3PWVA 1C12A 1XZ0B 1QSEB 3L3GB 1VEPA 4XC1H 5BZDA 1NMCC 9CGTA 1WEJH 4G8EB 3MCG1 1MCOL 4JM2A 1MWAH 3IETA 4QRRD 1QHOA 3E8UL 5L2KB 2BOBB 4I2XA 4MXQC 4CU8A 5JW3H 2WSKA 3NIDF 2CRYA 4AQOA 1CL7L 4XP9H 4GKZA 4YO0B 5J1AA 4Z7QE 2IH1B 4XRCB 4LARL 1CR9L 1U92A 4P46C 4OV6F 4ODWA 1MPAL 3TPUB 2XQBL 4TTDD 1AC6A 4L1HA 2DN7A 1TVBB 5IMKB 2DWDA 5HDLA 4ZQKB 5L8JB 1VGKA 1JZ3A 1HKLL 1LNUB 4YBQC 3CSBA 1NC4D 1VFMA 1HH6B 1GH7A 4KY1L 4PJCB 4LL9A 5ISZD 1PKQE 4PJGF 4U6XB 2HKHL 1AGFB 4R4FL 2HT4D 5EZOH 2FZ3A 1G7HB 3T65B 1IAOB 2H1PH 5HHPA 4TQEH 3VFMA 2WBJB 1G7JB 1L7TH 3LKSA 3NPSC 4NO0B 3BI9X 5DO2D 2P8PA 5ICXB 5EU6D 3WDJA 1T0MB 2PYED 1QYGH 1WBYB 3FRUB 3F7VA 5GS1A 4G8GA 4PREA 3K81A 3O6KL 3PQYB 3AB0B 3Q5YA 4HUKB 1ACYH 2K9UA 2CK0H 1A7NH 4JGMA 3HZKB 1QLRB 2MQCA 4LLVA 3I50H 4MJIA 1NKRA 3BP5B 4M1CC 4QWWD 2N4IA 1FORL 2E7LC 3CSYB 1KFAH 3OJDA 1TQCC 3P4MA 4LRNL 3QNXB 1FG9C 1X4ZA 4WO4A 1F8TH 1A22B 3KLSA 4Y2DB 3QEQE 3STLA 4YNYB 5J1SC 1YEFL 1CLOH 4I13B 5F9OH 2EXWD 5DRWB 1KIPA 1Y18A 2OL3A 1IQDB 4U3HA 5EZJB 5LJYH 5DTFA 3PE9A 4ZFFA 1ZT7A 3UTSB 4NUGH 4L9LC 1FZKA 4HH8A 4M7KH 4ZUWA 3MYJB 3TBVA 4G43B 4Y5YB 3DROB 4HPOH 2XV6B 2V2TB 3BJLA 5D1ZD 3IXTB 1QRND 1CK0H 3W39A 1ADQA 5IMOA 2EEBA 3I75A 4KTEL 2KDGA 4WCYL 1CZ8H 5HI4D 4E0RB 3PWUA 2J4WL 4S1QH 3IFNL 4QRPB 1CLZL 2ZCHL 3U83A 1KN2H 1CU4H 1M7DB 3GBML 4HV8A 2J12B 4LU5L 3TA3A 1CFNB 2DQHL 3PDGA 2BVPA 4G9FA 4NKMA 3V4UL 5KVEH 4Y4HC 3MV7D 4JPWL 3RU8L 4UT9H 1KPRA 3P3YA 4FMFA 3SY0B 3HE7C 5J4MA 4HF5H 1QQDB 5D7LE 3VXOA 4NQDE 4PBVC 4RMUA 5DURB 1B88A 1IAMA 3SGJA 2X7LA 1C08B 1YJDC 4OD3H 1I1FB 4FNLL 3VWJB 2WUBL 5JXAL 1HQ4B 3NN8B 3QDJA 1B9ZA 5EWIL 3OXRA 4P4KA 4KTDH 1G0YR 3IFLH 3CIQA 4X4XA 2OJEB 4PJ9A 3NCFB 2HH0L 2XKUA 3S96B 1JZ2A 5GZOC 5I76A 1FLTX 4XMPH 1U93A 1U2CA 4OGYH 5F93C 1F42A 1CD1A 3KPQA 4AZ8A 4CW1A 5J11C 4JHAH 3VA6A 3VXMD 1T89A 1CGXA 4JKPH 1WIPA 5FECA 1JF6A 4GAGH 2WQ8A 4X6EA 5D2NC 5JO5A 3B6SA 1N7MH 4KRPC 4KV5F 3HB3C 2DYPA 1CICD 3ESUF 1HWHB 2F8OA 5IOPB 3E2HA 2AJUH 4BSWA 1GPOH 4HWEL 2X6MA 1F90H 2F5AL 5DI8B 3SE3A 3PL6C 4XCNB 2F58H 3KWWB 3FT3B 4GLRI 1P7QD 3HC3L 3PDOA 3P4NB 4DN3L 3MO1B 4PJAF 5KVFH 2ZNXA 3AS0A 3WHE0 1P7KA 5K33A 4LCIH 1U8LA 4NNPH 1EAPA 5I1GH 4I4WA 4D9RD 4AM0A 1ZTXH 3MRNA 3O2WL 1WBXA 2VXUL 3ULUF 4GXVL 1MFBH 1SMOA 4XP1H 3SE8L 2VAAA 1P5VA 1OAZL 1N0XH 2CLVA 1WCQA 2MQ3A 5B38A 1YC7A 3MV8A 1XAUA 3C5ZA 4TPRH 3SKOB 3D3VB 3RGVD 3S34L 2B2XL 2OL3L 3STZA 1YYLL 4GAFB 4XNYH 3NABH 1H9VA 3TBWB 1U36A 1UVQA 5CSGA 4K3GA 3O9WB 2DM3A 4X6FA 4XWGL 5DK3A 2R2EA 3HZYA 4U1HB 2LU3A 2P5WB 3QJFA 3PWVB 1C12B 3I6LD 2VDRH 1ADQL 2YN3A 5F9JA 5BZDB 1T7WA 3QDGA 5HHOA 1FZMA 4RMRA 3SGKA 3IETB 3D39D 2EH8L 4BSJA 1JCKA 1A9BB 4OZFG 4XNMA 2X41A 4KK5C 3FT4A 4GKZB 2F53A 1G7IA 1IAIL 1YN7B 3CH8A 4WFGD 4YWGL 4JFED 4JO1H 2MFNA 3QPQD 3MBED 1U92B 5IVZB 1I1CA 4ODWB 4EBQH 2VZTA 3UTPE 1O7VA 1QEWA 5DUML 5A3ID 4D9LL 5DYOA 3ZDYF 1VGKB 5DDHA 5TDOA 3GZKA 4OFVA 4G80A 4IJ3B 1DBBH 2V7HB 4JPKL 2HMID 5T3ZE 3CD4A 1NEUA 2WW8A 5BW7C 3EIFA 4RDQF 1FH5H 1ZA6B 3MXVL 2FZ3B 4XZUB 5HHPB 5IW1A 2ATKA 3C60B 3SKJL 5INDA 25C8H 3VFMB 3RUGE 2EXYD 1N59B 4WJ5A 5EOTA 2LTQC 3T0BA 2BRRL 1WGOA 3LKSB 2FJFA 3IAPA 5GRUH 2P8PB 3ULVF 4BFGA 4U1GB 1C16A 1HHJB 4NQXA 5GGSY 1WF5A 1G9NC 2BY2A 5IB4A 4B7IA 4IIQC 5IHUH 4XWOC 5GS1B 1VHPA 2JB6A 4YIQA 3NCBB 2XZQL 3WL9A 3BW9A 4KMTL 3W9DA 4MXQA 5IHBA 4KUCF 5DMIH 3LHPH 3AMLA 4MJIB 5LXGL 3QWRA 3QP3A 4AH2A 4BH7A 4P46A 5DJXA 1R6VA 4NOBA 3OJDB 4FQ2L 3C2AL 5HGDA 2IALB 3P4MB 5FYKD 2HVKA 5FUZL 5E8OA 2ICWA 3U7WL 2JELH 3STLB 5GHWL 3OB8A 2OL3B 3GKZA 2IAND 5DTFB 4HCRH 5DUBA 3UC0H 1ZT7B 1FZKB 4ZUWB 4NYLA 2EIEA 3BUYA 4J3VA 5DD1L 5F21B 1ACZA 3RVTD 5H37H 5FV2A 3IXAB 2R0LL 3I75B 4G5ZH 4UOW1 4BQCA 1RZFH 3PWUB 2VMFA 3GDBA 4PD4K 1MJ8L 1JPGA 4JM4L 5C86A 2EDOA 2OYPA 1JRHH 4XNZB 2EECA 2VISA 4HV8B 3TA3B 2BVPB 3QZWA 4NKMB 5CUSL 2OM5A 1HXYA 5CIPA 4LOUD 1OP9A 1DQJA 3W0WA 2H6PB 3MQIA 5EO9A 1XR9A 2D9CA 1HHHA 5A43C 4HUUB 1NFIA 1TETL 4HEPG 1BZQK 3VXOB 2E7LA 4W6YB 1UM5H 2VXSL 5JHDA 4MS8C 1H5BC 2W0PA 4MGXA 4BZ1L 3QDJB 3ZKMD 3V6ZA 3OXRB 4P4KB 3MJGX 3WMSA 4X4XB 4YZFF 4PJ9B 4L4VA 5I76B 4L9LA 1HYSD 2Z93B 5T3XE 5SWZE 1CD1B 3KPQB 4CW1B 4DEPC 1AO7B 5DJ0A 4OQ1A 2AI0H 4JHWL 5HDBF 2P45B 3CNKA 1TJIL 3CDGB 4KQ4H 4M1GH 4ZS7H 4OUUA 1T1XA 3RPIB 1BM3H 4NKDA 3B6SB 3RWEA 2GK0A 3HUJA 4EUPA 2DYPB 1U3HD 1MUJA 3RHWK 5HVWA 5F9WB 1MCJA 5FUCE 2NTFB 3A67L 1N3NA 1QRKA 4JZNA 1MCNA 3N1PC 1MCIA 2XWJB 1R5VA 4Y4HA 2Q8AL 1J0KA 5T3XH 4JREB 3UTTE 2NX5D 3L5XH 3N06B 1I8KB 4JVWA 4K2UH 4UBDC 3HE7A 2ORBH 3BH9A 2YRPA 4FZEH 4I77H 1RAMA 4I4WB 2BSSB 3QG7H 4AM0B 5AZ2L 1WBXB 2VDLH 4KHTH 1XR8B 2ZOLA 1RULL 4Y2DD 3HR5A 3FL7A 2OSLA 4OCSL 1HWGB 1AXTH 3G6JF 2DKUA 3PHQA 2XTJD 3KAAA 1GGBL 3WNKA 2R0WL 3D87B 3OKDA 4W4OA 4Y1AA 4DAGH 3EYVA 4L8SB 3OKOA 4Q6YA 4HG4K 3EAKA 1Q0XH 1ZSDA 1UVQB 1S7TA 4P2OD 5BQ7A 5D2NA 4X6FB 1G7PA 2R2EB 1J1OL 3HZYB 2HLAB 3L3KB 4RGOH 4Z18A 5HTSA 2F19L 1QFHA 2HKFH 4HS8H 3BT2H 5FDYA 5F9JB 3LS5H 4CU6A 3WXWH 4NN5B 3QDGB 4P5TC 5HHOB 3PL6A 3VGFA 2EDYA 1F00I 1WICA 5HBBA 3SGDH 2VDOH 5AYQA 5HYSA 3C8DA 3FT4B 4P2QA 4JZOB 2E7BA 1G7IB 1A9EA 2BVTA 1NGXA 2BVQA 2HJFA 4P49A 1AY1H 4CVWA 3HNSH 4LCYA 1CDGA 3OB0H 1YY9C 4WVRA 2FEDC 1QEWB 4RBPH 4ODHL 5DYOB 2ZOKA 3OSKA 1U8PA 1OP3K 5TDOB 4NKQB 1B0GA 1D5BA 2AXFB 1A14H 1N2RB 3BDYL 4NZUL 5TQ0H 4IOIA 5L0QB 1NAMH 5IW1B 1YUHB 3MV9D 4R7DA 2ATKB 5INDB 4RAUA 4WJ5B 5EOTB 1IFHH 5D5ME 2ARJQ 3M45A 4Z9KB 4JHBA 4PLNC 2J6EA 4JVUA 1E6OL 4Q6IC 4XC3H 4I3RH 3D2UD 1PSKL 4F7MA 1OAQH 1NMCB 5EBGA 1NBZA 3UJJL 3WD5H 1WLHA 4YIQB 3V7AE 4PJCF 2V17L 3BW9B 5KZCD 5C2UB 4O58H 3EYUH 3W9DB 5F7NC 5I19H 1SM3L 5J0BA 3ECBB 5BMFL 4FFVD 5GJTL 1HCVA 2H45A 1EVTC 4AH2B 4P46B 2C4FU 5K9JH 4NFBA 4WUUE 1VEMA 2HVKB 4NQSA 3UTZA 4OZIE 2YK1L 4JO2L 2CMRH 1YJDL 5EU3A 1DQDL 3PHOA 1RZKC 2P49B 4XCEA 5SWQA 5DUBB 2C4XA 3BKMH 4NKOA 5BW7A 4FQXD 1EEUA 4NO3A 1MRDL 4NOFA 5DJDB 4KJQC 3BUYB 3KJ4C 2RR3A 1KNOA 3CLFH 3CVHH 4MDJB 4PDCE 3RWFB 3L7FA 1T03L 2GTZA 5I16A 3OX8A 4NM4L 1RIUL 5DMYA 2HA1A 2I5YL 4ORGA 5TDNA 4K71B 4GSDH 3BRFA 1JPGB 1Q9OA 4XCCH 4OTXH 4IIQA 1MHCA 4J1UA 3U0WH 5KS9E 4UQ3A 3QQ3A 4OD2A 1A2YA 2R2CA 1NUGA 1HXYB 4JM2D 1DQJB 2PETA 3BISA 3W0WB 5I8EA 1EPFA 4ERSH 4Z7UE 2AXHA 1FO0B 1XR9B 1HHHB 1MIEH 1DR9A 3PWPE 1BECA 1ORQB 3BP4A 3GMMA 4PLKD 4JFPA 1TQCB 2D7TH 5GISL 5JHDB 5K59E 2UWEB 3H9HA 1BD2E 1FRGL 2E9BA 5H35A 1G6VK 4C58B 4CMHB 4PJEE 5DQ9B 5DS8A 2HT2C 1CDHA 3BIBX 3DMMC 4MHHI 3X12A 4G59A 1PY4A 5J12C 2YC1A 3GSXA 1S7RA 1DANT 1HNFA 4L9LB 1A6PA 1UEMA 2JIXB 4X6CA 4LCWD 3T0WA 3B8YA 3MNZB 5KAQF 4J12A 1IC7L 4UNUA 1T1XB 4XPTL 3QCUH 3SDAD 4R90L 3IU3A 4NKDB 2GK0B 3HUJB 1MFAH 1TZGL 2HT3C 3VG0L 4EUPB 2GI7A 1MUJB 2J6EL 1C5DA 1NCAL 1RHHA 1Y0LA 4HJJL 5CCKL 1N3NB 1W72H 4JZNB 5JUEH 4G8GD 1EZVX 1FV1A 1R5VB 4K3JL 5E2JA 4Y4HB 1FNGA 2DS4A 3MUZ1 3SDCC 4PY7B 4MAUL 2BNRD 4NZJA 4KI5D 2DJSA 3HE7B 3BH9B 3TO4D 4P99A 2Z8RA 4DVRL 4MS8A 2V5TA 1H5BA 1BBDL 4LSQL 4XP4H 3TIEB 5CJ5A 4JKLA 4WO4D 3NH7L 3EYQC 1II4E 2ZOLB 4QRRE 1PG7L 2EE6A 4N5ED 1DSFH 2DRUA 4MAYD 35C8H 4ZTOH 3VFVA 1PYWA 3BKYH 5E4IA 3N9GL 1A5FL 1G7LA 5C0CA 3PHQB 2DLHA 5J11B 3GMNB 4K3EH 1KJMA 4QHKJ 4B5EA 5GS0H 3OKDB 3X3FL 1GVIA 2EO1A 2PN5A 3BAEL 1RJYB 4NCC1 3PDDA 2W9LA 4L8BA 3OKOB 2EC9T 4QT5A 1ZSDB 3FHQA 1S7TB 5BQ7B 2DOCA 5D2NB 1G7PB 4PJHA 3VXSA 1KCUL 2C3VA 4KK8D 3VXTA 3W5MA 3ORJA 3K7UA 1I8IB 3LOWA 1BF8A 2D2OA 2NMSA 1LK3L 2GJ6A 5ISZE 3IKKA 4YPGA 1XEDA 1G9NL 1IGTB 1RJZA 4KRNA 3RL1A 2MMXA 2ZP0T 1XT5A 2BFVL 4G9FD 2BRQA 1EXUA 3RDTC 2M26A 4ODXB 1MCWW 4P2QB 4WIQA 5CS7A 3MUGB 3BKCH 2GKIA 1E4XL 2A6DA 3K4ZA 3ZDZF 1A9EB 2O5ZL 3LPGA 5E6YA 5EU6E 1NGZB 2PYEE 4G3YL 5IHZA 5DRXB 4PRIE 5C08A 3RI5K 5EORL 5H2BA 3MGTB 4X7SH 4WU5A 5C9JB 3LAFA 3QDJD 5I1EH 4P9ML 3RIFF 1DBAH 3NVQA 5CWSB 2X4SB 2IQ9H 4GRWE 3I6KA 4PJ9D 4PJDE 4I0PC 3Q2CA 1UH2A 2Q86A 5KVGH 1UA6H 1WFNA 3DO3A 4R7DB 4HC1H 4LMQI 4QRSA 2D03L 4RAUB 4FFWD 4WEUD 1YPZE 3HZMB 3LSOA 1QFWL 4JDTL 2VC2H 2I24N 4QHLB 4J6RL 5D8JL 2VXVL 2AQ3A 5TE7L 1I85C 4F7MB 5D70H 4P5TA 1NBZB 4N0UA 1G7MA 2YD3A 1KIUA 1RK0A 4AL8L 5KSBA 1IGFL 4YHNB 1J88A 2VUYA 2NY2D 4JCLA 1QRNE 4DQOL 4POYA 1KN4H 2UV3A 1UXSA 4KK6C 3IB4A 3H9SD 2ADGA 1YEHH 3TIDB 3OV6A 3S4SA 3LN9A 3WIIL 4YK4C 2ZCLH 2Q1EA 3LQAH 3UTZB 4NQSB 1T7VA 3TJEL 3SE4C 3SPVA 3DV4A 3SDYH 1JK8B 3ZE0F 3PHOB 2XRAH 4M5ZL 1E27A 3MV7E 1ZHLA 5C0EA 1CVSC 2O93L 2VQ1A 4XCEB 5SWQB 1NCNA 3WXVH 1CTNA 1XMWA 4NWUL 3MV8D 4FFZL 3C5ZD 4NT6A 4XVTL 2OK0H 1HQRA 4C83B 3Q48A 4NO3B 4WDIA 3SJVD 1KNOB 3FQUA 4JFDB 2DQDL 3T3ME 3L7FB 5IF0A 2IF7A 3A6OA 4QOKD 4KJWD 1SJXA 4Q6IA 5C0FA 4ORGB 5TDNB 3GMQB 3KS0H 2WNGA 1NEZA 1Q9OB 5HXMA 4IIQB 1CDIA 1V8HA 1MHCB 4ONGH 2AGJH 3ARSA 2OP4L 4HGWB 3WO4C 4UQ3B 5T1LA 3QQ3B 4OD2B 1A2YB 3VXME 3EJZC 5I8EB 5EU7C 1FYTD 1YEEH 1I3GH 1HSBA 4XT1C 3B2UD 4EI5A 1NBVH 3BP4B 3GMMB 2J2ZA 3Q1SH 2AJXH 4JFPB 1OARL 5CGYD 2F53D 1NBYA 1B90A 2P43B 3IJHB 2I07A 3H9HB 5H35B 4YDJA 3B5GA 4PRAA 5DMGD 5JMOC 5CZVL 3KVQA 3CFCL 2HYMA 1BIIA 1OB1A 1FLRH 5DS8B 4LMQE 2BY0A 2VDQL 5LBSH 5CSBA 2VYRE 5ETUA 2YC1B 3GSXB 2I9TA 4NHUA 4ENED 5C0JB 2P8LB 5DJCA 4X6CB 2F5BL 4HQQH 1AGDB 2BK8A 2VSDA 4D9RE 1ZK9A 5IM7A 2NY6C 3QHZL 5KVDL 4JPIA 3IU3B 1KCSL 5ALCH 4Y5VB 1YEJH 5C2BH 3GKWH 1IGYA 1C5DB 1S3KL 1RHHB 4NZDA 4HDIA 4Z7VE 3KPRB 1Y0LB 3WV0A 5CAYB 4S0SD 4C57C 1AGEA 3OF6D 3QIUC 4KJYB 1UKQA 1MRCH 4GXUN 4OGXL 4P2RA 1T1WA 1W0YT 5HHMB 2AEQL 1AFVH 5E08L 1FNGB 1H15A 2Z31C 4ZFGH 5CEYA 4MXQD 1T1YA 4NQVA 3JV6A 3MJ7A 3KXFA 3O2VH 2R69L 4U6HA 3I6LE 3QWRD 1MIMH 4YUEL 2X4QA 2M8XA 1H5BB 4Z5RB 3KHQA 1NUNB 5DJ8B 1RUQL 5MEOA 1QO3B 3IFOA 4U1LA 1GGIH 2OLDA 2HWZL 3DMMA 4LCCB 4YBQD 5C3TA 5EBWB 1G7LB 4U6YA 4WFGE 4JFEE 1K8DA 3K1KC 5D7KD 4DEPB 3CXDL 2CO6B 1KJMB 1H3TA 3M07A 4CJ0A 2A9NL 4QT5B 1FNAA 2NY0B 4L4TA 2BVYA 4WTZA 4PJHB 2B1HL 5IVXA 3O41B 3L3HB 2WBKA 5FO8A 3C8HA 3UBXB 5I0ZA 1M4KA 2GJ6B 4E5XA 1TZIB 3FN0L 4YPGB 5DEGA 1RJZB 1RUML 4NHCL 2VLRB 1HNGA 3ZKSD 1U8QA 5JOEA 4RMQA 5F9AC 1EXUB 2R2BB 4HGMA 1FFPA 2IMNA 1C5BH 4BYHA 2A6DB 5C7XL 4X8JA 1SJEB 5TQ2L 2K3TA 3MOBH 1D5XB 1LE9B 4LSSL 1LP9A 3JZ7A 4LSTH 4XPBL 5C08B 3V5DA 4M7ZC 5HDQL 4L29A 3KHOA 3AM8C 4PG2C 5I30L 1CN4A 1U8JA 3VGAB 4XPHH 4L5FL 1L6XA 4S0TD 1J05A 1QA9B 3WIHH 3QXWA 4UILH 1RZKL 4WHYG 4L4VD 4IM8A 3ZSTA 3V52H 3VRLF 4GMSH 3SO3C 5FYKE 3VGDA 5A1AA 4X6DF 4NRYA 3FQXA 3LSOB 4MXWH 4RAVA 2QQLH 2MPAL 3AS1A 3IDGB 4H88L 4OCWL 2VDNL 4TYUA 4MNHA 3WLWD 5J13B 3QUKA 1X44A 2IANE 5JZ7D 4BSVB 4P5TB 4HW6A 5C0NC 1G7MB 4DW2H 5T5NG 1ZLWK 4GW1A 1VERA 3TN0C 1U8KA 3TPKA 1RK0B 5KSBB 1RUPH 4OCNC 2F74B 3RDTA 1R24A 2X89A 4TNVF 1DVFD 5EZLB 2ADGB 4PJ5A 3CU7A 4P57A 4H26A 2OZ4H 1OGAB 4KROB 5F96H 3B9KC 4ELMF 4LAJH 1GIGL 1ZEAL 4H0HB 4KC3B 3VMPA 1V7MH 3FJTA 2HVJA 5CJQL 4JFOB 3C5SA 1WWAX 1ZHLB 4S1SH 5D2LA 1RV6X 1K8IB 3LS4L 5EOQL 1MEXL 2BP3A 4NT6B 4I0PA 5IHLB 1BHGA 1HQRB 4RCAA 2B1AH 4WDIB 5E1HB 1CL7I 4BFIB 3D48R 2RB8A 5E8DH 5A2KH 1TZHA 4KWUA 5CILL 4Y1AD 3L7EA 4X5LA 1JPSL 5IF0B 3ULUD 3G04B 4K8RL 2W9EH 1OD9A 1ND0A 1OTSC 4Q6IB 5C0FB 5CJOL 4HBQA 4Q9QH 4TSCH 5JLZB 1I85A 3OKNA 4KRPD 4L3CA 4MD0A 1D9KC 3S88H 5BS0A 1SJVA 3VD9A 2R9HD 3DTXA 2DL9A 3WNNA 4O51B 1YEIH 5LQBL 5IQ9A 3KPMA 1TTGA 2WP3T 3PL6D 4DCQB 3FO0L 2AKRB 3KLAA 4E41A 5ACZB 1X7QA 5IMMA 1HSBB 1S7XA 3O3DA 4EI5B 5EUOA 3WNMA 3KPPB 3JV4A 4KKBD 3O3AA 1NBYB 2VLKD 2I07B 5I8KL 4I0KA 5EU4B 3VXQA 1P6AB 5E00A 1K5NA 3SE4A 1K9TA 1ZV5A 3KPSA 4N8PA 1OT1A 4NFDA 1ZLUH 3LKOA 2QL1A 5F97E 3GMLB 5EOCL 2NX5E 1A8JH 5DJ2B 5ETUB 2A9ML 1D5IH 2Z8WC 2XYCA 1ETZA 4Z7NF 5BV7H 4MD4A 2XN9A 3FONB 4RX4A 4UOW0 3VE0A 5E99H 1A6UH 5BVPH 2YPLD 3WN5C 4DGIH 1EHLL 2ZKHH 5EN2A 4QGTA 1JGVL 2UWEF 2OCFD 5FYJU 5C09D 4ZO9A 4TTGA 5IMLB 3BPLB 5ID1A 1FGNL 4TNVK 2FLRT 1KELH 2NW3A 1MREL 1I4FA 3TZVC 3ROLB 3DSNA 2RFXA 1ZVSB 1IGYB 4HDIB 4LSUL 1NCTA 4WENB 3EO9L 1AGEB 2XTJE 1N5AA 4P2RB 1P69B 1VB9A 3WUWG 3WUZA 4R97B 5CEYB 3LN5A 5IFHH 4XCFH 5E9DA 3V6BR 5E2TL 3JV6B 4KK5D 1BWMA 4U7MA 2W91A 4OZHA 2H32A 3MJ7B 3BXNA 3ULVD 4HFUL 3C8KA 3KXFB 5E94A 2YD4A 4DUWA 5MEQA 1RJCA 4UNTA 3G6AA 2X4QB 3RNQA 1LDPH 3QUMA 4NZRH 2NY1C 5D7IA 1IEAA 4U3XA 5MEOB 5KTEL 4PRNA 3HI5L 5SX4I 3L5IA 3WJLC 4DKFH 3BDXA 5EDXA 5EULV 5EC1A 1HZHH 1R3KA 3DMMB 3C87A 5J57B 1T4KA 1KCGC 4HIIA 4Y7MA 4GQ9H 3OKEA 5E8NA 2R23A 4YBLB 5IT2L 3MCKB 3PGCA 1A6AA 3QXUA 3JTCA 4HMDA 5IVXB 3PWNA 2FHFA 3IDYC 4LSPH 4MWFB 4KKAC 4UV4L 3OWEA 1NL0H 1JWMB 1J0IA 1UWEL 4E5XB 5DEGB 3G5ZA 4XWOD 4LNRA 3HNVH 1BGXH 1JZ7A 3MV9E 1U8QB 2Z31A 1R3HA 4Y16C 4WI5A 3H7BB 3TYGL 4Y19A 1P2CB 2NZIA 4X8JB 4MJ6A 1NGWA 5I18H 1YMHA 2IGFL 4HKXA 1JNHA 3TFKC 5MERA 1YQ2A 5EG6C 4OM0H 2FH8A 3BPNC 1Z6JT 2QSQA 1U8JB 5TFSH 5A2IH 5ENWB 2HFTA 3VU2A 1FVDA 4RAHA 15C8L 5DD0L 1IKFL 1MSPA 3S35H 3TJHD 4U0RB 4DVBB 4KKCC 5FAAA 2X10A 4XCYA 4NRYB 1MWAA 4L3EA 4MX7A 1GZPB 4O02H 5IB5A 3B4NA 1CFQA 3MCLL 4NZTL 4MNHB 4KAQH 2FSEA 3QUKB 5MHSD 2Y7QA 1J10A 4OCMC 3QRFM 4FQ1H 3GHEH 4XTRD 1BLNA 4HHAB 2APBA 4DOHE 3QIWC 3A6CL 2MWCA 5ECJE 1TVDA 2NY4D 2D4DA 1ZGLA 1U8KB 1UFUA 4N0RA 4WU7A 1A3RL 3QI9C 5FKAB 3RY6C 3HRPA 3RDTB 1I9IL 4HAGA 1C1EL 2DWEA 3WSQL 4K3DL 4C4KO 1I3RA 1CD8A 3T2OA 3BZFA 3GSUA 5IQ7H 2GTWA 4PJ5B 2MTPA 1UADC 1KYOJ 2PW2A 4JDZA 1T7YA 4H26B 1MLCA 1IGIH 4JRWA 5GSVB 2JJTC 1LEKA 3GM8A 4PG2A 1YA5A 1AJ7L 2FBOJ 3QUML 3LKNB 3C5SB 2PCPA 4AEIL 5J1TC 4I2XE 1EBAA 2BNUB 2HN7A 1MCEA 2R56H 4MYWB 4NBYB 5D96B 4MQTB 1S8DA 3DYMA 1FFNA 1EX0A 1CTOA 4EDWH 5C0CD 4JB9L 3AY4C 3KJ6H 3F65A 1IAII 1TZHB 4LF3A 2AV1B 3L7EB 4CDHA 5M94B 3HG1B 2XIDA 1PKQA 5LWYL 4X5WA 5T33H 4ODTH 1GAFH 3VXSD 2YD2A 3OKNB 5BS0B 5IVNA 1FNSL 5ILTH 2GT9A 3ZTJH 2K7QA 2OS7A 5IEKA 3TN0A 2C3XA 5C0RL 4U1JA 4LCWE 5DEFB 1JGLL 2A2QT 4G6JL 4M62H 1FSKC 3GIZH 2X09A 3GRWH 2R8SL 4J3SA 4K07A 4NN7C 4E41B 1X7QB 5IMMB 1S7XB 2N1KA 2DM7A 3K2UH 3O3AB 5FO7A 3MJ6A 2MJWA 4YK4B 3TWCH 3B9KA 1HSAA 5E00B 1NJ9B 1K5NB 6CGTA 2ZJSH 2EDJA 1G9MH 4G8GE 3KPSB 4ISVA 4WW2C 3LKOB 1R5IA 3C6SA 1RUAL 1MFEH 4P59H 2AJVH 4OZGF 1EEYA 4DTGL 2BNRE 3RNKA 2K1MA 4LAQH 1QD0A 4I3GA 4KI5E 1ETZB 1JN6A 2C3HA 4MD4B 3CC5A 3QEQA 3VE0B 1OLLA 2CJUL 4D0CA 3VD5A 1ULVA 2CUHA 5EN2B 1UWXH 5I1IH 5ID1B 3NCEB 2NW3B 1I4FB 2RFXB 1D9KA 1T5WA 4Q97A 5ALBL 1OSZB 1MCPL 1FL3A 3WO4B 1H8NA 3HAEG 4XP9L 1N5AB 3ZE1E 5B39B 2DQFA 1JI1A 5GS2D 3KR3H 1XGYL 3TBTB 3LN5B 3MRJA 1SQ2N 5LG1A 4NJ9H 4BK4A 1KUMA 4F3FA 3RWDA 5FUCC 3UEZA 3I9GH 3QG6B 1OSPL 3RNQB 4GJTB 3RZCC 3QUMB 2NY7H 5GGRY 5D7IB 5IEHB 4OZ4A 5D7LA 4G9FE 4NQDA 2ADFH 4M4PA 4YDVB 1MY5A 2FBJH 5IB2A 5HGGS 4TQEL 3NA4A 1KLUB 1T4KB 1SBSL 5FK9A 1WV7T 3UYOD 4HIIB 1EK3A 5F6HI 1L7TL 5ICZA 4U3CA 4XNXH 4UU9A 4V1DA 3WN5A 4OLUH 2BY3A 2R0KL 2NY6B 5KN5A 3T3PF 1QYGL 2FX8H 3PGCB 3MRLB 4WI3A 1A6AB 2PO6D 3TZVA 4YJZL 5DHVA 2CK0L 1A7NL 3PGFH 3VI4E 3U36B 4OM1L 2VNCA 4BQ8A 1FJ1A 3G5ZB 3I50L 4LNRB 3OKYA 2G60H 3EZ8A 5T1LD 2AV7A 1QPXA 3QFDA 3E6HB 1I9RH 5IUSA 4Y19B 1F8TL 4IRSD 4GMTH 4OT1H 3B3IA 4MJ6B 1NGWB 3MFFA 2J88L 3QULA 4I0CC 4X9FA 4HKXB 1JNHB 1YEGH 3MRDA 5I15H 3RKPA 1DBJH 1MJ7H 3WJLA 3RJQB 3FOLB 4NUGL 1J0YA 1KV3A 1XF2A 1IQWH 4WUKL 1AR1C 1FVDB 4LPUA 1RY7B 3H9SE 1CK0L 5I1KL 4FZ8H 4HUXA 4XMKL 1S9KC 4Q74A 4I5BA 3HA0A 4ZNCD 4KJQD 1DFBL 5DD3L 4S1QL 4PP8C 4FQLH 1GOGA 2Y06H 4GKSA 3PXHA 4L3EB 2XKNA 1CU4L 3U1SH 5L9DH 3NIGE 4HPYH 1F02I 1QR1A 1CFQB 2IH3B 3O45A 3B5TA 2FHCA 2P46B 2VITA 5KVEL 3MV8E 1BLNB 2OR9H 5HYEA 2XA8H 4P2YA 3RGHA 4UT9L 3CAFA 2EDTA 1JWUA 2ICWI 3KDMB 4WU7B 3SJVE 4HF5L 4Y16A 1F4AA 2DWEB 1I3RB 4WHDA 3BZFB 1UB5B 1H0DA 1F2QA 2GTWB 4QOKE 5A2JH 4UDUA 1KT2A 3HCVA 5FM4A 4JDZB 4ALAH 3TFKA 1KIRB 4S1DD 4RFEA 4M7ZB 4HLZH 4LSVL 4LQ1A 3WFEH 4OJFL 4XMPL 1U6AH 1D6EB 4DUXA 4HJGA 1AXSA 1FYTE 3ARYA 3LEXA 2V2XB 2HN7B 3BX7C 4QEGA 3EJJX 3VFRA 1S8DB 5TF0A 5B4MC 5EB9A 3FTGA 4LEXH 5EIIA 2F53E 5AD0B 3SCMD 1RURL 2YHGA 1N6QH 3BEVB 2J5LC 1N7ML 1FL5A 4POZC 4X7TA 1X5ZA 5FXCH 4PV9A 2IPKA 3T4YB 1GPOL 1PKQB 4OB5H 4L4TD 1RZJH 1EHXA 1LO2H 3TLRA 5ID0A 3U4BH 2V9TA 3MX0A 2HT3D 1KG0B 3NIDE 3RUGA 3IF1A 3QIWA 2GT9B 4ZTPH 4F9PC 5IEKB 3TN0B 5KVFL 4U1JB 1FIGH 2DDQH 3RY6A 5C07D 1ORSB 2EDDA 4YHIA 4LCIL 5C8JA 4M3KB 1IILE 4NNPL 3SDCD 1ZTXL 1QBBA 4YAQB 3IDXH 4M9PA 4FXGA 5DUPH 4U6TA 1S9VA 3UJTH 5GRYA 5C92A 3EYOB 1AE6L 4XP1L 3FB7A 1N0XL 4EOWH 3TVMC 2JJTA 1UEYA 3B9KB 3QPXL 4X0KA 1F3JA 4TPRL 4PJGE 5DWUH 3ET9F 4ISVB 5HGHA 3G6DH 1I7RA 4GUPA 4YQXH 4R7NA 1R5IB 3P0YH 4H1LA 1MAJA 3NABL 1FC2D 4HXBL 1EV2E 3QCVH 3S35X 4XGZB 3IGAA 5CD5C 5E56A 3CK0L 3CC5B 2C1PA 1NSNH 3QEQB 3S36H 1AXIB 3AY4A 3NCCB 2Z9TA 1J18A 1CIUA 4JN1H 4AG4H 3ARGB 3LCYA 2VDRL 4JN2B 5EIQA 1EUTA 4L1DA 3QWQB 5B38G 1CFSB 1NCDH 1FCCA 3VFWA 4WY7H 1T5WB 5B8CB 3P4OA 1DLHA 3GHBH 3HZVA 4HXAL 2H3NA 4GOSA 1I9JL 4OFIA 4N8VA 5D7KE 3VRIB 5JQ6H 2V9RA 1LO5A 4FG6C 4U1MA 4JO1L 4JKWA 3DYPA 2FATL 5IFJA 1C8PA 1FDLH 1EUUA 3QDHA 4F3FB 4EBQL 3DARA 2X89D 3PP4L 1KCLA 1PBYA 4LBEB 4P9HL 3K46A 5F7EH 1E6JH 4NQCD 4Z95L 2BVOA 4XMLH 3U9UB 4KKLC 5HI3C 4MNQD 1DBBL 2P24A 4RSVA 4WW2A 5JIHA 5AAWA 4OZ4B 5GS0C 1JF1B 4OZFB 5D7LB 5EZIL 1FH5L 1EO8H 4NQDB 1A0QL 5IB2B 4D8PB 25C8L 5FK9B 1BFSA 2P7TA 5C0AA 3D69B 1KGCD 1INQA 1KBGL 2EEDA 4KJPD 4H8WH 1T7ZA 2BDNL 2UZXB 4I0PD 1DBMH 2X4PA 3WN5B 4HH9B 4YXKH 4CMMA 3HE6D 1WT5C 5KN5B 2J8HA 1N26A 4GW5A 5IHUL 1J8HA 4JRXE 5E4EC 4GBXD 3TZVB 5SWZA 4CVZB 5DHVB 5T3ZL 5BXFA 5ADPH 3GMRB 1TENA 3LHPL 4L4VE 1LO4L 4Z7WA 1FJ1B 4J3UA 3BE1H 5F1NA 3T04D 4B53A 3BMWA 3LEVL 1VFBA 2O5XH 1IGJB 1JMZA 2QHLA 1S78C 4W70A 3MOAH 5ELIA 3NZ8A 1ZT1A 5LCVH 3WLBB 5I1JH 2X9YA 1A3QA 4E41D 3KYMA 1QSZA 1EEZA 4KK6D 4R6UA 3U46A 2JELL 3Q5TA 1ZS8A 3QULB 3WDIA 3OHXB 4HEME 4ESKA 2DLGA 3MRDB 3RZCA 2WIMA 4FQCH 2A74A 3ILQC 2IEPA 2X4RA 1F13A 4OCXL 1QFOA 2APXA 1NLBH 1U91B 1XF2B 4OF8A 2Q6WA 3P9MA 1I3UA 4M8QA 4PRHA 1K2DA 2EIDA 4JQIH 4AIZA 4BJLA 2DBLL 2PYFA 3M8OL 1PJ9A 5E5MA 3CMOH 1T21A 2EYRA 4KV5E 2XN9D 4I5BB 1RZFL 1S9WA 3BQUD 4EI6A 1KB9J 1JRHL 4GKSB 1ITBB 2XKNB 5D72H 1QR1B 3TESA 4EN3B 3O45B 1RK1A 2LVEA 5I1LB 2O61B 3IDYB 5IR1A 2VITB 3MA9L 4XP6H 4PJAE 4BZYA 1PY9A 1EFXD 3UPRA 1JZ5A 1CXLA 5JW5A 1JWUB 4XAWH 3D25A 1K85A 3LQAC 4Y16B 4Y1AE 4YHPA 3UX9B 2JCCA 4JFZH 3ULUE 2XWTB 2WK2A 5E9DD 4Y5XC 1UCBH 1OD7A 3GSVA 3KPNA 4LSRH 3SDXF 1RJLB 1BVKB 2HTLD 2EH7H 3QZWG 4RFEB 1BREA 5D1ZC 1B4JH 1JMXA 1ZAGA 3BPNB 3FB6A 4QCIA 1BEYH 2AW2A 3VGEA 3MLTA 4HJGB 1AXSB 2AI0L 3CFBA 3LEXB 1RQ5A 4KQ4L 3VXNB 1IAIM 4M1GL 3VFRB 2F54A 4ZS7L 3FTGB 4PYHA 3ULUH 1BM3L 4L3AA 3BPOC 2VLKE 1FL5B 1E4XI 4Y4KD 4NCC2 1Y6KR 1G84A 5J06A 4PBXA 1QZ1A 4OQTA 2XT1B 2ATPA 5ID0B 1J9CT 3HI6L 5AUMB 2EIZB 1AI1H 3RUGB 3IF1B 3QIWB 5T3XL 5TH2A 3ZYOA 3MACH 1F4WH 3L5XL 3BGAA 3QIUD 3JWDH 1NGYA 1JYVA 4L9DA 2YPLE 4YHIB 3VFPB 2L4OA 4I77L 1UGNA 2AK1L 2R4RH 4YE4H 3OKKB 2Z31D 5C09E 2XXCB 4OLWL 4FXGB 4KHTL 3NCMA 4EUPG 5IESH 3ZDYE 4RZCA 3L5WA 5TE4L 3FB7B 1QFWI 2DQJH 1KTDA 4X0KB 1T20A 1RU9H 5HY9A 3RTQC 3MJ9H 1AXTL 5HGHB 4GUPB 1KCVH 4R7NB 3OJ2C 3EDDA 3BPCA 1AGCA 4H1LB 2EICA 2I9LB 2IBBA 1TNNA 5DSCA 2CGRL 1E4WH 1QLFA 4WUUA 3IGAB 4NUJA 1NUFA 3D0LA 4M61A 3ULVE 1NCWH 4MQXD 3GSNA 3GMPB 5HYJA 5IIEB 2HKFL 3RWIA 1XF3A 4PB0H 2HTKC 3C09C 3SO5A 3MNVB 2GCYA 3LS5L 4YHZH 3O3UN 4KDTA 1U41A 4OCRH 3FFCD 3P4OB 1DLHB 3HZVB 4HKBA 2H3NB 3LPWA 4F9PA 1BJ1J 1DN0A 5KBNC 3STBA 2IQAA 4J3TA 1LO5B 1FSKB 2C7UA 4J8RB 4PJ8C 1AY1L 3WIFA 4C56D 3HNSL 1IKNC 2VO5A 3WNLA 3RGVC 1GOHA 2NY3D 4PBWD 1C5CH 4KZEL 4PJBF 3TVMA 1E4KC 2ICEA 4JGUA 3KYKH 3PWPA 1A14L 5DRZA 3I2CL 4WW2B 4X99A 5HYSG 3ERYA 1JHLH 2WV3A 5EBMB 1HHGA 4M5YL 1UZ8A 4JCMA 5TQ0L 4KMQA 3ES6B 2OJZH 4PRDA 2UYLA 1BD2A 3P11H 3QH3B 2AXGA 1AHWB 2P7TB 1IFHL 1INQB 4MMZC 4H20L 3FB5A 1YQVH 4Y2OA 2XZCH 2X4PB 1ROWA 4PJEA 4XC3L 1RIVH 4CMMB 2A83A 1W72A 2ILLA 3U4EB 1OAQL 4OF3A 1S9YB 4CADA 4HULB 1QNZH 3WD5L 5GGVL 4A6YH 5SWZB 5FO9A 4ZSOE 4XVJL 5FDWB 3EYUL 4OQTL 5BXFB 5I19L 1HXMA 2MOVA 2WP3O 3BH8B 5F1NB 5C0ND 1G6RA 4BQBA 5HHXH 3IDJA 1TPXC 4LDOB 3GIVA 3FCTB 4G8IA 1YNLH 3NZ8B 2HMIC 4I48A 5B22A 3KYMB 3GMOA 3U46B 2D31A 3HMXH 1UACH 2CMRL 4YZFE 5MHSE 4XBPA 2H26A 3TH4T 2AABL 3RZCB 5C71A 3UTTB 1MI5A 2E7MA 3BKML 5EU5B 4KPHH 3O11A 5HDBE 2KPNA 3MROA 2Q6WB 3U7YH 3P9MB 3UYRH 5DLML 1RFDL 2ARJA 1K2DB 1QFUH 3CLFL 2PYFB 2W60B 5JTWA 3MLSH 5FKPA 2WWMC 5E5MB 1CBVH 1J5OH 4P23C 3MLZH 4OV5B 4QRRA 2EYRB 2B4CH 4AT6A 1WT5A 3NTCL 4GSDL 4EI6B 3AGVA 4YXLL 2YPVL 3GSNL 4XCCL 4HK3J 4OTXL 4RGNC 1MHPH 1RK1B 4S1RH 1OTSD 2DI7A 5FM5M 5IR1B 3U4AA 4RFNC 3QYCA 1H3UA 3VWKD 3MRRB 1D9KD 2Y07H 3UJIL 4I8DA 1KF9B 3EHBD 4GT7A 1A6TA 2E9JA 2PTVA 2CXKA 4W68A 1OP3H 5CJXC 4YDKL 5D1XB 3JBG7 1NC4A 3OXSB 3HTLX 4JDVA 1WSST 3T4AA 5ISZA 2Q76A 5DFVD 2GFBA 3KPNB 3VXSE 1PZUB 2KH2B 4O5LH 1KEMH 1MNUL 5FGCE 3G6JE 1BX2B 1JWSA 4PJFF 1KC5H 3QCTL 3ZL4L 5DRNB 1MRFH 4LFHD 3MLTB 3C6LB 2GJZA 4LKXB 3IKCA 1XF5B 4PRIA 3HC4H 5INCA 1OAKH 5HPOA 3QCUL 1VENA 4WV1C 1F3RB 3LDBC 1S5IL 4V1DD 2CH8A 2ZZUT 3LPFA 5FCSH 3NBNA 1YECH 4LQFH 3MGOB 1X5JA 4MA8H 1W72L 4MA7H 2ATPB 5JUEL 3MRHA 1NLDL 5IW6A 3QR2A 4JG0L 1QBML 4Z7QF 4GAJH 1IM3A 3CFDA 2GY5A 1YPZA 5D5MB 4ACPA 1Z0MA 4YFLF 3ZKMC 2Q3ZA 5MEND 1I8MB 2EDEA 4TUKH 1NGYB 4BK5A 1B0WA 2CR6A 3TGXA 1GC1H 1G6RL 2NZ9D 2BHZA 2KBGA 3BVNA 2GJJA 5IK3B 2L0DA 1HYSC 4Y5XA 4DKAA 3L5WB 1MHEA 4DGYH 4M6NL 1A6VH 1NFDF 5DA0B 3AC0A 3UZQA 2CIIA 35C8L 5E8PA 1KTDB 5D1ZA 5HY9B 1QRNA 4NQEA 5BV7C 2ZCKH 4MCYA 2H9GA 4N0UE 2NY1D 1NAKH 1FCGA 1H3PH 4JY6A 1XGPA 4HX1A 5GS0L 3TV3L 5DSCB 4Y8AA 1QLFB 1O0VA 4WUUB 1IJ9A 4NUJB 4N0CC 3D0LB 4M61B 4OZIB 1IRAY 1U8NB 1QSFE 3T2NH 3ARBB 3GSNB 3NA9H 1ED3A 5DK2A 2J5LB 3FB8A 3MV7A 2P1YA 3G5YA 3NFSH 4X7DC 2FEEI 3VFTA 3IAQA 5IB3A 2Z4QA 4TVPH 1M1SA 4NNYA 1WISA 3O4OB 5ADOH 1K6QL 5DD5L 1BFVL 4PRBA 4ZS6D 2IQAB 2PTTA 1T7XA 5E0QA 4ODUA 3CUPA 4YHKH 1MCSA 2C7UB 4NWTH 5DJ6A 3FFDA 3WIFB 3KPOA 4UIKH 5KS9B 3EFDL 4N0YH 1UQSB 2V2WA 2XTJC 5DT1H 1E0OB 3FQTB 5I1EL 2CRZA 3VXMA 3RTQA 4Z7UB 3ROOA 2IQ9L 4U1IA 4MNGE 3WKMH 3DWTA 5JPNA 3TFKD 3PWPB 2YD7A 3BIAX 1FN4A 4ONFH 3T2PA 1P4LA 4LHJB 4EVNB 1CICA 2QQNH 4PRDB 3TBSB 1BD2B 5F72S 3K1DA 1R3LA 4O4YL 4N8CL 4AK1A 4Z78A 3FB5B 1OT2A 3DIFB 3VXPA 1KJVA 3UTOA 1VFAB 3QHTC 4KKCD 4PJEB 5KJRH 3JV0A 1P7QA 4OFYA 4HFWA 3V95A 43CAB 4X98A 3V6FB 3T0AA 4NGHH 4CADB 3EBAA 4J4PC 3UTSE 4AENA 2EIBA 4PGEB 4XNUH 2DLFH 4RGMC 5FO9B 2BERA 4YXHH 4WI4A 3X14A 1J7VR 4F8QA 3PV7A 4TUOA 4QNPF 1A1NA 4CJ1A 1HXMB 5LGJA 1KEGH 4UIMA 1ZANH 1DQLL 1G6RB 1KN4L 4NKIH 4FA8A 1VGEL 4NHUE 1A6ZB 3IDJB 1WZ1H 4ZFOA 3GIVB 3WBDA 3QI9D 1OTUC 1BWWA 4Z7VA 1IKNA 2ZCLL 3R8QA 1IT9H 4KVNH 3RGVA 3GMOB 1JFMA 4YFEA 2NW2A 5CBEA 2D31B 5E8EB 2B5IB 1E4KA 1YC8A 2H26B 4JFYA 3MRQA 2XRAL 4YGAB 3GNML 1JGEB 1FPTL 4OIIH 5IROC 3MLXL 4OIBA 5DC0A 3LZFH 3L3OA 3O11B 4G42A 4ZFZB 2IAMD 2BHYA 2D7NA 1GGUA 3U9PL 3ZE2F 4XXDB 1YN6A 2MNUA 1G1CA 3K3QA 5D71L 5FKPB 3VXUA 3S4SG 1ZLVK 3T09A 1MCOH 4JANA 4QRRB 3X11A 4AT6B 3U0TA 4RRPA 1PFCA 1OLZA 3LMJH 3QDAA 1CFTB 2W07A 1G0XA 4ONGL 2AGJL 4FFVC 2Y36H 5FYLH 3OGCB 4LIQE 4N9GB 4TRPH 4YHYC 4IHOB 4LARH 5KSAC 1CLYH 5I74C 5FHAH 3RRQA 5CINH 1FBIL 2XQBH 2IPTH 5F7HA 1A6TB 1YEEL 1IC4H 3O4LA 5SX5H 2AJXL 1HEZB 5GRVL 1NC4B 1DUYB 3UZEA 2FH6A 4JDVB 4JFFD 3VRJA 5ISZB 2XKSA 1NEZG 3Q3GA 4L4TE 1E4JA 3WJJC 2XWBA 1T5XA 3F6LA 2WZPD 3WIHA 3EOTH 3TP4A 1FLRL 3CDCA 3OKLB 4WGVB 3SQOL 2NY5C 1JWSB 5IJVB 1D5ZB 2AJSH 3WDHA 5C07E 1FAKT 2P8MB 4XHQA 5IP4A 4MMXC 5EU6B 5DC4B 2PYEB 4HQQL 4QRTB 4KTYA 1W8OA 3IKCB 5INCB 4U0QB 3O6KH 4PJXF 5CLTA 4BFBD 5C0AD 1XGQB 5DJAA 3GSOA 5ALCL 1YEJL 2CKNA 4GRWB 5C2BL 3GKWL 1LP9E 3OBAA 4PJDB 3CVIH 4PLKC 1F2XK 2CO7B 5F1OB 5F7YC 1J8HD 3MRHB 1MRCL 4X5XA 5IW6B 5J9PA 2OMNA 5HHQA 1AFVL 1XIWD 1B0RB 2E3VA 3CFDB 5EFIA 4ZFGL 1YPZB 1Q9WA 2LFGA 1LILA 3ZDZE 1LDSA 4FXKB 5F3HB 5F6HJ 1YEFH 2B39A 3O2VL 4OGAC 4U6VH 1MIML 3DRQA 4QRQB 1QFWM 1G9MC 3QRGL 1EMTL 3BVNB 4ZFOL 2QBWA 5C3LD 1TNMA 4Y5XB 2CK2A 3VJ6A 2CIIB 3RKDC 4U05A 5E8PB 5D1ZB 2SEBA 1QRNB 3C5JA 4ODVH 5A2FA 5CD3A 4MCYB 2H9GB 3MRCB 3WUWA 4KTEH 3SDAC 4CRPA 4PGBA 2YA1A 4WCYH 3EYFB 3THMH 5CP3A 2J4WH 4JY6B 4DN4H 4HX1B 4JRYA 3ZLQC 2HJLA 2F15A 4FQHA 4PRHD 1JFQH 3KPLB 4LLYB 2Y6SC 2HFGH 4LU5H 2DQHH 3BPOB 4WV1A 5I6XC 3V4UH 5DK2B 4NQCE 2UUDK 3FB8B 2IFFL 4FRWA 3MV7B 1IL1B 2PW1A 3G5YB 4MNQE 4XXCC 2J8UF 3VFTB 4Z7OF 3HI1A 5IB3B 2Z4QB 5JMRA 4CDGC