3BP7A

The high resolution crystal structure of hla-b*2709 in complex with a cathepsin a signal sequence peptide, pcata
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQHAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B-27 alpha chain
publication title Structural basis for T cell alloreactivity among three HLA-B14 and HLA-B27 antigens
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 81
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2007-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bp7A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3bp7A01
4XPTL 2BERA 1CLZH 2APXA 2RJMA 4FQQA 5T3ZL 4G6JL 4HSQA 2IGFL 3UJJH 4NKQB 4NQSB 4IDLA 3A6CL 4OLZH 3CH1A 1EX0A 4MA1B 3RVXD 3WIFB 2VQUA 3AM8A 4PLKC 1Z5LA 4OCRL 4HIXH 3G04A 4FQCH 2OM5A 1T1WB 1TJHH 5JXAH 2X42A 5L7XL 1YPZF 2EDEA 1YYLH 1RIVL 1ROWA 4GT7A 5IQ9B 4RIRB 4M61A 2PXYB 1M6OA 5ICYA 2C3XA 4HT1H 5F6IC 2P46B 5D2LB 2PTVA 3REVB 1RVFL 3B5GA 2E27H 1AC0A 1MHCB 1DL7L 2QR0B 4WDIA 3E3QA 1K9TA 2VDMH 3LKSA 4WNQB 2C4FU 2BNQE 3G6JE 4AEEA 3H9SE 4OGZA 5F1OB 1I8KB 1WITA 3LEYL 3UP1A 2YD4A 2VL5B 4W6WB 35C8H 5I1DB 3T0ED 1A64A 4Y4HA 2I25N 4JKPH 2X89D 4FQJL 2AS5M 3G5YB 2AV7B 3EOAB 4K3DH 4LGSB 4Y4FB 4IOSD 4NHUA 2CUHA 2A6DA 4JRYE 1PKOA 2HJKA 1NCNA 3N1PC 2LV4A 2WV3A 1F45A 1XR8A 2BNRE 5GS1C 4U1KB 1C1EL 4X7TB 1W0YT 3TIEB 1AP2B 5DK2B 5IOPB 1BQLH 1EJOL 4PJXA 2VERN 2YN3A 2QSCH 1LEKA 4LNRB 1A4KA 1VFAB 3HUJF 2E7LC 3DMMB 1D6EA 2H2PC 4S1SH 5C3TA 5FO8B 3ARFA 1DBBL 4N8CL 5DD0H 2V9RA 5B39A 3RNQB 3VFWB 2DL2A 1TETL 3TWCL 1MCRA 5K59F 3W11D 4NRXA 1ZHKB 3OZ9L 5B8CA 3HI5H 5DJZA 1LP9E 3ROOA 3GJEA 4ZPTA 4J4PA 4HKJB 4DZBA 4ODSH 4R0LA 2ESVA 3ZKND 2CKNA 3VCLB 1Z0NA 5ANME 1NJ9A 5DURD 3ULUH 2YUVA 3ARZA 2XXCB 5E2JA 3VGGA 4PJGF 4X99A 5CJBA 1SJHA 1OAUH 4HKBA 5DMJB 4H8WH 1SHMA 4XX1E 2NY7L 4MNHA 1MSPA 4FFWC 5C0CA 1A7PL 5KSVA 1ZE3C 3MGTA 4C56A 2FGWH 3BZEA 2AQ3A 5DHVB 3WJLA 1Q1JH 1HXYB 4XP4H 5IW1B 3DSNA 4JVUA 3JUZA 1A7OL 3RJDA 5CEZH 4YWGL 2ADJB 5DQ9A 5FYKU 4TVPD 4POYA 5H94B 4V2BA 2NW3A 2Z91B 1NGZB 2JJTA 1SBSH 2JB6A 4GRLD 4R97C 1KLGB 4WU5A 4YDJB 5DJCA 1BZQK 1YUHA 4MJID 3PNWA 4EBQL 2ARWA 4PJBE 5C0RL 3QHFL 2CKBL 3RIFK 5CLTA 3OHXA 4JJ5A 1QSEB 3AXLA 4KKCC 3QEGH 4UQ2B 3QG7L 1BP3B 2AGJH 5JXEC 1CFVL 4ZSOE 4ZUWB 4ZOCA 1XZ0B 4KQ3H 4ZFFB 3FRUB 3PWVB 2VXQH 1CG9B 1AQKH 3ZYJA 3HZKA 5KS9A 2CPCA 1MWAA 5F9OL 3RL2A 3U2SA 1JCKA 1IVLA 1HXMB 2Z92B 3TPUB 1WIUA 5DZLA 2FHBA 2CDEB 1ORSB 2J3SA 1CD1A 4Y8AA 4ZO6A 5MEQA 1TMCB 3LQAH 2IH1B 5GRWA 3QZWB 2BRRH 3U46A 2QBWA 4NYLB 1EGJL 4WUUA 1TFHA 2XZCL 3K4AA 5E56A 3V8CA 2AW2A 4LHUB 3HC3L 1AC6A 4ALAH 3EJYD 4L3AA 3VXPA 1LWRA 4BK4A 2Y07H 4AQOA 2IJ0C 3Q5OA 1FO0L 4V1DB 1ZLUH 4I3RH 3ZE2E 4XAKD 5DSCA 2BZDA 4XXCC 5GRJL 2WQ8A 3BWAB 3H3PH 4XBPB 3WXVL 5KVFH 2VITA 3LEXB 1KENL 4OUOA 1I9JL 2P7TB 3HFML 5K9OB 1RUAL 4KH2A 4RAUB 4HGWB 2W07A 1SBBA 4XBEH 4O9HL 5I15H 2PR4L 1FFOA 4U1MA 4ZNCD 5DYOB 4FZ8H 1ZLWK 2BVYA 2M26A 3ET9F 1QVOA 4WV1A 4GAYA 4Y4KC 2V2TB 4WI6A 7FABL 2AQ1A 4U2YA 4Y5XA 4K7PL 5AG9A 4OCLC 4Y2OA 3SDDD 3VXSD 5F3BB 4PRNB 4M7JL 3AREB 5F6HJ 2EYRA 4E41E 4HAFA 4A6YA 3ERYA 5LCVL 5JNYB 5GRXG 4OF7A 3X13B 4JFEE 5ADOH 3MJ9L 1QSVA 3HZVA 1MFNA 3EGSB 3V0WH 1VKXB 1IGCH 4G8GA 4U33A 3HRZB 3QFJB 1UVQB 2YPLD 1U8MB 4Q6IB 1ITCA 1TZIA 3O6MH 1GC1C 2IQ9L 3A0OA 1WBYA 3W2DH 1TNNA 1AR1D 3NH7L 2VZUA 5KOMC 5TE4L 1NMCB 4LSRH 5T33L 3TNNB 3T4AB 1ZTXH 4PJFB 3NPSC 3F7YA 4HS3B 4XC3L 5D7SH 1QKZL 3BPNB 2C3VB 3DUHA 4DQOH 5I8EA 1F11B 2M1KA 3RTQB 3CUPB 5HYFA 3UTSE 2QQKL 3MJ8B 2BSSB 1NC2D 3FL7A 4LMQE 5GIRA 1NBZB 5L88L 4XWGL 3AS0A 3VFMA 3DTXA 5FYJL 4UTAH 4P4KD 5J1AB 2IQAB 3HNTL 1T2QH 4O02L 4X5XA 4YHOH 3LSOA 5DJ0A 5DMGD 3O4LD 4N0YL 4TNVK 2YEZB 1T03H 3H9HA 3KNBA 1KJ2L 1S7RA 2EECA 2HVKB 4LPXA 4M5YL 3BGMA 4OQTL 1LK3H 4UTBL 1IKFL 2A9ML 1MLCA 5IK3B 5GGRB 1YEJH 1E6OH 1I1FA 3FQUA 1FZJB 3WHXA 4PRID 4JB9H 4X80L 2XN9B 3KPPA 1J05B 5DTFA 4XCYA 1JL8A 4HQQH 4Y2DB 2DI8A 1JWUB 3GBNL 5C07D 3TFKA 4O51A 4X6EA 4JQVC 5I76B 3LOWA 3DURA 1PKQB 3TBTB 4XNMA 5CP7B 3OXSB 5LQBL 1IZJA 3K3QA 1B6UA 2BSTA 5JA8B 5CIPH 2E9IA 1YNTB 2AKRB 2AJZB 2P44B 1J8KA 3H3KA 2GUOA 5D5MF 4HIIA 5EBWA 4L8BA 1I7RB 4P2QD 4JCMA 5EBMA 5MERB 4LHQB 1I3RB 3HZYA 1F00I 2XKNA 5HHQA 1UZ8B 1HINH 5DS8A 2J5LC 4F57H 1A0QH 1MAML 3MLVH 1VESA 3QCTL 4QHNB 1F6AB 3JWDH 4XBGB 1EFXD 3UTTD 2XZQL 3GO1L 5F88B 3T0WA 4DKAA 3DVNB 2VYRE 1FFNB 3RKPA 3IJHB 1EFQA 4JO2L 5F7NC 2HYMA 4NQCD 2YA1A 1F4YL 1UACL 2F8OA 3GI9H 2MKWA 3PL6A 5IJVA 5DT1L 1VGKA 5IFAL 1VB9A 3HMXA 2H6PB 4M62H 1U8NA 1DQDH 2VDRL 2FBJL 3NN8A 3S34H 2DB8A 2OTUA 1WISA 2EYTA 4YJZL 1Q9WB 4NQDD 1BD2E 1C5BL 5T1MA 4BZ2H 1FCGA 5FKAA 2BNUB 1J1PL 4R4BA 1HHHA 1U91A 3QDHA 1OGAE 5C70A 3TO2A 4Y1AD 1QPXA 1Q0XL 3QO1A 1G7IB 1ZWIA 2YZ8A 2O5ZH 3TYFB 4XI5C 1U8LA 3S5LB 3LKRB 4K8RL 2V7HB 5ICZB 1V7NL 2WIMA 3P9MA 4CN1A 3I3BA 1RUML 1CICC 1RUQH 1QSZA 3FB7B 3HHRB 1YY9C 4PLKD 4L4TB 5IWLC 5HVHC 5SX5H 2A83A 1FNGB 2X9XA 5EUKA 4HUUA 3WNKA 4DK3A 4XX1G 2E7MA 3SKJL 4I48A 4A2MA 2CIKB 5E5RB 4NNPL 3MRPB 1G9NC 3BN9C 3I2CH 4F7EB 5C7XH 1A22B 1B0RA 2R0KL 2VLRB 1BAFH 2HFTA 3I75B 4HLJA 1Z2KA 4GBXB 4TSBL 3WUWG 3MRIA 1DVFB 2PF6A 2VDQL 1WCBA 5BQ7A 3P4NB 1FC2D 3L3KB 4MXVE 4NQEE 2E9BA 2XY2A 1EUTA 2DIBA 2J4WL 3CFCH 5C0FB 3QIWB 5FO7A 2CRYA 1S7TB 1P1ZB 2V17L 3MYJB 1YY8A 1NCCH 4B53A 4UB0H 5CJXA 2ITDA 3RL1A 5DJYB 3T2OA 2K3TA 3L7EB 3TJHA 1WBZB 2HKHH 4R90L 2Y23A 4U0RC 1BBDL 2X40A 4JPKH 2VC2L 3BEWA 4JANA 4FMFA 2GT9A 1NC4D 5EUOB 1BIIA 1CQKA 4NQTA 4KDVA 4OZHE 4P9HL 6FABH 4NQVB 3CH1B 4X9IA 3RUGF 4XVTH 2H2PD 5CIPB 1QPPA 1Z5LB 4RISH 3QDME 1OAZH 1U58A 2RBLA 5B38A 5JIIA 1UCTA 1XH3A 4TN9A 3UBXA 1A4JA 4BKLA 4ZG1A 3EJJX 4HEPG 5GXBB 4FFZH 5EN2B 4D2NA 4G42B 1TQCC 3O6LH 2A1WH 4WDIB 3D85A 1C12A 3QUXB 1QFUL 3UXFA 3IDJA 2EE3A 1A2YB 2X7LB 1S9VA 5DMYA 5ID0A 4IOIB 1HWGB 1MQ8A 4YLQT 5HY9A 2ORBL 3QIUC 3UYRH 1OP5K 5SWSD 5IHLB 1WTGT 4P5KA 1QRND 4W81A 1NMAH 1N2RA 3KWWA 5JW4M 2IANA 4BH7B 3SCMD 3FO9B 3D2UB 1I3UA 4FFWD 4NHUB 3SQOH 4LLVB 1W2KT 1JZ3A 3ZT7A 4O2CA 1EEYA 2VLJD 3HG1E 3VI4F 1T80A 2OI9C 5CJOH 3ZO0A 4NUJA 3LHPH 2NTSP 5BZWB 4JRWA 5HHOD 1XF1A 4PJXB 3FQWA 3O6FA 4R4FL 5CINL 3FN0H 3U6RA 1MPAH 1D6EB 2IWGA 4NRZB 2AK1L 3O45B 4NO5B 3G6AB 1D5XA 3RVVC 5I1CL 4YGAB 1ZA6B 4Z7WB 43C9B 3MV7B 1A6UL 4KAQH 3DIFB 1QO3A 4H5SB 2OJEB 4KKCD 1S7WB 5IG7A 3BP7B 3ZL4H 3QNYB 3MRMB 3MZTA 3V0VA 5JXED 1RD6A 4YDVB 2CDGB 5J11B 2X1WL 3ROOB 4XPFL 1S9KC 2B0SH 1X5LA 3PGDA 4ZPTB 5BO1H 2YHGA 4RWYH 1CDUA 4LCYB 1CT8A 2ITCB 4R0LB 1NBYB 4X6CA 4FQXC 4OCSL 4J3OC 1U93B 4M48L 1NJ9B 3BZDA 2AJ3A 1CFQB 1R3IH 3RZCB 3K2UH 3ARBC 3NTCH 3SE3A 4XXDA 1LEIB 4DAGL 4J2XA 5SWZA 1DBJL 2DYPA 4MNHB 3VXUA 1JGDA 1H5BB 5F6HI 5C0CB 4NBXB 2F53B 5D7JA 4LCUA 1CDBA 4OZ4B 3IGAA 5FUZL 5F7EL 1HSAA 3KDMB 3MRRA 4AK1A 4AH2B 2HTKC 1FFPB 2UYLA 3S37X 3O3DB 4HK3N 4ETQB 2NW3B 3BD3A 2XWBA 4NN6C 4OD3L 4YXKH 4U7SA 3CAFA 1J0KA 5DJCB 1YUHB 2QQLH 5IVXB 1H3PH 1CTNA 1H3UA 4Y19A 5IBUB 1RAMA 2DLEA 4DOHB 2EKSA 1S9WA 1OCWL 1EEUA 2ZG1A 4JJ5B 4I8DA 1GYAA 4BM7A 1G9EA 3AXLB 4O2EB 3UZQA 3S9DB 1L9NA 1NEZA 4CN4A 4D94A 5C0GA 4YX2L 4D8PB 4YHLL 2HAZA 1UYWH 1WLHA 4Y4KD 4GQ9H 4LVHB 3OKEB 3U2SB 1FVDB 2F58L 4KUZH 1JPFB 3NIDF 4WFEE 3E2HA 1DQML 5C0BD 4XP1L 3ZE0F 1KN2L 3RWJA 1EUUA 2V6HA 2YN5A 4YR6A 3BP5A 2DQEL 4OLVH 1D5MA 4DGVH 5C0AE 1FNEB 1CGSL 2BNQB 3MLWH 2CXGA 2ID5A 4W6XB 4WUUB 5ALCH 4PG2C 2NY4C 4OAWB 2Y06L 2WBJB 1MFEH 3B83A 3GMRA 4Y5YC 3CLEH 3LN4A 2V2XA 3QUMA 3OJVC 3WNNA 1EDQA 3QUYA 3GKWL 4EVNA 1L7TH 3TVMD 2VITB 3EDDA 2BNRB 2P49B 5C0IA 2ZKHL 4OI8A 4PJ5E 5CAYB 2RAMA 3F8UB 1L0QA 3R0NA 3DXAA 1LDSA 5EDXA 4F9LA 5E1HB 1FFOB 5D6DA 1I9IH 2FWOB 1HKLL 2H32H 3OB0H 2YD6A 1MEXL 5D2NA 5D9SA 5DJAA 1KB5L 3VWJA 3GUTB 2J8UA 1A6TA 2Y36L 1PD6A 4WV1B 1Q9OA 5C8JB 1OSPH 4Y5XB 4RMQA 4L4JA 5BV7L 5KVGL 1CDIA 3IRZA 4A6YB 1S9XA 4D9QE 5GHWH 1LP9B 5TGBA 3FO0L 4FOMA 4NZTH 4S2SB 1CFNA 1AO7A 1MFCH 4LAQL 3TT1L 5GS2D 4G8GB 2I27N 1JPST 3VXRD 1NGYA 1PEWA 2NXYC 4JO4H 1DLHA 4PB9H 4TTGA 1CD0A 3HPLA 5BJTB 5IW6A 4PRPA 1JPGB 3IFLH 1M05A 4G7YH 2L7JA 1I4FA 1ODAA 4HUXB 1CGXA 4JFDE 3NZHL 4PLJC 4HS8H 1BZ7A 3QWOB 5FEBA 3BZ4A 4MAUL 5EU6A 4MNQA 5CSGA 2CGRH 4JRXD 3PDOA 4MGXA 2Q8BL 2CJUL 2BC4A 4NWUH 2W0LA 4JFXA 3WUWB 3EYFA 1IEBB 1YPZA 1RZJC 5T5FL 2J6EA 4PJ8B 3FB5A 3S98A 5DJ0B 5C0DA 1T22A 4WVRA 3WL9B 1GL4B 1UWXK 3VXMD 1VFUA 4Z0BH 5D8JH 1Q0YL 1ZLVK 5ISZE 3DVIA 4PJBB 1R3LA 3KPMA 4XNQA 3RPKA 3U1SL 5HJ3A 4OBSA 4LFHD 1PGRB 4OSUH 1QFWI 3MLYL 3D6GA 4ZTOH 1UXWA 3BIKB 1NGQL 2FCBA 4PJDF 2CSPA 5E95B 1FIEA 1RHFA 4EN3A 1MCHA 2OBGA 5JHLH 2ZCKH 2R39A 3DPBA 5F7FA 2YWZA 4GS7B 1G7HB 4PY7A 2ZG3A 4Z7VE 1NGPH 2NX5D 5I9QB 3HUJA 4OM0L 4F15C 4YEFA 2GUOB 1EO7A 1MCWW 4G6MH 3NCJH 4IMLA 3VW3H 4XI5D 1A21A 5TE7H 1JGUH 4OCYL 5GS0C 1GCFA 4HGKC 2IPUK 2YK1L 1CICD 4ELKB 4NQXB 4PY8J 1WT5C 1IGJB 4E0RA 1YY9D 4JZNB 3IKCA 4TYUA 2AVGA 2AJUL 3TF7A 1WTLA 2NNAA 5GZNC 4HC1L 1MI5D 4WEUD 5DEFB 5I74C 5EU5B 5HHVH 2ADIA 3BN9D 3PXJA 1QLFA 1R3HB 4PJCB 3OG6B 4OFYD 1EMTL 4XHQA 3B9EA 3ARTA 4PJGA 1FGVH 4QT5A 4QOKD 3MLXH 1MQKL 2B1HL 4D3CL 1L9MA 2H32B 5IEKB 4XC1H 1IC4L 1HQ4A 2AEWA 2BVOA 4PTUA 3ULVC 2ARJA 5T1LA 5JORB 4OTXL 1U8NB 5IUSA 2XQBH 4AMKL 1A1MB 2OTUB 5DVKA 4IRJB 4JFEB 3CX5K 5GGVH 4EXKA 5IB5A 4ELME 4Z76B 2F54A 4XB8A 4R4BB 1HHHB 2JLLA 2AXJA 5FFLA 4LLDA 1CLYH 1M71B 1N26A 5JTWA 1VFOA 1SEQL 1FNHA 3KAAA 2VABA 3IDMA 3TT3L 4JFYA 1CWVA 1EAPA 1KGCE 1IAOB 1SJVA 2A6KB 2DMBA 2PNDA 3NFPB 3EFFA 3U82B 2IFFH 1NMBH 3OXRB 3QG6A 4U49A 1JK8A 1HHGB 2B8OT 2ZSVA 4ODWA 3WNMA 2GJZB 2R0ZH 3S88H 1M1SA 5JOFA 5FHBL 5HHMA 5FCSH 5FHAL 3T8XB 3K80A 1MJJA 2NZ9D 1T1YB 3OR6A 2OL3H 5HI5C 2A6IA 3UTSB 1SY6A 5EUKB 5IVZB 4HUUB 1NUGA 3S37L 3QDJD 5DRNB 2I26N 5D7LB 4CNIA 1CBVL 4R6UA 4JE4B 4ZUUB 3DGGA 3EDKA 4KHXH 4XHJC 2VDNL 4PJHF 3BKYH 1WCBB 3QQNA 4DUVA 4NO3A 2F5BL 5MEOB 1E27B 4G5ZL 5FO7B 3B9KA 1J88A 4LIQL 4JDTL 4HULB 4ZUSA 1J1XH 4LSSH 3RL1B 2OMNA 2NY6C 4LVOC 1S7XB 3WFBH 1JGEB 5ADPH 1F2QA 3M17B 4G9FA 4GRWF 4YH6A 3SGJC 4KZEH 5LBSH 32C2A 4J3VA 1EERB 5EO1B 1CLZL 2GY5A 3FZUC 4M00A 3EYUL 5F1NB 5ACMA 3PJSA 3UJJL 2P8LB 2VIRB 3PXHA 3UPRB 1NGXB 3FRPA 4OLZL 2PKDA 1BIHA 4WFGE 4YK4B 3C6SA 2WSKA 2CRZA 2GK0B 4C83B 4HIXL 3RWGA 2P5WA 4FQCL 1TJHL 5JXAL 1NKOA 3QI9A 3GNMH 2NW2A 3RVVD 5T3XD 2PYEA 2X4PB 2ICCA 4LPVA 4WHTA 1U58B 3QB7C 4JZOB 4MA3A 5I1AB 5IHZA 1T5XB 1YYLL 3TZVC 1M7IA 5LVEA 2HKFH 2Z31A 2DWDA 4OKVA 1G6RH 1A4JB 3VXOB 4HT1L 4KZDH 1XR9A 2E27L 4GW4B 4G6KH 1P6AB 4X83A 1ZAGA 3OBAA 1C12B 1UENA 1LE5A 3PWNB 3M8OH 3IDJB 4NO2B 1OL0A 1IGTA 4HX1A 1N5YH 4FQXD 4EOWH 2JJUA 2C1PB 5HDBE 2AK4D 4BFEA 35C8L 1OAKH 3ARBD 1TZGH 4JKPL 3LKOA 2Q86B 1DUZB 2VQ1B 4K3DL 4NRYB 2R1XA 3H9SD 3MROB 1CFSB 2GFBB 4B50A 2X9YA 4MQ7B 2PCPB 2W91A 2R23A 2WBKA 4PJIF 4PBWD 4OIBA 2Z8WC 4XWOC 4RX4D 1OQOA 3O41A 1JVKA 3QUZA 1BQLL 2GSGA 1BD2B 4ZFOA 1Z9LA 2HTKD 4JRYD 4U1IA 4LBEB 3IF1A 3QDGE 2QSCL 2BVPA 1OGAB 2MNUA 3RFZC 5MENE 4U1NA 4S1SL 3OG4B 4FXKA 2CR6A 4I18A 2DQFB 1HCVA 2DTMH 4PJAF 3T2NH 5E1AA 2BVUA 4AEHH 3QFDB 1PAMA 4K9EC 3V0VB 3HI5L 2GJJA 3SKNB 4M8QA 1T0MA 4NO0A 4UMGA 3PGDB 2OL3B 3TCXA 4ODSL 1CLOH 5H2BA 3ULUL 4RNRB 4Z6AT 2AJ3B 3U7WH 3GMOB 1F58H 3GJFH 4F8QA 1X7QB 3IDIA 3UX9B 1OAUL 4FFVC 2A6JA 4XXDB 4H8WL 3D18A 3IFOA 5SWZB 1WAAF 4LCCA 4PGCB 5I66B 1F2XK 1AE6H 4Q2ZB 3VI3F 2FGWL 1YEDA 2NY4D 3TN0C 1Q1JL 5D5MA 3IGAB 4XP4L 4JPIA 5A3IC 4KROB 3DUSA 3RBSA 5C9KA 5CEZL 2FECL 2NCMA 1NL0H 4S1DD 4WWKC 1NGWA 4GKNB 1SBSL 3DUUA 1CD9B 4X7CC 5K9KB 1CXFA 2APBA 3SN6N 5C92A 4I0PB 4FHBD 3LAFA 1X5ZA 4OZGB 4JCLA 1WZKA 3CFIC 4S1QH 1XAUA 3OPZH 1V5JA 5J9PA 4PRHE 3GRWA 3N06B 1VEMA 3QEGL 4OZHB 4QO1A 3SJVE 4BSVB 4CVZA 2AGJL 2EDDA 1MH5B 4KQ3L 1XF3B 3QDMB 2VXQL 1AQKL 2EO9A 3ARGB 1QSFD 2KQNA 2X70A 1G6RB 1GZPB 2GTZA 2ZUQC 2QSQA 3RWJB 3LQAL 5IEHB 1Z9SA 5KZCD 4G59A 2Y6SC 2BSED 2BRRL 5IB4A 5H35A 3B5HA 5FGBC 1CTOA 2NXYD 3MR9B 2ICWJ 3MRGB 4HW6A 5SWQA 4PP2B 2AJXH 1UB6B 3BDXA 4ALAL 3SQBA 3UZEA 4L1DA 4PJ9B 2P5EA 1TZHA 3DYPA 3LN4B 2V2XB 2Y07L 3ELAT 4PLJD 5EBLA 3EO0A 1SYSA 1UJ3C 5GGRY 1MFBH 4I3RL 5J57B 3D39A 3KPSE 4JFZH 5E5UB 3T65A 3H3PL 3MA7B 5KVFL 1ZT1B 3HG1B 4QXTA 3Q48A 5CJ5A 1TXKA 2GW5A 3FOMA 5C2BL 2HLAA 3AU1B 4XBEL 5I15L 3DXAB 4Z5RB 3OKDB 5IJKA 5ILTH 1Y18A 4FZ8L 5IT2H 1YNLH 1SVCP 1D6VH 1AGCA 1NFDF 1INQB 4P2YA 2ZOKB 4EI5C 4NC1C 4HH8A 5BCAA 4PY8I 1U8JA 2ADGB 2DRUA 4N5EC 1KPVA 1E4WH 2AXFB 2D7TH 2G2RA 5ADOL 1S9XB 3MV9A 5JQHC 3VXQB 3S8WA 1LK2B 1U2HA 5DFWH 5FDWB 3V0WL 1FSKB 1IGCL 3VRJB 4JZJC 2CIIA 4E41D 1NFIA 3MYZA 4EI6A 3O6ML 3CSYB 1NQBA 4LASH 1NBVH 4LSRL 4PRPB 3V6FB 3MUGB 1ZTXL 2X1XR 1YDPB 5A40E 1WFNA 1I7TB 5D7SL 4J6RH 3AREC 5EO9A 4DQOL 1BZ7B 4XCNB 4QXGH 3JV6B 5FA4A 3RUGA 3SDAA 4UV4H 1ZHBA 4LDOB 3U9PH 5D7IE 3ZZ1A 1MIMH 1O0VA 2EDTA 5CSZB 1GXEA 4UTAL 4R4NC 5DRXA 3CLFH 3BP4A 1T2QL 3SKOA 2EDWA 4Q6IC 3MO1B 3W9EB 2PTTA 4CVWA 4YHOL 1PY9A 3O2DA 5E6YA 5AZEH 1NMCC 3BW9B 3C8HA 5GZND 1T03L 4Z7UE 1HSBA 3MX0A 1IC1A 1X6NA 5TQ2H 3QQ9C 3LPWA 1LK3L 2UV3A 2ZP0T 4J3UA 1R3LB 3TGXA 2GAZA 2Y7QA 3FO1A 4UT9H 3FQNA 2A38A 4NBZB 3KYMA 1YEJL 3HPJB 5HJ3B 4NFDA 3MV8E 3DI3B 3MSPA 1SVZA 4U31A 3U0PB 5IMMB 4JB9L 4XRCA 3BQUC 4HJJH 1FVCA 2BVQB 4HQQL 4N0UA 4KXZH 1WFOA 1ZMYA 5T1KB 1DCLA 1XT5A 5DK0B 2ZUUA 4LOUC 3VXNA 3ULVD 3BO8B 4XCEA 3C09B 1FN4B 5I75C 3MRKB 3P77A 4XT1C 1YEGH 2VLKE 1F3DH 5B3NA 5F21B 3HE6A 1S5HA 1J0ZA 4QHLA 4X5LA 5IHUH 4UIMA 5FM4A 1A8JH 2WINA 5C0AB 4F80A 1KFAH 4MS8C 1D5ZA 4RDQF 5KSAB 3O3BB 3BUYB 2EKJA 4IMLB 2VR9A 4F7MA 2ZSWA 5H8DA 1AQDB 4WFHE 4LAJH 4QHKI 4YFLI 2N7AA 4RRPG 3ARDB 3OKKB 2KBGA 4E0RB 1T0NA 5HI5D 2F74B 2W0FB 4IS6B 2PW1B 2YMXH 2DM2A 4LSQH 1HINL 2IH3A 3M1BA 5ITFA 4F57L 1A6ZB 1A0QL 3MLVL 1KIQA 2HJLB 3CD4A 3GGWB 5IB3A 4PJ5B 4ZPVB 3JWDL 4K23H 5M94B 1HCFX 3GIVB 2GIYA 3C5ZA 3QCUH 4X6DF 1IAIH 5GZOC 4XHJD 4QRPA 1JI2A 3JV0A 1N3NA 4NHCH 4QT5B 3QRFM 1F3JB 4IRSD 3ULVF 1A7RH 4PGBA 2CK0H 4HUMB 1JWMA 4PTUB 2ARJB 4M62L 2MWCA 1DQDL 1H3WM 3S34L 4LLUA 3UTZB 1TVBA 2XTJE 3VRLE 2NY6D 3BMWA 1ZLUK 1ZT4A 4BZ2L 2YSSA 2VWEE 1IAIM 1UCBH 3F6IA 1DEEA 4RFOH 5MHSE 3D25A 4NSKB 1WWWX 3TESA 3L6FA 5DVMA 5C09A 1EAJA 2VDPL 3QA3B 1U3HA 1FAKT 3L5WB 1EAPB 2O5ZL 3GSVA 5I73B 2KH2B 3FZUD 2NLJB 1DN0A 4XMKH 1EO5A 3FT4B 3SDXF 2MFNA 1RUQL 1H3GA 4JFDB 4YDIH 4C57C 1MJJB 4JN1H 4DK6A 3ZDXE 5BRZD 1JRHH 3BJ91 4ODXB 4WI7A 4KMTL 2HRLA 4MVBA 1T21B 2XG4A 4N8VG 4MQXC 5C7XL 3RI5K 2Y4SA 1FZKB 1BAFL 4OZIE 3GBLA 2C4FT 1OD9A 2G75A 2XPGB 3KXFA 3MRLA 4L8DB 5EFIB 5EOCJ 1NCCL 4UB0L 4Y16D 3ZKSD 5EZJB 3SKUD 4EIGB 1S7UB 3DWTA 3LKNB 2HKHL 2VUYA 1Q94B 3OX8A 3OSKA 4GBXC 1A5FH 5I19H 4JPKL 4N8PA 3PQYE 4XWOD 4ZQKB 5JO5B 3SE9H 1VADA 4PGJA 5FA3A 2XIDA 2Q8AH 3MRCB 4BFGA 4NM4H 5KTEH 2QKIB 5JPNA 6FABL 5AWNH 4W70A 3VH8A 3DO7B 3UO1H 4XVTL 4Z7VB 1MCLA 3VE0A 4RISL 4GXUN 1BFSA 3EYQD 4P3DB 2LU3A 4G8IA 3REWA 2NW2B 3EDJA 5DFTA 3DX8A 4WHTB 3STBA 3QH3B 3IDNA 4QHUA 5BVPH 1BQSA 1K8DB 2Z31B 1P4LB 4FFZL 2FX7H 1MRCH 4M8VA 1XR9B 1IM9A 1K6QH 4ZUVB 3O6LL 4OCXH 2X6MA 4K3EH 1LE5B 1E4XH 2OTPA 3QXDB 1FL5B 4MD4A 1IGTB 1HHJA 3CFJA 4HX1B 2W0KA 3AM8C 4LU5H 2WWKO 3T77A 3KYAA 5K9JH 3UYRL 3QNXA 5HGAA 3LKOB 4FFVD 3NIGE 1W8OA 1R5VA 4JAMA 4MDJA 2CLRA 1HYSC 4ZDHA 5D2LF 2XQYG 4ZOEA 2X2YA 3D3VA 2R2HA 3SQOL 3E3QC 5J3HC 3TN0D 2R15A 5IMOA 4L8SA 2EEAA 1BFOB 3O41B 4HGMA 5FCUH 2XFXB 5A3ID 5CJOL 1T5WA 3LHPL 1N6UA 5CEYA 4AEIH 2VLLB 1FL6A 1XMWA 3WYRA 5GSRB 4WWKD 2BVPB 4Y4HC 3FN0L 3INUH 1MPAL 2Z35A 3A6BH 3U0TA 2Q76A 2CD0A 3U7YH 4WI8A 3TJEL 4F7TB 5F44A 5D1ZB 4KAQL 3L3OA 5L2KD 2YD2A 1RZKH 5KOVC 1UQSB 1IAKA 3ZL4L 4ZUTB 2OP4H 1RZ8A 5DJ2A 4K7FB 3IETA 4WO4A 2B0SL 5BO1L 4FMKA 3DVGA 4RWYL 1LO0H 1JWSA 2APFA 3MREA 4LQ1A 4HXBH 3KPRD 2NXZB 4PJDA 4UUJA 4J3XA 3K2UL 3NTCL 1X5FA 3ARFC 4IJ3C 5ESAB 5ETUA 3WIIH 4JM2B 4QNPE 4O4YH 3D18B 2Y6SD 4MSWB 2CKBA 3GB7A 5E03A 3I6KA 3P73A 4L3EE 1HH9A 2DQDH 5B8CC 3MXVH 5J11C 1EH9A 1DUYA 2FJGB 5TF0A 2J88H 4J4PC 3TBWB 2SEBA 3FTGA 4KTDH 4KQ4H 1BPVA 1QFHA 3MV11 5E9DD 1E0OB 4IHOA 4KK8C 3MBEA 4R0LC 2J2ZA 2XWJA 5DEGB 2BDNH 1RURH 5SX5K 2JE8A 3CGTA 3U4AA 2WBWB 3RZCC 1Q9KA 5IFHL 3FOLB 2D2OA 1U8KA 3MOBH 4M02A 3EYOB 3U9UA 4YXKL 4QGYA 5GS3A 3GSRB 3WFCH 4B5EA 3QXAA 3WBDA 5INDB 2QQLL 1H3PL 4LRIA 4QRSA 5E8PA 4HKXB 2ZCHH 5AUMA 1KPRB 1N64H 1CZ8H 1JHTA 2NR6C 4MJ5B 3WJLC 3L5IA 3NCYP 4KJPC 3MQIA 5JHDE 2Y5TB 1FYTD 2R2BA 5F72S 1UYWL 4EI5D 1R3JB 4GQ9L 1CGWA 1U8OA 3NGBB 3X11A 2B39A 2JJTC 1PG7W 4KUZL 4CN6A 1VEPA 3C6LB 3SOBL 4N5ED 1FO0A 1U95A 2I07B 3DBXB 5D2NE 1OVZA 2JCCE 2EH8H 2J8UE 3LKQB 3T2PA 3OGCA 4OF6A 1KTRL 1YZZA 2YD9A 2ENSA 2NY1B 1XF4B 4RGNC 2CRIA 3MLWL 4R3SA 4YHZH 2H2SC 5MI0C 5ALCL 5E8DH 1I8MB 5DJ8A 1MNUH 3HN3A 3X12B 1MFEL 1B2WH 2X09A 4LVHC 1FZOA 3CLEL 3MC0A 4M1DH 4Y7MA 5J56B 2P5EB 1JV5B 2FEEL 3RWDA 1UT9A 5E8EA 1SYSB 5HDOA 3S97C 3T2QA 2IALA 4WGWB 5IWLA 1L7TL 1PLGH 2BRQA 1KCKA 3FB8A 1IGIH 1EZVY 4KRPC 3GMMB 2BOCB 3QPXH 1E28A 4JFFD 2AEPH 2ATPA 3J8F7 4XPHH 4KUCF 4L4VA 4MNQE 2GJ6A 3NPZB 2WUBH 3QDGB 1PQZB 2DF3A 1SYVA 1I9IL 3PWUB 5MENB 4YEEA 4CDGC 5CWSA 8FABA 1OSPL 4U1LA 3BYYA 1K4CB 2WK2A 3GMNA 4WFFD 2Q7YB 3FN9A 4LEXH 4K71B 5GHWL 1KXQE 3BQUD 1YQ2A 1Q9LB 4NZTL 1B90A 1MFCL 3MRJA 4HJGA 4LOUD 2E7HA 4JO4L 4RFNB 5E6IA 3GSQB 5C08A 4EI6B 5EU7C 1MVUA 4PB9L 3VWKD 4D9QD 4J8RB 4QRQB 4ZAKA 4WV1C 3IFLL 3VG0H 4G7YL 3C5SA 1KJ2A 2WWKT 4Y5XC 3O9WB 1OW0A 5IGXH 2ZPKH 4HS8L 4UIKH 1RJZA 1RZGA 2CGRL 3KYNA 3MRNB 3ISWA 1K4DA 4NWUL 4BYHA 1REIA 4ISVB 3ARQA 4HFUH 4M6OH 5C0EA 5EPMB 5DRXB 5E08H 3RDTB 3W0WB 1P7QB 4FTVD 3UPAA 5ACZA 3CCHB 1G7PA 1A6PA 3ULUF 3LD8B 3TBSB 4XGZA 4GW5B 1W8NA 1I1AA 5ACLA 4KK5D 5ERWA 4Z0BL 5D8JL 4G9DA 2EIDA 4M03A 2C1OA 1MAJA 2X4SA 1BJMA 4LPTA 5TDNB 3KYMB 4C54A 1KIUA 3RWEA 3QIUA 1A6AA 1II4E 3SJVB 4XB7A 2EH7H 4XRCB 1BJ8A 5ISZD 4OSUL 4N9GA 3QEQA 4ZTOL 1AXTH 5E99H 4R8WH 4FP8H 4OM1H 4Z77B 4I2XA 3VFOA 5JHLL 5B3JF 5F1IB 2ZCKL 1LE9B 1CL7I 2R29H 5DQDL 4AENB 4O5LH 1B0GB 4DWHA 4LF3B 4P2OB 2AP2A 1NGPL 5HBBA 5TE6H 5J6HB 4ORGA 3GK8H 2FL5B 1D5ZB 1H8NA 1V3KA 4G6ML 3NCJL 3DRQB 3VW3L 4R96B 3TNMB 5TE7L 1JGUL 1YMMA 3RWFB 3DV6B 2F54E 4PJAA 3TFKC 4XP6L 3NA4A 5BZDA 3BH9A 3OB8A 2YUXA 1T0NB 2XWTA 1C16B 5KAQF 3KPSB 4NCDA 1J0YA 3MLTA 2IH3B 5ITFB 2FIKA 4R2GD 5HHVL 1RJCA 3L5HA 5I9QC 4MQXD 1VA9A 1KIQB 2NY5H 2ATKB 5IB3B 2WUCH 4KK6C 3EFDH 3QIBB 5CHNB 3IJYB 1J8HA 3PHOA 4LLMA 1FGVL 1X5AA 2W92A 5D1XA 3MLXL 1YEEH 1X5XA 2A73B 2J8OA 3GDBA 4MCZB 4XC1L 4LCWD 4PGBB 4PJEB 1JWMB 4PJ7E 4YGVA 4P5TB 4N0FA 1CGUA 5HYSG 5K9QI 2DQCH 2XQBL 4TSCH 4XNUH 4HFWB 2K7QA 5EC1B 1ZGLM 1HKFA 4P2RB 5GGVL 2MJWA 2W0PA 3PGFH 3QUKA 4Z7NE 1I1YA 3FFCD 4PGEB 1XCTA 1DEEB 2OSLA 5F9WB 1CLYL 3L6FB 3O11B 1J18A 4P23A 4NC0B 5CBAB 4HK0A 1RJLB 3PL6C 2IFFL 1NMBL 1K5NA 5F70A 5KSBF 4MCYB 1DN0B 3S88L 2R0ZL 3OB0K 4G43B 4TVPE 1BBJA 4AL8H 4LHJB 1MHHB 1KGCD 3TBYA 4CMMA 4M7LH 5D70H 3DNKA 2OL3L 4MJ4A 3MMEA 3OWEA 3LPFA 5E2UH 5BOPA 4YE4H 1IE5A 5D7IB 3RI5F 3D0VA 2MHAA 3L3JB 3FQTB 3SGEI 4YFDB 4QRRA 5EU3A 1ZV5A 4LKCB 5JQ6H 1B0WA 2C7UB 1RZ7H 4MZ2A 4KHXL 2LAAA 3JWOC 3BKYL 3CFEA 3QRGL 4I77H 4Z7UB 2YRPA 3RGVB 3CDYA 3KJ4B 3KXFB 5DUBB 1CN4A 1H3VA 3BYTA 5HI4D 3GBMH 4OV6F 2UY6A 1C5DA 5TFSH 1J1XL 1S9YA 4LSSL 5E00A 5HGDA 2IAMD 3MV8B 3QNZB 3WFBL 5EOTB 1HYSD 1AGEA 5ITBH 1S78C 4G8FA 5ADPL 1W0VA 3WSQH 4KZEL 3RY4A 4K3GA 3FHQA 5LBSL 4GMSH 5J3HD 3UAJC 3T0EA 3CFDB 1BGXH 3MXWH 5D1QD 1QUNA 1VADB 2VLKB 3BPOB 3O8XA 2EDLA 3RWHA 4Y4HD 4PGZA 4XAKE 5CJXC 4HH9B 1CFTA 3BI9X 4MWFB 4MXQA 3UEZA 1IQWH 3KPOB 3REWB 3TJHC 1HEZA 1T7WA 4HMDA 2HJFB 3VFSA 1Q8MA 2HKFL 4QGTA 3QJHA 3VGFA 1G6RL 4BH8B 5F9AC 1M4KA 4KZDL 2VZOA 3IJSA 1NBQA 1SMOA 1F4WH 3NACH 5IQ7H 3I50H 1YC8A 2IMMA 4G6KL 5EUOF 1JNJA 2GYSA 1BLNA 2HT4C 3KPLB 3M8OL 2IADB 4MQTB 4MD4B 4LPWA 2IPKA 1N5YL 4OT1H 4YK4C 3VXSE 2CDFA 2KZ1B 4EOWL 4QTHB 3P0VH 4G80A 1TZGL 3ARFD 1ZGLB 5DMKA 3IXTA 2GITB 4JR9H 5FUCC 1BFVH 2DIAA 1MCEA 1CE6A 2GEEA 3H3BC 4DCQB 3QCVH 1K2DB 3CDCA 4RQQA 3Q5TA 2Z93B 5L2JB 1NANI 2YPLE 3D3VB 3HZMA 4UINH 3KLDA 2W9DH 5FYJU 3MCKB 4PLOB 4PRAA 5TDOB 4NPYB 1CS6A 4J4PD 4YPGB 4KK8D 2XTJB 2ESVD 4L8CA 2A74B 1I9RH 1KJVB 1XIWA 2ARJQ 3EO1A 3FQRB 1MCSA 2V7NA 4PV9A 1OGTB 2VDOH 1DR9A 2EC9U 3U0TB 5BS0A 2Q76B 3SO5A 5JOPE 4YBQC 4D0CA 3FT2B 3T2NL 4G6FB 4AEHL 1QA9A 3STZA 2EDQA 4C56D 4U6HA 4UAOC 1HNFA 1RZ8B 4KJPD 2YD3A 1EXUB 4NFCA 5DJ2B 5JMOC 1KCSH 4WO4B 3HKFA 3O4OB 4PJXF 2QQNL 3UMTA 4RFEB 3O6FC 4MMXC 1Y6NR 5I8CB 1CLOL 3EDFA 1JWSB 3RY5A 1OOAA 5F96L 3CFKB 4H0HB 4PRDB 3U7WL 1S3KH 5IF0A 1F58L 4Z7WF 5HPOA 2L7UA 4OZIB 3PABB 4UBDC 4BSWA 4L3CB 4RGND 5C07E 4KV5E 4D0DB 5J6GA 2CKBB 2H2SD 4X5WB 4OGXH 3LN5A 1HH9B 1AE6L 1C5CH 2BK8A 1W72H 5JDSB 1V3JA 1FP5A 3PWPE 4FXGB 4P0DA 4ZS7H 3VRIB 2R0WL 1L6ZA 3MFGB 2XWJB 1NL0L 1GOGA 4PDCE 2AABH 4P46B 3U9UB 3SE3C 3L95A 4ZODA 3MV01 5FYLD 3PQYB 4XNZB 5CGYC 3QUMH 1TPXB 2WZPD 4KRPD 4JLRA 2FEEI 2W60B 4S1QL 4JKKA 3OPZL 4WUUD 5D7JC 4MD0A 4X6DA 1JHTB 4PG9B 3VGAB 1V3LA 1UM4H 1UA6H 4HZLA 5DD6A 4QYOB 2K1MA 4TSAL 4C4KO 4YDLB 3WIHH 5IVOA 2DLIA 4PRHD 4IDJH 1NDMB 4PV8B 3UTTE 3HE7A 5IVXF 2BOBA 4U3XA 3FMGH 4I0PC 1XCQA 4NQCE 3OGCB 3BJLA 1BQHA 3FB6A 3IKKA 4URTB 4KVNH 1S7QA 4PBVC 1Y6KR 1R5WA 2BSRB 5DJ8B 3ROLA 3NFSH 5F93C 1LD9A 1KB5A 1JJUA 4RWHA 4CVXA 3GFUA 3FKUS 1N4XH 2ICEB 3GMQA 1N0XH 1ZHNB 3MOQA 3SDXA 3Q6FA 3E2HC 1MFBL 5IB1A 1ZKAA 4LK4A 4OBRA 4JFZL 1KT2A 4WIQA 1JTPA 3V5DA 1D9KA 1I7ZA 3MACH 2JTDA 4EZMA 4PP8C 4WHYH 3BRDA 1QBAA 2ATPB 3MBXH 3V7MA 1IMHC 3E1F1 4L4VB 4JKWA 4OI7A 3RUGE 1H0DB 2FX8H 4YO0B 1IC5L 4M1CD 5F8RC 5ILTL 5HPMA 4E42A 5HYSB 4YBLB 5IT2L 3BVNB 1YNLL 1WVZA 1ZVHA 5KG9A 5CWSB 2EIEA 3OKMA 4P4KA 4PBXA 1IQDB 1FH5H 1E6JH 3QUYC 3DSFH 2XKUA 3L3HA 3GMNB 3PV6B 5D96B 3O4LA 1E4WL 2D7TL 3G5VA 1XGQB 4GLRH 2DWEA 5D93B 5E2WH 4WW1B 4LEOB 2BP3A 4LVEA 3FCTA 3MRJB 2AI0H 3RAJH 3V9FA 1TVDA 4XVUC 3I85A 5D6DC 1KXVC 2VO5A 3JTTB 2QADC 3VWJC 4LSDA 3NFNA 4X7DC 5MEPB 1QQDA 4LASL 4ZAKB 1ORQA 1NBVL 4N0UE 5J0BA 1KJ2B 2R9HC 3MRHA 3NCFB 5BW7A 2GCYA 3QEHB 3TO4A 4J6RL 5INCB 1G7LA 1VSCA 1WUNT 4X4YB 1IGMH 2JJSA 4QXGL 4XH2A 3FO2B 4L3EB 1LP9F 5HVGB 4UV4L 3CZJA 3RWCB 3BGAA 3VI4E 1MIML 2VISA 5DJDB 2MCPH 3WD5H 3TZVA 5F89B 3OKOB 3CLFL 5C0EB 2JJVA 3PIQB 3TFKD 4AEFA 4ZXBB 1ZT7A 3LPGA 1PZ5B 1ZVSB 4XNYH 2E7LE 3K81A 4K07A 4J3WA 1ZSDB 2X4UA 2XA8H 4R26H 5AZEL 1MUJB 3H8NA 4TOYH 1R3KA 5EZIH 1NEUA 5ERWB 4NQSA 1OTTD 5TQ2L 1G9MH 5LKNA 4RAVB 5HYJE 3DV4A 3GJFK 2C1OB 3WIFA 4FZEH 4UT9L 4IRZH 3X14B 3CDFA 3VFTA 1MCWM 1X6LA 1E4KA 4KTYA 1P84K 2BJMH 4HJJL 5JHDB 1U42A 4LKXB 4RIRA 3QEQB 5F7HA 2PXYA 1K8IB 5ENWB 4CJ0A 1MFAH 2DQTH 5D2LA 3REVA 2I24N 2NY2C 1MHCA 2QR0A 3G5ZB 1AD0A 5E2VH 3WLWC 1FRGH 4XCCH 4QRPE 5SWSE 1YEGL 1Z6JT 5HHNA 4PJBF 4KMLB 5CEXA 4HC1A 3TA3B 5DD3L 1I8KA 1CIDA 5GQBA 1YEFH 2VL5A 4X6FB 5IHUL 1JN6B 4PP1C 5I1DA 2VDLL 4MXWH 1FL3B 1KFAL 3G5YA 3SE8H 2LAGB 2VLJE 2AV7A 3EOAA 4Y4FA 3PL6D 1TTFA 1UKSA 3GHBH 1U8PB 1YMMB 4YIQB 1AKJB 3C09C 1A6WH 1DBAH 4EN3C 4U1KA 4X7TA 1IJ9A 4JGJA 3I6LD 3TIEA 1AP2A 2XWTB 5DK2A 5IOPA 5JA9A 2YMXL 4LSQL 4WFHD 4OF5A 5AD0A 4LNRA 1KCUH 2FIKB 4OD2B 1VFAA 3D87B 2LABA 3DMMA 4K23L 3CXHK 1XGPB 3QCUL 1IAIL 1T1XB 2R4RH 1J8HB 5SV4A 4Z95H 3RNQA 1R24B 1N0LA 4NHCL 3VFWA 4EIZC 1A7RL 2CK0L 1ZHKA 3VGDA 4ZFZB 4TNWF 5C2UB 3TF7C 3NIDE 4C4KT 2UVFA 4PR5B 4MAYD 4HKJA 5J89A 4PJCF 3U7AA 3VCLA 3HA0A 2Q1EA 1S78D 1UCBL 1GGYA 1I1YB 4RFOL 1DDHB 1VPOH 2DKSA 1ZLVH 1P7KB 2QHRH 1F4HA 3UAJD 2OK0H 1WC7A 2DJ4A 4TVPH 1CR9H 4H0GA 4XMKL 5E7FA 3V52H 5MHSD 1VENA 4KI1A 1QBBA 4YDIL 3RA7H 5DHVA 3GHEH 1HXYA 1JZ2A 3TBYB 4D9RD 5IW1A 4JN1L 3RNKB 1M7DB 1JRHL 3TJHD 1RK0B 4WW2A 2RB8A 3ZDZE 4KWUA 1BVLB 3WS6A 5H94A 1NUNB 1QFPA 5J4MA 2Z91A 1NGZA 1KLGA 2OR8A 3OKLB 1Y0LB 4FXLA 3WO4C 3UTQB 2HT4D 3CFEB 5F7KC 1S7SB 3CSPA 2X4QB 3QXTA 4UQ2A 4KGLA 1FAIH 3HRPA 5C0BE 1XZ0A 5GRVK 4ZFFA 3FRUA 3PWVA 3HAEG 4L9LB 1OTSD 1WJ3A 2YZ1A 4WTWA 1GVIA 1VACB 1AGEB 1HXMA 2Z92A 4G8FB 3TPUA 2A9NH 2CDEA 4C59B 1LILA 1ORSA 4XZUB 5I19L 3QAZC 3D85D 3T0EB 3VGBA 1TMCA 5HYIA 1BVKB 3SE9L 1RIHH 2IH1A 2COQA 2QSTA 3QZWA 4MLIA 4DGIH 1YJDC 2Q8AL 5FIEA 5KTEL 4NM4L 4NYLA 1ETZB 3B8YA 4NOBA 3WO3B 3B9KC 5AWNL 3ORJA 5DJXB 3SCMA 3KPQA 1KACB 3UO1L 4LHUA 5EIQA 2X1OA 3SO3C 1J5OH 4YBQD 4BFIB 2IAND 4J1UB 5BVPL 5IB2B 4WU7B 4V1DA 3VFSB 1JUFB 5HHOA 3QJHB 4FG6D 5CZVH 3CC5B 3BWAA 4U6YB 2B4CC 4XBPA 2FX7L 1MRCL 5I71C 3LEXA 1K6QL 3RGHA 4OCXL 2P7TA 4ZO7A 3O2VH 4K3EL 5K9OA 2R1WB 2HFFB 1CIUA 3L1OH 4XPAH 1E4XL 4HGWA 3O6FD 2RCSH 3VFPB 1FQ9C 3E6FB 5E4EC 5DYOA 1MLBB 1U3ZA 3AMKA 4LU5L 5JW3H 2DIJA 2RIKA 5K9JL 1J0IA 4N90D 2V2TA 3IXTB 2D9CA 5HGGS 2Z31C 4KKBC 1AXIB 3VXRE 1KIPB 2C26A 5I8OH 3B6SB 5JNYA 2FATH 2OCFD 3NCYS 3X13A 4PJ7B 5DURB 4PRAB 4XMPH 3EGSA 1VKXA 5EG6C 5FCUL 3PWLB 4NNYB 3HRZA 4HKZB 4AEIL 2CUMA 1UVQA 1U8MA 1CE1H 2BFVH 1XIWB 4ZS6C 4JRXE 1FNFA 1KLUB 3INUL 5HGBB 3F7RA 2V7NB 3TNNA 4CRPA 3A6BL 3T4AA 4PJFA 5DA0B 4HS3A 1JF6A 4R7DB 5CGYD 3U7YL 2DYPD 5JUEH 5CSBA 3F65A 4PREB 4D0CB 1T04B 1X9QA 4PD4J 2C3VA 3VXUD 1F11A 3MJ6A 1MCFA 3RTQA 3CUPA 4A2LA 1VERA 5D7JD 1RZKL 4JY6B 1RZIB 2BSSA 4U6HB 1ES0B 1FVEB 1NBZA 1WEJH 1IBGH 2AV1A 2OP4L 2ICWA 4GRLB 4OKDA 3QUZC 3VXME 4HCRH 5J1AA 4MJIB 1X5KA 1F6FB 5HTSA 1LO0L 5HHXH 1CDGA 4HXBL 2YEZA 4I18C 4F37K 5I17B 4Y19D 4XPBH 4HBQA 4O4YL 5DF0A 3SEPA 3HNSH 1PYWA 2GK2A 5I1GH 2DQDL 3LN5B 3GIZH 3MXVL 1FG2B 2XN9A 1J05A 3MTRA 2EDBA 2J88L 3MNWA 4KTDL 4Y2DA 4KQ4L 1JWUA 4AYFA 2NY0D 4G7VH 4OFIA 2NXZC 2BDNL 1RURL 3SGKA 2NX5E 1CVRA 1PKQA 3MOBL 1TNMA 2C3HA 4CMHB 2HP4A 3L95B 3OXSA 3WFCL 4MXVF 4LCCC 1YNTA 2AKRA 2AJZA 1TJIL 2B20A 2ZCHL 4HIJB 3VDCA 4NZDA 1JNNH 1N64L 1OLLA 4YXLL 3AS2A 5CP3H 5ESVB 1G1CA 5MERA 3OKNB 2VSDA 2IPTL 3RPIB 3T08A 4AT6B 3QUYD 3QJFB 1UZ8A 2OR7A 3LV3B 1ZEAH 3N9GL 2YOCA 2EH8L 4OZGF 1J86A 4QOKE 5DC0A 4PJHE 3IDXH 3RY6A 4QHNA 2FO4B 1F6AA 1AXSB 4XBGA 4OZHF 4NZUH 5F88A 4YHZL 1FFNA 3SDDB 3VXSB 4FA8A 2QADD 1H9VA 3IJHA 5E8DL 3VWJD 3KYOB 1EO8H 4C55A 1R5WB 1MNUL 1RJYA 4FQPA 1B2WL 4YDKH 3GSWA 1AIFA 1XGYH 2R9HD 4M1DL 2R2EA 2H6PA 3ARSA 2ZZUT 2UUDH 4NKIH 4OGAC 4OUUA 5C08E 2YPLB 4Q9RH 1Q9WA 5BV7B 5L9DH 3QISA 1PLGL 2BNUA 2Z8VC 2OJZH 1AO7D 1ZHLB 4U1GB 1IGIL 2YUZA 3QPXL 5DD1H 1AFVH 3AS1A 2AEPL 5HGHB 2EO1A 2WUBL 1DN2A 4J12A 1G7IA 3TYFA 1LO4H 3MUZ1 3HS0B 3S96A 1B9ZA 3LKRA 3EJZC 3FT3B 1NC2B 2CLZB 3V6ZA 3DECA 4MNGB 3FB7A 4DZ8B 5IP4A 3L5JA 4P4RB 3SBWA 4K7PX 3DVFA 5EU6D 4P4KB 4MNQD 3QDJE 1GGTA 4L4TA 1FNGA 3L3HB 1KXTB 3O4LB 3G5VB 4LEXL 3MLUH 2CIKA 3V79C 1XGUB 3MRPA 5HVFB 4F7EA 5L0QC 2VLRA 5ID1B 1MREH 4JFOB 4GBXA 2NY2D 5IJKC 1DVFA 3F7QA 5JPMB 1PFCA 3GSNH 5C1MB 3L3KA 5DI8B 1QQDB 1B4JH 1PX3A 3VG0L 4PRIB 5EC2B 3MA9H 2P24A 3F5WB 3MLRH 3QIWA 5C0FA 5C0JB 3K7UA 3T0BA 5IGXL 3CPLB 2ZPKL 3MYJA 4PP1D 4UIKL 3L3GB 2E5EA 4XH2B 5C07B 4PJIE 4M1GH 4BA8A 4B7LA 5DJYA 3D69B 2DQIH 1QBLH 4OJFH 1V3MA 3L7EA 3OKYA 1WBZA 3VG9B 4MX7B 3VXTB 2VISB 1MHEB 1JZ4A 4HFUL 4M6OL 1GAFH 4HWBH 5E08L 5FV1L 4EN3D 3S3PA 1KTLB 2X4UB 1WF5A 4K94C 4DEPC 4M7ZC 1R3KB 2R0LH 4UILH 2Z4QB 5T3XE 5EUOA 4OB5H 3HAEB 3CJJA 3NABH 1A14H 3KHQA 1F4XH 2DQJH 4NQVA 3IS1X 3DV4B 4PJAE 4GJTB 2JJWA 5CIPA 4P2QB 3SDAC 4DW2H 4PGDB 1WIPA 1L8JA 4X4XB 1J11A 4GSDH 3VFTB 2EH7L 3RDTC 4RAHA 3BISA 4KJWC 5JZ7C 4JQXA 1ACYH 1AXTL 5E99L 3S3JA 5EN2A 4R8WL 2WNGA 2AK4E 4OM1L 2LE9A 4G42A 5CILL 3VGHA 1AD0B 5FGRA 2HN7B 1EFXB 3UTTB 3QUXA 1T89A 4F2MB 1A2YA 2X7LA 5HHNB 2R29L 4JY4A 4O5LL 5CEXB 2AJYH 4NQCB 4IOIA 3U30B 1WAAE 2O93L 4RA0C 3V7AE 2XNAB 3KLAB 2MTPA 5TE6L 5AYQA 3GK8L 3NZ8B 1GJIA 3IXAB 5LAXB 2XTLA 4MB4A 4BH7A 4NQDB 1NCAH 3D2UA 3FO9A 3N1QC 3ZDYE 1RHHB 5T1LD 4LLVA 4JPVH 2FR4A 1UM5H 4BZYA 4LRNL 3SY0B 3STLB 5DDHB 4Y1AB 2EXYD 3UJIH 4QY8A 1KB9K 4P2OC 3HE6C 5BZWA 2F54D 2VTFA 5AD0B 4JFPB 1N7MH 2R4SH 2FH8A 1U8QB 2NY5L 2VAJA 3ZSTA 3G6DH 4NRZA 2WUCL 3O45A 3EFDL 4NO5A 4F58H 3G6AA 1JRHI 1ZA6A 4Z7WA 43C9A 4UDTB 1QBMH 1A47A 3MV7A 3O3EB 3T09A 1YEEL 3DIFA 1P4BH 4GAGH 4H5SA 5HHMD 2OJEA 4X4ME 1CGVA 1S7WA 3G08B 1HQRA 3BP7A 3QNYA 3MRMA 3KS0J 5DC4B 4YDVA 2CDGA 1BZ9A 4UNUA 2DQCL 4TSCL 5KANG 4XNUL 2FGZA 4GXVH 4LCYA 5GGQH 4NCC2 2HVJB 2ITCA 4F3FB 1NBYA 3PGFL 1U93A 4BSJA 1CFQA 3RZCA 3C5ZC 3X3FH 2EIBA 3M45A 2XQYK 2G5RA 3BEVB 5EOQH 1F02I 1LEIA 1WGOA 3V6OA 1AY1H 4NGHH 1WC7B 1QEWA 2HFEB 3GSNB 1H5BA 2NTFB 5A2LH 3HC4H 1UC6A 2F53A 3B9KD 3E0GA 3K0WA 4MDIA 4OZ4A 1A3LH 3EIFA 4AL8L 3BKCH 5BVJB 4WY7L 1CDHA 4M7LL 5D70L 3KDMA 4LFHG 4NM8H 5E2UL 4GKZB 5GS1B 4KU1A 4AH2A 3PHSA 4YE4L 1FFPA 1GGBH 4WW2B 5HXMA 4K3JH 3O3DA 2OZ4H 4ETQA 4G9FD 5CGMA 4CDHA 4J7RA 5CBEA 1NC4B 5KN5B 7CGTA 2G9HB 1U3HC 5JQ6L 1RZ7L 5IVXA 4CU8A 4I77L 4WI3A 1MCIA 1NFDE 3BUTA 1QSFE 4W68A 4S0UC 2EZ0D 1AGFA 4O2EA 5D72H 5IMKB 1P7HL 3B8SA 5FUOH 2P5WD 3GBML 4D8PA 3VJ6B 3QI9D 1DE4B 2PYED 5TFSL 1GIGH 4Z7QF 3OKEA 4MVBC 4NDMB 2Z31D 1EJOH 1FVDA 5ITBL 4KKBD 1K3IA 1A1OB 1JPFA 1BM3L 1GC1H 2VXUH 1FE8H 3WSQL 4YFEA 4GMSL 4NP4H 2IBBA 4ORZC 4XP9H 3CXDH 3SE4A 5DRWB 1BGXL 3KJ4C 3HLAB 3MXWL 5C0NC 4N8CH 1FNEA 1KCVH 4KDTA 2BNQA 4M6MH 1QRNB 4JVPA 1F8TH 1U8IA 3H9SA 4KMQA 1RMFH 3CVHH 4EQ3A 3SCMB 1A9EA 4KRNA 4OAWA 9CGTA 3KPQB 2MPAH 2WBJA 3WKMH 4DKDC 1IQWL 3MNVB 2XRAH 3NIFF 2R1YB 2LTQC 2R8SH 2LU4A 4KKAC 3MLZH 4KPHH 3RWIB 5HHOB 2H3NB 3WXWH 1F4WL 2BNRA 4MHHI 3QUZD 3EO9H 5BS0E 3BT2H 3BPOC 5D7KD 4RMWA 1P5UA 4UNTA 2FJFB 3TC9A 1HYRC 5A43C 4HEME 4XNXH 4D9LH 4GUPB 1PX4A 4Z7VF 4OT1L 4HXAH 2FWOA 4KK9C 4JDZA 3VU2A 3GUTA 4FFYH 1IT9H 3P0VL 4R7NB 3RVTC 3B9DA 3RX7A 5J13B 4FFEX 3ARVA 4JR9L 1BFVL 5C8JA 5C86A 5GS2H 5A1AA 4UU9B 3QCVL 1G84A 1QP1A 2WWMC 2B5IC 4RGMB 4UINL 2W9DL 2OR9H 5GGSA 4IOFC 4AM0B 1YMHA 1LP9A 4NO0D 4S2SA 3FN3A 2XI9A 1SJXA 4GKSB 4MB5A 1I9RL 2YA2A 1U41A 4ZYKB 5BJTA 4CKVX 1JPGA 3MODH 4P9MH 2VDOL 4HUXA 1BMGA 1WZ1H 5EO0B 2VRAA 3QWOA 2X4RB 5C6TH 5DFVC 1KSRA 2VZSA 4UQ3B 4BUGA 2CQVA 4OF0A 1OTUC 4L8SC 3WUWA 2AV1B 5ICXA 1IEBA 5JOPD 2ICWB 3DHJA 1KCSL 3MNZB 3DROB 4UT6H 4PJ8A 3JZ7A 4F37F 5CZXC 1SJEB 5TPWL 3AS3A 4K7PY 3WL9A 4X6DE 1S3KL 1ONQB 3ARXA 4U6XB 1PG7H 1NUDA 3AROA 4PJBA 2VKXA 4Y4KB 3ULVE 4CW1B 1U9KA 1PYWB 1JGVH 3U4EB 4OGXL 1C5CL 1UZ6F 4WO4C 5C0BB 1W72L 2VZ3A 5E94B 1YECH 3FAWA 4JO3L 3MNWB 4LP4A 5HD8C 3BIKA 1JF1B 5DUPH 4ZS7L 1EHXA 4NT6B 1UJTA 4M93C 4OGAD 2PR4H 3WLBA 4JM2F 4ODUB 1GZQB 3F7VB 4M3KB 5AYUH 4OFDA 3PWPD 1G7HA 1MCDA 2MOVA 3V0AC 2YUWA 3NPSB 4NNXB 1DEDA 4APQD 1DFBH 1A7BA 1XFPA 3OL2A 3I3EA 1U6AH 3LB6C 1UM4L 1UA6L 3EJZD 3CVHB 3MBEC 1G9NH 1NDGB 3T0VA 3TVMB 2AXGA 4ELKA 4NQXA 3WIHL 3WHE0 3V7AG 1IGJA 1CXLA 4JZNA 2L4OA 5F1SA 2H8PB 3CZFB 3D39D 4HIHB 4HJ0C 3VFRA 1HDMB 3FMGL 4XNZC 2VMFA 4LRIC 5DEFA 3HNVH 4BQ9A 5EU5A 4YC2C 3ZT5A 1G7MA 3PDDA 2X44D 1EBAA 1R3HA 4PJCA 1DJSA 1HZHH 4X98A 4KVNL 5EZLB 4O2FB 2JF1A 4JDVB 4JFHD 3NFSL 1RJYB 2N7BA 2H32A 3C8DA 4WHDA 5IEKA 4P3CL 5EH1A 1D5BB 1AIFB 3GSWB 1N4XL 1E4JA 2R2EB 5JORA 4GRWH 1N0XL 4E41A 3VXRB 4OUUB 1A1MA 5J06A 3MV9D 4IRJA 3H9YA 2OQJB 4JFEA 4H0IA 2K9UA 3QDAA 3V5KB 4D0BB 4Z76A 1FV1A 1C08B 3MACL 2BMKA 3FJTA 1M71A 3MBXL 5IBLC 1FFRA 3MGOA 4QXWA 1IAOA 2A6KA 2FX8L 3NFPA 4JRXB 3OXRA 3S96B 5BRZE 4JFQB 1MCPH 1HHGA 1P69B 2GJZA 1WWAX 2AEIT 3V6ZB 5JMRA 3T8XA 1FH5L 1E6JL 1T1YA 4PUBH 4Q9QH 3DSFL 3SDAD 5I6XC 4KJYA 3UTSA 1KELH 2C4XA 3FONB 5IVZA 4ONFH 2YS4A 5E2WL 3VXMB 2CXKA 2J5LB 1KC5L 5JZ7D 1K3ZA 5DRNA 2AI0L 3RAJL 5D7LA 3PHQA 4ZUUA 1CQYA 2D7OA 5FO9B 4H26A 3QR2A 2H9GB 5DGQA 5MEOA 1TQBC 4I1NB 1E27A 2P24B 1MAKA 1MFDH 5D2LE 1IGML 2W38A 5D96C 3QXWA 1X4YA 1MJ8H 1T66C 1TCRB 3MUY1 1S7XA 1NH6A 2GSIB 1JPSH 1MOEA 3UTPD 1JGEA 4UZGA 5BMFH 2MCPL 3WD5L 1QFWH 3M17A 3QCTH 3BPCB 3IU4H 2FO1A 4GKOA 5E6IC 1RSFA 4XNYL 5EO1A 2NX5B 2XA8L 4R26L 3K1KC 5T3XH 1VDGA 4ZAKC 3S7GA 5FF6A 3S36H 3H0TB 2PN5A 5EZIL 4GG6E 4KTEH 5F1NA 4YNYB 3HE6D 1OW0C 2P8LA 2VIRA 3UPRA 1UACH 1NGXA 4WCYH 1G9ML 4FQIH 4FZEL 4PIRF 1CICB 2GK0A 4C83A 4IRZL 1OAXH 1QFWM 4OIIH 4GOSA 5IFJB 2X4PA 5I1AA 4JZOA 1T5XA 2JB5H 2NPLX 1GOFA 2BJML 5HYJD 1MI5B 4ZXBC 3ZKXB 4X9FA 3LRHA 1JHLH 5FM5O 3VXOA 1MFAL 3QULB 2FH6A 2DQTL 4AG4H 3K2MC 4GW4A 5E2VL 1I1AC 2DAVA 5DC9B 4U1HA 1FRGL 3LS4H 4XCCL 3PWNA 4K8RH 4NO2A 4I0CC 4JY4B 2VLMD 4QOKB 3E8UH 4PJHB 3LZFH 3S35H 4IRSA 2C1PA 2NYYC 1YEFL 4N1EA 3C5ZD 4MXWL 2Q86A 1DUZA 3SE8L 4QRPD 3ZKMC 4OV5B 4OFKA 2L0DA 3B5TA 4Y0GA 2VQ1A 3JVGA 1AJ7H 4NRYA 3MROA 1CFSA 4PB0H 2GFBA 1P53A 3GHBL 4QXUH 4MQ7A 2FRGP 2PCPA 5B22A 3RKDC 2FR4B 1X5IA 1A6WL 4U6VH 3E6HB 1DBAL 2R0KH 3P2TA 5I0ZA 4U0RB 4U1JB 1X5YA 3QHZL 4N0CA 5EU4B 1BD2A 4QY8B 4LBEA 1KCUL 5L2KE 1OGAA 5C09D 1G0YR 1U3HD 5T5NF 2DQFA 4MA7H 5MP6H 2R4RL 4Z95L 4X8JB 4PLNC 4J23A 3SKMB 3QFDA 1I7UA 2X4OA 1G0XA 4EUPG 2WY3A 1JPTH 1HQRB 3KPRE 2FLRT 3QDJB 3SKNA 3IVKB 3OF6A 1BZ9B 2EIZB 4LSUH 4JQIH 3P30L 4N1CA 1ITBB 3IFNH 1TQCB 2OL3A 4U05A 1QSEE 5LGJA 4RNRA 1CD8A 4Y5VA 1VPOL 3GMOA 5FB8B 3V8OA 2F15A 2QHRL 4M7KH 4YHPA 1X7QA 2OK0L 2NY3C 1F5WA 5D1XC 5C0ND 1QYGH 4WTZG 3ALPA 4Y16A 5E9DE 4PJEF 4K8RC 4PGCA 5I66A 4NQEA 1QEWB 1CR9L 4TVPL 3V52L 4S11A 4JN2B 2GQHA 1UADC 4Q2ZA 4QRTB 3PF2A 1A9BB 4MDIB 5J12C 3RA7L 3GHEL 3MRBA 2V5YA 2IBZX 4PJIB 4P5MB 5CD3B 4OLUH 4OZFG 2OI9B 4HF5H 5I2IA 3CMOH 4GKNA 5LG1A 4BQ8A 5CBEB 3P4OB 4P23C 5K9KA 5HYQA 3RIFF 4I0PA 1FYTE 4MD5A 4OZGA 1NCUA 4NC1E 4JHWH 2HG5B 4BSVA 1AGFB 4OZHA 3VA6A 3QHTC 1FAIL 1MH5A 2UWEE 4TTDC 1N8ZB 3RBGA 1XF3A 4RMRA 3QDMA 5D7IF 1IKNA 3RVTD 4EEEA 3JV4A 2J7LA 2E8ZA 3ARGA 2ICES 1DQJB 2WWMD 4DGYH 2DDQH 4W4NA 3X3GH 2A9NL 1WCQA 5I1JH 4FQXB 1IM9D 2ZG2A 1G6RA 4IOFD 1GZPA 2Q6WB 2AK4B 2AK1H 2KPNA 4Z7UF 4ZMAT 3ARBB 5IEHA 1RIHL 4DGIL 4O00A 1TTGA 1JIBA 1L0YA 4OFPA 1C7SA 1U8IB 3G6JB 1F97A 3H9SB 3MRGA 3MR9A 3RIAK 2DI7A 1VFBA 4P9HC 2MQ3A 1A9EB 2EDJA 4PP2A 1UB6A 4N68A 1WICA 1J5OL 1RZJH 4PJ9A 3D0LB 3EW3B 1Z9MA 4JFFE 3CFBB 4ZTPH 1NAMH 1IL1B 3MGAA 3QFJE 4ESKA 5DFVD 3RU8H 1OTUD 4JRYB 4ACPA 5CZVL 2BHYA 3DETC 4Q6YA 3MA7A 3T0EC 3HCVA 1ZT1A 3HG1A 3UZVB 4NN6B 4PS4H 1JNHA 1PDKA 1ZANH 3O2VL 3O8XC 1O5DT 3L1OL 4XPAL 2QJDA 3GMPA 3AU1A 3KPNA 5HSFA 5CZXD 1WFTA 4Z5RA 3OKDA 3L9RA 3RVWC 2F8VA 3P4MA 4JDZB 5L8JB 4WFFE 5JW3L 3TM6A 4MXQC 4Z0XB 4HWUA 3VD9A 1INQA 4DVBA 2ZOKA 1MRFH 3WFHA 5DZNA 2ADGA 3MJGX 1UWGH 5I8OL 1KTDB 2FATL 2AXFA 1A7QH 5GGSB 3VXQA 4XMPL 1LK2A 1YMHB 2R2CA 5FK9B 5FDWA 5B3JE 3VRJA 1HHKA 5ESQB 1HN1A 1F90H 4EUPH 4HIEA 5ELIA 5E70A 2BFVL 5ANMB 3CSYA 5KW9H 1LNUA 3BESR 2XN9E 3V6FA 3MUGA 1YEKH 3IDGB 5GS0H 1YDPA 2NY4B 5JUEL 3D5OF 1I7TA 1CK0H 4Y5YB 1UEMA 4XCNA 4FTVE 3W9DB 3CX5J 1U92B 3JV6A 5CFHA 3G5XB 2F58H 1CDCA 1A3RH 1UXSA 5TH2B 5I30H 4QLRA 1WEJL 5KVEH 1IBGL 3V4UH 1ACZA 2KUTA 1RPQA 5ICXB 5CSZA 5FYKE 4HCRL 3MBED 4WTXA 3ECBB 3MO1A 3W9EA 4TNVF 1NCWH 1CGSH 1J9CT 1XIWC 5DO2C 5HHXL 1LO3H 2VE6A 5CGTA 1I8IB 3BW9A 5M7QA 2D0FA 4HJ0D 1UB5B 4OZFH 1T4KB 5GPRA 3ULVH 3RZWA 3U79A 3HC0B 3HNSL 3HPJA 1QSFB 4B0MM 4H20H 3VDBA 5I1GL 3GIZL 5IMMA 3U0PA 2DBLL 3HR5A 4JG1H 4ZSOB 2I9TB 3JTCA 2BVQA 5T1KA 2VN7A 1LO5A 3P0YH 4G7VL 5DK0A 4UOW0 3O81A 5KZCB 2PTUA 2QSVA 3BO8A 1FN4A 5FKPB 1XF5A 2NXYB 3MRKA 3WLBB 1CU4H 2HRPH 5I1LB 4OZIF 1FJ1B 3IB4A 3OAZH 4WUKH 4ZNEE 3OJMB 5KSBE 3ARWA 5C0AA 5IBLD 4CU6A 5DUMH 3AFLA 1JNNL 5KSAA 3O3BA 1OHQA 3BUYA 4ODVH 2JKXA 1YN7B 3BIAX 1AQDA 3SDCA 2AXGB 4YHNB 3BPLB 3ARDA 3OKKA 2YPVH 2W9LA 1KNOA 3H42H 1OWWA 2F74A 4CMHC 2W0FA 1NAMB 4IS6A 2PUQT 3VFRB 2PW1A 3R8QA 1U3YA 4ODTH 1A6ZA 3MCLH 3Q0HA 3V5HB 2ZUSA 3DX9A 3EJYC 3IDXL 2HJLA 3GGWA 3NZHH 1G7MB 1P2CB 4PJ5A 4ZPVA 4M3JA 2GJ6D 1KUMA 4LCWE 3NAAH 3GIVA 5IESL 4NZUL 4X98B 4OCMC 4AIZA 5DD5H 1EO8L 4X9HA 1F3JA 4TUJB 4YDKL 2UZIH 1XGYL 3FFCE 4TULH 1SM3H 5E5MB 4NKIL 3ULSB 3HE7C 1RK1B 1OPGH 4E41B 3UTZA 4Q9RL 2QEJA 1T66D 5L9DL 3VWKA 3RX5A 2D0GA 2OJZL 3OMZA 1FV1B 5FYJD 4GO6B 1NLBH 4NSKA 5DD1L 2BMKB 1AFVL 1F42A 3K4DA 5DJ6A 5E6ID 3QA3A 5C08D 2PO6A 1ZA3B 2YC1B 3L5WA 3MGOB 4WI4A 4ZAKD 1LO4L 1MJ7H 2NLJA 4PRBB 4LSPH 3FT4A 2D7PA 4JFDA 3RHWK 2NMSA 3B43A 1MIEH 5BV7C 4KJYB 4ODXA 3IDYC 2ZOLB 1D9KC 4U0QB 3WEXB 3MLUL 3P9LB 1T21A 3QO0A 4NJAH 4RGOH 5F7LB 1EHNA 2OXHA 1FZKA 1MREL 1R5IB 1HILB 3PHQB 1I1AD 3GSNL 2DLHA 1I85A 2KDGA 2M2DA 2XPGA 4H26B 4YHYB 1B4JL 2EDHA 1MCKA 3QXVA 4P4KC 3MA9L 2I9LB 3MLRL 4B7IA 1ZS8B 4L8DA 3VDAA 3BKMH 4OZFB 5EFIA 1G6VK 1DQLH 1TDQA 3QIUD 2X1PA 1AHWB 4M1GL 3E3QE 5DMIH 3I3DA 5EZJA 3SGDI 2DQIL 3B3IA 1QBLL 3TIDB 4OJFL 1S7UA 3LKNA 1Q94A 1GAFL 4HWBL 4ZQKA 2N4IA 3OAUH 5JO5A 3UPCA 4H1LG 5FF6B 1FCCA 3UYOD 2R0LL 3MRCA 1GGCH 4UILL 2QKIA 4OB5L 1PG7X 3CSGA 5BW7C 1XF2B 2IBZY 3TO4C 1IZKA 3NABL 4NHUE 1F4XL 3DO7A 2Z8RA 4HS6B 3JTSB 2JJSC 5HHPB 4K9EH 4Z7VA 4LGRB 4DW2L 3TCLB 4P3DA 4AMKH 1G1YA 4GSDL 1VEOA 3QH3A 2VUOA 4JHAH 2P47B 4PJXE 1K8DA 1HHIB 1P4LA 4O58H 2DLGA 2J12B 5IV2A 1HIMH 4R9HA 1G7QB 2A0LC 3KPTA 4ZUVA 2X4NB 4U1HB 2VDML 3P0GB 3P11H 3QXDA 2H26B 1PZUB 1FL5A 3AMLA 2AJYL 4MA1C 5FDYA 4XVJH 4IRSB 1N5AB 2ZUWA 1J8HD 2WIIB 1INEH 1E4KC 4OLEA 5AG8A 2NY3D 5D1XD 4X4ZA 3L7FA 2PXYC 3K8KA 4K8RD 3QYCA 2ESVE 3S4SG 3WMSA 1OP9A 2NY6B 1NCAL 2BY1A 4LVOB 1NFKA 5T1DH 1LHZA 4JPVL 2VH5H 2FLBT 1UM5L 3BAEH 1LVEA 3BXNB 1I8LA 4MLSA 1BFOA 1NAKH 2XFXA 3UJIL 1W0WB 3ME0A 2MCG1 3U30C 2VLLA 25C8H 2Q20A 5GSRA 3T4YB 5C0CE 5F1KC 1J87A 1N7ML 5F3HB 2R4SL 4C56E 4P23D 3G6DL 5D6CA 4F58L 1JFQH 4Y4FC 4F7TA 1B4RA 1QBML 5DD0L 3LN9A 5BRZB 5D1ZA 2OX5A 4Q9CA 3O3AB 3ES6A 1P4BL 4GAGL 4F7PA 3R06A 1UQSA 1I7UB 2X4OB 4YHIB 4ZUTA 2FNBA 4M6NH 4TTDD 1QTYT 4K7FA 5IVXE 2UUDK 4DOHE 1QHPA 4GXVL 4U2ZA 5GGQL 3EYUH 4NFBA 2FZ3B 4RGNE 4QRRD 3DMMC 5SX4I 2P4AB 4V2CB 4ZO9A 3KLSA 5FOJA 2FJHB 3H7BB 5LGJB 4HD9A 4Y5VB 3X3FL 1ADQH 2CO6B 1RUPH 1G7JB 4MYWB 5ESAA 4YHPB 4JM2A 3W39B 5EOQL 5HYEA 1RZFH 2APTA 1AY1L 4NGHL 5KAQG 1QLRB 4MSWA 5KS9E 5EB9A 4Y16B 2IAMA 4E5XB 3WFEH 4NQEB 5IIEA 3HC4L 3QPQC 1A3LL 2FJGA 1XGTB 4HUNB 3BKCL 3MRBB 3TBWA 4GFTB 5FYLE 4NM8L 4OLXH 5DEGA 5D1QA 1GGBL 4K3JL 2OZ4L 2P8PA 3FOLA 5F7DB 5I2IB 4WUUE 4F9PA 3EYOA 1P9MA 3DETD 3ZTNH 3GSRA 5HYQB 3ABZA 4IBLT 5INDA 4MD5B 4JJHA 4HKXA 3O8XD 4OLWH 1HWHB 5FOBB 4GG6B 4HUVB 4TPRH 1KPRA 2GTWA 3FFDB 1UH4A 3RVWD 5D72L 4MJ5A 4H1LH 1CYGA 5FUOL 2Y5TA 4MXQD 1UWEH 1AD9B 4WW2C 1R3JA 3JV4B 1GIGL 1S7VB 3WS6C 3C6LA 4KC3B 4EDXA 1GC1L 2I07A 3DBXA 2VXUL 1FE8L 2X05A 5EU7E 4NP4L 3LKQA 3H9ZA 4N5UA 4XP9L 3CXDL 3S36X 3RIAF 4CL7A 1XF4A 3IFPB 1T20B 1KCVL 4M6ML 1AR2A 1F8TL 4HLZG 5KJRH 1RMFL 3CVHL 1DLFH 1VFBB 2BHZA 4RRPA 3KGRA 1I8MA 4LLWA 2MPAL 3X12A 3S5LG 3WKML 2PYFB 1TJGH 3TN0B 1FG9C 2F19H 2XRAL 3U36B 4G8GE 1JV5A 2R8SL 1OD7A 3MLZL 4KPHL 4AY0A 1ND0B 1KBGH 4X0KA 4WWKB 3HCVB 3WXWL 2Y72A 3AGVA 1JNHB 3EO9L 2YBRB 3BT2L 3GMMA 2BOCA 2ZCLH 1KULA 3R0MA 1QACA 3C60A 4Q9BA 1BECA 4XNXL 1XIWD 1NCDH 3GMPB 5DO2D 3C2SA 3KPNB 3SCMC 3QDGA 1URLA 4NKDB 3S35X 1PQZA 4HXAL 3L9RB 1RULH 5L2KB 1NCBH 3P4MB 3PWUA 4FFYL 1IT9L 5MENA 5BS0D 2AEQH 4BZ1H 2YD1A 1KPUB 2YKLH 4DVBB 1IC7H 1FNLA 4I5BB 3WFHB 5E2TH 4W6YB 1GGUA 1K4CA 2C3GA 2EYSA 3OAYH 2OR9L 2Q7YA 3KPRB 1Q9LA 1JFMA 3SPVB 5IBTH 2ZUQB 1HHKB 4QWWC 8CGTA 3GSQA 1F6LL 2ADFH 4HIEB 5JLZB 1U8HB 5J13C 3W2DL 4J8RA 4QRQA 1LNUB 3WS3B 3MODL 4P9ML 5CMAB 1T6WA 1WZ1L 3O9WA 3GJFB 3C9NB 2UVEA 1DP0A 1EPFA 4RGMC 3LIZH 5E9DB 5C6TL 4PJ7F 4LQFH 3GSUA 1H8SA 4HUWB 4N8VA 3MRNA 2JELH 1UXSB 2YPKB 1UJ3B 5FYKH 3OJDB 5CD5C 5JIHA 4ISVA 3Q5YA 3EKCA 3QQ4B 2O61B 5EPMA 5GS0D 3RDTA 4UT6L 3W0WA 3PV7A 1P7QA 5C71A 2MQ0A 4Z7NF 5CJ8A 1OLZA 3CCHA 2D0HA 2DD8H 2VE6B 3TBSA 3ULUC 4GW5A 3KG5A 2JK5A 3WE6B 2A77H 2VZTA 5DGRA 1PG7L 4KKNA 3BPNC 5F9JB 1FYTB 4H8WC 5E8NB 2RFXA 1YEHH 3RTQC 5TDNA 5LJYH 4EI5B 4KI5C 4PRHA 4Z9KB 2BHUA 1E6OL 1JGVL 5IM7B 1IGYA 3QEUA 1FNSH 3SJVA 4QF1A 2UWEB 3HR5B 4WJ5B 1YECL 1L7IH 4H1LB 2B1AH 1RIUH 1KG0B 1LO5B 2Y1VA 4PJCE 5DUPL 4ONHB 5C2BH 4Z77A 2P42B 3HE7D 4JZJB 2YWYA 2VXTH 1XF5B 4H25A 4AQ1B 2W1NA 5F1IA 1LE9A 4AENA 5AYUL 1B0GA 4LF3A 4P2OA 2Q7NA 2F9BT 1I3VA 1JP5A 3C5JA 4HHAB 1BOGA 1T1ZB 3GI8H 5J6HA 1DFBL 2FL5A 3MJ7B 3I6LE 3DRQA 4FQ2H 1U6AL 4R96A 3TNMA 4Y2DC 1CI5A 2UZXB 5JW4Q 5B39G 3RWFA 3DV6A 1JYNA 3SDCB 1G9NL 1KCRH 4P49A 4HLZH 2Q3ZA 3SGKC 4JFFB 4JPWH 4OCWH 3C2AH 1KNOB 1C16A 1F3RB 3KPSA 1D9KD 3ZKQD 4QCIB 5JW5B 3HNVL 1D7FA 5F7UA 2DOCA 3DX9B 4AIXA 2ZUYA 3LQAC 2ATKA 1KJMB 2QL1A 1LDPH 3S4SB 1HZHL 3QIBA 3T0XA 5CHNA 3FQXB 4OI9A 3IJYA 1F13A 5F7YC 5TJWK 5KSUB 1C7TA 4AIZB 3LRSB 4JY5H 4I3GA 3ARUA 3TVMC 4WEBH 3N85H 2A73A 2HFGH 1UFUA 5DR5H 4MCZA 5K9QG 3GI9L 5JW4N 3BQUB 3GSXB 4PJEA 4XAWH 3EZ8A 2FHFA 1L6XA 4TRPH 4P5TA 5D7LE 3I02B 3MUJA 4HFWA 4DKEH 5EC1A 4HMCA 4P2RA 5I75B 3VWKB 3RY6C 4PGEA 2BCKB 1FPTH 1H15A 4IIQA 3O11A 3MPCA 4L29B 5DJ6B 4LVNB 2PO6B 1OB1B 5CBAA 5IBUG 4D9RE 1RJLA 5J1SC 4NN5B 3RHWF 4MCYA 1MCPL 4DN3H 3QQ3B 3TBVB 4G8EB 3LY6A 5GGTH 4G43A 3TO4D 2EDOA 3B2VH 4ZFGH 3BGFB 1MHHA 2DJSA 3L3DB 1FDLH 4FTVB 4PUBL 4LDLB 4Q9QL 1MCNA 3EYVB 1KELL 5D7IA 4ONFL 5TDPB 3IU3B 3EDEA 3TZVD 1ZXQA 3L3JA 3FQTA 4EQ2A 1YYMH 1WK0A 4KY1H 4IMKA 3I2CL 3QO0B 4NKMB 4OIAA 2FIRT 4LKCA 2C7UA 3BZFA 43CAB 3NMEA 2A0LD 4LSTH 1AGDB 1YN6B 4Z7UA 1D3CA 5FUCE 3RGVA 1KTKE 5DUBA 3SBWC 2FD6H 3CFCL 3ARYA 1OAQH 5ISZB 1CGYA 1MFDL 3AAZA 1VGEH 2DM7A 4NWTH 4NOFA 4WGVB 4POUB 4ODHH 1MJ8L 3MV8A 3QNZA 3B3IB 5EOTA 1JPSL 4FQHB 2PXYD 5BMFL 1QFWL 2MMXA 3IU4L 4YAQB 1DVFC 4EDWH 1BJ1H 3CFDA 3V4VH 5T3XL 4RMSA 4GAJH 3S36L 4LLYB 5IKCB 4KTEL 2VLKA 3CU7A 3QIWC 5IW3A 1CL7H 3DYOA 2IANE 4WCYL 4KV5F 4GRMB 3VFGH 4FQIL 3L3IB 3PWJB 5KSBB 4HH9A 2RHEA 3ZSSA 1OAXL 4MWFA 5EOCH 1HH6B 2OTWB 3KPOA 4OIIL 4Y4FD 1OAZL 2JB5L 2HJFA 4POZC 3KVQA 3QWRA 1OF2B 4BH8A 1JHLL 1V05A 4R2GB 4AG4L 2VDPH 5IV2B 5GSVB 5I1IH 3Q3GB 2A1WL 4CADA 1J1OH