3BP7A

The high resolution crystal structure of hla-b*2709 in complex with a cathepsin a signal sequence peptide, pcata
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQHAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B-27 alpha chain
publication title Structural basis for T cell alloreactivity among three HLA-B14 and HLA-B27 antigens
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 81
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2007-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bp7A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3bp7A01
4KI5C 4WI3A 2HT4D 5ENWA 4YEFA 5MEQA 5C0AA 1AGCA 5GISH 1CT8B 2QBWA 4PTUB 1FCCA 3TO2A 3VH8G 4E41B 1J12A 4LSPH 4MAUH 1IVLA 2HRPH 5T3XH 3VFMA 3VD5A 3SKNA 4JPKH 5SWSD 4OIIL 1IC1A 3WDJA 1Q0YL 3THMH 4G7YH 3RVUC 1H3WM 4PJBE 1I1YA 3ARBB 3A6OA 3V4UL 4HIIB 4L5FH 2NZIA 4I3SL 3TT3H 3OF6A 3MACH 3ZYJA 1IFHL 3S36H 4R97B 2VLRA 2ITDB 1JHTA 3LKOB 5BRZD 1QR4A 2Y25A 1T22B 2YK1H 3P0VH 5DDHB 3EYFB 3CSBA 3IDJA 4X5LA 5DEGB 5C0RL 1DVFA 2JCCB 2HTKD 4LBEB 4X9IA 5BS0D 1DANT 5TDPB 3AREA 4X7EC 1I8LA 5CSGA 2ENYA 1WGOA 4Y19B 4IRJC 4FNLH 2CDFA 3G6DL 1XGUB 2PCPB 3FB8A 4UU9A 2NX5E 4QYOA 3T8XB 3CLEL 3TJHD 3ARYA 4JFFE 1C08B 4OI8A 1NGYB 1L9MA 3GMOB 1CI5A 1KJVB 1FO0A 2B2XL 4Z78A 2VISA 4MYWB 3KJ4B 4O2CA 5FO7B 4HEPG 3ARFC 4PG9A 3WFBL 3GM0A 4XCYA 1MFBL 3P9LA 5F9JA 4YHPB 5LWYL 1A22B 4JQVC 4ZFOA 4MJIB 3GSWB 3TESA 4R97C 1URLA 1H5BB 1TMCB 2JIXA 4WUKH 1K5NB 4EIGB 2VIRA 4OIAA 3P73B 3K7UA 1B6UA 2H2PD 1MY5A 1F11A 4YX2L 2XFXB 3E6HB 4KKBC 4J12A 3IT8D 3DHMA 3QFJE 1QSEE 4WI7A 4YIQB 1ZS8A 1X5ZA 3U30B 4Y1AD 2HLAB 3SJVD 3DIFA 4OZGB 1I9RL 1BQHB 5CINH 1DP0A 4I9WD 5KG9A 1IAOB 4MD5B 4BZYA 4MXQA 3RDTB 1E4XI 5TDNB 3VFNA 3S35L 5ISZB 1UZ8A 4WW2F 1BF8A 1QA9B 3LV3A 1OSZA 1YNKH 2MWCA 3B4NA 4PD4K 1B4JL 1DR9A 4OLZH 1BM3L 4OLEA 3GSNL 3VMOA 1XGTB 3QT2A 3WHE0 1FYTB 1PKQB 4GRWF 3HMWL 5AZ2L 5FOBB 2YMXH 4YUEH 5D2LF 3RQ3A 3CMGA 1CFNA 3P11H 2OK0H 4HH9A 1U36A 4GQ9H 4P5TD 1QBMH 3MOBL 2CRZA 5TQ0H 3KVQA 3UPAA 3E3QE 3KPNA 3VWJD 5CFHA 4OZIE 2HT2D 4PJ8D 2X70A 5ETUA 2B0SL 4JPVL 2D7TL 5I1JL 4P59H 1OGAE 4JG0H 5I1CL 4UIKL 3LKQB 2WQRA 4ZG1A 1BX2A 1ZOXA 1K8DB 1IEAA 1I3GL 3TF7A 2CIIB 1HHJB 1FORL 3N1QC 2OI9A 1NMBL 3QBTB 3KJ6H 4NQVA 4EI5C 2VLKA 1JGLL 2PYEA 4LLUA 1WITA 4X4ZA 1KPUA 4BSWA 3RDTC 1PFCA 4MZ2A 4M62H 1PDKA 3QEGH 1HHHB 2B4CL 1SBSL 3TFKC 2R1YA 3VRLE 1KEGL 5DJXA 2PW2B 5EBGA 4XP4L 2J8OA 3RVVD 3TO4B 4CVXB 4H25B 1E0OB 4HS6B 3VI4E 4P2OD 1O7SA 5DJDA 1T89A 3EO1A 1AGEA 4Z7UF 3WUWG 4QNPF 2DBLH 4UV7H 2A74B 3QJFA 4NCC2 5HHOE 4U6YA 1Q9OB 5E6IB 2Y7QA 3RWIA 4EDXB 4ZNEA 1FSKB 1S7QA 2RGSA 5CJ5A 2QKIB 3MQIA 4MQ7A 4ZO6A 4JAMB 1TTFA 1EMTH 3EFDH 2V2XA 5TE6L 1OSPL 1ZA3A 1BFVL 5ICXB 4Z8FL 5C0IA 3ALXA 1N8ZA 1NCTA 2W07A 1F90H 4G6AC 4ZUVB 5D72H 3RGHA 1L0QA 4NN6B 1SM3L 2D7PA 1NGWB 5AYUL 3RY5A 4K7PX 4WEMB 1IARB 1A6VH 4NKOA 4Z0XA 3GJEA 3C6LD 5FIEA 2H45A 4Y2DC 4GSDL 3V6ZB 1RVFH 3C5SB 1JNHA 2FB4L 2VR5A 4XAKD 2R2EA 4NZDA 3FFCD 4QXUL 2BHZA 4M5YL 4LSVL 2XN9E 4TUOB 4U7SA 4ORZC 5KVDL 2E7LA 3L6FA 4Z7WF 5EORH 1NUFA 1HSAB 2MKWA 3JTTA 3ULUF 4YHLH 4P9MH 3IAQA 3J7HA 4PGBA 5HD8D 3UJIL 2Z31D 2ID5A 3RWFB 4F7CA 1ZV5A 4P3CL 1J5OL 1KB5A 1A7RH 4L3AA 4P2RE 3NVQA 4NKIH 2BJMH 5KSAA 5E6IC 4OF6A 1V3LA 1K8IA 2DQDH 2FX7L 3KPRB 4XXCC 1AC0A 3BPNB 5IMOB 4TVPE 2QQKL 1KBGL 4XP5H 2Z31A 5C08E 5EO9B 4JRYB 3E6FB 4XNMB 4NN6C 3O8XD 5FCSH 5JW4R 1Z3GL 3QUYB 2IBGA 5T1MB 2H1PH 4OI7A 1HEZB 1X5KA 1NFDB 3DVNB 2ZJSL 3QEUB 5MI0B 3ZL4H 1D6VH 3MRNA 1I9JH 4PLOB 3C87A 4NZUL 4U1HA 1TIUA 1JZ8A 1NBZA 1BVLA 1RZ8A 4GFTB 4PRPA 2OCFD 2PXYB 2IADB 3U2SB 3CFDA 3F6IA 4NC2B 5E4EC 3VA6A 5IB3B 4K7PY 4FZEL 1GCFA 4CUCA 1NGZB 4UB0H 2VLJA 1ZKAA 4HIJB 5CEYB 2J8HA 4LIQE 1G84A 4V1DD 3IXTA 4O02L 4ELKA 4GRLA 3MX0A 1A6TA 5DS8A 5J57B 3HNVL 3HFML 1W0YT 4XPAL 1MHEA 3ZLQC 1NCWH 2MOVA 1EBPA 1Z9OA 1ZHLA 3F7QA 5MP6L 3IETB 5BV7L 3BPNC 1JJUA 4O2EA 5CMAB 3BEVA 1ZGLP 3C8KB 4YHML 3H3KA 1UCTA 2X4SA 1WVZA 1D6EA 2ICCA 3NCMA 2G2RB 1EO8L 3RWEA 4P2QE 5T1DH 1IGCH 3ZYZA 3K46A 2R56L 3MJGX 5HXMA 4LLWA 4MB4A 3SGKC 4N0RA 3MO1A 2XQBH 5JW4M 1A4KB 1GZPB 3NH7H 1OAUL 1JBJA 2PXYC 3QUXD 1WCQA 4RQQB 5DYOB 3D9AH 3PP3K 2BNRD 1HIML 3BH8A 4X5XA 1XH3A 4OZHF 4NBZB 4FFYL 3QIWA 5JXAL 4P4RA 4QHKJ 4P46D 2IQAA 4HXAH 1DN0B 1HQ4A 4G8EA 4PGJA 1P6FA 4LCUB 4EQ3A 4KZDH 3JV4A 1KCUL 4U1IB 4NNYA 4ZFZA 2PR4L 3WNPA 5I1LA 4NZRH 3GO1H 1FDLL 4O2FA 3AU1B 5KAQG 2V2TA 1M05A 4XXDB 3MLXH 1TTGA 1UA6H 4WJ5B 2BP3A 4YHOL 2H6PB 1NDMA 1S7RA 4X99B 1D5ZA 1A7NL 1BD2A 1QLEL 5D7KD 3CFBA 5CHNA 4JQXC 3DVFA 4X4MA 4KJWC 1Y18A 2NY1C 1F8TH 3OKOA 3LN5B 4JANA 3U4EB 1HXYB 3EDFA 1T3FB 1XGQB 2FH6A 1H15A 1MHHB 1ETZA 4NJ9H 3NACH 3SKUD 3NPSC 5T1LA 4OJFL 3FO1B 5DUPL 2IH1B 2FD6H 3MOAL 4NCDA 1CL7I 4PGCB 5HHNB 3JWOC 3WEXB 1IKNA 2J5LB 1A3RL 2VYRE 5FGCB 3MV9D 3U0TA 3HI6L 3GIZL 5IW1B 1EAPB 1QRNB 4GRMB 4XMLH 2W38A 2WBJD 4X6CE 3MRLB 2YD6A 3I85A 3F6LA 4LHQB 3U7YH 1G9MH 4IRSC 3QA3A 1JN6B 2OJZH 4XRCA 3B9KA 4JM2D 5I17B 4I0KA 3DRQB 4PJDE 1D9KA 1RU9L 1AKJD 5EO0A 3NN8A 4JHAH 1TITA 1CXFA 4FQIH 1RZKL 4ZPVA 1MJJB 3SKMA 3TZVD 4HXBH 2DQUL 2W0PA 4KK9C 3MNVB 5CUSL 5D1ZD 2Z8WC 2BDNL 5GS3A 3MNZB 2XICA 4QCIA 1MFCH 4L8SB 4CU8A 2JB5H 2VDRH 3EIFA 4I8DA 4TSAL 1CG9B 4KJYA 3L3KB 1QLFA 1ZT4B 4ZTPL 1Z2KA 5C07B 2ESVD 4PRHD 3L1OH 2FX8H 5EOTB 2H9GA 5CP3A 3TIEB 3IFNL 5F88A 3CCHB 4G6JL 1NSNL 3UTSD 4YE4H 3CXDL 3PGCA 3UC0H 1HH9A 1EHNA 5E2UH 5DVNA 2VH5L 5E8OA 4JZNB 4LSRH 4M7KL 3BP6A 4NKMB 4PRIA 4X4XA 3OKKB 5BZWA 3KYMB 2IAND 3ES6B 1LDPH 3MNWA 1WAAE 3KPSD 5EU6D 4FQCL 4UQ2A 2XTJB 2ZUWA 4MAYB 3O2DH 2GT9B 5F7HA 1BBDH 1R0AL 5FECA 2HVJB 1OQXA 1FZMB 1KFAH 2AJUH 3P9MA 3MLYL 2DLTA 4LCWA 3D69B 1PX3A 2E6PA 3K0WA 4OKVA 5DA0B 3IFPB 4Y5YC 5IJVA 1J7VR 3DTXB 4LARL 4JVWA 5JHLH 1A47A 4PJ7B 3X14A 4JEGB 3O4OC 4R2GC 3HHRB 1BGXL 5CBEA 1OP9A 3F58L 1TETH 3T09A 5CGYC 3FQUB 3Q6GH 4PYGA 4PJAA 3GMLB 4KKCC 1Q72H 4RAUB 1BEYH 4EEEA 2DQTL 2GJ6D 3C2AL 1LO0H 1U8PB 3EYSH 2F8XC 1JUFA 5E2VH 2IAMD 4NNXB 2AAVA 1IC4L 5F1KC 1U8IA 4CVWA 2G60H 5D2NA 3D0LA 5JOPD 1CFSB 1QBLH 4H88L 5TDOB 3GUTA 4YEEA 2YC1B 3OXSB 5DRWA 3ME0A 5I1EH 1I8MA 5DZLA 4JFPB 3T0ED 4I4WB 5FYKE 1QEWA 3DO3A 4KDVA 5D1XA 4U7KA 1OAYL 2IAMA 1IL1B 4QOKE 1JWUB 4NO0A 3LIZL 2BVEA 5E5UB 3T3PF 1OT1A 3F5WB 4LVOB 3HZKA 4JKWA 1PG7X 4MAYC 5EPMB 5TF1L 1M71A 5IJKA 3VDAA 3NZ8B 3OAUL 3AB0B 3KLAB 3FO9A 2EIBA 3PJSB 2GKIA 1MAKA 2QLVB 3VRJA 2P24A 5F1SA 2JB6B 4OCYL 4WHCA 4XCCH 3RP1A 1P2CB 1WIUA 5A16A 4HFUH 3LQAC 4N8PA 3FMGH 3I2CL 4M6NH 4I3RH 1IM9D 1DBML 1S7TA 1UM6H 1T5XB 4AIOA 3HE7A 4WFFE 3L95B 2R23A 4WO4D 3G08A 2BSTA 3H9SE 4KQ4L 1NAKH 3K1KC 5DEFA 2N1KA 5D5ME 1ACYL 3FRUA 3OAYK 1GGBH 3EYVA 5DO2D 2HFFB 1HNFA 4HIHB 1W0VA 3BRGC 1U8MA 4L29A 4KHTL 3ZTNL 4D9LH 1AIFA 1I9EA 4L4TD 2FDBP 5D7IE 3FONA 1G0DA 1JPFA 4PGDA 3GNML 2OJEA 4YBQC 1PQZA 1G7LB 4QHNA 1D7FA 3V7MA 4XVJH 4E5XB 4M6MH 4FABH 3QXWA 2FRGP 2LFGA 1JYVA 1DBJL 4P3WA 4RX4A 1MCHA 1MIEL 1OTUC 4KK5C 4U1JA 4GXUM 2DLFH 5LXGL 3LY6A 4B7LA 3VD3A 4MS8A 3H7BA 4UOW0 4AH2B 5AG8A 4OF8A 4KXZH 5IUSA 2F8OA 4P5KA 1MJ7H 1ZAGA 1EEUA 4OZIB 5E8EA 4DZBA 4Q0XH 2F5AL 2HH0H 5DQ9B 1QR1B 2QADD 4M7LL 3KLHC 5F9OH 4PJGE 1UYWH 3FQTA 4CVZA 1S7SA 5I9QC 3TN0B 4N5EA 2ICWA 1U8JA 1OPGL 4RMSA 1LO2H 2CDEA 1Q0XH 2QQLL 1VEOA 3I6LD 5L2KA 3QNYA 4QRTA 3K2MC 1K4CA 2GFBA 2BSSB 1MCOL 3OKNB 5HGAA 4ZAKD 2I07B 5J1SC 1TCMA 4ETQB 3IYLW 2LV4A 1INQA 1KJMB 2RFXA 1AGFA 2YUWA 4GBXD 3N1MC 4N0UA 3MROB 4X7FC 4MXWH 2E9WA 2BC4B 3HE6D 1KPVB 2XA8H 4PJCE 5IMKB 3X3FH 3E2HC 4BSJA 3RL2B 3ZTJH 3RU8L 5C0JB 1JYNA 1JNNH 5JW5B 2YEZB 3E3QC 5SWZB 1IGMH 2F74A 2X4UA 4IMKA 4N1HB 3CK0L 4AEHH 2W92A 2BZDA 4RISH 4R3SA 2MFNA 1RUKH 3OKEB 3KLSA 4HC1H 4JFDB 4J6RL 2XIDA 5IQ7H 4JO4L 5HHVH 1T1YB 2FSEA 4MSWA 4PJIB 3WIFA 1R3JA 1DEDA 1Q94A 4HKZA 3W0WD 3U36B 4MNQB 4X7TA 4WUUA 1Q9LA 4ZUSA 5DJZB 4ODHL 3BN3B 1EO7A 3RTQB 2AGJL 4ZODA 1A0QL 1BHGA 2DWDA 4XVUC 5EU5B 5ESAB 3HA0A 5ICYB 2XN9B 3ZHKA 2NCMA 3GSNA 5I8KL 3W0WA 4KK8C 4MJ6A 4QY8A 1MVUA 1ADQL 2OTWB 4NUJB 2NXYB 1B3JA 5F97E 1KC5H 1JHLL 2BNQE 4G9FE 35C8L 1ZE3C 3D5OF 4JGMA 2DYPB 5K33A 3SE8L 3S34L 3S96A 5GRXG 1QBAA 5I8OH 3MXVH 3EOBA 1JV5A 1ZT1A 3TLRA 1U8NA 3C5JA 2IPKA 4HJGB 4GAYA 4HHAB 4L3ED 5GISL 3SDCC 5DK2A 3QI9C 3SDAA 4LSPL 4PJHA 2Y72A 1F4HA 4LLQA 2QHRL 3ARTA 2VWEE 4GAGH 2HRPL 3IS1X 4NIKB 3CJJA 1UWXK 1I1FB 2NY2B 3HB3D 4WDIA 5DJ8A 2EDKA 3U4BH 4JPKL 2I9LA 3BFOA 3S5LG 5IEHA 2I27N 3FT4A 4Y5VA 3TV3L 4FS0A 2GY7B 1R6VA 4LHUD 5C71A 4G7YL 3I3DA 1SJHA 3TA3B 3G5VB 4L5FL 3BWUC 5JNYB 3VFSA 3BXNB 5A2LH 3RTQC 3TT3L 4R4ND 4DKFH 5ADOH 3EHBC 5I19H 3KWWB 4LHUA 5E9DE 3P0VL 1CLYH 3QWRA 5DMGC 3NIGF 5HHPB 3VFVA 5DHYA 4M8QA 2MSPA 4EQ2A 4F15B 3WO3B 2Y07H 1UKTA 1WZLA 4H8WH 2CGRL 4P2YA 3MFGB 2WANA 4L4VB 3RVTC 4R90L 1WFOA 3GI9L 1QG3A 3MCLH 4IMLA 4X6BA 4JPIB 4TQEH 3LCYA 3H42H 3DMMD 5H35A 2YD8A 5E6YA 4UI2A 4DN4L 5F7EH 1MCQA 2P7TA 3MFFB 4UT7H 5FA4A 4AEIH 1JYWA 4OFYA 4EVNA 1F4YH 1C5BH 5KSBA 5C0BA 1FNHA 4U6HA 4U1NB 3LEXA 5HBBA 5EZLA 5IV2A 5D7LE 4P2QB 4OGAD 5MENA 3QAZB 3P40A 2DQIL 3W9EA 1FN4A 4MVBD 4NSKA 4M93B 2OQJB 3ECBA 3HC4H 2B1HH 2WP3T 1AC6A 1F4XH 1JPGB 3HS0A 3BO8B 1TZHA 1RZIA 3PL6A 4WUKL 3MV01 2VMFA 4IOFD 1MCRA 4CADA 3FQNB 5DJYA 1L9NA 3QO1A 1WTLA 5J12B 3MODH 3QUZB 4MVBA 5F44A 2DKMA 5IWLA 5MEOB 3QDMD 5K9JH 4IRZH 3STLB 4BELD 4ODWA 1BIIA 1OTTD 3PNWB 1UG9A 5JXEA 4FQ1L 5D93C 5CEZE 1H8SA 3BHBB 4N0CC 5CINL 4CMMB 3QDMA 2J7LA 5LCVL 3DRTB 4HGWA 3D3VD 3PP3H 3TH4T 2C1PA 2WY3A 4WW1A 1HWGB 1IM3A 4HJJL 2VZSA 2VN4A 1H3GA 5GRYA 5IF0B 2ZSWA 4HKBB 2GK0A 4F37F 5JHDD 4X8JB 4KK6D 15C8H 1X5FA 4OLZL 3SBWC 3JZ7A 4ZSOA 2GSGA 3BJLA 3RWJA 2C5DC 1IJ9A 3D3VA 3G5YA 2RB8A 1LE9A 4LSDA 1FBIH 4YUEL 3ARDC 4XTRC 2Q76B 3MLVH 5DRXA 4GQ9L 1UZ6F 1FJ1B 1LO5A 5DR5L 4YHIB 4G6KH 1A2YA 1GPOH 1IC5L 2EDQA 2X1PA 4F37K 2IH3B 5FHAH 3GMMB 2NR6D 4Y4KA 2P49B 4P59L 3T1WA 3PV6A 4DN3H 4FQQA 4JG0L 4RWYH 5HDLA 3WHE1 5HPOA 3C9NB 1AR2A 1P1ZB 3OGCB 4QHMB 4NQED 2X89D 4EOWH 2HYMA 1EGJA 1DQLH 4WTWA 1T2JA 4Z7NF 1A1OA 1VESA 4QTHA 1LMKA 4PRNA 3VXSB 3ULVD 1ZHKA 4U0RC 3BW9A 4JREC 2PO6B 4FFZL 1AD0B 1HINH 5L0QC 3AXLB 1F4WL 3BDYH 3QEGL 2HTLC 2P5WD 1HOCA 4GAJH 4F3FB 3DXAE 3VXRB 1FIGH 1A1NB 5IFHH 3QJHA 1NMAH 2JK5A 1E4KA 2F54B 3ILQD 3KNBB 2BOBA 4LVNB 3WJJA 5IBLC 1PAMA 2EDDA 5ILTL 4AYFA 3BQUB 4H0GA 2DBLL 4UV7L 4B41A 3MBXH 1CD8A 2NY4D 1CICC 4D3CH 3WLWC 1JF6A 3MRGA 3BPOC 2BY0A 5D96B 5DD5H 3QDJA 1WWAX 4M03A 1BFOA 1LEKB 4GKNA 1EMTL 3EFDL 2F53D 5IKCA 4JY6A 1KXVC 4YWGL 4J3UA 4UQ3B 2WIMA 5E95B 8FABA 4O4YH 2JELH 1BOGB 5ADPH 1F90L 3ZE1F 5D72L 1U3HD 4YDJA 4RGNE 1WTGT 4PJEB 1I7ZA 1YMME 4D94A 2R1XA 1A6VL 1CGWA 4ZUWB 5FO8B 2BHUA 5J9PA 3HRZB 1BJMA 2EDYA 2KQNA 3QFDB 4YGVA 4WEBL 3ULSB 1RVFL 3NMEA 3PQYB 4YR6B 3MJ6A 1F4AA 3QRGH 1PYWA 5HYJD 1F6AB 3EDJA 4OFDA 5DGQA 3BISA 5HPMB 2OZ4H 2YWZA 2FHFA 4K3DL 4LPCA 3LKNA 4JM4H 3BOVA 3UBXA 5DD3L 5F96L 1BBJA 5CEXB 4YHLL 4HMDA 4JB9H 5T5FH 4P9ML 2NNAA 1QVOB 3FZUC 4F9PA 1TJHH 1ROWA 3N1FC 4ONHA 1U8KB 4NKIL 2BJML 1T1WA 1JTPA 2D7NA 4MX7B 2W0FA 1LWRA 2DQDL 5GGSB 1S9XA 4GLRH 2FWOB 2AABH 3S4SA 1II4E 5D1QD 5A3IC 1ITCA 1S7UA 3UPRB 3PV7A 4POUB 2N4IA 3AM8C 1J1OH 1YEKH 1X5JA 4W4OA 1KCSH 3BSZH 4EN3A 3PWVB 2CDGB 1WBXA 3VFUB 3GMPB 3WN5B 5ANME 4IEFB 1AO7D 1MJUH 3P4OA 2NXZC 5HHXL 1JHKH 5JQ6L 1BFTA 4LEOB 2X4NB 1TPXB 1NBVH 1PG7W 4JFED 1J05A 1OTSC 3MUJA 1VACB 1YN7A 3FAXA 1XR9B 1SYSB 3ZL4L 1D6VL 4NHUA 4GRWE 1P5VA 1AO7A 4HUUB 4DJMA 4MCYB 2FJGA 3O4LA 1T1XA 1FVCB 4MZ3A 5HI4D 4RRPA 3SPVA 3H9HA 3GBLA 2EDOA 4HFWB 5JPMB 2F9BT 4QRPE 5TGBA 1BIHA 4LSSH 1EX0A 3PDDA 3BZFB 3SCMD 4RIRA 3MR9A 1QKZH 4JHBA 3U83A 2P44B 1NCWL 2JF1A 4AZ8A 1AQKH 4QRRA 1DQQB 2CKBA 2APXA 5BRZB 1WK0A 1T04B 3WV0A 4C58B 2VL4A 4FG6C 3MRDB 5HJ3B 4AEEA 2DLGA 5HHME 3U9UA 5FV1L 3WN5C 2B1AH 4EZMA 1GGCH 3D1MC 5BS0B 5CSBA 3KYNA 5T1DL 1IGCL 3HAEG 2N7BA 2X4QB 3DYMA 1OAKH 2HT4C 4LCCA 5ACZA 4N68A 3UTTE 3A67H 3QNXB 1RK0A 2XQBL 5J6HA 1INDH 1NLDL 4Z7UE 2GCYA 1EUTA 1EFXD 3MGTA 3NH7L 1A8JH 2EC9U 3CSYB 1FG2A 1BECA 4KROD 1UM5H 1WFNA 3TBWA 3O11A 4P9HC 3SDDA 1IEBA 1JK8B 4HXAL 5D8JH 4PR5B 3G5XB 5B38B 2GJZA 3HZMB 4PRAA 1OLZA 4XHQA 2OSLB 3T77B 1VENA 1JMXA 3DX9A 3WL9A 5A2IH 2DF3A 3Q6FA 4NZRL 1MCNA 2BK8A 1NEZA 5HY9A 2QSVA 4ZS6D 3GO1L 2M2DA 1SY6A 2A6DB 1IT9L 2YA2A 4EUPB 5FB8B 1R3KA 5L2JB 3EYUH 3U6RB 3F62A 2IQ9H 3LRGA 2XQYK 4BKLB 4S11A 3TJEL 1ZANL 4F7TA 1I1AA 2IPUK 2CPCA 2X7LB 2DWEA 1MREH 4JFHD 4Y1AB 1KT2B 2ITCB 3SJVB 2GTWA 4Z7WE 1F8TL 3IJYA 3ULUE 4TTDC 1B0RB 4P5MB 3JVGC 3DV4B 1TJGH 4X5WB 3I02A 4JJ5A 4PBWD 4JRXE 4HIEA 1VPOH 4NJ9L 5J4MA 4I3GA 3I6GB 4XT1C 4QGYA 4C56A 2P8MB 1CYGA 5IB4A 4L9LB 3I75A 1NGXA 2FR4A 1CXHA 1IAIH 5B39G 3VXME 4Q2ZA 4KAQH 2XKSA 3INUH 1YEFH 3K8MA 1U92A 4KUZL 1F6LL 2ATKA 4ZUTB 4CKVX 3GZKA 3MCG1 5DQJB 5DJ0B 1R3HA 5IESL 2GAZA 2FEDD 5J3HD 2XTLA 1JPTH 1IGYA 3VWJB 1YJDH 5KS9E 4PJ8B 4HT1L 1CVSC 1J8HD 2BNUB 3RGVA 5DXWA 2JLLA 1QP1A 2H2PC 4G5ZH 2AK4A 4JHAL 1GGIH 4FQIL 3CSGA 2D4DA 2P4AB 4HXBL 2CUHA 3S3PA 5JO5A 1XFPA 1RUAL 2V2WB 3HG1A 3VMNA 4DW2H 3SE3A 5D7JC 5IT2H 2AJVH 1Z5LA 1MFCL 1W2KT 5ID0B 2JB5L 2VDRL 3DNKA 3RWDA 3GB7A 1XCTA 2JJSC 1G7MB 1MI5A 3K8LA 3PHOA 2BNQB 4CRPA 2Q86B 4M43H 4NQTA 5I76A 3GSUB 1VGEL 3L1OL 4DGVH 4X98A 5DUBA 3QEQD 5HYFA 3IS0X 1I4FA 5HI5C 1C12B 3MGAA 4H5SA 4P2OB 5INDA 4JO1H 5E94A 3EO9H 5DJ6B 4FTVA 3UC0L 5HGBB 5E2UL 5HHQB 2BVQB 2FZ3A 4LSRL 4FQXD 2ZZUT 3JWOL 3H9ZA 4LLDB 2FO4A 2D3VA 4LRNL 4PP2B 1LDPL 1G7JB 1OY3B 1ORQB 4NQDD 3VWJC 5BMFH 4PJ8C 5C0GB 2BY1A 4GUPB 4XNQA 4XB7A 5FKAA 3OR7B 2G9HB 1ZHBB 3CMOH 2LAAA 2UWEB 2EO1A 2NLJA 4U6TA 5KVFL 3O2DL 2EIEA 1BBDL 3JTCA 4KV5F 3UAJC 1YNLH 5GS1B 3MRPB 3X13B 1KFAL 4EUPH 1ZVYA 2AJUL 4X83A 1XIWC 4OZHE 4WGVB 4NQDA 3C6LB 3G6JE 1C8PA 3JV5A 2IBZX 3HPJA 2XOTA 4G8GA 4PV8B 4UDUB 3NIFF 4U3CA 3FFCB 1ZVSB 3BGAA 5C09A 3BZDA 1S78C 3Q6GL 5DVKA 1KLUA 2C1OB 1Q72L 2YR3A 1BEYL 1ZXQA 1P4BH 1CFTB 5IVXF 3TYFB 1LO0L 1Q9KA 2Q7NA 3EYSL 1AHWB 3N1GC 5E2VL 5GZNC 1O0VA 5KN5A 3ZKND 1NKRA 4P2OC 5DHVB 2G60L 4H26A 4GO6B 1GOGA 2WLYA 5JIHA 1L7IH 1JWMA 3V4PH 3QP3A 3OSKA 2VWEC 4G80B 4WFHE 4LLAA 1TVBB 3BWAA 3VMPA 4KFZC 3DETC 1I8IB 5JLZB 5BO1L 2YS4A 3BP5B 4XHJC 3VFWB 5F7WC 3RWCA 1YC8A 1FNEB 3WIIH 5FUCE 5TH2A 1RV6X 1E28A 5EFIA 3O8XB 2E7MA 1J0ZA 3MRBB 4R7DB 4R9HA 3GMRB 3QO0A 3ROOA 4F7MA 1ZWIA 2B39A 4PJ9A 2PTUA 5EUKB 5IB5B 4W81A 1ADQA 4G43B 3PXJA 3GMQB 4I3RL 1ZLWH 3VXQA 1UM6L 3V6FA 4RFEB 4XMPH 4PJ5B 4NDMA 4ACPA 3HNSH 2LTQC 2H32B 1NAKL 2VUYA 2AQ1A 4XAWH 4N90D 1AP2A 4XZUA 2IBZY 3EFFA 3OG4B 4M1CD 4DCQA 4ZDHA 5CJXC 3ZSSA 3D0VB 1QTYT 1MF2H 5DJAB 1T4KB 1XAUA 3AMKA 3E0GA 4NQCE 3FOLA 1S9VB 2P5ED 2CD0A 4V1DB 1FZOA 4D9LL 4NO3B 3DLQR 2RR3A 4JY4A 3VXPB 5C6PB 3LRSA 4JO3H 3RBGA 4N9GA 2EXWC 3SQBA 1ZTXH 2BCKB 1Y6MR 1GL4B 5AUMA 5C0CD 1AJ7H 4XVJL 4M6ML 3ALPA 2FGZA 5JW4Q 5I16B 5DD1H 1UB5A 3QXDA 4PJHF 1HK6A 5KOMC 1CFQA 4G8FA 4MWFA 3TBSA 3CH1B 2DLFL 3ARGA 2DM3A 3O8XC 1MCLA 3D48R 1DQDH 4U3HA 4BZ1H 4KTDL 1UXSB 5JORA 3GSRB 4HX1A 3TVMA 4MNGA 1CR9H 5IB2A 3VGEA 7CGTA 4Q0XL 4BK4A 4YXLL 3QUXB 1VEMA 4OM1H 1V3MA 2BNRB 1DQTA 3M1BA 5F9OL 4LK4A 2VABB 1UYWL 4M9OA 2J3SA 3BPCB 4P46B 3LQAL 2YKLH 3WLBB 3NPZB 2R2BA 4UOW1 3EDKA 1QUNA 1LO2L 1Q0XL 1ZA6A 3QDAA 4KRMB 4N0YH 1IQWH 2ICEB 3FOMA 2VAAA 2AXFB 3VE0B 5EB9A 1S7VA 1JGEB 4YHYC 3LSOB 2QSTA 3OL2A 5DHVH 1PEWA 4XWGH 5FDYA 1M1SA 3CD4A 2YPLE 1U42A 1UC6A 3RVUD 1QBBA 2XA3A 4FQHB 5F1IA 4CW1B 5JMRA 3RZCA 3RA7H 3BUYA 4X6DA 1P6AB 2A77L 3VCLA 3S37H 4XPFH 3BZ4A 1R5VB 1F58H 2XA8L 2Y5TA 3BVNA 4D0DA 1LP9B 4NN5B 3X3FL 1T0MA 4M61B 1NC4D 1U8HB 4UIMB 3LVEA 1JNNL 3P2TA 4XH2A 1CZ8H 3BGFB 3GSXA 1QSFA 4RISL 4B5EA 3QUXC 4WEUD 3P77A 5HYSA 2X4OA 4HC1L 3WXVH 1X7QB 2VITB 4GW5B 5HHVL 3SKOB 5IQ7L 1S7XB 4IRJD 3MV9B 4M6OH 4RMVA 5K9QI 3T3PE 5CBAB 3QZWA 2WBJB 4BH7B 5IBTH 5IEKB 3OB0K 1T7VA 2H32H 4J3XA 4NJAH 3VFOB 1WEJH 3D85B 2R2CA 3LN9A 1MCFA 1CT8A 1MH5B 4PTUA 3K3QA 4E41A 4JM2B 3ARFD 1AKJB 3SDXF 2LE9A 3X12B 2E9JA 2E8ZA 2ZCKH 3MRHB 3D6GA 1P5UA 3REVB 5I8OL 4MQSB 3TZVB 4BJLA 1YY9C 3MXVL 4N8VB 4NN5C 4RMTA 5D1ZB 3TT1H 2EH7H 3PF2A 3ARBA 4GS7B 4HIIA 3MRCB 3TP4A 2APBA 4JRWA 3BGFC 3BRFA 2ZUYA 3OZ9H 1WLHA 3I50H 4KKBD 2ITDA 4GAGL 4M7ZB 1SVZA 4ISVB 4NZJA 3RI5K 2ESVB 3LKOA 4PRHB 3U4BL 1T22A 5C0AE 5DDHA 1OARH 4PFEA 1NANH 3KPMB 3EYFA 5H94A 1S9YB 4PV9B 5DEGA 4LKXB 2VDML 2JCCA 3UTSB 1T83C 4LBEA 1TQCC 4OCWH 2KH2B 1V7NH 2WBJC 5TDPA 3VXOB 1DBKH 2L7JA 4DKFL 2PTTB 4K3JH 5D2LB 2OBGA 1ODAA 2IANB 4Y19A 1TJIL 4JG1L 4APQD 2A9ML 1EVUA 3KPSB 3LD8C 5EU6B 3W11C 1R5IB 5I6XB 5TPWH 1CLYL 5BVPH 1XGUA 2PCPA 3T8XA 1FPTH 2EEDA 2MJWA 4F9LA 4AL8H 2Y07L 4MJID 3SDYL 1FHGA 4RCAA 4H8WL 4M00A 2VLRE 3GMOA 4R0LB 1KJVA 4AY0A 4WWID 3NA4A 5IBUB 3MCLL 5FO7A 2P42B 1I75A 2XI9A 2HG5B 3U7AA 4TQEL 3H42L 2AJZB 4NC1C 3U48A 4YHPA 5F7EL 4UT7L 4AEIL 4MJIA 3GSWA 3QCVL 3EDEA 1H5BA 1MELA 1F4YL 1C5BL 1GSMA 1TMCA 4LLMB 3MMEB 3BIKB 1NKOA 1K5NA 3A0OA 4J3WA 2GJ6B 4EI5D 4O9HH 5C0EB 2OR9H 2E7CA 3P73A 1JP5A 1P9MC 1NGPH 5EO1B 4OBSA 3RDTD 2XFXA 3E6HA 3J8F7 4Y4FC 1QNZH 1DUZB 4PJXF 3HC4L 4YIQA 1CD9B 2B1HL 5ESVB 3LS4L 2HLAA 3TFKD 1X4XA 4LGRB 1NMCB 4OZGA 1BQHA 3T0EB 1FL3B 4GG8B 5ERWB 5I74C 1IAOA 5I6XC 1F3JB 4MD5A 4BQBA 3WNLA 4UBDC 5TDNA 3ZT6A 5ISZA 4HLZG 1H8OA 4Z0BH 1QA9A 2R39A 5K9JL 4XPHH 1CDJA 1MWAB 2GSIB 4FHBD 5T3ZD 1IZKA 1P84K 1G6VK 5F89B 1XGTA 2BVPB 1KOAA 5F9DC 1FYTA 4PJBF 1PKQA 3OAZH 5FOBA 1GVIA 4LP4A 3TC9A 3VXUD 1JTTA 4G6AD 3ZMRA 1BWMA 2B5IC 4K23L 4UV4H 1IM9B 1LO4H 3QG7H 1AR1C 3WXWH 1X9QA 1B2WL 4WO4B 1A9BB 1JGDB 5TE7H 3WIHH 4CAGA 15C8L 3C8DA 4HS8H 2FGWH 4Y2DD 4OCRH 4K94C 5DI8B 5AEAA 1K8DA 1SJXA 2K7QA 3L3DB 5CSZB 3UYPA 1N5YH 1LEIA 5C9JB 2BX5A 1MRDH 1E4WH 2CIIA 1HHJA 4K55A 4LEXH 5DF0A 3MLVL 2CR3A 3KR3H 1S9WB 3EYOB 4L4TB 5E8NB 1BMGA 3IDUA 5SX4I 4G42B 5FDWB 4G6KL 5BCAA 1GPOL 4R4FL 1M7IB 1B0GB 3UZEA 1X5XA 1K4DB 3WNNA 4P23C 1JZ5A 4DN3L 5I2IB 4RWYL 1HHHA 1L8JA 4ZO9A 5E6ID 1WBZA 2ADIB 4FMKA 5F1OB 2LU7A 2PW2A 3TO4A 3PWJB 4CVXA 1CE1H 4F57H 4H25A 4HS6A 5EIQA 2VZTA 1EZVX 4EOWL 4CN1A 3F8UB 2A74A 5DGRA 5CCKH 4QT5B 1G6RB 1Q9OA 4EDXA 3U7WH 1HINL 2ZWLT 3IKKA 1B4RA 1OGTB 1ORSB 3OMZA 2DM7A 1WCBB 4GAJL 2QADB 2QKIA 5DMJB 1FIGL 4JAMA 5IFHL 4K7PH 4LVHB 2EDRA 3BKJH 5ICXA 1ZSDB 2BXZA 1CLZH 2VLKE 4ZUVA 2PYEE 5DO2C 3NIGE 1CTNA 3ULUC 3PWLB 4F7EB 1NGWA 2Q6WB 1Q1JH 4D3CL 1A6UH 1IQDB 1QFWI 5DD5L 4K94H 4MHHI 3ZDZF 3C5SA 3FO2B 4ZAKB 2C3HA 2BHYA 4B0MM 5IG7B 4MCZB 2JELL 4FZ8H 4NYLB 4TUOA 5CAYB 4GBXB 4UT9H 4LHJB 5DT1H 2IG2H 3L3JB 5FUZH 1DBAL 2VO5A 1BZ9B 3HE6B 4HUXB 4ZNEE 5BZDA 1HSAA 1F13A 2HVKB 3FQRB 5BQ7B 4JHWH 1XCQB 4Y2OA 1QPXA 2CJUL 1RJYB 4D9QD 3RWFA 5EWIH 1X6LA 1MWAH 4DVRH 2R9HC 4DEPB 3QRGL 2H41A 3BD5A 3ZKMD 4S1RH 2GEEA 3KPRA 5IMOA 4XCEB 4JM4L 1EZVY 1FG9C 5ALBH 5EO9A 5GSVB 3C09B 3FL7A 3RVXC 2ZUXA 4JB9L 5T5FL 5T5NF 4JRYA 1V5JA 2AK1L 3E6FA 1TJHL 4XNMA 5L88H 2GUOB 4J3OC 3N06B 4JHZA 2GTZB 5BW7A 3HI5H 3QUYA 5T1MA 2R29H 3LKRB 2BMKB 1HEZA 1IEHA 5FXCH 4PY8J 1EA9C 1NFDA 3DVNA 3QEUA 2Q8BH 2E7LE 4LRIC 4MB3A 3BD4A 3MUZ1 4OBRA 5BXFB 1FNGB 1J1OL 1V05A 3MBEC 1KCSL 3C60D 4YPJA 2PXYA 2IADA 3REWB 2CRYA 3U2SA 4LPVA 2W65B 1OB1B 2EEBA 4PBVC 4Z7QF 4HUNB 5IB3A 1MJUL 3HE6C 3VRLF 3KXFD 1JHKL 1KTKE 3ZYOA 1NGZA 3R06B 3DI3B 1NBVL 1IGJB 4KMLB 3WDHA 1CDYA 4HAGA 4IIQC 4H20H 4HIJA 4OI9A 3PWPA 4H1LB 4L3EB 5CEYA 3GGWB 2AJXL 3UYOD 4DEPC 4MQXC 5B21A 2X42A 4FRWA 3CDGB 3O9WC 4OM0H 4UMGA 2OLDA 4KJWD 5CMAA 2XXMB 4BH8B 3OG6B 1UZ6E 3V52L 1JTOA 3WE6B 2NY1D 3RL1B 2X1QA 3C8KA 1G6RH 3K4ZA 1SYVB 4WV1C 1R3IH 3D39D 4HCRL 3VI3F 2G2RA 3G6DH 4MMXC 3BMWA 3LB6C 4PRPE 4LSUH 4LSSL 4M4PA 4JQXA 3VH8B 1QKZL 4C55A 4D9RE 5DFVD 1RJZB 1YZZA 1NQBA 1AQKL 5ICZB 2EE3A 3SE4C 1A4KA 1GZPA 2XWTB 2VLJE 4RSVA 4Z7NE 3W5MA 1R5WB 3ARZA 3TYGL 1VA9A 3WFBH 4RQQA 5DYOA 1RHHB 1SHMA 3OKLB 3BKCH 3GIVB 4WTZG 4POYA 1GGCL 3MLRL 1W0WB 1RURH 5FYJE 1DN0A 4IRSD 4DAGL 2NTFB 1OAKL 5ID1B 3STBA 4LCUA 3A67L 4U1IA 3I3BA 4RGOL 3DMMB 4TULL 3VGGA 5JR1H 4N0FB 1U3YA 4LCIH 4MA7L 3O2DA 1JGVH 5IVZA 5GS2D 1F00I 5FUCC 3AU1A 1OAXH 4XXDA 1P7QD 5EH1A 4WJ5A 2H6PA 2ZNWA 4X99A 4PRDB 2V6HA 3Q5YA 4Z77B 4YO0B 3H6JA 4YDLB 1FVEB 3BAEH 3ZE1E 4LLYB 4MA3B 2FLBT 3VGDA 3L7EB 2ZG1A 3MCKB 1B4JH 1A6WH 3LN5A 1LVEA 3U4EA 1HXYA 3LH2H 4K7FB 3EYUL 1T3FA 1XGQA 1MHHA 3LS5H 5AZ2H 3HKFA 5ABDE 2DIBA 3O3EB 4HWZB 3FO1A 3JXAA 2IH1A 4PGCA 5HHNA 1N0LA 2HAZA 4G59A 3NTCH 3MOBH 3WEXA 4U3XA 5F7DB 1CFBA 1MREL 2CIKB 5IW1A 1MFNA 3UROR 4JPVH 1EAPA 1QRNA 4GRMA 4RWHA 1OD9A 3HCVB 3DMMC 3MRLA 3EAKA 4R4BB 5FYLD 1VPOL 1BD2E 3PGDB 4YH6A 4P4KD 2FHCA 2APFA 2D0HA 5DK0B 3QDGD 4PJFB 4X4ME 4FXLA 1CDUA 1JN6A 4H1LH 5JHDB 1NMBH 4XC1H 5I17A 4PPTA 3DRQA 3SGEH 1IAIL 2FHBA 3O3AB 1T21B 4R2GD 4KAQL 2WAHA 4HKXB 3INUL 1MJJA 2A6JB 5DC9B 1KCGC 3UTQB 2VDNH 3MNVA 5EUOB 4KKCD 3DV6B 4QO1A 2WWKT 1N6VA 4XNZB 5F7NC 5B8CB 1JPTL 3F12B 4L8SA 1RZJH 3KYAA 1CG9A 2ZCHH 3L3KA 5K9QG 4OQTH 2X1OA 3T2PA 4NFDA 4G5ZL 4M6AA 1ZT4A 4X7SH 2OR8A 5C07A 1GGIL 3WKNA 5EOTA 3HRPA 3TIEA 3S6CA 2UYLB 4NQEB 3CCHA 5TE6H 1UKSA 5IT2L 4HS3B 2XY2A 4DUXA 1KIPB 3JWDC 4JZNA 4BQCA 3VFTB 4NKMA 3OKKA 1DCLA 3KYMA 1HI6B 3VJ6B 2P5WB 3M17B 1TQBC 4WU5B 5AYUH 3ES6A 1KJ2B 5KOVC 3V4VH 4DGVL 3QQNA 4BK5A 1X3DA 4V2BA 4GSDH 3MV7B 4MAYA 2FB4H 2GT9A 1C1EH 2CUIA 1FV1B 4JO1L 4ZPTB 3EO9L 3MV8E 4M5YH 2HVJA 4BFBD 4LSVH 4ELMB 1FZMA 1Z0NA 4KQ3H 4PP8C 2NY4B 3D69A 1W72B 3IFPA 1A5FL 2PW1B 5B8CC 3DTXA 5BMFL 2F53B 4M4RA 4MA1C 1RUMH 4PJ7A 4K9EH 3CUPB 2C3VB 5DMYA 4Y5XC 5JIPA 5DJCB 1U2HA 3FQUA 3QUMB 1U3HB 3GMLA 1I7UB 3WUWB 4RAUA 1Q8MA 3X11B 1WBYB 1YNLL 3BP7B 4PRIE 1P7HL 1KF9B 2NX5D 2DQEH 1U8PA 4YBQD 4RBPH 4Y4HD 4NNXA 2W0KA 2WK2A 4GW1B 3ZT7A 4JFFD 4WFEE 4BSVB 4UTAH 1OW0C 4J23A 1CFSA 5TDOA 3O6FC 4YDIH 2YC1A 3OXSA 1PG7H 4KK5D 3V5KB 2DQFB 1U8OB 5HYJB 1J18A 2EECA 4JFPA 4I4WA 3MGOB 3QB7C 3SO3B 3F7YB 1IL1A 1JWUA 1CQKA 3JWDH 1P4BL 2C7UB 4AM0B 5CJQH 4XP6H 4LCWE 3KHOA 1BLNB 1P69B 3F5WA 4PJDF 5GRZA 3ARRA 5B22A 1WIPA 1EJOL 4HV8B 4Y7MA 5EPMA 4X6DF 3NZ8A 2A73B 5KSUB 1D5MB 3KLHD 1X5HA 3KLAA 1NCBL 5TQ2H 1L7IL 4PJAE 1X4ZA 3V4PL 3PJSA 4FZEH 3VDBA 4QRUB 3IDGB 4HC1A 3QFJD 2JB6A 1QSED 5D1QB 1P2CA 4K3EH 3TIDB 2R1WB 5D2NE 1T5XA 3WIIL 3L95A 4O02H 2EYTB 5HDOA 5DSCB 3GJFK 2Y36H 2VNCA 5MP6H 3JUYA 4QYOB 4JFEB 4MDIB 2NZ9D 5GGQH 2Q1EA 2HFFA 1KUMA 4U1GB 4HIHA 4EXPX 1F6FB 1TNNA 1FO0B 3KPLB 3B83A 1JMZA 2E9BA 4GW4B 3SO3C 2VDPH 3FB7B 4XMPL 3HNSL 4KJQC 1G7LA 1G7IB 4E5XA 3ULVH 3FO0H 4XAWL 3L9RA 2OXGA 1JI1A 1MRFL 3BIBX 3NGBC 4EDWH 1MF2L 1I3VA 1KJ2H 5GGRA 1B0WA 1OGAD 3SCMB 5IVNA 5EU7E 5FK9B 4FFYH 4AH2A 4JO3L 5J89A 1ZTXL 2R0LH 3HUJB 3MRQB 2IC2A 4JJHA 1AJ7L 5DD0H 3AREC 2VDKL 1QR1A 5DQ9A 2BXYA 1W72H 4XVUD 3S9DB 4JQIH 1UGNA 1U0QA 2EDXA 1K3IA 1NBYB 1DQDL 1LO3H 5L9DH 4BZ1L 3TN0A 4KK8D 5CD3A 3QUMH 4TUJB 2JCCF 1CR9L 2OL3B 4OV5B 3PDOB 1QLEH 1EFXB 4X6EB 1HNGA 4OM1L 2BSSA 5CLTA 5HHOD 3OKNA 2I07A 4KROB 4RMWA 2XWBB 4ETQA 4Z76B 1KJMA 3V8OA 5HI4C 2YKLL 5IK3B 3SDCD 5AAWA 5J6GB 4HK3N 4HW6A 1KELH 3B43A 3MROA 1YEIH 5GIRB 3QI9D 6FABH 2BC4A 1KTDB 4N0YL 1KPVA 3SCMC 5IMKA 5DUPH 4KV5E 4Z7OF 4C4KO 4KUCD 1MAMH 3E8UH 3RL2A 5C0JA 1H0DB 2OTUB 1A3RH 3CXHJ 5JW5A 2YEZA 4XWGL 5F6IB 4TOYH 3B6SB 5SWZA 3IDIB 3HI6H 1U8LB 3GIZH 5CGMA 3RA7L 1TTUA 3RTQD 3OKEA 5L2KE 4XPFL 2DLHA 4JFDA 1F58L 1T1YA 4MXQC 5GZOC 1FZJB 3FCTB 2XN9D 1EJ6A 3NA9H 4JFQB 1RIHL 3EHBD 4MHHG 4PJIA 3ZKXC 1G0YR 5DMGD 3U36A 4MNQA 5IR1B 2YD3A 1RU9H 1EAJA 5DJZA 3DSFH 2G75B 2ERJB 4KRLB 3RTQA 2APTA 4N0UE 4I77H 1CLOH 5EU5A 5ESAA 4P2RD 5ICYA 4Y16D 2DQUH 25C8H 3IDNB 3RVTD 2YWYA 4M1DH 3WXVL 1WWCA 2MQ0A 2OP4H 2WINB 2OTWA 4NUJA 5ITFB 4WHDA 3BT2H 3WHXB 1HYSC 1UENA 1T1ZB 4TVPD 3JV6B 5C08D 2DYPA 5IBTL 1MFEH 4DK3A 4ZTPH 5CKAA 4NJAL 2AQ2A 1WEJL 2Q3ZA 1KLGB 1YPZB 4HJGA 5C2BL 4HHAA 5DJ2B 4DKEH 2EZ0C 4NKDB 5DD6B 3TF7C 5F6IC 5F1NB 1J8HB 3FRPG 4Q6YA 1UJ3B 4JE4B 3JBG7 4WUUE 3T04D 3IU4L 3IFLH 2ZCKL 3CC5B 3N85H 4HIXH 5EC1B 1I1FA 4PJGF 5MERB 3TEUA 5GHWH 2FBOJ 3MUY1 1UWGH 3SQOH 2APVA 2HWZH 3EJYC 3TT1L 2EH7L 4FQCH 1CGSL 3TA3A 4G3YH 2A6KB 3G5VA 3W0WE 5JNYA 3BXNA 3OZ9L 3AS0A 1T89C 4U1KB 5EBWB 3RRQA 4LAJH 1HQRB 1FYHB 3KWWA 5KSAB 3QEQB 2OL3H 1ACZA 5HHPA 4NO5B 4N0CD 1J0HA 3H8NA 1S7WB 2DMCA 5I1HH 4WHTB 3FAWA 4PREB 4OCWL 1E6OH 2DI7A 1MCPH 1V7NL 3F58H 4PJHE 1DBKL 1Y0LB 4FQXB 4L4VA 3T4AB 4P2QD 4MDJB 4RFOH 2C4FU 2FEDC 4JPIA 4KWUA 2YBRB 2OR7A 5TPWL 3MREB 3MFFA 1QO3B 4G9DB 5BVPL 3R0NA 4KPHH 3ARDD 4U6VH 2Q3AA 4XTRD 1FPTL 3IDYC 3QISA 2IF7A 4U1NA 4AL8L 4ZQKB 1I3RB 4P2QA 5JW3H 4TSBH 1OAYH 3FT3B 3SKJL 4GJTB 2XRAH 4Q74A 2E7LC 4M1GL 3SE9H 3ARWA 2OQJA 3IAGC 3EJZC 1WICA 5TF1H 1FNFA 2EICA 2EDNA 4Z5RB 4S2SB 1JPGA 3TNMB 1EXUB 3BO8A 4OAWB 3NCEB 5KSAC 3FQNA 2FLRT 3HLAB 2VQ1A 3QUZA 4O9HL 2OR9L 1H3TA 1YA5A 3UDWA 5MEOA 4ESKA 4OD1H 5I15L 5I1DB 1NGPL 5AAMA 1HSBB 3UZQA 1QNZL 2HTLD 1L7TL 3IJSB 2V7NB 3D87B 5KSBE 4HK0B 5C0BE 2WUCL 1H3UA 5FCUH 2O5ZH 2OZ4A 5IBLD 4EIZC 3BHBA 1DN2A 4LP5A 5MENE 4CMMA 3VWKD 5L8KB 3DRTA 4Y88A 4OD3H 1QFWM 1UWEH 4Z0BL 3CVHB 3L3IB 1CICD 4ENEC 5IF0A 4XPHL 4HKBA 1H9VA 3WLWD 2MPAH 4X8JA 1U8QB 4UAOB 3AY4A 1JRHI 3ISWA 2W1NA 3RBSA 2Q76A 5JOFB 1MIEH 2BOCB 1XGYH 4UV4L 1LO4L 3QG7L 1FJ1A 1T80A 1Y6KR 3DWTA 4YHIA 1F3DH 3O2WH 4P48A 5TE7L 2IH3A 3WIHL 4GRLC 3GMMA 2YHGA 1XGPB 4HS8L 2FGWL 2WBKA 4OCRL 2VZVA 4OB5L 4KHXH 3ZKNC 5KANI 3QDME 3C9NA 3CFIC 1JF5A 1N5YL 4LNRB 1P1ZA 3OGCA 2P5EB 2RAMA 1MRDL 1E4WL 1WF5A 4LEXL 4QHMA 2GIYA 3KR3L 2AW2A 3VXSA 5IQ9B 4ZSOE 5D6DA 5C0CB 3FZUD 3ILPB 2PO6A 1AD0A 3U0PB 3D3VE 3AXLA 4KMQA 2M1KA 1CK0L 4F3FA 3VXRA 1V3KA 1A1NA 2F54A 3BPLC 1LNUB 3KNBA 4I2XE 5A3ID 1M7XA 4HWUA 2IFFH 5FGBA 4F57L 3NCJH 1MQKL 1RIVH 3BQUA 2XKNB 3QIWC 5C2UB 1EPFA 1EDQA 5CCKL 2DS4A 5C8JB 2QTEA 2NXZD 1SEQH 4GKSB 5IHZB 2K1MA 4KTYA 4K7PL 3HMXH 1LEKA 3CPLB 3AM8A 3UTOA 3DOSA 4UQ3A 1F5WA 4Z95H 3BKJL 4AJ0A 1CLZL 3ZE2E 1BOGA 4X9GA 4ODXB 4IDLA 1DL7H 4PJEA 5F6HI 1D3CA 1RZGB 3WS3B 3HC0B 4LCYB 4TYUA 5EO0B 4ZUWA 5FO8A 1Q1JL 2ZOKB 3GJFB 3HRZA 3LMJH 1A6UL 3EYQD 4K94L 1YNTB 4ZPVB 3QFDA 3GHEH 3ULSA 3PQYA 4YR6A 5E00B 3T65B 2AQ3A 5EBMB 9CGTA 1F6AA 2YXMA 5JOEA 2W9EH 3RY6A 4UT9L 2AGJH 5DT1L 5CP7B 4O51B 5FUZL 3MV8B 2PTVA 1CBVH 2VRAA 4YDKH 2O5XH 3QDJE 5CEXA 4JHWL 1BJ8A 1QVOA 5IW3A 1NC4B 4FG6D 4F7PB 5EWIL 4GMTH 3CVHH 4NM4H 4YDVB 1OHQA 3IU3B 3C6SB 1MWAL 2JJUA 1BPVA 1IKNC 1U8KA 3K4DA 4MX7A 35C8H 4TRPL 4ZXBB 1I9IH 2YD9A 4NRXB 4S1RL 5GGSA 2FWOA 1HH9B 3GMNA 3UPRA 4PUBH 5ALBL 5DA4A 3PWVA 5FYKD 2CDGA 4IRJB 1WSST 5FM4A 3VFUA 4QOKD 3GMPA 1XGRB 1VADB 3WN5A 1IGIH 1QYGH 5L88L 2QHRH 4XPTH 5AWNH 3HI5L 1CTOA 4LEOA 2R29L 1D9KC 4KTEL 2X4NA 1VACA 2WWMC 5IMMB 2Q8BL 1XR9A 1SYSA 3QQ3B 3WFCL 3TV3H 1NDGB 3VG9B 2X05A 1CN4A 3ARFB 4HUUA 2KL6A 1LD9B 1FVDB 4MCYA 1HYRC 1E6JH 3R8BB 3DO7B 1FVCA 5IHLB 5SWSA 4WFFD 3RVWC 1RY7B 4JN1H 3H9SD 5JZ7C 1MIMH 1ZGLM 4M9PA 3C2SA 4HFWA 4H20L 5JPMA 3BZEB 3F7VB 3BZFA 2DIAA 4L1HA 1XMWA 1E4XH 4I5BB 4ZXBC 2A9NH 1A3LH 2EIDA 4OM0L 3B8YA 4UUJB 2CGRH 3N9GL 1DQQA 2LAGB 5BRZA 1T04A 4R90H 3P4LA 3GI9H 5ACLA 1X5AA 3MRDA 5HJ3A 2WNGA 4TTDD 1G6RL 3Q1SH 1R3IL 4DN4H 4NHUE 5FV2A 4RFNC 5I1IH 5CKGA 5BS0A 4I0PD 4LSUL 5F93C 4ZS7H 1AO7E 1A7BA 1U95B 2X4QA 3BP4B 1XF1A 3O4LE 3FB6B 3QNXA 3JVGA 2DQIH 4APQB 5CILH 1JPSL 4OZFG 3VG9C 3S5LB 2AP2A 1JNLH 2APWA 3GJFH 4PB9H 3DX6B 3CSYA 3TJHA 3BKCL 3X3GH 3SGDI 5C0NC 3TNNB 3MJ7B 1X5LA 1JK8A 3RPIB 1RURL 1G7PB 4PR5A 5I66B 3G5XA 4JCLA 4QRRE 5B38A 4YHZH 3HZMA 1H3VA 2OSLA 3T77A 1T66C 3CIQA 2H3NB 1A6AB 5E5RB 5IGXH 4FQPA 5HDBE 5JR1L 4LCIL 4ODSH 2ZUQB 1JGVL 2HJLB 5D2NC 2C4FT 1KNOB 2A6DA 1OAXL 4EUPA 3Q5OA 3V6BR 5D7JD 5L2JA 1YEHH 4FQ1H 3U1SH 3U6RA 4EI5B 3ZDZE 1MOEA 1ITBB 4PGDB 3IJHB 4BKLA 5LCVH 1QHOA 5LGJB 1BOYA 2YD1A 3BAEL 2AJ3B 4HJJH 3C08H 5IOPB 2X7LA 5GS0C 4WFGE 4NHCH 4ZD3L 2YUXA 4RAVB 4Y1AA 3GRWH 3RUGB 1KT2A 2ITCA 3SJVA 5IJKC 1A6WL 2D4FA 1B0RA 4P5MA 5HI5D 4APQC 3DV4A 3LH2L 2MKLC 4A6YB 1WT5A 1QQDB 4X5WA 1N6QH 2DQJH 3NOIA 5T1KD 2JJSA 3LS5L 3I6GA 2P8MA 3QWQB 4DOHE 1HKFA 3NTCL 2PYFB 4KDTC 4L9LA 5KVEH 5DR5H 1AQDB 1IC5H 5EU7C 3O0RL 4ERSH 1GHFH 3O3DB 3B9DA 3VXUB 2D03H 4ZUTA 3UAJD 4P5TA 3ZKSD 2ZUQC 5DQJA 2H2SC 5DJ0A 1U8JB 1EHLH 1RK1B 2CDEB 1XIWD 3VWJA 5BVJB 3D18B 4PJ8A 2MHAB 1C5DA 2BNUA 2MQ3A 4XC1L 4Y2DB 1LILA 4K71C 1TVDA 1TZIB 4FFZH 2DL2A 4OQ1A 5IVXB 3BUTA 1F4WH 5F3HB 1INQB 2EYSB 1S78D 2BNQD 5M95B 1AGFB 4G9FD 4Z7QE 4C56E 2VDNL 2V2WA 2DOCA 2EE6A 3WO4B 5GZND 1JIBA 5ID0A 3P30H 4PY7B 2IFGA 5ILTH 4MS8C 1RZJL 4DKAA 2ZCHL 4LDOB 1G7MA 2YPKB 4OQTL 2HFTA 4NWTH 1VB9A 2Q86A 4X7SL 1FFOB 3GSUA 2I24N 1WQVT 1SJEB 4XBPB 1A1MB 1T20B 3O3UN 2OMNA 3WSQL 3DETD 1C12A 3FQXB 2Z8RA 4P2OA 4YWGH 4W70A 4F8TA 4X6FB 4XHJD 5DJ6A 1GIGH 1IGTB 5HGBA 5HHQA 2BVQA 2AEIT 4IS6B 4NFBA 2AK4E 4LLDA 3VI3E 4N5EC 4NKQB 4S0SD 2XG4A 3QRFM 2VQTA 3LPGA 4PP2A 1G7JA 4ZOCA 1ORQA 1TFHA 3HG1E 2EDHA 4PP1C 5C0GA 4YXKH 3V4VL 1E27B 4AIXA 1JF1B 4GUPA 3OR7A 2G9HA 1ZHBA 4WEBH 2FIRT 2UWEA 3DBXB 1C1EL 1NFIB 5E9DD 4HBCL 1MUJB 3SO5A 5GS1A 1MI5E 3MRPA 3X13A 2Z9TA 4KQ3L 1MEXL 5E4EB 5FAAA 1DBBH 4K3DH 3C6LA 1MNUH 2FJFB 3VGHA 1SQ2N 3LAFA 5DD3H 5F96H 3WO4C 4PV8A 5DFWH 4JO2H 3EOBB 4UDUA 2VLLB 1RUML 4K9EL 4HDIB 3FFCA 1ZVSA 2P1YA 4FTVE 2C1OA 1BFSA 4XI5C 1CFTA 4IMKC 3KLDA 1N7MH 2EXWD 3RIAF 3TYFA 2DQEL 3QIUD 4A6YH 3MC0A 1AHWA 1GGUA 1ZHNB 2V5SA 5DHVA 4UTAL 5E8DH 5CJXA 1J0JA 5D7LD 1KIUA 4R8WH 4YDIL 1FCGA 4NC0B 1PG7L 4ZOAA 2M26A 3I6KB 1NUGA 4QRSB 3RWGB 5T3ZH 4UT6H 5HHXH 2FECI 5JQ6H 4G80A 1TVBA 3SY0B 1I8IA 5KS9F 3JWDL 5JLZA 5CJQL 1AXIB 4XP6L 3RIAK 3BP5A 5CJ8A 3VFWA 2DLEA 1FNEA 2Q8AH 4G8GE 2FJHB 1MFDL 2HJKB 3O8XA 4RMQA 3VRIB 3MRBA 5C09E 2K9UA 1NC2D 2XNAB 4PJ5D 4R7DA 2X4PB 5TQ2L 1Y6NR 3GMRA 4PJIF 4HPOH 4LQFL 2A83B 4LASL 4GG6B 5EUKA 4K3EL 4G43A 3GMQA 3U9PL 2J1KA 3C60B 5CEZD 3GEWB 4NPYB 4RFEA 4PJ5A 2IGFH 2Y36L 2H32A 1ZEAH 3KXFB 4LPXA 3SDAC 4WWKD 3UJJH 4UILH 3ROLB 2DTSA 4NQXB 3W9DB 2PF6A 5GGQL 1J87A 4JKPH 3UYRH 2NYYC 3D0VA 5DJAA 5IB1B 1T4KA 3PE9A 1YUHB 1S9VA 1UJTA 4Y5VC 1F45A 4V1DA 3PIQB 4NO3A 4F58L 3O3BB 3VXPA 3WUZA 2VL5B 3ZKMC 4HWBH 2YN3A 3MLPA 1CL7H 2BCKA 2VDPL 4U33A 2ATPB 5K93A 3ULVL 4HGMA 2NY1B 3FO0L 2ADJB 4HPYH 5I16A 2B4CC 4Z7VB 5I73C 3PL6B 4FA8A 2ARJQ 5ECJE 1NLDH 1U91B 5J06A 4EDWL 3D39B 1N6UA 3CH1A 1KJ2L 3S7GA 2EKJA 3NPSB 4MNHB 3OXRB 3PDGA 3K8KA 1KN2L 3CAFA 3GKWH 2A6IB 3RIFF 3FFDB 3G6JF 2Z4QB 1UXSA 2R0LL 3GSRA 5KW9H 2EEAA 1DZBA 4U1MB 4J3VA 4PS4L 5DD0L 5KANG 3DUHA 2ICWI 3C60C 5J1AB 1I85A 3GHBL 3QUXA 4D0BB 2BNRA 3EOYG 1VEPA 3WD5H 1W72L 2VABA 4JQIL 1UXWB 5SWQB 3SDXB 3BPCA 4P46A 3DXAD 2P46B 5DUML 3WLBA 5T3XE 2O93L 4IRSB 1LO3L 1IT9H 5L9DL 5EZJB 3RIFK 2EC8A 1UADC 4UINH 3CLFH 4U6XB 1YY8B 3L5XH 3QUML 4LPTA 4HWEH 3LEVH 1HDMB 2Y23A 3TJEH 2ICEA 3KPQA 1ZANH 2AXFA 4YFEA 3VE0A 1INEH 3LSOA 1YY9D 4LOUD 1G0XA 1JZ4A 4PGEB 1P7QB 4FQHA 3HAEB 2P8PB 4I2XB 3CX5K 3PL6C 4MNGE 1A2YB 5EIVA 1KELL 2VERN 1UT9A 1YEIL 6FABL 2FCBA 3B5GA 1R5VA 3C5ZD 3EZJB 2EKSB 4G8IB 4YFDB 3LN4B 2EDEA 3W5NA 1LP9A 2VKXA 4RGND 3A6BH 1A21A 1MAML 1YMMD 3E8UL 1U8HA 5DFVC 4UIMA 5J7CC 3G04B 5E03A 2GY5A 4TOYL 4YBLC 5JIIA 4QEGA 4J8RB 4I18B 2BRRH 1CDGA 2FATH 2V9RA 4KUZH 4P49A 2YSSA 4KI5E 3D85D 1X7QA 2VITA 4GW5A 3SKOA 5IESH 2E7BA 3NA9L 3MV9A 4OTXH 3W11D 4PLJC 2X2YA 4HT1H 5I71C 1T83A 4TNVK 5CBAA 3VFGL 1R24B 2WBJA 3DSFL 3WS6A 5IEKA 2MQCA 4X6DE 4I77L 3D85A 1T7XA 1CLOL 1XEDA 4P4KB 5KVMC 1MH5A 1RUAH 2BVOB 25C8L 3QDGB 2E7HA 5DZNA 4M1DL 3OPZH 2OP4L 4JM2A 1FO0L 4Y5YB 4J4PD 1AKJA 3BT2L 4NM8H 3X12A 5DC4B 1CS6A 1I3UA 3MRHA 3O4OB 2I25N 4R2GB 1QSFE 1J88A 1RJLB 1FQ9C 1CVRA 3REVA 1N5AB 5K9OB 3TZVA 1MFEL 1AE6L 4N8VA 2KDGA 1QSZA 3LRHA 4ZFOL 3Q3GB 5D1ZA 1VGEH 1K2DB 3GDBA 2RHEA 3WIHA 4PJXB 1XF2B 4DKEL 5J8OA 4POZC 3MRCA 3RNQB 4I18C 4ONGH 1QLRB 4Y4FD 5BV7C 5B39B 4FFEX 3IFLL 3JTSB 4GXVL 3N85L 2R2HB 3JWOH 4HIXL 4ISVA 2ESVA 4PRHA 5GHWL 1UWGL 4LRNH 3SQOL 3KPMA 2HWZL 1S9YA 4PV9A 3KPTA 1P9MA 4OF0A 3KPOB 4LKXA 4G3YL 1E4KC 3UTSA 4E41E 4UBDD 4LLVB 2DM4A 1OOAA 3WJJC 3VXOA 5KVFH 5B4MC 4PJBB 5CD5C 2PTTA 5D2LA 4QRPD 2IANA 2VZUA 4P4KC 1O7VA 4RDQF 3KPSA 2NY0C 5EU6A 1R5IA 3IF1B 2Z92A 2Q87A 4HUVB 4JVPA 2J8UA 2OL3L 4OZ4B 5I1HL 5GS2H 1UCBH 1E6OL 1ES0B 1AR1D 1MCPL 4R96B 5HHMD 4R0LA 1MVFA 43C9B 4EN3B 3ETBF 3HAEH 5GGUB 5F7KC 4AENB 4OLXH 2HLFC 3P4OB 2VSDA 4RFOL 2NY5C 2HG5A 5IROA 2AJZA 2EDFA 4HUKB 2A2QT 3UTTD 3MLUL 2JCCE 2VDLL 4KPHL 4U6VL 4ALAH 3CFKB 2X44D 2I5YH 3MMEA 4FFWD 4LLMA 3BIKA 1DQMH 2GJ6A 2YRZA 2NX5B 5JW3L 4TSBL 3D25B 4NO2B 4Y4HB 4Y19E 5C0EA 4ETYA 4JFFB 4P23D 3MRMB 2XRAL 3B8SA 5EO1A 5BO1H 3SE9L 2GW5A 4OF5A 4PJEF 1DUZA 3QHZH 3VXNB 1CXEA 2P8LB 5ESVA 2X4RB 1MFAH 1J9CT 5FYKU 1PVHA 1K85A 3FQWB 4Q9QH 4F9PC 5HGDB 3T0EA 2WW8A 1LK2B 1FL3A 4XWOC 4GG8A 5ERWA 1FE8L 3TCLB 4Z7OE 1F3JA 4G6FB 4MXVF 4YFLF 4PYHA 2A38A 5FYLH 4M48L 3V95A 4QRRB 5E7BA 1MHCB 4OD1L 1MWAA 4OUOA 2GSIA 4MJIE 4QXWA 2ZKHH 4W4OC 4EN3C 4PDCE 5F89A 1PY4A 2E27H 3WFDL 2BVPA 5FCUL 2O5ZL 4LNVA 1LHZA 5SV3A 3MRRB 3QFJB 1QSEB 1MQ8A 3QULB 3I84A 5I9QB 1QOKA 2E6JA 2YRPA 4OD3L 1IM9A 4GH7B 3ULUD 1MJ8H 5EOQL 4NNPH 1UWEL 3DX8B 1RK0B 2DTMH 2H26B 3BYYA 4WO4A 1A9BA 1JGDA 4JRXD 4XPGH 2MPAL 3CX5J 4DGIH 3LHPH 3RNKB 4NUGH 1OP3H 1REIA 4OZGE 3QEHB 4Y4HC 4NBYB 5DI8A 1WZKA 2L0DA 3L3DA 5E70A 5CSZA 1P4IH 1WISA 2F5BL 5C9JA 3VXMD 5ISZE 1XGYL 4LGPB 3CVIL 5TFSH 3EYOA 1KGCE 4L4TA 5E8NA 3T1FB 4G42A 3O45B 2KPNA 2ICES 3DI2B 1XF3B 3O2WL 1M7IA 1B0GA 1F2QA 3E2HB 1K4DA 4KTDH 5L8LB 4I0CC 3T2OA 1FYTE 4PY8I 4U1LB 3VGAB 1PKQE 1P7KB 3MPCA 1EIBA 5I2IA 4KHXL 2R8SH 2R9HD 1EEQA 3L3OB 1IAKB 2ADIA 4YXLH 3QNZB 3W82A 1J0IA 5FUOH 5T33H 1OGAB 4DUVA 3PWJA 5F8RC 4ZYKB 5DVMA 1T0PB 4LKCA 4WIQA 4U1SB 3LQAH 3D2UB 3RVXD 3JSSA 1C7TA 1G6RA 5FO9B 4XP1H 4LCCC 1OGTA 1ORSA 1WCBA 4NT6B 1CD1B 1KLFA 3MYJB 1D5BA 3EOTH 3EW3B 1ZSDA 2IFFL 1E4JA 3NCJL 3EBAA 1RIVL 2NZ9C 3S3SA 1FLRH 4AK1A 3MBED 4HQQH 5HI3C 3PWLA 3SDDC 1GH7A 4F7EA 3VG0L 2A77H 2Q6WA 4ODTH 4EI6B 1IQDA 1SEQL 1XZ0B 1XR8B 4JKMA 4LRIA 2VXVL 5HHOB 5DFTA 3HMXL 3FO2A 3GSVB 3NAAL 4ZAKA 5H2BB 4Z95L 4D0CB 5IG7A 4MCZA 3RAJL 2VSCA 3VGAC 1BQLH 3SDCB 4NYLA 5F71A 1H3XA 4FQJH 4MQXD 5MHSE 2XQYG 4GBXA 2PETA 2I9TB 3KDMB 3QI9B 1TCRB 1DL7L 3L3JA 1S5IL 3STZB 1BZ9A 3HE6A 3O9WD 1Q9WA 4HUXA 3CDFA 5C0FB 2HVKA 3FQRA 5BQ7A 1XCQA 3LMJL 3M8OH 4BUHA 1CXKA 4IJ3C 5D70H 1RJYA 3DJ9A 4E42B 1I1AC 3UBXI 4XMKH 5F8QC 3GHEL 3ZE0F 4KY1H 1KN4H 1PLGL 3LB6D 5HYQB 1GAFL 2W9EL 2CLVB 1A4JB 3MRKB 4XCEA 3M07A 1CBVL 3CFCH 1JFQL 4YDKL 5GSVA 2V5TA 5GRUH 5KVGH 2O5XL 3FB5B 4ZFFB 3MLSL 1FL6B 5GGVY 4AQ1B 4GMTL 3AUVA 2GUOA 3CVHL 3EDDA 4NM4L 2GTZA 3LEYH 4HF5L 3LKRA 2BMKA 3NABH 4CVUA 1I9IL 5INDB 1I7RB 1RUPH 1FFQA 4X7CC 4JR9H 4P2RB 5MEPB 4Y16B 2EO9A 2WQ8A 2FX9H 4PUBL 3SE4A 5BXFA 2VDQH 4OSUH 1FNGA 2ZUTA 4WFHD 3REWA 1HKLL 1V7MH 2W65A 3QXAB 4UDTB 1OB1A 1U6AH 1IGIL 3ZDYF 1QYGL 5C08B 5I1AB 4XPTL 5AWNL 4XNQB 2FNBA 3RGVC 3R06A 4BYHA 1IGJA 3KPRE 3TPUA 4L8DB 1A6ZB 1FGNH 1U2CA 3DURB 1UQSB 2CLZB 4H1LA 4L3EA 3GGWA 1J10A 2VDMH 4JRYE 2A1WL 5GSRB 3CDGA 1OAZL 1Z9SA 3BGMB 1E6JL 4BH8A 1V3JA 3WE6A 4PB0H 4RZCB 3RL1A 1NFDE 1TJIH 4JG1H 5C09B 2A9MH 1SYVA 4JN1L 1PZUB 3OX8B 1MIML 2D9CA 1DFBH 5I0ZA 4OQTA 3VH8A 1RQ5A 2Y1VA 1E4XL 2NW2B 3SDYH 4JN2B 5HGGS 2A9NL 1A3LL 2GITB 4NQCD 1RJZA 4Y16C 5ICZA 4J3SA 2XWTA 3DGGB 1HILB 2X9YA 5D93B 4L8BB 3TH2T 1R5WA 4FMFA 3PWPE 3Q1SL 1RHHA 1T7WA 3RFZC 3OKLA 3GIVA 3V0WH 3QCVH 5I1IL 3V79C 3ESUF 1W0WA 4ZS7L 1ZLWK 5TH2B 3GSOB 2NTFA 2DQCL 5ID1A 5IIEB 2MTPA 5CILL 4CNIB 3MOQA 3DMMA 1CGTA 2W59A 4N0FA 5A1AA 3PUCA 1CXIA 4NP4H 1A3QA 1JNLL 4PB9L 1L0XA 3ARDB 4JGJA 4OLYH 3X3GL 3LS4H 3RPKA 4BZ2H 5E08H 3VFPB 2VXSH 5F7UA 3LZFH 1J1PH 4PRDA 4YHZL 4Z77A 2UWEF 3V6OA 1FVEA 4LL9A 2X9XA 4V2CB 4S0UC 5IGXL 4LLYA 4MA3A 3VFRB 3L7EA 3MCKA 4ODSL 1PD6A 4AIZB 4PG2A 1YEHL 4K7FA 4ZOEA 3U1SL 3KPPB 3DSNA 4Q7DA 4U0RB 3O3EA 4HWZA 2YPLD 4JREB 4JKLA 4K23H 4JDTH 3MRFB 2XWJB 5L0QB 3C08L 2LABA 5AD0B 1NCCH 1OWWA 1KXTB 4NHCL 1B2WH 4NN7B 5F7DA 3GRWL 1U58B 2CIKA 4JPWL 2VN7A 4BFEA 4TVPH 1N6QL 3HCVA 4PLKC 2DQJL 3VWKB 5E2WH 5DK3A 5C7XH 3OKDB 4R4BA 4DZ8B 3PGDA 4UNVA 3DPBA 3MLTB 5DK0A 4PJ9C 4MNGB 1CICB 2FYYB 4PJFA 3BPOB 1D5IH 5JHDA 5KVEL 2YA1A 3DECA 2LQRA 4R4FH 2V9TA 3B3IB 3O3AA 4ERSL 1GHFL 1T21A 2KZ1B 4Q6IB 4HKXA 3WJLA 2A6JA 2D03L 4KGJA 3UTQA 2HFGL 2XZCH 2HFEB 5EUOA 1ONQB 3DV6A 4OF7A 2R2BB 3VA2C 1EHLL 5B8CA 4X6CB 3F12A 3MLWL 4IOIB 4JDZB 5FGCE 2Z93B 5F70A 1KEMH 2Z35B 6CGTA 3O6FD 2AEQH 1QRNE 3AS2A 2UV3A 4LIQH 1IC7H 4PJDB 2AV1B 2YUVA 4TVSa 4NN7C 2UYLA 4L3CB 4NQEA 2X89A 4HS3A 1OW0A 5C86A 1KIPA 3ARGC 3P30L 3UTPE 4C83B 2XZQH 3MV7D 3GSQB 3VWKC 5GS0L 3VFTA 3HZYB 12E8H 4PTTB 1KYOJ 4XX1E 1HI6A 5CGTA 3VJ6A 2XKUA 5JDSB 2P5WA 3M17A 2P45B 2VOTA 4NWTL 4WU5A 1KJ2A 2ORBH 4S1DC 1P53A 1T7YA 4P2CG 1HHIB 3P77B 3MV7A 2ZP0T 1FV1A 4ZPTA 3JUZA 1QACA 4Q6IC 5C0AD 1GIGL 4ELMA 4DVBB 3ZO0A 5C07E 1DBAH 2Y9RT 2NXZB 5B3NA 3GI8H 1OP5H 1D5XB 4P0DA 4U7MA 1W72A 2PW1A 3IGAB 4XC3H 2P47B 3QG6B 5JA8B 2F53A 2CJUH 4YXKL 2ARJB 1K9TA 2C3VA 2ZG3A 3CUPA 4QHUB 2KZWA 4LHUG 4DFIA 3O2VH 1EVTC 5DJCA 2J4WH 1OCWH 3UXFA 3QUMA 1U3HA 1I7UA 1BVKB 3WUWA 3LDBC 3X11A 1WBYA 3BP7A 3Q0HA 3RZCC 5IHUH 1DBBL 4GW1A 4KJQD 3OF6D 1MNUL 4BSVA 5GGTH 4KC3B 1LQSR 2VLRD 2XTJE 5E99L 3QPQC 2XT1B 3BKMH 4JO2L 1ZLVK 4NRYB 2AK1H 3V5KA 1QFUL 2DQFA 1U8OA 5HYJA 4KRPB 3MGOA 2VR9A 5FOJA 3F7YA 1VFAA 4G6MH 1DVFD 2FH8A 2C7UA 3B2UD 4AM0A 3T0DA 1N7ML 4A6YL 1HH6B 1FAIH 1BLNA 3MV11 4HV8A 5ELIA 3VW3H 1X5GA 3ARED 4HGKC 5E8DL 1FH5H 4HZLB 4LF3A 4PJ7E 1AXSB 2A73A 4R8WL 1OM3L 5KSUA 1D5MA 1CU4L 2Y6SC 3RWHB 2VLME 2V5RA 5H94B 1VKXB 4EKXA 4M5ZH 3OJ2C 5T3ZL 4UT6L 1LP9F 4QRUA 4JLRB 3IDGA 1DLHB 2EDBA 5D1QA 3GBMH 3DVGB 1AGDB 3AMLA 3TIDA 3MXWH 2R1WA 2Q8AL 2AJXH 2CH8A 4QOKB 2HKFH 4HLZH 2EYTA 3QWOB 2DQHL 5DSCA 2GK2A 5E2TL 4OCSL 1KPRB 4JFEA 4MDIA 3V52H 3FT2B 4HPOL 3EYQC 4JCMA 4HUWB 3RX7A 2JIXD 1BZ7B 4OLWL 4YHNB 4HCRH 3KPLA 4KKLC 3ARBC 4A2LA 3LKPB 4KRPC 3BE1H 4GW4A 3FB7A 5FF6B 1G7IA 4QRQB 2IGFL 5B3JE 4YLQT 5D9SB 1ZEAL 3B2VH 3UJJL 3OHXB 4YNYB 4JM2F 4UILL 3H9SB 4JKPL 3UYRL 3PWNB 3UPCA 2R4SH 1UVQB 3TYGH 5J11B 5D5MB 3SCMA 1YC7A 1R3LB 1B9ZA 2NMSA 5FK9A 2AJSH 3MLRH 4HWBL 4JY5H 4MXQD 5DC0A 5GZOD 3AAZB 1CL7L 3HUJA 4IHOB 3MRQA 4DAGH 1NCAH 3HPLA 5D7IB 2DDQH 2M8XA 5HGHB 4HPYL 1SMAA 3QHFH 1QZ1A 2ZCLH 4RGOH 4TULH 4OGYL 3OAZK 2VE6B 4MA7H 4I0PB 2VTFA 1NBYA 2E6QA 2NY7H 3NFNB 3GKWL 2ED9A 4F9LC 4TUJA 3QUKB 5KW9L 4RGMB 1HYSD 2OL3A 4OV5A 3PDOA 1PW3A 1EFXA 4X6EA 3KJ4C 4QKXB 2V17H 4XNXH 2CMRL 2IMMA 3WNMA 3WD5L 3WFHB 2XWBA 4Z76A 5FGRA 4ZNCD 1A7QH 5CZXC 1H5BC 2EZ0D 4MLSA 5IK3A 2J8UF 5J6GA 1NEUA 4PJGB 2QL1A 3SGJA 4UINL 5GIRA 3CLFL 3L5XL 3RHWF 4HWEL 1KTDA 2XYCA 5J11C 3LEVL 2VLKD 4S1SH 3K2UL 2PNDA 1NJ9B 2PYED 1M6OB 3FTGB 4PJAF 5IFJB 1PZ5B 5EG6C 2LVCA 4FN0A 1LEGB 1INEL 1H0DA 2OTUA 2RQ8A 1U93B 3EJYD 1LEIB 3B6SA 3IDIA 4ZMAT 5D7JB 1U8LA 3U30C 1IMHC 2AS5M 1DLFH 1OQOA 2FO1A 2D7OA 3RHWK 2HN7B 4I0PC 1FZJA 3FCTA 5CIPB 2YZ1A 4JFQA 3QHTC 4NRZB 2E8YA 3A6BL 2AKRB 1WBZB 2JE8A 5FYKH 4PJCB 1ZT7B 1Z9MA 4QWWC 5IR1A 3W39B 4JFXB 5JTWA 1YQVH 2HT3C 1FIEA 2NW3B 5I8EB 4RGMC 2G75A 4LMQE 1S8DB 5T1KB 2J6EH 5JUEH 2BRRL 2CK0H 2FATL 3TBTB 4PRBB 4P9HH 3QIBB 5A43C 3WDIA 3IDNA 3HZVB 2VC2H 1QSVA 1TXKA 2WINA 3UBXG 5ITFA 1X6NA 2DQGL 2EXYC 4OTXL 3WHXA 3NCBB 5LGHH 5SWZE 1T1ZA 3JV6A 2NQCA 4J1UB 2W9DH 3M45A 3L5HA 4GQPH 5FA3B 5INCB 4NFCA 1KLGA 1K6QH 3RJDA 4JFDE 1YPZA 3PG2A 1XIWB 5DJ2A 1HHGB 4NKDA 5DD6A 3S4SG 4PJIE 3OPZL 5F1NA 1J8HA 3BI9X 2W60B 3NZHL 3EJZD 1UJ3A 4CJ0A 4MNQE 4NM8L 1J8KA 2J88H 2DMBA 3CC5A 5EC1A 5MERA 3QPXH 4G9FB 5KSAD 2Z8VC 4JDVB 1L6ZA 2A6KA 5BZDB 4WHYH 3MRIB 3TO4C 4DUWA 1XF4B 4ONGL 4U1KA 2BVUA 1KTLB 5EBWA 5AZEH 1HQRA 3QIBC 2YN5A 3QEQA 1FSKC 4AMKH 4NO5A 1A5FH 4N8CL 3PHSA 1S7WA 1F42A 4RRPG 5H37G 4WHTA 2D31B 4I1NB 4PREA 4DK6A 4DTGH 4K8RC 4ENED 1Y0LA 4FQXA 1KENH 4WCYH 4R7NB 3T4AA 4O00A 3NFPB 2ZUSA 3HN3A 4PRPD 4MDJA 1F97A 2YBRA 4CJ1A 4D9RD 3L5WB 5DEZA 3MREA 5F7YC 1QO3A 1KCVH 4G9DA 1CD0A 3V5DB 2VLJD 3O6LH 5E9DB 4ZQKA 1RJCA 1UCBL 2D0GA 1I3RA 3DX7B 5HDQL 3FHQA 3FT3A 5GJSH 4GRLD 1PJ9A 1KIQB 2LTQB 4OLXL 3HMXA 1OT2A 2F19H 5FYJD 1X44A 1EJOH 2QR0B 3FN9A 1JZ7A 4Z5RA 5CIPH 3LOWA 4S2SA 3TNMA 1EXUA 1H3PH 4ALAL 3RKDD 1KCRH 4OAWA 3PWPB 4KVCH 1LQVA 2DKSA 2I5YL 1NCBH 1DQML 3HLAA 4L4VE 2WBWB 2O61B 3QIUB 1VFMA 1AXTH 4NGHH 3VXTB 3G5ZB 1EGJL 4FFVD 5I1DA 3P4MB 5D7LB 1HSBA 3UX9B 3IJSA 3QHZL 2V7NA 5TE4H 1MFAL 4DGYH 3GFUA 4HK0A 2XPGB 4PD4J 4Q9QL 2IEPA 3T0WA 4P99A 1NEZG 1U3JA 4LQ1A 2SEBB 2G5BB 5BW7C 3QUYC 4Q9RL 1AI1H 2OM5A 4QTIL 2IALB 1UACL 3SEPA 4NWUH 4K8RH 5EBLB 1ZLUH 3QIWD 3L3GB 3U46B 5E5MB 1KULA 5MI0C 5FYLL 3ZDXF 5T5NG 3CVHA 3L3IA 4W68A 1K3ZA 2FIKB 1U8QA 5EIIB 2ZKHL 3QCUH 4MD4B 2E27L 5DQDL 1NC2B 3V8CA 3VD7A 4M7JH 3IXAB 1MRFH 1FP5A 2HJFB 5JOFA 2HMIC 1EK3A 2BOCA 2WLZA 3S8WA 1MJ8L 5FKPB 1G9MC 4NNPL 4PIRF 2DTML 1G7QB 3AC0A 2V5YA 2BSED 4XPGL 2NY5L 1BD2D 3LHPL 4DGIL 4NUGL 1XGPA 3R4DA 5IVOA 4YHYB 4WWKB 4X4YB 3QIUC 4C57C 5IVZB 2I60H 1TVHB 4X80H 2DICA 4WI2A 1EEYB 3U0WH 2VR4A 2VDKH 5DTFA 5F3BB 1P4IL 4LNRA 2P5EA 2AXHA 1NBQA 1CF8H 3AS3A 5TFSL 1CE6B 1G7HB 4U49A 3PWUB 1WZ1H 5IQ9A 5T1LD 5C0CA 3ILPA 3T2NH 3U0PA 4R6UA 1DUYB 2R8SL 2GQHA 1CXLA 1KJ3H 1FZKB 3RZWA 4F2MB 5FUOL 1LNUA 5T33L 3GK8H 3L3HB 3S35X 4RNRB 5JPNB 4OD2B 2XKNA 1UB6B 3ARPA 5IP4A 1N2RB 4JFYB 2EYRB 2FL5B 4O58H 3V5HB 2Q7YB 4BFIB 4XP1L 5LBSH 5C8JA 3B9KD 4QXGH 4GKSA 5IHZA 1D9KD 3QH3B 4C59B 4HLJA 1J0KA 3CPLA