3BP9A

Structure of b-tropic mlv capsid n-terminal domain
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
131
structure length
131
Chain Sequence
b'PLRLGGNGQLQYWPFSSSDLYNWKNNNPSFSEDPGKLTALIESVLTTHQPTWDDCQQLLGTLLTGEEKQRVLLEARKAVRGNDGRPTQLPNEVDAAFPLERPDWDYTTTEGRNHLVLYRQLLLAGLQNAGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag protein
publication title Structure of B-MLV capsid amino-terminal domain reveals key features of viral tropism, gag assembly and core formation
pubmed doi rcsb
source organism Murine leukemia virus
molecule tags Viral protein
total genus 39
structure length 131
sequence length 131
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, X, Y
ec nomenclature
pdb deposition date 2007-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 3bp9A00
4E92A 4XFZA 4HTWA 4U0FA 4DGAC 1EM9A 3H47A 4B4NA 4NX4C 4QNBA 1U7KA 4DGEC 4U0EA 2X2DD 3H4EA 4XROA 3NTEA 5JPAA 4WYMA 4PH2A 3P05A 1M9XC 2V4XA 2GONA 2Y4ZA 4XRQA 1M9DC 1E6JP 2KGFA 2X83A 1EIAA 5HGOA 2M8NA 5HGLA 2XDEA 2EIAA 5HGKA 1L6NA 2PWMA 2LF4A 2XGVA 2GOLB 1G03A 2PXRC 4XFXA 2WLVA 1D1DA 1M9EC 4U0BA 1AFVA 2M8PA 2XGUA 1GWPA 4XFYA 2M8LA 3MGEA 4U0AA 2X82A 2XGYA 1M9FC 1AK4C 4PH3A 4PH0A 1QRJA 2PWOA 2WLVB 3BP9A 5HGNA 1P7NA 5HGMA 4U0DA 4U0CA 4J93A 4E91A 1M9CC 2JPRA 4INBA 4LQWC 1M9YC
chains in the Genus database with same CATH superfamily
4E92A 4XFZA 4HTWA 4U0FA 4DGAC 1EM9A 3H47A 4B4NA 4NX4C 4QNBA 1U7KA 4DGEC 4U0EA 2X2DD 3H4EA 4XROA 3NTEA 5JPAA 4WYMA 4PH2A 3P05A 1M9XC 2V4XA 2GONA 2Y4ZA 4XRQA 1M9DC 1E6JP 2KGFA 2X83A 1EIAA 5HGOA 2M8NA 5HGLA 2XDEA 2EIAA 5HGKA 1L6NA 2PWMA 2LF4A 2XGVA 2GOLB 1G03A 2PXRC 4XFXA 2WLVA 1D1DA 1M9EC 4U0BA 1AFVA 2M8PA 2XGUA 1GWPA 4XFYA 2M8LA 3MGEA 4U0AA 2X82A 2XGYA 1M9FC 1AK4C 4PH3A 4PH0A 1QRJA 2PWOA 2WLVB 3BP9A 5HGNA 1P7NA 5HGMA 4U0DA 4U0CA 4J93A 4E91A 1M9CC 2JPRA 4INBA 4LQWC 1M9YC
chains in the Genus database with same CATH topology
4E92A 4XFZA 4HTWA 4U0FA 4DGAC 1EM9A 3H47A 4B4NA 4NX4C 4QNBA 1U7KA 4DGEC 4U0EA 2X2DD 3H4EA 4XROA 3NTEA 5JPAA 4WYMA 4PH2A 3P05A 1M9XC 2V4XA 2GONA 2Y4ZA 4XRQA 1M9DC 1E6JP 2KGFA 2X83A 1EIAA 5HGOA 2M8NA 5HGLA 2XDEA 2EIAA 5HGKA 1L6NA 2PWMA 2LF4A 2XGVA 2GOLB 1G03A 2PXRC 4XFXA 2WLVA 1D1DA 1M9EC 4U0BA 1AFVA 2M8PA 2XGUA 1GWPA 4XFYA 2M8LA 3MGEA 4U0AA 2X82A 2XGYA 1M9FC 1AK4C 4PH3A 4PH0A 1QRJA 2PWOA 2WLVB 3BP9A 5HGNA 1P7NA 5HGMA 4U0DA 4U0CA 4J93A 4E91A 1M9CC 2JPRA 4INBA 4LQWC 1M9YC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E92 A;  4XFZ A;  4HTW A;  4U0F A;  4DGA C;  1EM9 A;  3H47 A;  4B4N A;  4NX4 C;  4QNB A;  1U7K A;  4DGE C;  4U0E A;  2X2D D;  3H4E A;  4XRO A;  3NTE A;  5JPA A;  4WYM A;  4PH2 A;  3P05 A;  1M9X C;  2V4X A;  2GON A;  2Y4Z A;  4XRQ A;  1M9D C;  1E6J P;  2KGF A;  2X83 A;  1EIA A;  5HGO A;  2M8N A;  5HGL A;  2XDE A;  2EIA A;  5HGK A;  1L6N A;  2PWM A;  2LF4 A;  2XGV A;  2GOL B;  1G03 A;  2PXR C;  4XFX A;  2WLV A;  1D1D A;  1M9E C;  4U0B A;  1AFV A;  2M8P A;  2XGU A;  1GWP A;  4XFY A;  2M8L A;  3MGE A;  4U0A A;  2X82 A;  2XGY A;  1M9F C;  1AK4 C;  4PH3 A;  4PH0 A;  1QRJ A;  2PWO A;  2WLV B;  3BP9 A;  5HGN A;  1P7N A;  5HGM A;  4U0D A;  4U0C A;  4J93 A;  4E91 A;  1M9C C;  2JPR A;  4INB A;  4LQW C;  1M9Y C; 
#chains in the Genus database with same CATH topology
 4E92 A;  4XFZ A;  4HTW A;  4U0F A;  4DGA C;  1EM9 A;  3H47 A;  4B4N A;  4NX4 C;  4QNB A;  1U7K A;  4DGE C;  4U0E A;  2X2D D;  3H4E A;  4XRO A;  3NTE A;  5JPA A;  4WYM A;  4PH2 A;  3P05 A;  1M9X C;  2V4X A;  2GON A;  2Y4Z A;  4XRQ A;  1M9D C;  1E6J P;  2KGF A;  2X83 A;  1EIA A;  5HGO A;  2M8N A;  5HGL A;  2XDE A;  2EIA A;  5HGK A;  1L6N A;  2PWM A;  2LF4 A;  2XGV A;  2GOL B;  1G03 A;  2PXR C;  4XFX A;  2WLV A;  1D1D A;  1M9E C;  4U0B A;  1AFV A;  2M8P A;  2XGU A;  1GWP A;  4XFY A;  2M8L A;  3MGE A;  4U0A A;  2X82 A;  2XGY A;  1M9F C;  1AK4 C;  4PH3 A;  4PH0 A;  1QRJ A;  2PWO A;  2WLV B;  3BP9 A;  5HGN A;  1P7N A;  5HGM A;  4U0D A;  4U0C A;  4J93 A;  4E91 A;  1M9C C;  2JPR A;  4INB A;  4LQW C;  1M9Y C; 
#chains in the Genus database with same CATH homology
 4E92 A;  4XFZ A;  4HTW A;  4U0F A;  4DGA C;  1EM9 A;  3H47 A;  4B4N A;  4NX4 C;  4QNB A;  1U7K A;  4DGE C;  4U0E A;  2X2D D;  3H4E A;  4XRO A;  3NTE A;  5JPA A;  4WYM A;  4PH2 A;  3P05 A;  1M9X C;  2V4X A;  2GON A;  2Y4Z A;  4XRQ A;  1M9D C;  1E6J P;  2KGF A;  2X83 A;  1EIA A;  5HGO A;  2M8N A;  5HGL A;  2XDE A;  2EIA A;  5HGK A;  1L6N A;  2PWM A;  2LF4 A;  2XGV A;  2GOL B;  1G03 A;  2PXR C;  4XFX A;  2WLV A;  1D1D A;  1M9E C;  4U0B A;  1AFV A;  2M8P A;  2XGU A;  1GWP A;  4XFY A;  2M8L A;  3MGE A;  4U0A A;  2X82 A;  2XGY A;  1M9F C;  1AK4 C;  4PH3 A;  4PH0 A;  1QRJ A;  2PWO A;  2WLV B;  3BP9 A;  5HGN A;  1P7N A;  5HGM A;  4U0D A;  4U0C A;  4J93 A;  4E91 A;  1M9C C;  2JPR A;  4INB A;  4LQW C;  1M9Y C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...