3BP9A

Structure of b-tropic mlv capsid n-terminal domain
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
131
structure length
131
Chain Sequence
PLRLGGNGQLQYWPFSSSDLYNWKNNNPSFSEDPGKLTALIESVLTTHQPTWDDCQQLLGTLLTGEEKQRVLLEARKAVRGNDGRPTQLPNEVDAAFPLERPDWDYTTTEGRNHLVLYRQLLLAGLQNAGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag protein
publication title Structure of B-MLV capsid amino-terminal domain reveals key features of viral tropism, gag assembly and core formation
pubmed doi rcsb
source organism Murine leukemia virus
molecule tags Viral protein
total genus 39
structure length 131
sequence length 131
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, X, Y
ec nomenclature
pdb deposition date 2007-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 3bp9A00
4INBA 4XRQA 4E92A 2KGFA 1L6NA 2PXRC 4PH0A 5HGKA 4XROA 4U0AA 4B4NA 5JPAA 1M9EC 4DGEC 1P7NA 2GONA 1EIAA 1D1DA 4U0DA 5HGOA 4U0FA 1AK4C 4U0BA 3P05A 2XGUA 4HTWA 1QRJA 1GWPA 2M8NA 4XFXA 2Y4ZA 1AFVA 4J93A 1M9YC 5HGLA 4PH3A 4U0CA 2XGYA 2X83A 2V4XA 5HGNA 2PWOA 2X2DD 4XFZA 4E91A 2WLVB 4PH2A 2M8PA 1U7KA 3MGEA 2JPRA 1E6JP 2XGVA 2EIAA 4NX4C 3BP9A 2XDEA 2GOLB 4U0EA 1M9CC 4XFYA 4LQWC 3NTEA 2WLVA 4WYMA 2LF4A 5HGMA 1M9XC 2PWMA 2M8LA 1EM9A 4DGAC 2X82A 4QNBA 3H4EA 3H47A 1M9FC 1G03A 1M9DC
chains in the Genus database with same CATH superfamily
4INBA 4XRQA 4E92A 2KGFA 1L6NA 2PXRC 4PH0A 5HGKA 4XROA 4U0AA 4B4NA 5JPAA 1M9EC 4DGEC 1P7NA 2GONA 1EIAA 1D1DA 4U0DA 5HGOA 4U0FA 1AK4C 4U0BA 3P05A 2XGUA 4HTWA 1QRJA 1GWPA 2M8NA 4XFXA 2Y4ZA 1AFVA 4J93A 1M9YC 5HGLA 4PH3A 4U0CA 2XGYA 2X83A 2V4XA 5HGNA 2PWOA 2X2DD 4XFZA 4E91A 2WLVB 4PH2A 2M8PA 1U7KA 3MGEA 2JPRA 1E6JP 2XGVA 2EIAA 4NX4C 3BP9A 2XDEA 2GOLB 4U0EA 1M9CC 4XFYA 4LQWC 3NTEA 2WLVA 4WYMA 2LF4A 5HGMA 1M9XC 2PWMA 2M8LA 1EM9A 4DGAC 2X82A 4QNBA 3H4EA 3H47A 1M9FC 1G03A 1M9DC
chains in the Genus database with same CATH topology
4INBA 4XRQA 4E92A 2KGFA 1L6NA 2PXRC 4PH0A 5HGKA 4XROA 4U0AA 4B4NA 5JPAA 1M9EC 4DGEC 1P7NA 2GONA 1EIAA 1D1DA 4U0DA 5HGOA 4U0FA 1AK4C 4U0BA 3P05A 2XGUA 4HTWA 1QRJA 1GWPA 2M8NA 4XFXA 2Y4ZA 1AFVA 4J93A 1M9YC 5HGLA 4PH3A 4U0CA 2XGYA 2X83A 2V4XA 5HGNA 2PWOA 2X2DD 4XFZA 4E91A 2WLVB 4PH2A 2M8PA 1U7KA 3MGEA 2JPRA 1E6JP 2XGVA 2EIAA 4NX4C 3BP9A 2XDEA 2GOLB 4U0EA 1M9CC 4XFYA 4LQWC 3NTEA 2WLVA 4WYMA 2LF4A 5HGMA 1M9XC 2PWMA 2M8LA 1EM9A 4DGAC 2X82A 4QNBA 3H4EA 3H47A 1M9FC 1G03A 1M9DC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4INB A;  4XRQ A;  4E92 A;  2KGF A;  1L6N A;  2PXR C;  4PH0 A;  5HGK A;  4XRO A;  4U0A A;  4B4N A;  5JPA A;  1M9E C;  4DGE C;  1P7N A;  2GON A;  1EIA A;  1D1D A;  4U0D A;  5HGO A;  4U0F A;  1AK4 C;  4U0B A;  3P05 A;  2XGU A;  4HTW A;  1QRJ A;  1GWP A;  2M8N A;  4XFX A;  2Y4Z A;  1AFV A;  4J93 A;  1M9Y C;  5HGL A;  4PH3 A;  4U0C A;  2XGY A;  2X83 A;  2V4X A;  5HGN A;  2PWO A;  2X2D D;  4XFZ A;  4E91 A;  2WLV B;  4PH2 A;  2M8P A;  1U7K A;  3MGE A;  2JPR A;  1E6J P;  2XGV A;  2EIA A;  4NX4 C;  3BP9 A;  2XDE A;  2GOL B;  4U0E A;  1M9C C;  4XFY A;  4LQW C;  3NTE A;  2WLV A;  4WYM A;  2LF4 A;  5HGM A;  1M9X C;  2PWM A;  2M8L A;  1EM9 A;  4DGA C;  2X82 A;  4QNB A;  3H4E A;  3H47 A;  1M9F C;  1G03 A;  1M9D C; 
#chains in the Genus database with same CATH topology
 4INB A;  4XRQ A;  4E92 A;  2KGF A;  1L6N A;  2PXR C;  4PH0 A;  5HGK A;  4XRO A;  4U0A A;  4B4N A;  5JPA A;  1M9E C;  4DGE C;  1P7N A;  2GON A;  1EIA A;  1D1D A;  4U0D A;  5HGO A;  4U0F A;  1AK4 C;  4U0B A;  3P05 A;  2XGU A;  4HTW A;  1QRJ A;  1GWP A;  2M8N A;  4XFX A;  2Y4Z A;  1AFV A;  4J93 A;  1M9Y C;  5HGL A;  4PH3 A;  4U0C A;  2XGY A;  2X83 A;  2V4X A;  5HGN A;  2PWO A;  2X2D D;  4XFZ A;  4E91 A;  2WLV B;  4PH2 A;  2M8P A;  1U7K A;  3MGE A;  2JPR A;  1E6J P;  2XGV A;  2EIA A;  4NX4 C;  3BP9 A;  2XDE A;  2GOL B;  4U0E A;  1M9C C;  4XFY A;  4LQW C;  3NTE A;  2WLV A;  4WYM A;  2LF4 A;  5HGM A;  1M9X C;  2PWM A;  2M8L A;  1EM9 A;  4DGA C;  2X82 A;  4QNB A;  3H4E A;  3H47 A;  1M9F C;  1G03 A;  1M9D C; 
#chains in the Genus database with same CATH homology
 4INB A;  4XRQ A;  4E92 A;  2KGF A;  1L6N A;  2PXR C;  4PH0 A;  5HGK A;  4XRO A;  4U0A A;  4B4N A;  5JPA A;  1M9E C;  4DGE C;  1P7N A;  2GON A;  1EIA A;  1D1D A;  4U0D A;  5HGO A;  4U0F A;  1AK4 C;  4U0B A;  3P05 A;  2XGU A;  4HTW A;  1QRJ A;  1GWP A;  2M8N A;  4XFX A;  2Y4Z A;  1AFV A;  4J93 A;  1M9Y C;  5HGL A;  4PH3 A;  4U0C A;  2XGY A;  2X83 A;  2V4X A;  5HGN A;  2PWO A;  2X2D D;  4XFZ A;  4E91 A;  2WLV B;  4PH2 A;  2M8P A;  1U7K A;  3MGE A;  2JPR A;  1E6J P;  2XGV A;  2EIA A;  4NX4 C;  3BP9 A;  2XDE A;  2GOL B;  4U0E A;  1M9C C;  4XFY A;  4LQW C;  3NTE A;  2WLV A;  4WYM A;  2LF4 A;  5HGM A;  1M9X C;  2PWM A;  2M8L A;  1EM9 A;  4DGA C;  2X82 A;  4QNB A;  3H4E A;  3H47 A;  1M9F C;  1G03 A;  1M9D C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...