3BPJA

Crystal structure of human translation initiation factor 3, subunit 1 alpha
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
70
structure length
70
Chain Sequence
GIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFLEVLVRDVCISLEIDDLKKITNSLTVLCSEKQKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of human translation initiation factor 3, subunit 1 alpha.
rcsb
molecule keywords Eukaryotic translation initiation factor 3 subunit J
molecule tags Translation
source organism Homo sapiens
total genus 26
structure length 70
sequence length 70
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.60 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Eukaryotic translation initiation factor 3 like domains 3bpjA00
3BPJA
chains in the Genus database with same CATH superfamily
3B9MA 2K0NA 3LU6A 2AGHB 2BXMA 2EFCA 4W4UB 2ROHA 2AJEA 5D7GA 5ID7A 2BXHA 4NAWB 3H37A 4ZBQA 4MBEC 5DQFA 5HOZA 1KW2A 4OR0A 4DHXB 4F5TA 2QHBA 1BKEA 2DBUA 2I2ZA 1TXUA 2XSIA 4N0FD 3WHSA 1BJ5A 2KBZA 2Z8KA 4GDXA 4S1YA 1LOTA 3A73A 3H3AA 2BXIA 1E7IA 2DG5A 2XVWA 1HA2A 3A75A 3GQXA 5DBYA 2DBXA 4K2CA 3LU8A 3V08A 5GIPA 4ZC6A 2NQOA 4PO0A 1J7EA 1GNJA 4K71A 1MA9A 4F5UA 4DM0A 4N0UD 2NNWA 3GQUA 1O9XA 2I30A 1HK2A 4M70B 2OT3A 4FIPB 3VQIA 2JUHA 2LOQA 2XVQA 1FOUA 3G9KD 3NVMA 3FWBC 4ZBRA 3ECPA 1MIWA 4LB2A 1VFIA 1MIYA 3JQZA 2BXBA 2XW0A 2XMOA 3KIKA 3PLAA 4EMXA 1AO6A 1KXPD 3UIVA 2XW1A 2BXAA 2BXCA 1HK4A 5IJEA 1VZSA 2DYOA 2OZBB 1N5UA 2XVUA 4HGKA 1SB0A 2EFHA 4LA0A 2LQIA 1E78A 3TDLA 1BM0A 2CKXA 4OTTA 3NVIA 1MUSA 5IFOA 4Z69A 2Z8JA 4ZUXV 3KJLA 4LUHA 4JK4A 4OT2A 4L9KA 4G01A 4Z9OA 1HK1A 3M99C 2BXDA 4FK5B 1JNBA 5GIOA 1GNIA 4TQ1A 1E7AA 2BXKA 2QM6A 4G04A 4GDKB 5B5TA 1J78A 4FJCB 2V36A 3GA9L 2BXOA 1NT2B 2DYMA 2BXFA 2LXTA 1E7GA 3ICXA 4L8UA 2EFEA 1E7BA 4C31B 2DBWA 1E7FA 5IIXA 4D7XA 3CX9A 4IW2A 4J2VA 4HGMB 3JRYA 1H9ZA 5GINA 1KDXA 4N3ZA 1UORA 4LUFA 2VDBA 4ZBKA 4F5SA 5IJFA 2BX8A 4GG2A 3SIUB 5BPKA 2BXLA 3V09A 2KWFA 2YDFA 2E0YA 4E99A 3FNMA 1MUHA 2LXSA 4F5VA 4GDLB 3V03A 1MM8A 1E7HA 3MHSB 1HK5A 5ID9A 2GUTA 3SIVB 1LNSA 3SQJA 2BXQA 2VUEA 4WA6B 3WHRA 2BXPA 2BXNA 3BPJA 4G03A 4I9OA 4TQ0A 5FUOA 1HK3A 1MIVA 3NVKA 2Z8IA 4BY9C 2EFDA 4IW1A 4ZCGA 2LQHA 3NMUA 5IIUA 2BXEA 4L9QA 4LB9A 1E7EA 1IJGA 3WHQA 5IJ5A 2BXGA 5GHKA 4OTUA 1H5WA 2E0XA 4BKEA 3W1SA 2VUFA 2QMCA 3B9LA 3FWCC 3LU7A 2XVVA 3MHHB 1E7CA 5IIHA 1TF0A
chains in the Genus database with same CATH topology
3BPJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BPJ A; 
#chains in the Genus database with same CATH topology
 3B9M A;  2K0N A;  3LU6 A;  2AGH B;  2BXM A;  2EFC A;  4W4U B;  2ROH A;  2AJE A;  5D7G A;  5ID7 A;  2BXH A;  4NAW B;  3H37 A;  4ZBQ A;  4MBE C;  5DQF A;  5HOZ A;  1KW2 A;  4OR0 A;  4DHX B;  4F5T A;  2QHB A;  1BKE A;  2DBU A;  2I2Z A;  1TXU A;  2XSI A;  4N0F D;  3WHS A;  1BJ5 A;  2KBZ A;  2Z8K A;  4GDX A;  4S1Y A;  1LOT A;  3A73 A;  3H3A A;  2BXI A;  1E7I A;  2DG5 A;  2XVW A;  1HA2 A;  3A75 A;  3GQX A;  5DBY A;  2DBX A;  4K2C A;  3LU8 A;  3V08 A;  5GIP A;  4ZC6 A;  2NQO A;  4PO0 A;  1J7E A;  1GNJ A;  4K71 A;  1MA9 A;  4F5U A;  4DM0 A;  4N0U D;  2NNW A;  3GQU A;  1O9X A;  2I30 A;  1HK2 A;  4M70 B;  2OT3 A;  4FIP B;  3VQI A;  2JUH A;  2LOQ A;  2XVQ A;  1FOU A;  3G9K D;  3NVM A;  3FWB C;  4ZBR A;  3ECP A;  1MIW A;  4LB2 A;  1VFI A;  1MIY A;  3JQZ A;  2BXB A;  2XW0 A;  2XMO A;  3KIK A;  3PLA A;  4EMX A;  1AO6 A;  1KXP D;  3UIV A;  2XW1 A;  2BXA A;  2BXC A;  1HK4 A;  5IJE A;  1VZS A;  2DYO A;  2OZB B;  1N5U A;  2XVU A;  4HGK A;  1SB0 A;  2EFH A;  4LA0 A;  2LQI A;  1E78 A;  3TDL A;  1BM0 A;  2CKX A;  4OTT A;  3NVI A;  1MUS A;  5IFO A;  4Z69 A;  2Z8J A;  4ZUX V;  3KJL A;  4LUH A;  4JK4 A;  4OT2 A;  4L9K A;  4G01 A;  4Z9O A;  1HK1 A;  3M99 C;  2BXD A;  4FK5 B;  1JNB A;  5GIO A;  1GNI A;  4TQ1 A;  1E7A A;  2BXK A;  2QM6 A;  4G04 A;  4GDK B;  5B5T A;  1J78 A;  4FJC B;  2V36 A;  3GA9 L;  2BXO A;  1NT2 B;  2DYM A;  2BXF A;  2LXT A;  1E7G A;  3ICX A;  4L8U A;  2EFE A;  1E7B A;  4C31 B;  2DBW A;  1E7F A;  5IIX A;  4D7X A;  3CX9 A;  4IW2 A;  4J2V A;  4HGM B;  3JRY A;  1H9Z A;  5GIN A;  1KDX A;  4N3Z A;  1UOR A;  4LUF A;  2VDB A;  4ZBK A;  4F5S A;  5IJF A;  2BX8 A;  4GG2 A;  3SIU B;  5BPK A;  2BXL A;  3V09 A;  2KWF A;  2YDF A;  2E0Y A;  4E99 A;  3FNM A;  1MUH A;  2LXS A;  4F5V A;  4GDL B;  3V03 A;  1MM8 A;  1E7H A;  3MHS B;  1HK5 A;  5ID9 A;  2GUT A;  3SIV B;  1LNS A;  3SQJ A;  2BXQ A;  2VUE A;  4WA6 B;  3WHR A;  2BXP A;  2BXN A;  3BPJ A;  4G03 A;  4I9O A;  4TQ0 A;  5FUO A;  1HK3 A;  1MIV A;  3NVK A;  2Z8I A;  4BY9 C;  2EFD A;  4IW1 A;  4ZCG A;  2LQH A;  3NMU A;  5IIU A;  2BXE A;  4L9Q A;  4LB9 A;  1E7E A;  1IJG A;  3WHQ A;  5IJ5 A;  2BXG A;  5GHK A;  4OTU A;  1H5W A;  2E0X A;  4BKE A;  3W1S A;  2VUF A;  2QMC A;  3B9L A;  3FWC C;  3LU7 A;  2XVV A;  3MHH B;  1E7C A;  5IIH A;  1TF0 A; 
#chains in the Genus database with same CATH homology
 3BPJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...