3BPJA

Crystal structure of human translation initiation factor 3, subunit 1 alpha
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
70
structure length
70
Chain Sequence
GIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFLEVLVRDVCISLEIDDLKKITNSLTVLCSEKQKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Eukaryotic translation initiation factor 3 subunit J
publication title Crystal structure of human translation initiation factor 3, subunit 1 alpha.
rcsb
source organism Homo sapiens
molecule tags Translation
total genus 26
structure length 70
sequence length 70
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.60 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Eukaryotic translation initiation factor 3 like domains 3bpjA00
3BPJA
chains in the Genus database with same CATH superfamily
1J78A 1GNIA 2XVWA 3WHRA 1IJGA 5BPKA 5GIPA 2ROHA 3LU7A 4PO0A 1HA2A 3SQJA 3FWCC 1E7EA 2K0NA 1E78A 2EFHA 2XMOA 2DYOA 2BXOA 1E7HA 2I30A 3KIKA 2BXLA 2E0XA 2LXTA 4N0FD 5HOZA 3V03A 2BXKA 3A73A 3UIVA 1E7FA 4BY9C 2XSIA 3B9LA 2VUEA 1E7CA 2XW0A 4E99A 1VZSA 1UORA 1KXPD 4DHXB 1N5UA 1SB0A 2NQOA 2QMCA 4LA0A 4N0UD 5IIUA 5GINA 2OZBB 5IJ5A 3NMUA 1TF0A 5B5TA 3LU8A 1HK2A 3MHSB 1E7BA 1BJ5A 2LOQA 2LXSA 2LQHA 3KJLA 4LB9A 1KW2A 2VDBA 4F5SA 4ZUXV 2AGHB 2Z8JA 2BXHA 4G04A 1GNJA 2BXFA 2LQIA 2GUTA 3H37A 1J7EA 4HGKA 4TQ1A 5DBYA 3FWBC 3ICXA 3B9MA 1TXUA 2XW1A 5IFOA 3LU6A 3V08A 3NVIA 4M70B 4LUFA 3GA9L 4GDKB 3BPJA 3SIVB 4OTTA 4ZCGA 1E7GA 2Z8KA 2BXMA 2XVUA 3GQUA 3TDLA 5IJEA 1MUSA 2E0YA 4FJCB 3V09A 2XVQA 4IW1A 5ID9A 1AO6A 3ECPA 3M99C 4L8UA 1MUHA 2XVVA 4GDXA 4Z69A 2V36A 4F5VA 4D7XA 1VFIA 2BXEA 2EFDA 2JUHA 4I9OA 2NNWA 4OR0A 3WHQA 2BXIA 2VUFA 3MHHB 4S1YA 4BKEA 5DQFA 4LB2A 4N3ZA 1JNBA 4L9QA 4F5UA 1MIVA 3FNMA 4HGMB 1NT2B 4L9KA 4C31B 4FK5B 4ZBRA 4W4UB 5IIHA 2AJEA 4Z9OA 4WA6B 2BXBA 2YDFA 5GIOA 1HK3A 3G9KD 4G01A 4GDLB 2EFEA 4MBEC 5GHKA 2BXGA 1LOTA 4TQ0A 1H5WA 1HK4A 3W1SA 2DYMA 1KDXA 1E7IA 4OT2A 1E7AA 2EFCA 3PLAA 1MIYA 1MIWA 2QHBA 2DBUA 2BXCA 4LUHA 2BXPA 2I2ZA 2OT3A 4JK4A 1HK1A 4ZC6A 2DBWA 4G03A 4NAWB 2BX8A 3H3AA 4ZBKA 1O9XA 4ZBQA 2KBZA 3JQZA 3VQIA 5ID7A 4J2VA 1MA9A 4IW2A 3JRYA 3NVKA 4FIPB 1HK5A 1LNSA 3SIUB 4F5TA 2BXDA 2Z8IA 4EMXA 1BM0A 1H9ZA 5D7GA 5FUOA 5IIXA 4GG2A 2KWFA 2DG5A 3CX9A 1BKEA 3GQXA 2DBXA 1MM8A 2BXAA 2CKXA 4DM0A 2BXQA 5IJFA 4K71A 4K2CA 3A75A 3WHSA 1FOUA 2QM6A 2BXNA 3NVMA 4OTUA
chains in the Genus database with same CATH topology
3BPJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BPJ A; 
#chains in the Genus database with same CATH topology
 1J78 A;  1GNI A;  2XVW A;  3WHR A;  1IJG A;  5BPK A;  5GIP A;  2ROH A;  3LU7 A;  4PO0 A;  1HA2 A;  3SQJ A;  3FWC C;  1E7E A;  2K0N A;  1E78 A;  2EFH A;  2XMO A;  2DYO A;  2BXO A;  1E7H A;  2I30 A;  3KIK A;  2BXL A;  2E0X A;  2LXT A;  4N0F D;  5HOZ A;  3V03 A;  2BXK A;  3A73 A;  3UIV A;  1E7F A;  4BY9 C;  2XSI A;  3B9L A;  2VUE A;  1E7C A;  2XW0 A;  4E99 A;  1VZS A;  1UOR A;  1KXP D;  4DHX B;  1N5U A;  1SB0 A;  2NQO A;  2QMC A;  4LA0 A;  4N0U D;  5IIU A;  5GIN A;  2OZB B;  5IJ5 A;  3NMU A;  1TF0 A;  5B5T A;  3LU8 A;  1HK2 A;  3MHS B;  1E7B A;  1BJ5 A;  2LOQ A;  2LXS A;  2LQH A;  3KJL A;  4LB9 A;  1KW2 A;  2VDB A;  4F5S A;  4ZUX V;  2AGH B;  2Z8J A;  2BXH A;  4G04 A;  1GNJ A;  2BXF A;  2LQI A;  2GUT A;  3H37 A;  1J7E A;  4HGK A;  4TQ1 A;  5DBY A;  3FWB C;  3ICX A;  3B9M A;  1TXU A;  2XW1 A;  5IFO A;  3LU6 A;  3V08 A;  3NVI A;  4M70 B;  4LUF A;  3GA9 L;  4GDK B;  3BPJ A;  3SIV B;  4OTT A;  4ZCG A;  1E7G A;  2Z8K A;  2BXM A;  2XVU A;  3GQU A;  3TDL A;  5IJE A;  1MUS A;  2E0Y A;  4FJC B;  3V09 A;  2XVQ A;  4IW1 A;  5ID9 A;  1AO6 A;  3ECP A;  3M99 C;  4L8U A;  1MUH A;  2XVV A;  4GDX A;  4Z69 A;  2V36 A;  4F5V A;  4D7X A;  1VFI A;  2BXE A;  2EFD A;  2JUH A;  4I9O A;  2NNW A;  4OR0 A;  3WHQ A;  2BXI A;  2VUF A;  3MHH B;  4S1Y A;  4BKE A;  5DQF A;  4LB2 A;  4N3Z A;  1JNB A;  4L9Q A;  4F5U A;  1MIV A;  3FNM A;  4HGM B;  1NT2 B;  4L9K A;  4C31 B;  4FK5 B;  4ZBR A;  4W4U B;  5IIH A;  2AJE A;  4Z9O A;  4WA6 B;  2BXB A;  2YDF A;  5GIO A;  1HK3 A;  3G9K D;  4G01 A;  4GDL B;  2EFE A;  4MBE C;  5GHK A;  2BXG A;  1LOT A;  4TQ0 A;  1H5W A;  1HK4 A;  3W1S A;  2DYM A;  1KDX A;  1E7I A;  4OT2 A;  1E7A A;  2EFC A;  3PLA A;  1MIY A;  1MIW A;  2QHB A;  2DBU A;  2BXC A;  4LUH A;  2BXP A;  2I2Z A;  2OT3 A;  4JK4 A;  1HK1 A;  4ZC6 A;  2DBW A;  4G03 A;  4NAW B;  2BX8 A;  3H3A A;  4ZBK A;  1O9X A;  4ZBQ A;  2KBZ A;  3JQZ A;  3VQI A;  5ID7 A;  4J2V A;  1MA9 A;  4IW2 A;  3JRY A;  3NVK A;  4FIP B;  1HK5 A;  1LNS A;  3SIU B;  4F5T A;  2BXD A;  2Z8I A;  4EMX A;  1BM0 A;  1H9Z A;  5D7G A;  5FUO A;  5IIX A;  4GG2 A;  2KWF A;  2DG5 A;  3CX9 A;  1BKE A;  3GQX A;  2DBX A;  1MM8 A;  2BXA A;  2CKX A;  4DM0 A;  2BXQ A;  5IJF A;  4K71 A;  4K2C A;  3A75 A;  3WHS A;  1FOU A;  2QM6 A;  2BXN A;  3NVM A;  4OTU A; 
#chains in the Genus database with same CATH homology
 3BPJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...