3BPOB

Crystal structure of the il13-il4r-il13ra ternary complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
198
structure length
198
Chain Sequence
b'DPFKVLQEPTCVSDYMSISTCEWKMNGPTQCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADQYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTQVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYQVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin 13
publication title Molecular and Structural Basis of Cytokine Receptor Pleiotropy in the Interleukin-4/13 System.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/cytokine receptor
total genus 29
structure length 198
sequence length 198
ec nomenclature
pdb deposition date 2007-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09238 IL4Ra_N Interleukin-4 receptor alpha chain, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bpoB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bpoB02
5D9SB 1A9EB 3U2SB 4AIZA 2W92A 3PV6A 5GRVK 2J5LB 5EU6B 3MV01 4EN3D 1KLFA 2DLGA 1K9TA 4H8WC 1N7ML 1NCNA 3O4LA 5EULV 3WFHA 4PJEA 3IFLH 1MCNA 4BUHA 4IIQC 4PJFA 4YGAB 5F89A 4H20H 4UU9A 3RX7A 3S36H 3T0VA 4LQFL 1V3KA 3GSRA 5T33L 2NQCA 4ZAKD 4HUXB 1KENL 1CG9B 4CNIA 4JGUA 3VD3A 4HGKC 4MVBD 1QRNB 1IGIL 4GW1B 5J89A 1BFVH 3GMMB 5IF0B 1BX2A 4OZIB 1KEGL 3ZTNL 4F15C 3FO9A 2Y07H 3LSOA 4HKZB 4M7JH 4G9FA 1MJ8H 2HLFD 3QDMA 1RUAL 3QIWD 2BY1A 4M7LL 2P5WE 4KDWA 3P4OA 4OCRH 1R6VA 1FZMA 1NAMB 4V1DA 5J6HA 5L0QB 2VO5A 3ULVC 3I6LD 2AK1H 4OSUH 3OKMA 5FKAA 3JBG7 4JEGB 2HTLD 4ZO6A 5E8EA 1JNHB 5KVEL 3QWOB 3FT3B 5CHNB 1WFNA 35C8L 3RZCD 4PGEB 5AWNL 2NY3B 4WWKC 4PJAA 4RIRB 3G5ZA 3IDGA 2NLJB 5MENA 5B38G 5IFJA 4Y8AA 3BKYH 2FL5B 3OKLB 3R8QA 2YD2A 1PW3A 3HMXH 4XNXL 4HH9B 4JZJA 4HUKB 1DUYB 5CIPH 1LO4L 1PKQE 2VAJA 5DD1H 3BH9B 1MJJB 1Y18A 2VLKA 2F19L 2W9LA 1FC2D 2A73A 3HCVB 3EJZC 4QWWD 3K1KC 1AJ7H 3TF7C 3GMPA 1KN4H 1OGAE 1ETZA 1OARH 2F53E 1WUNT 3TBVA 1X6LA 4XC1H 3FQNB 2IH1B 1R5VA 3CCHB 1TITA 1YEIL 5D72H 2ILLA 4R90H 1T4KA 2YWYA 4EI6A 2VQ1B 1WFUA 4JFEA 2YD9A 2FZ3A 3MODH 2EDKA 1BZ9A 1R5WA 2YPVL 4QHLA 3CH1B 1GSMA 1CR9L 1C12B 3HC0A 2OQJA 1S7RA 1NCCL 4NZTH 1ZT7A 4PUBL 4Z78B 4RWYL 1KB5A 2CJUH 1U3JA 1DE4B 4NFBA 4LVNC 4KGLA 3V4PH 5EU3A 5HPMA 5EIQA 1KACB 3ZT5A 4RX4D 5IVXA 1NFDA 4MCYA 3OAUL 4I1NB 2MQCA 4OM1H 2CDGB 4R6UA 5F9WC 1UVQA 2Y06H 3QCTL 1WAAA 4QRPD 1JGUH 3K46A 3PIQB 4ZOEA 4F33B 5C09D 4NZDA 2JF1A 2ZUTA 1S9YB 2X42A 3FQXA 3TJHC 3PWNB 1QFPA 3R1GL 1KN2H 1QYGH 3MXVH 1JP5A 3FHAA 3ZSSA 3UTOA 5FM8A 2FO4B 3PGCB 1L0QA 2CLVA 1TDQA 3MR9B 4WEBL 3MFFB 4DTGH 4JRXB 5I1DA 5FGRA 5JXEA 4KQ4H 1CU4H 4E41A 1XGUB 2BMKA 4ZUSB 5ICZA 3U30B 2P1YA 2Q76B 5E8PB 1B4JH 3H9ZA 1DFBH 5CEXA 1YNKL 1YN6B 1QSEB 2A6KB 3VXMD 3PWLA 1KPUA 5CCKH 5BZWA 1QFUH 2AGJL 4LLMB 2VZOA 2Z8VC 4QXTA 1ZA6B 1EO8L 5JOFB 3MNZA 2Y6SD 5H94A 1ZANL 3S35H 3BT2L 3BIAX 1J88A 3KJ4C 2Q3ZA 5DC4B 1FPTH 1JIBA 5GIRA 4DW2H 5CP3H 4M1CD 2MSPA 4LPWA 1VA9A 4JGJA 1AD0A 4XZUB 1D9KD 3BOVA 4LU5L 3C5ZD 4F37F 4B41A 5C0JB 2EDHA 2FLBT 3B9EA 4NUGL 1P4BL 5ID0A 1WISA 1A7PH 3LRGA 4MAUH 5I18H 2X4TB 4S1RH 4GMSL 2EDNA 4MJIE 1YN7B 4L3EA 4K71C 1RAMA 1XGQA 2X05A 1KIQB 3ULUL 2FIRT 4P2QB 2IFFH 3WXVL 5JXAL 2XZAL 4RFEA 1DUZA 3UJIH 2AXFB 2DF3A 2FEDC 1A0QH 1MI5B 2G2RA 1RURL 1KCLA 2WINB 1I1CA 4L29A 2DJSA 1N64H 4YC2C 3M17B 2E6PA 3KPSE 2LTQB 1TTGA 4NKDB 2ADFL 3VXSA 3E6FB 1AO7A 5FGCB 5IEHB 1JZ8A 1RK0A 3DROA 4MB4A 4FXKA 3SDAC 1MLCA 4XTRC 2MHAB 3PGFH 1MCHA 3C8KB 4MDIB 1XCQA 3ARDC 5T3ZL 4L9LC 2Y5TA 2FJFA 4NBYB 2CRZA 5F9AC 2ZG3A 4R96A 1V3MA 4Y1AE 3ILPA 3U82B 1Q94A 2GK2A 1T89C 2DJUA 3D2UD 3VWKD 4IOIB 3UTQB 5IW1A 4GBXB 4P2OC 1FRGH 5EZLB 3WN5B 2E6JA 5ESQB 3WL9A 5I19L 2QKIB 1XGRA 2F5AL 4JM2D 5GS1A 3ESUF 4XP4H 3E8UL 4IRJC 1KFAL 1W8NA 2DTML 2VIRB 5HHQB 4PRPB 1CICB 3D39A 5D1XD 1BD2A 1KB9J 1QHOA 1T21A 1DVFB 1NBYA 3STZB 4OF7A 3I6GA 4NKMA 1WWWX 1B0GB 5EC2A 4XP1L 1AGCB 4Y5XA 3VRJA 3KVQA 4PTUB 5DZOA 3LKNA 5F9DC 5FO9B 3RTQB 4U6HB 4O5LH 2NY0D 1G7JB 1CFBA 1ORQB 3MRBB 2JTDA 4ZUWB 1DBAL 1KCSH 5EZJB 3MBXL 3WEXB 4MNGE 2GKIA 1I1AB 4OJFH 4P49A 2DQFA 1QBBA 5HJ3B 4NPYB 4UOW1 4YDKL 1U0QA 4U05A 4KUCF 2D4FA 2YZ8A 4XH2B 1NCBL 3SDCC 5CJXA 4GMTH 1HXYA 2CKBA 3P73A 5JDJA 3MUGA 5KSVA 3MLRH 3UTSA 2EYRB 2JCCB 5DFVD 5EBLA 3MREA 3VFUA 1HSAB 1KT2A 1R5IA 5I8CA 1FYTB 3NVQA 4XXCC 1RVFH 5KSBF 1R3KA 5I1EL 1K2DA 3MRQA 4Y2DD 12E8L 1QO3A 3NAAL 2BVQB 2RR3A 5EIVA 5F72S 2BC4A 1ZS8A 3O6KL 1INEH 3HE6D 2ESVB 2AK4A 5L9DL 4PBXA 2YRZA 1MPAL 1I3GL 2BNRA 4LCCC 3VFWA 4HLJA 1HI6B 2ZCHH 4IS6A 3LN4A 2Z93A 1FL5A 3D69B 5DJ6B 3GSOB 5E9DD 3HPJB 5IB4A 3S3JA 3LPWA 4OFDA 1SBBA 4LSTH 3SN6N 5BVJB 5B39A 1A6ZA 4RBPH 1M6OA 5IESH 2FHFA 4QRRB 2BSED 4KRNA 4NT6B 4Y4KB 3SKJL 4CBPA 3UZEA 4LPCA 1S5IH 1B0RA 4G6MH 4HQQL 4JY4A 4LKCA 3H42H 1G9MH 2XWJB 3AY4C 4UT6L 1N5YH 4ZS7L 3MLSH 2GFBA 1T2XA 2Q8AH 3CUPB 1U2CA 5C0IA 1OCWH 4U6YA 1GOGA 4URTB 1PG7W 4N8PA 2ZP0T 2P24B 3TBYB 1IQDB 3Q2CA 2V6HA 5IBTL 3QEHA 1TETL 4LLWA 4QXGL 4RAHA 3TBSA 5C0CB 5CKGA 2B2XL 2PYED 5BRZA 5TE7H 1IGFL 3QEQE 5DS8B 4BH7A 3S8WA 2X9WA 5D7IE 3OKYA 5T3XH 4MHHG 3DXAE 4FNLL 5MI0C 1W72B 5I0DA 2F74A 2A1WH 2EH8L 4Y4FD 2JB6A 4NZUH 4YR6A 1IC7H 1JVKA 3BPNC 3O9WC 2CXGA 3RBSA 1T1WA 2EE2A 4IIQB 4ZD3L 5FFLA 2VAAA 1RU9H 1J0ZA 1GC1H 5DD6B 4A6YL 5F1NA 3O0RH 3B9DA 3S88H 4XAWL 4FQXD 1CL7L 3BPLC 4KKCD 5JW4Q 3WLBA 2I9TA 2VXQL 1E4XH 3NCCB 2RCSL 3FRUA 1REIA 1B6UA 3L7FA 4NP4L 2P7TB 2PTTB 1I9EA 4X4XA 3S5LB 5DT1H 1G0DA 3BJLA 1IGCL 2BJML 3QWRA 1BAFL 1J12A 4NHCH 2P8LA 1ORSB 3D5OF 1ONQB 5KJRL 3QDGE 1AGBA 1DEDA 3Q48A 1AGEA 2YBRB 4OF6A 4NHUB 5EOCJ 5TE6H 1ZLUH 4KGJA 2C3XA 1CVSC 3P4NB 4JFFD 2V5RA 3CGTA 4CVZA 3F7QA 5I1CH 4KI5E 3HI5L 1Q9KB 3GRWA 3R0MA 1IGTB 2V17L 4P57B 1N3NA 5TDPB 1IVLA 1C7SA 1OSPH 3MV8E 5H37G 3VXUE 4NM8L 2BHZA 4P9HC 1VEPA 5A2KH 3P4MA 3PHQA 5HHOA 1DJSA 3C6LC 2DDQL 3QZWA 1QSFB 4WFHD 1JI1A 2IQAB 1JJUA 2H32B 1EGJL 1A6VH 4MXQD 2J8UE 4QRSA 3GK8H 2WMPA 4PRAB 3ULSA 2VC2L 5EPMA 1K8DB 4UTAH 3V6FB 1KTLA 3TNNA 5J1TC 2X9YA 4D0BB 3U46B 2HT4C 2V2XA 1RFDL 3F6IA 1JHTB 4TSCH 1H3TA 2X41A 4LKXB 3JV4A 2IFGA 2KBGA 3JWDH 2QQKH 3QEGH 3DI3B 4K2UL 1FNSL 1CFQB 1KB5H 3GNMH 2RBLA 5IHUL 3MRKB 4LLVB 5D7IF 2VJXA 3V5HA 4PGZA 5ADOL 3V52L 1J10A 2XICA 4LVNB 1NGYB 5FHAL 3KPNA 5DLMH 3MJ9A 4OBSA 1JN6B 3EJJX 2G5BA 1YY8A 4QY8A 4JAMA 2QL1A 5IFHL 5J6GB 5T1LD 1RPQA 5F9WB 1CF8L 4X7TA 1MHCB 2EEBA 2DL2A 4G6KH 3BE1H 4RRPA 3WUWB 3X11A 3CFKA 2PR4H 2Z91A 1R3LA 2EE9A 4M61B 4UQ2A 1CLYL 2X7LB 4JQVA 1J87A 4TSBL 2VH5H 2P4AB 3M1BB 4HSQA 2X4QB 3MV7B 3FN3A 4X6FB 1IEHA 4XRCB 4G6JH 3JV0A 5IP4A 4N8VA 5IGXL 2IBZY 3MRPA 2HVJB 2XQYK 5F6IC 2HFFA 1CLCA 4WI9A 3DSFH 4I3SL 1AP2B 2WIMA 4JFZL 5LGHL 1Z5LA 4Z7NE 3MRGA 2GW5A 4J1UB 1FGVH 5AEAA 1TVBA 3KS0J 4NBXB 1EEZB 5I6XC 2FJGA 4KI5F 3HG1D 2FATH 4TRPH 5JOPD 1ZWIA 2ICEA 5HHMB 2YA2A 2IQ9L 3D85A 3EYFA 3EIFA 4KUZH 5ADPL 2R4RL 1GHFH 2DWDB 1VGKB 1H5BA 4MLIA 5DRZA 3T4AA 3FQUB 5FM4A 4UUJB 3RWJB 3BAEL 1JUFA 3FZUC 4NDMB 1G7HA 5E7FA 1RJZA 1ZLWH 4CW1B 1K4CB 4AMKH 3PWPB 2XTJD 4HG4K 1BPVA 1L7TH 1O7SA 2ICWI 3QPQC 1KG0B 1FO0B 3MOQA 4K71B 3C5JA 4NNYA 5C07B 2NY5L 1F5WA 4JANA 4N1HB 5M7QA 3GIZH 5E8OB 4OLXH 1EFXA 1UYWL 2AV7A 5DC0A 4U7MA 3BWAB 3BKMH 4PG2C 3LS4L 3P4LA 2UY6A 3QCVL 4XVTL 3EJYD 4LBEA 5JQHC 3RWGA 4PRDA 3EYOB 1Q9OA 4GRWE 4JHWL 4ONGH 2H41A 4RISH 5TFSL 4OZFA 5JW4R 4QT5B 5CBEA 5DSCB 4YC2B 5JHDD 5C9JB 2ADIA 1P7QD 2R29H 2Z8SA 5HGBA 3SDAB 3LB6C 5CGMA 4QKXB 1T1ZA 3V0WH 3ARDB 3LVEA 4L9LB 1NJ9B 4JDZB 5TQ0L 4X80L 1S7TA 1J8HD 4MAYA 4QRTB 3HAEB 2F54A 5E00A 3WD5H 1ZGLP 2PCPB 5I2IA 4PRID 4G5ZH 5DMKB 3S7GA 4P2OB 3JV6A 3FQTA 4NO0B 1OAZH 1FN4A 1H8SA 5JPMB 1F13A 3CPLB 3BN9C 5J06A 4Q9CA 3M8OH 4U4BA 3Q0HA 1H8OA 1YEGH 4IRJB 3QYCA 2DLIA 4U6TA 4YEEA 5DWUH 4X4MA 5FUZH 1OP3H 1BM3H 1FHGA 3WNOA 2O5XH 1T04B 1TIUA 4X6EB 3RL2A 2R1YB 2J88H 3GKWH 4PGCA 2IPKB 5FA3A 2VZUA 1X5JA 1XCTB 2KDGA 3PE9A 2P49B 3DRQA 3MLVL 5GJTL 1KCRL 4PS4H 4Z7NF 4BQ8A 1V7NL 4JRWA 5C08E 4Z7WE 5D8JL 5GS2D 4WFGE 4JPVH 3X12A 3K1DA 5DDHB 4TQEL 5T5FH 4PJHF 1E4XI 4X7DC 3T65A 2DN7A 4U1IA 5GZND 4FTVE 3RDTA 2EXWC 2EEDA 3ZYJA 3RWFA 4JO1L 1HDMA 4N0FB 2CKBH 3S4SB 4KK9D 3O8XD 2VXTL 1D5ZB 5HYIA 2KQNA 3W9EB 5HHPB 1IARB 4U1SB 3SDCB 4CMMA 3O3AB 4G6AC 5FUOL 5HSFA 3VFPB 4PJGE 2R2BA 4IBLT 2R1WB 2F58L 1U8NA 2AEQH 2BCKA 4LRNH 4ISVA 3UJTL 3VGBA 4GG8B 2UVEA 3QUKB 2CDEB 3LZFL 1H0DA 1A3RH 3TT1L 4MDJB 1CGYA 1CS6A 3IXAA 4NJ9L 3VFVB 4XWOD 1GGYA 1JWSA 2A9NH 1MFEL 4KFZC 1NDGA 4GRWF 2KL6A 4HF5H 4ONHA 4P5TD 1GGBH 2W0FB 3U4AA 2VZTA 3PP3K 1SYVB 4GG6A 4ZO9A 4KDVA 3E2HC 1Y0LA 4IMKA 1E27A 5HYJA 2JJWA 1YMHB 2GJ6A 4YHIA 2ZUUA 3VFOA 3KYOB 1U8JA 2NY7L 2M1KA 3T08A 1T83C 3V4UH 3DV4A 2AJ3B 3ALPA 4W6WB 5GZOC 1NCWL 3CFEB 5E94A 5D1ZC 4KK6C 5J1AA 1MHPH 2FEEI 4ODTH 1CDIA 1UXSA 3KPPB 4L5FL 1BREA 4NKQB 5CZXD 4KRPC 3MACH 5E8DH 4NWTL 5HGGS 1U3HA 5B21A 1UC6A 2DQUH 3MJ6A 5GS0C 2PETA 2WIIB 1VPOH 5GRVL 4EUPB 4NQEE 4YUEL 3HC3L 1FL3B 5D6CB 4HG4J 4OGZA 1K6QH 3GBNL 5I16B 3BZEB 1MH5A 3MCLL 3RKDD 1Q0XH 5LBSH 4HUWA 2VLJB 4Z7VB 5IWLA 4KY1H 4HK3J 1X4ZA 3QFJA 1BQHB 1ZHBA 4ZFOL 4WW2F 5HI4D 2VDKH 1J18A 5ALCH 3UBXA 4I77H 4Z7WF 2ICES 3EYSL 1HINL 1HQRB 4I2XE 3O41A 3UDWC 1A4KB 2EKJA 5LAXB 4Z8FL 5EUOA 3BPNB 5I30L 3O9WB 5AUMB 5IJVB 5ALBH 3DIFB 1U8KA 1S7WA 4XAKD 3FT2A 3H9HA 4FFZH 3RNQA 4GW4B 1UACL 4UQ3B 5DA4A 1NUNB 4N0UE 3TN0C 4HUUB 4OLYH 1DQDH 4LSQH 2Y9RT 4JQIL 1KCUH 3MA9H 3SBWA 3JVGC 4LLUB 3X14B 5FHBL 3SDYH 4KROC 3IKCB 1KPVB 2COQA 4ZUUA 1OT2A 3ARQA 4R7NA 2FBOJ 2EECA 2R0ZL 1EMTH 1EJOL 5F7DA 2ATPA 5FYLH 2HMIC 3GRWH 4GLRH 2EC9U 3NA4A 1BQUA 4IOFD 1NBZB 4LEXH 3WIHL 4KH2A 3I3DA 3X3FH 4AENB 3H9SE 4I8DA 1I7ZA 5BO1H 2QV2A 4LARH 3Q5YA 3KPRE 3B5TA 1QD0A 4QOKE 4NRZB 1DN2A 5C0AB 4BZYA 4KK8C 2RFXB 4GUPB 1BZ7B 3O2DL 4IDJH 4YIQA 1LEKB 3P9LA 3AAZA 2OR9H 3MJ8B 3BD4A 3BP7B 2GTWB 5EBWA 2P45B 4X8JA 1H15A 3HNVL 4O2EA 5DO2C 5LQBH 2EC8A 4BH8B 1KIUA 3O2WL 4FQIL 4AH2B 4P5MB 1N4XL 3K81A 5JHLH 4X6DA 2ZJSL 5BS0B 2GAZB 2WANA 3UTTE 5B3NA 4LRIA 2X4SB 3BVNA 4K7PH 3W11D 5D2LA 3MLUH 4JHAL 1CDYA 5C0RH 3QUZB 3SJVB 5F1IB 1ZA3A 2IANB 3MROA 1VADB 4RGNC 3ZO0A 1UZ8B 2V2WB 1LILA 4P46A 2R0LL 4ZO8A 3MJ9H 4Z0BH 3G04A 4OM0L 5I1GL 3T8XB 5IOPA 1R0AH 3FQRA 1MHEB 2DYPD 4XMKH 1ZLUK 3TBTB 3W82A 1UT9A 2WAHA 1GGCH 4P23C 3BDBA 2C1PB 4HWBL 5D96B 4PRHB 5HD8C 3GGWA 4Q9RH 3TO2A 4QF1B 3QUYA 1JI2A 3VD4A 1I9RL 2VE6A 3GHBL 5DJ8A 2VR9A 3VXTA 1CFVH 3ZYZA 1FORH 8FABB 1AIFB 4XPBH 4WGWB 5E8NA 1UCBL 5E1AA 1QBMH 2H32H 2I9LA 3OXRA 3RU8H 2JIXB 1HE7A 3QJFB 1KLUB 4XCNB 3Q5TA 4KKLD 5J11C 2WBJD 1D5MB 4FQQB 3TIEB 4XPGH 5B8CC 5F6IB 2XZQL 4X99A 1ZLSH 1RUQL 3L7EA 1I7RB 1I4FB 5JNYB 1OF2A 5TQ2H 2XN9D 5KSUB 4HZLB 2YXFA 5I6XB 5L2KD 4YXKL 3WFCH 3UC0L 4PJAE 3MYJA 1S8DB 3GBMH 4WIQA 2EXYD 5M95B 1FL6A 5JQ6H 4JO3H 5C70A 2DQHH 4M8QB 1S7UA 2VITB 1E28B 2DQTH 3O6FD 2R0WL 1X5XA 1BBDL 4POZD 3BQUD 1AQDB 1JZ5A 5DUPH 4ELMB 2RHEA 2BY2A 2AVGA 3GB7A 2FR4A 3T0EC 2VLKE 4DZBA 4JG0L 3FB7B 3MLXL 1NLDL 1MCJA 4KKBC 3N1PC 4M43H 4RMSA 3IJSA 2H26A 3MA7B 4FFWD 1HNFA 5GRJL 4X5WB 1R24A 1OL0A 1XF4B 2D7PA 5EU6E 5SWSB 5DD0H 4OZFH 5DK0A 2OLDA 2W0LA 5DJ0A 5EU4A 2BSRB 4JFHE 3WIFA 4F3FA 3IDIB 1FCCA 4GRLA 5DHYA 4UOJA 1OLLA 4MJ5A 1JWMA 1FFRA 5F9OH 2OTPA 2H2PD 5E2TL 1AC6A 3TVMD 5D7LB 1T1XA 3U36A 1S7SB 2P48B 2JJVA 2VL5B 2IEPA 4LQ1A 1FH5H 1QRNE 2I24N 5BJTB 3PQYD 4PB9L 2EC9T 2GUOA 4OZIE 3MLZL 4BK5A 4M7ZC 5C6TH 1U8OA 4AL8L 3MXWH 3TPUB 4W68A 5EOCL 2ARJB 32C2A 4BM7A 1TZIA 2C7UA 4M1GH 3QHZH 4L4VA 1LO5B 2M8XA 4D9QE 5IVXE 2AI0L 3NIGF 1NC2D 4HKJA 3SO5A 3GMNB 5TGBB 4KI1A 1I7UA 1BWWA 3VCLB 2FX8L 1LP9B 4PJ9C 4JFDA 2ZSVA 4KJWD 3MNVA 1D3CA 3ARTA 4X7SH 1MFBH 5ID1B 2HTKD 2EKSB 5DURD 3X13A 5J8OA 5MEOA 1XF1A 4G8GB 4OFYA 1TZHB 4OCNC 1NL0H 4LFHD 3EGSA 5INCA 4RFOL 1V05A 3NFNB 1CZ8L 3SQOH 2E7CA 4ZPTA 1SVCP 3STBA 3ARYA 4XGZA 4YDVB 1ND0A 2YPLB 43CAB 2X70A 4M5ZH 2ORBL 5FV2A 1JTTA 1HHGA 3TBWA 1DQJB 2VXUL 1TVHA 3IDMB 2NPLX 1C5DB 5FCUL 1I9IH 1I75A 5FGBA 2CGRL 4C83A 4RAUB 4GKZB 4HJ0D 4ZTOL 4HWZB 4JCLA 4LLYA 3TCXA 3TT3L 1MCQA 5A2LH 2AJXH 1ZKAA 1OAQL 3GMOA 4HPYL 1B0WA 3SGJC 3DVNB 2IAMD 25C8L 1M71B 1MAKA 3RWEB 3LAFA 4WU7A 3IDNA 2J4WL 1OP5K 1NSNH 3NFPB 3QH3A 4G8EB 3TPKA 5J1SC 4L1DA 1ZTXL 4KAQL 4M6NL 2PXYA 3LEVL 4H25B 5SWZB 1OTTD 3HS0B 3OWEA 4WHTA 2BOCB 5GGSY 4CN6A 3O3DB 15C8H 3PGDB 4KDTC 1VFAB 1HKLL 4FQ1H 3IRPX 5E2WH 4PJBB 1OP3K 4KZDH 5SX5H 4CU8A 4IM8A 1SHMA 3NN8B 4H1LB 1F4AA 4UT7H 4OZIF 3B9KD 1XIWC 3ZDYE 4GAFB 3A67H 4ODBD 1IGJB 4M93B 2HJLA 2VDQL 1HILA 2JK5A 4WDIA 2AKRB 2EZ0C 4EDXB 3MV9B 2BOBB 5JW5A 4JRXE 3IU3B 2NY5C 5IQ7L 4F8TA 5D1ZB 5IROA 5IVXF 3WE6B 4DN3H 3IFOB 1IAOB 1GGTA 3QAZC 3DMMD 2FWOB 4G9FD 1QSEE 4X5LA 3QDMD 1BFTA 1P4LA 4KRPB 4OKVB 4V1DD 5M94B 1JHLH 2WBKA 4HV8A 3ARGA 2A74A 2NR6C 4XNQB 4HJJL 4QCIB 5F7YC 1IC5L 4W4NA 3LHPL 4EXPX 4XBEH 3A6CL 1GGUA 1T0PB 2H1PH 2PF6A 5ISZD 2MQ0A 3V7MA 3NFSH 1IGYB 3IDYC 4PG9A 1E6OL 5C0FB 4NNXB 4L4TB 1HHKA 4LCIL 4O02L 5EO0A 4H88H 1ZGLB 5MEQB 2YK1L 3KYKL 4OZGB 2XPGA 1A6UH 3ZDZE 1NMBH 3QRGH 2DICA 3IS1X 1VERA 3BDYL 2DBLH 2ED9A 4HD9A 4P2QE 2H8PA 3RGHA 4ZQKB 1HNGA 4YHMH 3CSPA 2DIJA 4LHJB 3QULA 5I1HH 4NYLB 5D71H 1IAIM 4P9MH 2RGSA 1DBBL 3W0WA 1MI5E 2UUDK 3N1MC 4JJ5B 3TN0B 43C9B 5F88A 4P2RD 5IW6B 4Y5VA 3L5HA 2A9MH 3MZGB 1N0XL 4ODWA 3HUJA 3GSVB 1YA5A 3VXRD 4X9IA 5ACZB 4KROB 5HI3C 4C56D 5FGCE 3UTSE 1OAKL 2OXGA 1OQOA 5KS9A 3QIBB 3QJHB 5DR5L 2EH7L 4JFED 3QO0B 2PO6D 1F2QA 1CGVA 4LAJH 2EE3A 4WHDA 2R8SH 3L5WB 1U8QA 4LASL 1MCOL 1A7OH 1RHHB 5D7JA 4U33A 1LE9B 1N8ZB 4LEOB 3HZYA 2HH0H 4HIHA 5I73C 6FABH 3CH8A 4BQ6A 3I9GH 3RP1A 1YMMB 3MRFA 2NXYC 3SCMC 2BNRE 3K7UA 4HS6A 3IJHB 1XF5A 5DZLA 3IFLL 5A2IH 3QXDB 5F1SA 1PVHA 5ICYB 4H20L 3S36L 5JZ7D 4J4PD 3BEVB 5TDOB 2LU7A 1YEDB 3A6OA 1LWRA 4PRPE 2C3VA 2O26U 1BFVL 3QUXC 3RIFF 4OZ4A 2PN5A 1EXUA 1NC4D 3RY6A 2Y07L 4M7JL 1MJ8L 3L3HB 5EBGA 3S96A 1VGEH 1OY3B 1F02I 2XZCH 4LSUH 2FO4A 4OCRL 4F9LC 4I18A 4WVRA 4U1JA 2AK1L 4OSUL 5JXED 1UB5B 1T7VA 3DBXB 4FQHA 4QTHB 4D9RE 2VUYA 1Q9WB 1SJHB 3BZ4A 2N7BA 2V7NA 2X40A 4PJ8A 1CE1H 2CLZA 2VDRH 4MD0A 1S7VA 1NANI 3CZFB 4RGNB 1MEXH 4DKAA 4HIXH 3BDXA 2GY5A 4QGYA 4LNRA 5IIEA 3BKYL 3Q3GB 3LQMA 1BJ1H 4PV9A 4ZMAT 1DEEA 3KLAA 3UZVB 3IFNH 3RBGA 3HMXL 3G6JB 2JCCE 3ZDZF 4OCSH 4JFQA 3ZSTA 1VB9A 2ZPKH 3EHBD 2X1XR 1T0NA 3V6BR 1AFVH 5DD1L 4P23B 3RNKA 1EBPA 5INDA 2J6EA 5AD0B 3OR6A 4ZFFB 1QQDB 1M1SA 2B8OT 4NOBA 1AJ7L 1KN4L 4I4WA 1OARL 1RZGB 4KJYB 4XC1L 1EEYA 5E6YA 3ABZA 3BPCA 4W4OC 3JWNC 1IZKA 2P44B 3F12B 5D72L 3ROOA 4R90L 3TA3A 4UILH 5J11B 1TXKA 4F7CA 3VGAC 1CDUA 4Z7OF 5B8CB 2Z8WC 4PJCB 3MODL 1OGAD 4OCLC 3CFDB 5JO5A 1T2JA 1WZKA 2F53D 5F6HI 4ODSH 2HG5B 4OV5A 2UZXB 4WO4A 4X98A 1OSZA 3QI9A 3QUMA 2HAZA 4NZTL 2Z4QA 5T1MB 2OR8A 5JR1H 4A6YB 4BKLA 3CFJB 2CJUL 2PYFA 2XXMB 4U6XA 3V4PL 1RK1B 3DUHA 4G9DA 3VXNB 3EYVA 2GY7B 2FO1A 4OM1L 2GK0A 3B2UC 1FZJA 3HR5A 3ZE0F 2Y06L 4MNHA 1NCDH 3LKQB 4X5XB 1JGUL 4U1LA 1TENA 4C57C 5E08H 2VZVA 1S78D 2NY2D 4NQCB 3TO4C 1KPRB 4F7TA 3BJ91 3W39A 4I0PC 5C0CE 1CDHA 4HCRA 4ZXBD 3VA6A 5I15H 1KN2L 1QYGL 3MXVL 3KPTA 1RIHH 1KNOB 4OLVH 3NZ8B 1AHWA 1A1OB 3VRLE 4FXLA 1A3QA 4DTGL 1CGTA 1NKRA 3U9UB 1N26A 4ELKB 1Z9LA 3GSUA 4KQ4L 4WUUA 1CU4L 1M05A 1I8IB 4IRSC 3D39D 4JVPA 1X7QB 5GSRB 4D3CH 3IDJB 1B4JL 1DFBL 1CFNA 5E7BA 1U8IB 1P1ZA 5CCKL 2OJEA 1QFUL 2BXZA 2AQ1A 4UDTB 2ZUSA 5I1LB 5FO7A 5D7KD 3EYQD 3VMPA 1F3DH 1AKJA 4DKEH 3S35L 3GUTB 4OF3A 4M7ZB 3ZE1E 1FPTL 1KELH 4DW2L 4PJ7A 4LLQA 2JCCF 3VFRA 4LSRH 3OZ9H 1FFQA 1A7BA 5GISH 3MRHA 2C1OA 3T2PA 1A7PL 3QDJB 4MAUL 3FRPG 2DQJH 5DMYA 5I18L 4WENB 4S1RL 5HHVH 4PJ9B 4PLJC 3DHMA 2QR0A 3D3VA 3O6LH 4R7DB 2IFFL 4L8SC 3UJIL 1YEKH 1SJEB 5JIPA 1YEHH 3KLHC 1P2CB 5CJQH 4MNQB 3HI6H 1A0QL 4KUCD 3W9DA 3CK0H 3CXHK 4TNWF 3BP6B 3SE4A 4PP2A 4ZG1A 1KJ2A 4UV7H 2K9UA 2BVOB 1N64L 4QO1A 5GRZA 5IMLB 4Z5RA 5DI8A 3QIWB 3U6RB 3C09C 3PGFL 1GZQA 1TMCB 5DTFB 4I5BB 2CRMA 3IU4H 3EO1A 3QNZB 4XNZC 5TPWH 5ESVB 2NY4C 4FABH 4DOHB 1ES0A 2VLRB 3FN9A 4YK4B 1FRGL 3RZCB 5KSAA 1QPXA 4XP4L 1KBGH 3VFSA 3REWB 3RVVD 2VOTA 1VFBB 3DVFA 4G80B 3VRLF 1OD7A 4JM4H 4HJGA 5FGSA 2VRAA 5HGAB 1WITA 2NXZC 5DHVB 3PL6D 4DKFH 1EHNA 3B8YA 1C16A 1S7XB 2EDJA 5BRZD 1P6AB 3AB0B 4Z76B 1LK2B 5FYJE 4J3VA 2NX5A 2FX9H 4JFPA 5D1QD 3FT4B 4M8VA 2QLVB 3FB6A 4U1GC 2CK2A 2X4NB 4M9OA 4DQOH 4ZPVA 1NH6A 3MCKB 5EU7C 4IMLB 4EN3A 5B4MD 1XIWB 1F00I 4O5LL 3RVWC 3ZE1F 4JZOB 3VW3H 4EVNB 1FZKA 4N9GB 4RMQA 5DEGA 4EKXA 3MV7E 1KCSL 2AAVA 3VXQB 4ZFZA 5KN5A 3ULVF 1ACZA 4ZAKA 4OJFL 5DQ9B 1PY4A 4HIEB 5B39G 1JPST 1I8KA 3QAZB 5FOBB 4GMTL 3K8KA 1WBYB 5KVGH 2QQLH 3MLRL 4OCXH 3B8SA 5EZIH 9CGTA 3GEWB 2K3TA 2M2DA 1KIPA 2XXCB 3WNKA 1RVFL 4F57H 1F4XH 2XI9A 4BSWA 3MPCA 1SJVA 1TJHH 5HHME 3MGOA 3RUGA 3ELAT 1INEL 3F58H 3I6KA 5EBMB 3I84A 3QT2A 5KG9B 5ICXB 2AJSH 4WWKA 3IDYB 1S7QB 2ZCHL 4D94A 1NDMA 4HAGA 3WS6A 4QHKI 4GH7B 5IEKA 4DKDC 2XFXA 4HWEH 4G42B 4PREA 4FOMA 4L8DB 4NWUH 1JRHI 4LSTL 4WTZA 3F5WA 4L8CA 1LO3H 5HHOD 5IMKA 5IESL 4RMTA 1OTSC 3MC0A 5ETUA 5C07E 4QRUA 1DBJH 4AY0A 2IF7A 1EAPA 3TGXA 1S5IL 3QCUH 4G6ML 5DF0A 3HRZB 4MD5B 3H42L 4X9BA 1G9ML 5BCAA 5SX5K 4CDHA 1N5YL 2P43B 3C60D 1CFTA 3BX7C 3MLSL 4J8RA 4WNQA 4POYA 2Q8AL 4KC3B 4JKWA 3L3JA 3IAPA 1OCWL 3HLAA 5D7SH 1HYSC 3ULUH 3N1GC 1PEWA 1WBXB 4Y0GA 1I7TA 1D5XB 4XP6H 1A5FH 4XBPB 3UMTA 1MQ8A 1D9KB 5TE7L 4XNMA 2FSEA 5T3XL 4RQQA 3FB5A 3SO3C 5I73B 1XR9B 3SDDD 3CJJA 4YHPB 3CXHJ 4R0LA 2A1WL 1U93A 2NXYB 2UWEA 4NZUL 3DX7B 1IC7L 3F62A 3D48R 3JZ7A 1ZHNA 3AM8C 3N9GH 1F90H 4RX4A 4DK6A 1RU9L 5ENWB 2VLMD 3KPMB 1GC1L 1FJ1B 4LSSH 3O0RL 1CGSH 3NCFB 3S88L 1LMKA 2D31A 4QRPA 1NGZA 4O2FB 3QUXB 3QZWG 5C09A 1E4XL 3ARED 5FKPB 3BGMB 1M7DA 1BLNA 5DT1L 4NO2B 5J4MA 2R23A 3BZFA 5IMMA 4NHCL 2GIYA 3GIVA 1CD0A 1U95A 5BV7H 3RWCA 4PD4J 5K59F 2QEJA 4WU5A 2X9XA 2Z8RA 3RRQA 3VH8A 4PJXA 5TE6L 4LVOC 1FNEB 1T3FA 2GT9A 5EN2B 3VXMA 3OX8A 2P5WB 1A9BB 1U6AH 4G8FA 5I1CL 3REVA 4FFYH 4HZAA 4DFHA 3OQ3B 3MLWH 1OSPL 1YY9D 4NFCA 1HEZB 2CRIA 1RUPH 4LHUB 1O7VA 3MRNA 2J6EH 1UKQA 1HCFX 1XZ0B 2E7LC 1HSBB 3INUH 3RJDA 3S5LG 1QFWH 4J2XA 3VGDA 2ZOLB 1A6VL 3C5ZA 3FQUA 2UYLB 3RWJA 4KI5D 4BJLA 1AXSA 1MJUH 3GK8L 4D0DB 3MV8D 3VXUD 4M1DH 1IM3B 4PTTB 4L3CB 4UTAL 4Y16C 1FO0A 4CVUA 4JKPH 1RZIB 3A6BH 1YEJH 4TSCL 4AEFA 4F7PB 4XP5H 5HGHA 4K7PY 4ZFOB 1CIUA 2LVCA 4KQ3H 1PKQB 1R3IH 3BKCH 3MRJA 4HFUH 5DVKA 3JWDL 1OB1B 5E4IA 1G6VK 1VHPA 3JUYA 2QQKL 3QEGL 4AEHH 4PJ5A 3QUMH 1UM6H 4JHZA 4HGMA 3V6ZA 1KB5L 3GNML 2E7BA 1F3RB 5FYKH 5JOEA 4ODHH 4PLOB 1I3RA 3IDXH 1MIEH 1T5XB 4ZOAA 3QXUA 5ECJE 1NCUA 3TC9A 5DLML 1MCLA 3T2NH 2VKWA 2IPUG 3GSNA 4MAYD 1YPZB 4HCRH 1PLGH 5IG7B 3MGTA 4G6KL 3BE1L 1PQZB 5JPNA 2D0GA 4GS7C 2YOCA 3D2UA 3VWKA 2PW1B 3RVTD 2IADA 2PR4L 2LAAA 2VLJE 4Z7VE 5BMFH 3V4VH 1U8PA 3ISWA 4JM2A 2VH5L 2BNQD 1VCAA 2Q86A 1C08B 4G6JL 2VABB 3OKEB 1DQLH 4J12A 3SGKC 4IRSB 1PZUB 2OZ4A 4E0RB 3CFCH 4OZHB 5D1XA 3ARSA 3DSFL 3T3PE 3T0XA 5BXFB 3FONB 3V5DA 5D2LE 5FAAA 1CBVH 1FGVL 4EQ2A 4UNTA 1GAFH 3MBEC 1FG2B 5FK9B 4H26A 1VEOA 1GZPA 2NNAA 3PWVA 4NQVA 2FATL 4OZFG 4TRPL 5D5MB 2Q7YA 3WUWG 3G5XB 3NACH 1S9XB 2C4XA 3TYFB 3V5KB 2DLFH 4KUZL 5FECB 3BEWA 4XI5C 1VFMA 4Y19B 2AXHA 1GHFL 3RI5F 3TZVD 3FFCB 4ZDHA 1NBVH 1JGVH 1SEQH 2BDNH 3QIUC 3HB3D 1WC7B 1K4DB 5CMAB 4AMKL 4K23H 5DQDH 4N90E 1V3JA 5FM5M 3KLDA 1L7TL 2IBZX 5D70H 3QB7C 1LNUB 5DEFA 4XWGH 1HOCB 7CGTA 5FIEA 3BIKA 3ES6A 3DX6A 2DI9A 1NGXB 3GIZL 4OLXL 2BY0A 5CEZE 1IKFH 1VEMA 4L8SB 3BKML 1KJ2H 4XXCA 2EDBA 5HYEA 2VLLA 4Y2DA 4RISL 4ONGL 2BNUB 4M48H 4R3SB 1UZ6E 1KCVH 4MJIB 3HE6A 4JG1H 5HI5D 4KVCH 4LCCA 4I13B 2R29L 5KAQG 4N8CH 4YFDB 4O2CB 1WBZA 2VXSH 5E9DA 3C09B 3RWHA 4JY6B 2UY7A 2R1XA 3V0WL 1NMAH 2Y36H 4YAQB 5CAYB 1CXHA 3PWJA 1PZ5B 3CSYA 4XNZB 5BS0E 1PSKH 4JJHA 3WKMH 2NY4B 3WD5L 4GFTB 3KPSB 4G5ZL 4OF5A 1CYGA 1OAZL 2YHGA 3SJVE 1YQVH 4PBVC 5E2VH 2I07B 4MA3B 2IANE 4H5SB 5IBLC 3M8OL 4GW5B 1FVDA 2CIIB 4Z7VF 1YEGL 4CAGA 3IB4A 5FUZL 5DWUL 3VE0B 3OBAA 1BM3L 4JFYA 2O5XL 4Y1AB 3ARFC 2ZUXA 2J88L 3GKWL 3VMOA 5CJBA 2NXZB 3PDDA 3L1OH 1B90A 5H35B 4PS4L 3T3PF 2PYEA 1A4JB 2QHLA 3ARRA 3RGVC 3CSGA 4WJ5A 3ALXA 4ESKA 4JPVL 1U8LB 3TYGH 3ARZA 4Z77A 1CTOA 4UINH 5JIIA 1A7NH 5T5FL 1DSFH 1NUFA 1I85C 4WEUD 4Y4FA 4OUOA 1IT9H 1TLKA 1T1YA 3WJLA 1ROWA 4OIAA 5JMRA 5DRNB 2Q3AA 1IEBA 1YYLH 4EOWH 2CKBL 1UENA 4Q0XH 4HW6A 3QQ3A 4WFGD 2OSLA 2EYSA 4PFEA 4ZNEA 1BVKB 4ZUTA 4MCZB 4FQXA 2GSGA 3H7BB 3DRTB 1Z2KA 5CEYB 4YFLI 5ERWA 4X7EC 4ORGA 3QFDA 5I76B 4Q2ZA 2AEQL 4PR5A 1JBJA 2VUOA 4LRNL 2EIZA 3KHQA 3QSKB 3QP3A 1U92A 1A3RL 1BJ1J 5E4EC 4KV5E 4MYWB 1KGCE 4JQXA 5C0ND 2YWZA 2A9NL 4OT1H 1L6ZA 3NIDE 4HF5L 5GRWA 1GGBL 2DIBA 5CP7B 1FZOB 5A2JH 4ELME 1HHHB 4JFFA 2VDLH 1BOGA 5C0GA 3OAYH 2HLAB 1I9JH 2PKDA 1YUHA 4U2ZA 4UV4H 3K8LA 4P59H 4MZ3A 1Q0YH 4U1KB 4QEGA 4KJQC 4APQC 4YX2H 3UBXG 3V4UL 3C6LA 1CTNA 3FO0H 1QVOB 3EDDA 2YEZA 4YDJA 1K5NB 2SEBA 5SWSE 1MHPL 4NQXA 1MCDA 5C2BH 4MS8D 4ODTL 3IAGC 1SMOA 2A0LC 3ZKND 2IMNA 3MACL 5E8DL 1SY6A 3UX9B 4Y7MA 5D7LE 2ITCA 1MFCH 2DQUL 3JTTA 5I9QC 4PYHA 4HS3A 3LKSA 4YJZL 1VPOL 4YHLH 2D7OA 3CVIH 3HI1B 2XKNB 2R2HB 1K6QL 5E6IC 3EFDH 3I75A 3DUUB 2YPKB 1CLZH 1G1YA 1Q0XL 5LBSL 5ITFA 4DGVH 5C8JA 4KY1L 1HHJB 2PW2B 3G6AA 3CVHB 4QHUB 5GGRB 3KXFB 2VDKL 2W38A 4MSWA 2EDOA 2XTJB 4I77L 5ALCL 3SO3B 4F7MA 4NQED 3CDFA 4EI5C 3HZVA 1FGNH 3RX5A 1LP9E 3SKMB 1AH1A 3CFBA 3NOIA 1IC1A 3P11H 5ALBL 2DLHA 4CU6A 4WRLA 1BIIA 3WCYA 2FHCA 3QEQB 4DVBA 5ESAB 3R4DA 2H3NB 5T1LA 4GQ9H 2DKUA 4FFZL 1R3HB 1TJIH 1U58B 3QO1B 3DXAB 3FO1A 4OLYL 5C9KA 1DQDL 4LSQL 3L3GB 1KCUL 4KXZH 2O61B 3MA9L 1ZVSA 1CXLA 1CXIA 3SDYL 4L8BA 4YO0B 5SX4H 2YPLE 3FL7A 1BQHG 4OI8A 4Q7DA 2HYMA 3NGBC 1RJLB 3SKNA 5KW9H 2B1HH 3NCYS 2C26A 3DV6B 4P4KD 3RKPA 1EMTL 3LIZH 4KV5F 5FYLL 2NMSA 3GRWL 4NQDD 3UPRA 1JPGA 1V8HA 4LEXL 4PRIB 1LD9A 3OF6A 2ARWA 3VI4E 1I8MB 5F9JB 3X3FL 1EO7A 2CDFA 2Z31C 4ELMF 5BO1L 3DX9B 2C9AA 4LARL 3WS3B 5GGVH 1T5WB 3QR2A 3HA0A 5CSGA 3HG1A 3ET9F 2X4OA 5I17A 2XWBA 4X9GA 1OAUH 1CK0H 3ARBC 3QDGB 4QHMB 3ECBB 3DETC 4IDJL 2HT2D 4NIKB 1P4IH 1BIHA 2OR9L 4S11A 5I8OH 3UTZA 4FHBD 4JO4H 2FECI 3H9SD 4Y4HC 5SWZE 4HFWB 3WHE0 1RZJH 3AROA 3RAJH 5LQBL 3MJ7A 2Q8BH 3SPVA 4WI6A 1WTLA 5C0EB 4LCWA 5I66A 4Y16B 4G8IB 3W0WE 1T6WA 5JHLL 4ETQA 5DMGD 1XF2B 1F6AB 5FA4B 4K7PL 3EZJB 4FG6D 3O11B 3LKRA 4YBQC 4AM0A 1KJMB 3RPIA 5C0RL 5H2BB 4GRLD 5I1IH 2J8UB 3D0VB 1MFDH 2LV4A 2NY1C 5D2NB 3MV9E 2OMBA 3VFTB 1I8LA 3SE9H 3S36X 5F7NC 5C0BE 5EO9A 4AIOA 5MEPA 3ULUE 3GZKA 3O8XB 3UTTD 2VSDA 2J8OA 1FVCB 3MJ9L 4Z0BL 4AYFA 5JHDA 1P7QA 3GSNH 1G9MC 4L1HA 4G43A 1JV5B 1PYWA 1SEBA 1AI1H 2W60A 1R0AL 4Y2OA 3EFFA 1GXEA 1LP9F 4I3RH 3VWJC 1N5AA 2G60H 2P5EB 4XMKL 3UZQA 4PGDB 5T1KD 4JRYB 1GGCL 4L4VD 5L8JB 4Q9RL 1J8HA 2QHRH 1BFOB 1QEWB 4R4BB 1CFVL 4GS7B 1FORL 1KCKA 3LV3A 3CIQA 1U91B 4XPBL 1JMXA 1J05B 2KUTA 1FCGA 4JFDD 5FM5O 1ED3A 3E1F1 1QBML 1G7IB 4L4TE 2OZ4H 3RU8L 2V9QA 3C87A 4UNVA 2BHYA 4YE4H 1L0YA 4XPGL 4I48A 1ZLSL 1I1RA 1QLEH 5IT2H 1WZMA 4NRXB 1LE5A 3MMEA 4P5KA 5TQ2L 3HE7D 2NZ9D 1A64A 3MBEB 1FLTX 3DUSA 3VI4F 1GC1C 5EIIA 3WFCL 4YFEA 3BP4B 2AS5M 2JJUA 3GBML 3DX8A 4X9FA 4P2YA 5EO1A 3VD5A 4NNPH 1MCCA 5TJWK 2ZSWA 4TNVF 1RMFH 3HPLB 2DQHL 4JO3L 5JQ6L 4NCC1 2DQTL 3FCTA 4AG4H 3IDUA 5DUPL 3QIUB 1GYAA 3O6MH 1T66C 4G6FD 1X5ZA 1A14H 5E5RB 3T2QA 2ZUVA 3OG4B 3PV7A 3CDGB 1DN0A 4M43L 1W0WB 4YHZH 2HVKB 1GIGH 4PJIA 5DD0L 1YMME 4H25A 2BSTB 4JZJC 2A6IA 5F9OL 2APBA 5GRUH 5JUEH 2P8MB 1K3IA 1EK3A 1MVUA 3WDJA 5IHLB 4POUB 3LEXA 5CIPB 4P5TA 3C5SB 3ULUF 3MLTB 1FH5L 4KRLB 2E27H 5EU6D 2APXA 2J5LC 3E6HB 5E56A 3RWDB 5C6TL 3QG7H 4KK5C 4JFHD 3MXWL 1OVZA 1N2RA 4PV8A 4XCCH 4D8PA 4MD4B 3LDBC 2G9HA 5DYOA 1JNJA 1NGWB 2FYYA 4QRQB 1A22B 4OGXH 4M1GL 3QA3B 3QHZL 2BVPB 4RDQG 5FYKE 4ENEC 3NPZB 1KJVB 1QRND 3MRMB 1TFHA 1FQ9C 5GQBA 1DQTA 1QPPA 4HGWA 5IBUB 4FXGA 3JWDC 3AMKA 1PJ9A 4YPGA 4FFVC 3JSSA 5BVPH 1WCBB 4X7SL 1MFBL 4RGNE 4OV6F 4Z7UA 1R3JA 3WUZA 5FF6A 2HA1A 3BP5A 1NEZB 2HKHH 5FUCC 3ARFB 1T20B 2W0KA 1NL0L 1HHIA 4BSVA 3KYNA 3QXAA 1WIPA 4OZGF 5I8EA 5HVWA 3I3BA 3MSPA 1CD1B 3G6JE 1LEGB 3EOBA 3SGDI 3SQOL 4PJDB 2DWEA 5IQ9B 5IMOA 4XCEB 2NY3D 2P47B 3RGVB 4MX7B 4PPTA 1J11A 1FNGA 3QEUA 4M5ZL 2I26N 1MCBA 1CT8A 5JW3H 3P3YA 3B9AA 2ITDA 1EZVY 1F8TH 4DZ8A 5GGUB 1I9IL 3UDWA 2D4DA 4KXZI 4HK0A 3GSWB 4MJ4A 4YFLF 1RULH 2AJXL 1II4E 2V2TA 1TJGH 2C4FT 4EBQH 1BEYH 5C08B 2ATKA 3L3KB 3BH8A 3D9AH 4HIIA 1EUUA 5IVNA 2MPAH 3BW9B 4NN5C 2ZOKB 1FFOB 3FOMB 3GJEA 4OTXH 1NSNL 2VISA 5C71A 4HHAB 4MQSB 4K8RD 4KZEH 1SYSB 2NW2B 3FHQA 4X6CA 1EPFA 1U3YA 1J86A 3WHXA 4JPKH 2EICA 2F5BH 4OBRA 5E4EB 2XV6B 3VXPB 15C8L 3EO0A 3R06B 1X4YA 5D7JD 1HQ4B 4YXLH 2OJZH 4FQ1L 5K33A 5E2WL 4BZ2H 4PJGB 1IM9B 4LLDB 2DOCA 1U8HB 4KZDL 3DO7B 4NQCE 4E42A 5K9KB 4UT7L 1G7MA 4R97C 4XCYB 1NCAH 3A67L 4EEEA 2W07A 1JYNA 4APQB 3OAZH 5DJ2A 2X4UA 2VXVH 1S5HB 4DEPB 2DI7A 1A6AA 1SY6H 1S3KH 1A2YA 3DTXA 2A2QT 3KWWB 4H0IA 1UJ3A 4DN3L 3F7VA 4D0CB 1DDHB 2BSSB 4OD1H 1HH9B 5IHZA 2A6JB 4U1MB 1F4WH 1ZT4B 1JHLL 4GXUM 4NO5B 4JRXD 1RSFA 3Q6GH 1L7IH 1JNNH 5F3HB 1JGDB 4H1LG 1IKNA 4XBEL 2H1PL 1QSED 1TCRB 1BVLB 3NFSL 3G6JF 1BVZA 3WBDA 3U0TA 3SDXB 2CXKA 3OB0K 1IAKB 4N5EC 3IJYA 4XVUD 4DUXA 1P7KB 4TUJA 5GS1C 4H88L 3GMLA 2NX5E 3QDJE 3FAWA 3G5VB 4G3YH 3DVGA 4EI5B 4NRYB 4IHOB 2P8PA 3RA7H 1A6UL 3MRRA 1NMBL 3QRGL 4U1NB 5F93C 2DBLL 3MO1B 3OMZA 1N59B 3FO2B 2DYPA 4M03A 3IFPB 5C0DB 4YHML 5IVZA 3O81A 5DXWA 4DN4H 5IR1A 5I1HL 3NIFE 4JVUA 5D71L 5CGYC 4P9ML 3OAYK 1F3JA 3OKDB 3KNBA 1QBLH 1RQ5A 3FOLA 4I2XB 4PJCF 4RGMC 2YC1A 2A9ML 5F70A 4ODXB 4TTDC 2EYTB 2AEPH 4P2QD 4S1SH 5GGSB 3NGBB 1LEIA 1G6RA 4XCFH 3KDMB 3UP1A 4XB8A 3VFMA 1O0VA 4CN4A 3RVXD 4DGIH 1MI5D 2WBJA 1JHKH 2R8SL 3DGCR 2FIKA 5DRWA 4ZS6C 1A7OL 1EERB 3I6LE 2HFTA 3L9RA 1ZHLB 1H3PH 4M4RA 4NUJB 2O5YH 4Q9QH 2AXJA 2XN9A 2HH0L 2J1KA 4DOHE 3VD9A 6FABL 5CJXC 2Z31B 1QR1B 1A6TB 2VLRE 3I9GL 4LDLB 2WWMC 5L2KA 1HXMA 2AXGA 2XWTB 4R4NC 5DJAB 5DEZA 2DIAA 1QNZH 3CVHH 5DURB 3I3EA 5IB3B 3O6FA 1WSST 3BQUA 4GBXD 4M6MH 4Y4HB 3QXWA 3CX5K 3BFOA 3T04D 3U4BH 2B20A 3G9AB 3WN5C 3U1SH 3KPRB 4B53A 3T0EA 4QOKB 1VGEL 4KKAC 4JFOA 2XZCL 4LSUL 4MXWH 2A83A 3H3PH 1CICD 4WUUD 4U1HB 4TVPD 2GITB 2HFEA 4O51B 3I2CH 3ROLB 4BFIB 5GRXG 3KYMB 4YHNA 1DVFC 3N0PB 4XT1C 2R9HC 5IKCA 4RAVB 2NY1B 4N0RA 2BRQA 1CE1L 2FGZA 2VDRL 5A2FA 2L4OA 4WUKH 1MEXL 3EDFA 3TVMA 4PGBB 1CIDA 4HIXL 2F8VA 2QJDA 3ARUA 3HZKA 3TJEH 1AKJD 1XGPB 4DCQB 3O3BA 3PQYA 4MB3A 4HMCA 3RTQC 3IFNL 2FLRT 4GKNB 4NZRH 3ZE2E 3VWJB 1XR8A 4OCSL 5MP6H 2ZPKL 1NFIA 3OR7A 1VFOA 1AFVL 3F65A 3FFDB 1WT5A 2NY6C 2NYYD 3U7WH 4JE4B 3F7YA 1UH2A 2VQTA 1I1AC 3OJDA 5B38A 1NC2A 2X4PA 2EDQA 1I1FA 5SWQB 1KIRA 4OAWA 3CMGA 3I02A 3CDYA 2APFA 4AIZB 7FABH 4QRPE 3PV6B 2C3GA 4N5UA 2D7TH 5C09E 3QQNA 2EDXA 3CLEH 1FYTD 1JPSH 2LU4A 3O4LB 2F8XC 4UILL 3WFHB 4OI7A 4I3GA 4PJEB 4PJFB 5F89B 2H2SD 4UU9B 3PDOA 1QLFA 3GSRB 3EOAA 4OCMC 4ODSL 4OCWH 2IALA 4X7CC 1KUMA 2ESVD 4CNIB 3C9NA 1HCVA 1BX2B 1T22A 3FO9B 3LSOB 5JR1L 4G9FB 3QDMB 3P4OB 1FZMB 3BD5A 4V1DB 4UI2A 3V8CA 3KPLA 5J6HB 4LVEA 3GI9H 4QRRD 3OKMB 5FKAB 5JTWA 4Y4KC 5E8EB 3NZHH 3GDBA 1MHHA 3JWOH 2XKSA 5E08L 2AJZA 3FTGA 1A8JH 1L6XA 2IAMA 4NSKA 3DARA 5DK2A 5CD3A 4PJAB 5I15L 3X17A 3G5ZB 3IDGB 1RIHL 4OLVL 1WV7T 2BRRH 5MENB 5IFJB 5CWSA 2EDLA 2AEIT 4E5XA 3NPSC 4HBCH 3RVUD 1VFUA 4D3CL 4JZJB 5C0CD 4GXVH 2V5TA 1Y18B 2VLKB 1ZSDA 2HJKA 3VFNA 5DD5H 3G5YA 2A73B 4LCUA 2ED7A 2GEEA 3GMPB 3E3QE 1ETZB 1UQSA 4OIIH 3TBVB 4DKEL 3PABA 1P69B 3IGAA 1QLRA 1R5VB 5DMIH 1KELL 2R4SH 3F8UB 3B9KA 4JFXA 3LDBB 2VWEC 3ZE2F 2WLZA 1T4KB 3KHOA 4LSRL 4EI6B 3OZ9L 4MLSA 3O45A 4LP4A 1X5KA 3IF1A 1YC8A 4JFEB 5MHSD 5GISL 2FZ3B 3OGCA 1ZXQA 2CUHA 3AMLA 1OAXH 1BZ9B 1R5WB 1DQQA 2DQJL 3EUUA 4QHLB 4CVXA 5GS0H 4O4YH 3HC0B 5HHVL 3DMMA 2OQJB 3TNMA 1S7RB 4HIJA 1ZT7B 1J1OH 3O6LL 5DJXA 1KB5B 1V7MH 3ULVD 5HPMB 1YEKL 4GKOA 5EU3B 1YEHL 3CX5J 1D6EA 5CJQL 2FJHA 3HI6L 5IVXB 1NFDB 4MCYB 3QPXH 3FQWA 3CK0L 4JKKA 1UVQB 1Q9LA 1RUMH 1AGFA 1LDSA 4UV7L 5ISZA 1SBSH 5GSVA 3MNWA 3MRIA 2E9IA 4WWKD 4U49A 1PGRB 4MA8H 4MMXC 5F71A 1NLBH 5KVFH 3FQXB 4WTXA 3C6SA 4K3HA 4MQ7A 3BD3A 4AT6A 5CILH 1FIGH 5CGTA 3AS0A 3N85H 5HGDA 2CLVB 3IU4L 5HY9A 2GI7A 1MRFH 2DMKA 5I1DB 3L3OA 1QSFD 1N6UA 4IDLA 4NCDA 5TPWL 3PG2A 4E41B 2BMKB 5ICZB 4FABL 2BY3A 5CEXB 3VDCA 1S9WA 3EJZD 3PWLB 1KPUB 4CADA 5BZWB 3LQAH 1UG9A 1X9QA 1XF3A 5HYSA 3EKCA 5D6DA 1KBGL 1KB9K 4NN5B 5K9OA 4MJ6A 4P2RA 2DRUA 4QXTB 1YEEH 3QXVA 3QNXA 3MNZB 5H94B 5HDLA 2D3VA 4YEFA 4JM4L 3VXRA 5DJCA 5GIRB 4C56A 4DKFL 3F6LA 3GMRA 3LH2H 1AD0B 4C4KO 2PO6A 1LVEA 1H5BC 1OWWA 2FX9L 1YPZE 5ID0B 5CUSH 4RZCA 3M45A 2YKLH 1QA9A 1OHQA 4DQOL 4L3EB 1XGQB 4R97B 3SCMA 3VW3L 4MMZC 1I1YA 2JELH 4RFEB 5FYJD 1DUZB 1ULVA 1PG7X 2ZCKH 4J4PA 3OKNA 3MCG1 1EHXA 4WTZG 1OPGH 1BQLH 2G2RB 4ZSOA 1ACYH 5E0QA 3ME0A 4L29B 4OZHE 1EHLH 2HT3C 3WJJA 3TJHD 2H45A 3MRLA 1UKTA 3ILQC 3L5IA 1NC4A 1JWUA 2EDRA 2QQLL 5KVGL 1VKXA 4GSDH 4OCXL 3T1FA 1GOHA 1AO7B 3VXSB 5EZIL 3T0AA 1RK0B 3DROB 5CSZA 1F58H 2VQUA 3L6FA 3MV7D 5HDBE 4FXKB 4K3JH 1MLCB 5IFAH 5MERA 4F57L 1F4XL 3MRDA 1XCQB 3K80A 1TJHL 2R69H 2FJFB 2Y5TB 5D5ME 3SY0A 3CC5A 4Q9BA 4R96B 5DC9B 1YZZA 2JJSA 1RIVH 5IM7A 3F58L 4Y19E 3LY6A 4F9PA 3ILPB 1Q94B 3JTSA 3FFCE 4WEMB 3AS1A 2AJSL 2P5WA 5IW1B 1CDBA 3WL9B 4K7FA 1XGRB 5HHNA 2PYEE 4HWEL 4CGTA 5GS1B 3AVEA 4ODVH 1JZ3A 4NWUL 4TUOA 2DLEA 5HHMD 1KTKE 4Z0XA 3VXOA 1LO3L 5F21B 5BOPA 1B9ZA 4MQXC 1DBJL 1MOEA 4UT9H 3QCUL 3D39B 1BD2B 1T21B 1NBYB 1WICA 3SKOA 4F8QA 3PWPD 3I6GB 5J9PA 1Z9MA 4KJPC 4NKMB 3LS5H 2V5YA 4GJTB 5EC2B 1AR1C 4Y5XB 4RGMB 1G6RH 3VRJB 1WWCA 4F80A 5C07D 5D7SL 5IHBA 3LKNB 3OAZK 2CR3A 2KQMA 4PY7A 3DGGA 4NQSA 4FQLH 4KKNA 4Z18A 5DQJA 3UYPA 1G7LA 1IQWH 2E6QA 1MQKH 2FEDD 3RDTC 4XP6L 5IB1A 1A5FL 5L6YH 4PJ5D 4D9LH 2C3HA 4B50A 3BESR 3DSNA 1FV1A 1OGAA 2ADJA 2F53A 4J6RH 2DQFB 4PLNC 1YPZF 1URLA 1S9VA 3VH8G 1HXYB 2CKBB 3P73B 3LCYA 4HWNA 3MUGB 3BXNA 5KSVB 3P9WB 4WY7H 3SDAD 3UTSB 4ERSH 4XTRD 3VGGA 4JFFE 2Q7NA 5EBLB 3MREB 2MNUA 3VFUB 3ARDD 4ZYKA 3PXHA 1KT2B 3N9GL 4K3DH 4NO3A 5L7XH 1F90L 1R5IB 5I8CB 3RIAK 4A2LA 2X09A 3OHXA 2CSPA 1R3KB 1K2DB 3MRQB 4OD3H 4LSSL 1QO3B 4TUKH 1CGSL 4XP9H 2BC4B 2IH3A 3IVKA 1ZS8B 4P2OD 3TO4A 4NO0D 3WV0A 2AK4B 4I0PA 4OZHF 1MY7A 2BVEA 4N0CC 2BNRB 3VFWB 3L3IA 4ZXBA 4IS6B 3C08H 3LN4B 2Z93B 1FL5B 4IMKC 4IRJD 5IB4B 3IETA 3PP3H 4PP1C 4GQPH 5LG1A 4HKBA 5TH2A 4GRMA 3ALWA 4MXVE 5HDBF 3V7AE 5BV7L 4XMLH 4LPUA 5EU7E 5B39B 1A6ZB 3GJFA 1M6OB 5D5MF 3K0WA 3CU7A 3VFGH 1J5OH 4JY4B 1B0RB 4K3EH 4LKCB 1U6AL 4OLWH 2EDWA 1L9MA 5GGVY 4FFYL 1MF2H 3MLWL 2GFBB 3H0TA 1U3HC 3P9MA 4UTBH 1RUPL 5C0IB 4U6YB 3V79C 1DBKH 4U7SA 2J6EL 3UAJC 1FNAA 4MB5A 3BMWA 3INUL 2WP3O 3OPZH 5GJSH 1QFWL 1P9MA 1Z0MA 2NY6B 3HZMA 3QEHB 2BFVH 4LLWB 4PRBA 3TBSB 5CMAA 1MJUL 2EDYA 5BRZB 5IWLC 2YMXH 4M1DL 3SDCD 1E0OB 4BH7B 5EH1A 4N1EA 4JKPL 3A6BL 1YEJL 4XP5L 2F74B 5TF0A 1HKFA 4KQ3L 2JB6B 1R3IL 3BKCL 4YR6B 1A1MA 4HFUL 1MSPA 4M6OH 1T1WB 2OK0H 4AEHL 3QUML 1MCFA 2VAAB 1UM6L 3DYOA 4LHUG 3ARXA 3RWIA 1F4HA 4HPOH 3UEZA 3K4AA 3PJSA 5F1NB 3AXLA 5KOMC 5FYKL 3WLBB 4AJ0A 4ODHL 2I9TB 2W65A 3IDXL 3FRUB 1MIEL 3SBWC 1BF8A 3L7FB 5KSBA 2YN5A 4X4XB 1T0MA 3T2NL 1E4KA 3B3IA 4MA7H 1U8MA 3LKPA 4DGYH 5F7LB 2P8LB 3P0GB 4HCRL 4NCC2 1PLGL 4LLAA 1X5LA 1AGBB 1AGEB 4YPJA 4K7PX 2F15A 2YD6A 3BUYA 2ADGA 3AGVA 2XNAA 2B0SH 5JORA 4QHKJ 4OD2A 5BMFL 3V4VL 4CVZB 5CD5C 5EUKA 3KXFE 1N3NB 2XTJE 3NPSB 1DQLL 2CUMA 4MXVF 4JPIA 3P4MB 3PHQB 5HHOB 3CFCL 3QZWB 3PL6A 2W9DH 4GKSA 2VLJD 1U42A 4FS0A 1I3VA 4LCYA 4S2SA 1CBVL 3BMVA 1GAFL 3QRFM 4QRSB 4M7KH 5D1QA 3GSXA 4GO6B 3ULSB 2AV1A 4M3JA 5EPMB 1KTLB 3TNNB 3C8HA 3NACL 1AQKH 2V2XB 1PAMA 3U0PA 2AQ2A 5JHDE 2DLFL 3O9WD 4MZ2A 4LRIC 3JV4B 1NBVL 1JGVL 1SEQL 3GMQA 2BDNL 3MOAH 3TEUA 2XQBH 2QADC 3V8OA 4K23L 3VJ6A 4Y88A 4JO2H 5DQDL 1A1NA 2XY1A 4HUVA 5I1KH 5D70L 1INQA 4LOUC 4XWGL 3D0LA 4P46C 4PRIE 5HHXH 3V5HB 3WKNA 2OYPA 1CQKA 3RJQB 2XYCA 1IKFL 2FECL 3K4DA 1KJ2L 1VACA 3KPNB 2C5DC 4MNGA 2G5BB 1YY8B 4QY8B 4JAMB 4QYOA 2DQDH 3B6SA 4N90D 3TCLB 3A0OA 1OW0C 3LRSA 4M48L 1KCVL 2R39A 2FNBA 4X7TB 3QUYC 4JG1L 4KVCL 3PXJA 1JPFA 5EOTA 4S1QH 5CBAA 2V9RA 5CEZD 4N8CL 4Y5YA 3PWUA 3X11B 1PFCA 3CFKB 2O93L 1OGTA 2Z91B 2VXSL 1R3LB 1UKSA 4UQ2B 1CLOH 4XHJC 5C0AD 1NMAL 2Y36L 3C6LD 1PSKL 4RMWA 4N8VB 1A6WH 1HWHB 3WKML 1HZHH 5IB5A 3MRPB 2HFFB 3S37X 4BFBD 1QSVA 1MFAH 4H0GA 1Z5LB 3MRGB 1YQVL 3HN3A 4GAGH 5E2VL 1M4KA 5D2NE 3C60A 1TVBB 3OTTA 4J3UA 1EDQA 1OD9A 2FJGB 2HT4D 3P0YH 3U4EA 5EC1A 1W0YT 4W81A 4ZOBA 5BS0D 3MUHL 4J23A 4WW1A 5I1AA 1F11A 1AD9A 1FNHA 1MNUH 1ZWIB 2ICEB 2ICCA 3D85B 1OTUC 3EYFB 5JW4N 4KWUA 4PJIE 3ZKMC 1LO2H 3L1OL 3SJVD 3QUZC 2P5EE 1H5BB 5DRZB 3T4AB 5F7UA 2IAND 4JRYE 1JUFB 1G7HB 1RJZB 5DRXA 3TYGL 2LQRA 1HH6A 1BZQK 1IFHH 2ZG1A 4UINL 1A7NL 3SDDA 3C5JB 3T0DA 4NNYB 1S9KC 1DSFL 4RWHA 2FH6A 3STLA 4JANB 3BPOC 4NKIH 1IT9L 1EFXB 2AV7B 1EEQA 1YYLL 3QEQA 4EOWL 4PRHD 1DR9A 5D96C 4Q0XL 4LBEB 5D7IA 3VU2A 3RWGB 4PRDB 1Q9OB 2G75A 5EFIA 1NPUA 1KYOK 1YNTA 4OZFB 2HFGH 2BZDA 4OCYH 5CBEB 1EFQA 4HX1A 4PBWD 3AREA 3ORJA 4JZNA 2ADIB 5F7MC 1KLGA 2D7MA 4PLKC 5DHXB 2ZKHH 4GAYA 5HGBB 2JIXD 2EDEA 3S6CA 4X0KA 1TQBC 1T1ZB 3V7AG 4Z7UE 2YSSA 4ZFGH 4S1DC 5E2JA 1S7TB 3GSQA 4OT1L 4UB0H 2F54B 5E00B 5I2IB 4FQJH 5CJOH 5FXCH 3CLFH 3OF6D 4KMLB 1VENA 4J3OC 2NW3A 3JV6B 5E95B 2VDLL 3FQTB 1F45A 5ACLA 1FN4B 3CFIC 1I9JL 4UIKH 4OGAC 1KTDA 3TIDA 4UV4L 2GCYA 5I0ZA 4P59L 1Q0YL 3H9YA 4BZ1H 1KGCD 5J3HC 1AGDA 4YX2L 5LGJA 5A3IC 2E7LA 1NMCC 3FO0L 4LF3A 3RL2B 3QG6A 4PGCB 5CS7A 4IRZH 5FA3B 4YWGH 3FZUD 4YZFE 3DRQB 5C2BL 2HJFA 1UXWA 2J8UF 3LKOA 1Y6NR 3MV8A 1SQ2N 4LCWD 3VXUA 4XAKE 3QPQD 1ZGLM 4P0DA 1C5CH 1MFCL 3TM6A 3FN0H 3X12B 4P3CH 4O9HH 4M62H 4YHLL 3QQ4A 1DQMH 5FGBC 4JDVA 3CVIL 5SWSD 4MWFA 3T65B 2FX7H 4U1IB 3RDTB 4P3DA 3EFDL 1ZHKA 1CE6A 3RWFB 1CLZL 2E9BA 3GBLA 1HDMB 1FE8H 1MUJA 4R9HA 4DGVL 5D7LD 2ZUWA 1ZT1A 3SE8H 6CGTA 3EOYG 4X4YA 4CJ0A 4CMMB 1A47A 3BSZH 5L8LB 3LB6D 1FGNL 2R2BB 2GTZA 2IGFH 2ZWLT 2VB5A 5I8KH 3P11L 1U8NB 2BCKB 1OP5H 4ISVB 1Z0NA 4IJ3C 1AXTH 1H0DB 2PXYC 3IXAB 1JK8A 4GQ9L 1TJIL 3BRDA 1JWSB 1FAIH 5DVNA 1NDGB 2AP2A 2QSVA 1NUDA 4ONHB 1X4XA 5C1MB 3T4YA 3D25A 4PJDE 3BN9D 5ELIA 4GG6B 5FB8A 2VL4A 2Q6WA 1Y0LB 3D18A 1E27B 1FFPA 2BNQA 5HYJB 1FFNA 5KW9L 4G8GD 2B1HL 2GJ6B 3VFOB 3WNPA 5EOQH 1U8JB 5BQ7A 3LIZL 2L7JA 3DV4B 1IAIH 1OT1A 2VDMH 5E94B 4HULB 3K2UH 4M9PA 2CLRA 5IROC 5J1AB 1JGLH 2YPLD 1DZBA 3KPQA 4JY5H 1DLHA 4KTEH 1RJYA 1UXSB 1C5BH 5GGVL 5GRYA 1U3HB 3ARGC 1OAUL 1CK0L 2EXWD 5GGRY 2E9WA 1P4IL 4JKLA 5H37H 3TZVA 5I8OL 3ZT6A 1JF1A 1MH5B 4JO4L 5KVMC 1T6VN 1JCKA 5C7XH 4HUWB 1RZJL 3RAJL 2RIKA 2Q8BL 3QFJB 4G6AD 3WFBH 4PJHA 5FDWA 1XGTA 3UBXB 2L7UA 3TFKC 4X8XA 4BYHA 1L9NA 1X3DA 2CIKA 3O41B 3LN9A 3J7HA 1KYOJ 5EUOB 4ZOCA 5SWZD 2YD7A 3LN5A 5DGRA 5I1IL 1U8KB 1MFDL 1S7WB 3SE9L 1BBJA 2UV3A 3FT2B 3H9HB 1WFOA 3RNQB 2IBBA 1EEUA 5B3JE 3V9FA 3GSNL 5IK3A 1ERNA 2WSKA 4Y5VC 1F6FB 1QUNA 1AI1L 2UUDH 1WF5A 2XN9E 4YGVA 1G7PA 5TDNA 4I3RL 1OWRM 5IUSA 4JHBA 2G60L 4M93C 4KVNH 5L2KE 3MV9D 4C58B 4NM4H 4LPXA 4ZUUB 5JLZA 4R7NB 5GZOD 3ULUC 5D1ZD 2B7DT 2QHRL 4Q6IA 4KK6D 4Z7QE 2BX5A 4PYGA 4RA0C 2ATPB 5F7DB 1QR4A 3RL1A 3PUCA 5SV3A 4WFED 3D6GA 1MELA 4KRPD 4F2MA 1G7QA 4PJDF 4Y8DC 3SDXE 1I7ZB 2DM7A 2OZ4L 4K94H 5GS0D 1MLBA 3ZKQD 1K3ZA 2HN7A 2H9GA 4HXBH 3MTRA 4YE4L 1QLEL 5IT2L 4P3WA 4YIQB 3AAZB 2WQ8A 5JIKA 2WUCH 2XZZA 5T3ZD 2QQQA 5EBWB 4X8JB 1H15B 3CXDH 4O2EB 3RY6C 5EWIH 5DMJB 5E99H 1YDPA 1G9EA 4YDLC 1FVEA 4YH6A 1JFQH 4I18C 4NNPL 4X6DB 4F7EA 2NCMA 1RMFL 5ANMA 3C2AH 1ZLVH 2IWGA 4AG4L 3BVNB 5FO8A 5D2LB 2WZPD 4WW2A 3P2TA 3P30H 1X5IA 5A16A 3O6ML 2QADB 3OV6A 4Z7WA 4Z9KB 5BV7C 1A14L 1ZA3B 4PJ8C 3TN0D 1RY7B 3MROB 1Z6JT 1H3UA 4P46B 5CSBA 4YHZL 3G04B 4JN2A 4FTVA 1GIGL 2DM4A 4KROD 1RZ8A 4PJGF 1W0VA 4I9WD 5FYJU 5KVDH 3U83A 5IOPB 2YR3A 1BMGA 3R0NA 3FB8A 1DL7H 3FQRB 3QIBC 3QHFH 3Q6FA 3BHBA 1JL8A 2W91A 1Z9OA 4UDUA 5GRUL 4R26H 2HMID 5JUEL 4LIQH 2KZWA 3GGWB 2B4CH 3TO2B 4XNUH 4C4KT 3QUYB 4YNYA 5DJDA 3OXSA 4M6AA 2VE6B 1KXQE 5DJ8B 3VXTB 1JGEA 1VSCA 2H6PA 5B3JF 2E27L 3DURA 3MUZ1 2LAGB 1YMMD 3AS2A 5E8NB 3QG7L 1GCFA 1T7YA 4XCCL 4KK8D 3OXRB 2I9LB 5EA0H 2W9EH 3TA3C 4OGXL 3HKFA 5EG6C 2L0DA 4X99B 1BFSA 3L7EB 3RZWA 4QHNA 4UBDC 1OF2B 5DO2D 3T77A 4WO4C 3EOTH 1UH3A 5BVPL 3QI9C 1X5GA 3O4OC 4CMHC 5T1DH 2XT1B 3SDXF 2FGWH 4AQ1B 2HKHL 3L5JA 3MYJB 5FV1L 4RGOH 1FL6B 5E6IA 1Z9SA 1S7UB 1BGXH 2XQYG 4LPTA 5JDSA 2VDOH 2Y4SA 1EIBA 1FBIH 2V7HA 4RGND 2VR4A 3GB7B 3FAXA 2HKFH 3KPOA 2FR4B 5JW3L 1CFSA 1G9NH 2AABH 4DZBB 1A6PA 1UEMA 3MYZA 1F8TL 5IBUG 4NQEA 5EORH 3IJSB 1ZE3C 2H26B 4UIMA 3BPOB 4HKXA 1E6JH 1R24B 1B6DA 1RULL 1DCLA 4UMGA 4P23D 5DK0B 5DUBA 1XEDA 1RZ7H 5DJ0B 5HD8D 5EU4B 2GSIA 1TJGL 3O4LE 3WIFB 4F3FB 1NEZG 5T3XE 5DHYB 4GRLB 1BEYL 4EBQL 3BO8A 4MJ5B 4RNRA 1JWMB 4PJEE 4PJFE 1Q72H 1GPOH 4P4RA 3D9AL 4WV1A 1UM4H 4X6BA 4W6YB 2MPAL 4XPTH 1T1XB 3AU1A 3U36B 1IAII 8CGTA 3DHJA 5BZDA 4OTXL 2WWKO 1JPTH 2GUOB 1U8OB 4KZEL 2X4RA 4G9FE 1M7IA 3QDME 1TQBB 4JPKL 2F5BL 1MY5A 4V1DE 4HC1A 1EZVX 5H8DA 32C2B 1GGIH 4N0UA 4P4KA 1TZIB 2C7UB 4LL9A 4L4VB 1IRAY 2YD4A 3G08A 1IL1A 4YXLL 4NQDA 2OJZL 4W6XB 3QBTB 2F9BT 2R56H 2P46B 4HKJB 4NUJA 4BZ2L 5F3BA 1I7UB 3EDJA 4ZUVA 1IEAA 4JFDB 2ZSVB 2DMBA 3MNVB 1NCAL 4CUCA 3LQZA 1MWAA 3BI9X 3ARBA 4K55A 5MENE 4XHQA 5DJZA 3X13B 2VXVL 5MEOB 3PNWA 1NMCB 1D7FA 5L2JA 1SY6L 1S3KL 2DD8H 3EGSB 4FP8H 5INCB 3SE4C 5DFTA 1ZV5A 3O3EA 4NQCD 3H9SA 1GRWA 4ZPTB 4OD1L 3T0ED 5DJYA 3QQ9C 3KPRA 4XGZB 5E5MA 1ND0B 5F7FA 3WXWH 2X70B 2EIDA 2I5YH 1F4WL 2ICWA 4KKBD 3B43A 4NZJA 3CAFA 1HHGB 5IV2A 3TBWB 1AE6H 4R2GC 1TVHB 2OL3A 1YECH 1G84A 4WI2A 2GJZA 3Q6GL 1L7IL 1A02N 3OKKA 4C83B 2NTFA 1JNNL 4OLUH 1B88A 2OTUA 1UB6A 1HIMH 4LLYB 4CVWA 2VN4A 3GMOB 3L95A 1OM3H 4XXDA 4HUNB 4ODUA 4JFEE 5D93C 5KSAC 1D5BA 2CH8A 3UTTA 1U41A 4G3YL 1PX3A 1XH3A 4WU7B 3RA7L 3IDNB 4OUUA 4PRNA 3HFMH 3V0VA 3WLWC 3VRIA 1BHGA 1Q38A 3QH3B 2FBJH 3HNSH 4IJ3B 2PXYB 2FB4H 4DN4L 5T1KA 2Y7QA 2Q1EA 5FUCE 5LJYH 2WP3T 4WHTB 3WFEH 1NFDE 3IXTA 1FDLH 4PJEF 1QBLL 2N56A 4PJFF 5BW7A 3V6OA 3TP4A 4NKOA 4PJ9D 1WAAE 1EX0A 1Y6KR 4ZSOE 1F97A 2AEPL 2IC2A 4S1SL 2V5MA 5K9QI 1MRDH 5IB2A 4EN3C 4XCFL 3PHOA 1CQYA 4MNQD 2HJLB 3U7AA 1NGPH 1HILB 2JK5B 4WDIB 4DGIL 5GGTA 1JHKL 4KMQA 5CZVH 1A7RH 5JW5B 1XMWA 1QHPA 4F37K 4NGHH 3MUY1 3I50H 4ZAKC 2OTWA 1H3PL 4E41E 2YXMA 4QGTA 2O5YL 5LKNA 4Q9QL 3HE7A 4MVBC 4U3XA 2A6DA 3ZHKA 1P4LB 1JNLH 2HLFC 4OFPA 3QIWC 4HV8B 3ARGB 4PJAF 3W2DH 2A74B 1QNZL 3CVHL 4MA1C 5EU5A 1A7QH 3CSBA 1XAUA 2HTLC 2FH8A 2VLRD 2Z92A 4M6ML 3OKOA 4YK4C 3RZCC 1DTUA 3U4BL 3U1SL 1P53A 2BVTA 4PG9B 2XOTA 3MRCA 4HLZH 4MXWL 3WS6C 1HHKB 5EO0B 5HYQA 3H3PL 3T0WA 4GLRI 2J3SA 3P77A 2XPGB 4L3EE 2VDPH 1NGQH 3I2CL 5SV4A 2H8PB 3U7YH 3AB0C 4JLRA 1JF6A 4A2MA 4HDIA 3QNYA 3SHSA 3UJJH 3QULB 4WUKL 1MCIA 2R2EA 3S9DB 3GJFK 5D9SA 3W0WB 1A9EA 4XMPH 1CD9B 4TULH 3E0GA 4QWWC 4OB5H 4LFHG 3U2SA 4PB0H 3TJEL 5E70A 2VDNH 5F88B 1U36A 4GRWH 4Y5VB 5EU6A 2Y5EA 4ODWB 1XIWD 3HUJB 4NC1C 4NZRL 4PY8I 3VXSE 5MP6L 1AO7E 1IC4H 4GAJH 2EZ0D 5KS9B 3U7WL 5AG8A 5C0BB 4DAGH 3L5XH 2HWZH 4YBHA 4HUXA 4WFFD 1CG9A 1U8QB 1QRNA 3MX0A 1NFDF 4GW1A 3EYUH 3GMMA 5IF0A 5D7JB 4OZIA 2Y72A 1K8IB 1JF5A 4HKZA 3HZYB 7FABL 4HIHB 1WAAF 1ZVYA 2D7TL 5E24E 3THMH 2NR6D 3CLEL 2OBGA 1NAMA 4R0LC 3MRFB 1UM5H 4Q6YA 1JPSL 3CNKA 4HS6B 2IMMA 3WO4B 1XF5B 1H3XA 4QTIH 3NA9H 1J7VR 5LXGH 2VTFA 2DQGH 2YUZA 1JNHA 2YD3A 4BSJA 3QWOA 2VNCA 4QNPE 4OCWL 3FT3A 3BKJH 5CHNA 4BELD 2C3VB 4PGEA 2WQRA 3K4ZA 3D39E 1BD2E 3NMEA 4WHYH 4OZ4B 4RIRA 1EXUB 3RPKA 4FQ2H 2NLJA 5BOZG 3S96B 3MV11 3RY5A 2FL5A 3OKLA 4YDLB 3CMOH 1YYMH 4I18B 4U1JB 5D7KE 3GI9L 3P0VH 4FQHB 4HH9A 4OGYH 3ZT7A 1DUYA 1X5AA 3NZHL 3JWOL 3BH9A 4M5YH 1MJJA 3BZ4B 3HCVA 5BV7B 2V7NB 4JR9H 4PJ8B 2CLZB 4MD0B 1S7VB 2BXYA 2BRRL 4LNRB 3FQNA 5IIEB 1CI5A 2IH1A 3NCYP 4PV9B 3CCHA 1DEEB 5HI3D 2Y6SC 3KLAB 4HBCL 4DUVA 5EZOH 1RV6X 1QSZA 4JFQB 4M1CC 2VQ1A 4GXVL 3UTPD 1T0NB 5F44A 1D9KC 3RNKB 5INDB 3C5ZC 4U31A 5DD5L 3OR6B 3CH1A 1C12A 1FAKT 4I4WB 4OIIL 4FZEH 1EEYB 2YN3A 5CLTA 2AK4E 4EDWH 2NXYD 4Z78A 3SCMD 3BPCB 1QOKA 5DMIL 2R4SL 1RZJC 2D03H 1DE4A 3AC0A 3ROOB 3ZDYF 3WFZA 1OLZA 3TA3B 5KSBE 3KG5A 1UH4A 4X9HA 2CDGA 4F7CB 2J2ZA 3QWQB 1EA9C 1N6QH 3OJ2C 1PBYA 4U0RC 5JO5B 3PIQA 3E3QC 3QUXD 1OAXL 1OQXA 2OS7A 4F33A 4OV5B 5GS0L 4WO4B 4O4YL 1S9YA 4X98B 1OSZB 4RSVA 3PWNA 3QI9B 1YEFH 1KEMH 3QUMB 4RMUA 3O4OB 2Z4QB 2DKSA 1J1OL 1ZLVK 4CMHB 1V7ML 3PGCA 4BKLB 2PYFB 4U6XB 3MR9A 3MFFA 5HYSG 4JRXA 5AZ2H 4G9DB 2WUBH 3EYVB 3QPXL 1XGUA 2GK0B 4ZUSA 1FZJB 3FRPA 2Q76A 2B5IC 3HR5B 4MNHB 5E8PA 1SM3H 1RUML 1YN6A 1QSEA 4U1LB 2A6KA 1SBSL 4QNPF 1A3LH 5IJKA 2P5WD 2JB5H 2VYRE 4F7TB 4MA8L 1MREH 3VWKC 1NLBL 3W39B 5KVFL 5HYFA 5T5NF 4LLMA 5BRZE 1ZA6A 5CILL 2QSCH 1FIGL 5JOFA 4JM2C 5KZCD 1AHWB 4LHUD 3N85L 4UOW0 1RZKH 1MRFL 3U9PH 1WTGT 2F8OA 2LE9A 3GSUB 4WUUB 4RCAA 1M05B 4XZUA 4NC0B 4NQUA 3ZMRA 3L3DB 5C0JA 5D1XC 1CFNB 3WSQH 1P1ZB 5HVGB 5EDXA 4U0QB 2OJEB 3LQAL 1B2WH 1RJCA 2X4TA 2A77H 5FO7B 1YEEL 1YN7A 1JZ6A 1AKJB 1KIQA 2DQIH 4HC1H 4P2QA 2O5ZH 1Y6MR 2ARJQ 2J12B 2AXFA 4PJ7B 3LH2L 2NY0C 2OCFD 4LLQB 3VFRB 1MI5A 2E5EA 4OQTA 1GH7A 2WINA 3MRHB 1CXEA 2C1OB 5CUSL 2WLYA 3M17A 1MWAH 2YKLL 2YD1A 4NKDA 1ZEAH 3E6FA 5IEHA 1MJ7H 2QR0B 3D3VB 2MHAA 5DFVC 3C8KA 2JELL 4LIQE 2Z9TA 5FYLE 4MDIA 3B2UD 2ZCKL 4TSAH 3W9DB 1OPGL 1BQLL 4Y2DC 1ACYL 4JDTH 4PP2B 5HHOE 3TO4D 1C1EH 4IOIA 3UTQA 1EHLL 1KJ2B 4GBXA 4I0PD 3HE6C 5EZLA 2OL3H 3WN5A 5ESQA 2QKIA 1E4WH 4GSDL 4IOSD 4Z5RB 1F58L 5DI8B 3BUTA 4R2GB 4K3JL 2BERA 1GZQB 5IFAL 2VIRA 4KTDH 5HHQA 4IRSD 4PRPA 1CICA 2R69L 3EO1B 4J3SA 5C6WH 3NCJH 1ITBB 1KOAA 1RIVL 1DVFA 2AW2A 2YA0A 3STZA 2VWEE 1TNNA 4CJ1A 1J1XH 4JB9H 1ES0B 1B0GA 2LU3A 1AGCA 5D93B 5KSAB 4S0TD 2VSCA