3BPPA

1510-n membrane protease k138a mutant specific for a stomatin homolog from pyrococcus horikoshii
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
216
structure length
216
Chain Sequence
AKNIVYVAQIKGQITSYTYDQFDRYITIAEQDNAEAIIIELDTPGGRADAMMNIVQRIQQSKIPVIIYVYPPGASAASAGTYIALGSHLIAMAPGTSIGACRPILGYSQNGSIIEAPPAITNYFIAYIKSLAQESGRNATIAEEFITKDLSLTPEEALKYGVIEVVARDINELLKKSNGMKTKIPVNGRYVTLNFTNVEVRYLAPSFKDKLISYIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel dimer structure of a membrane-bound protease with a catalytic Ser-Lys dyad and its linkage to stomatin
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
molecule keywords 1510-N membrane protease
total genus 72
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2007-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3bppA00
4U0HA 5E0SA 3TDCA 3OT6A 5DU6A 5INGA 4KPKA 1RJMA 4F47A 4DI1A 5KDRA 2VSUE 4I52A 3ST9A 3P85A 3VIVA 1N6FA 4QFEA 3GF3A 4JOTA 1X0UA 5E0NX 4ZDDA 3IB9A 2J5GA 3Q1TA 3RRVA 3R0OA 5DU8A 4JCTA 3ZWAA 3KTIA 4KWBA 5DZKH 4U0GA 3QREA 4JYJA 2FW2A 3ZW8A 1DUBA 2J5IB 4IZBA 2F6QA 3IBBA 2ZL2A 3SWXA 4ELSA 3T88A 2EJ5A 2UZFA 2ZQQA 3BPPA 3IAVA 5C90A 1WDKA 1FCFA 3TZ3A 4I4ZA 1UYSA 5DU4A 3H0JA 4KNPA 2VSSF 1WZ8A 2VREA 3GKBA 4JYLA 3T3WA 1UYTA 4U19A 4JFCA 3R9QA 4ZU2A 1XNYA 2PG8A 2F9YB 2PBPA 3L3SA 1K32A 1N6DA 4K3WA 1XNVA 5C9GA 4B3HA 3TT6A 3OMEA 4U1AA 1XO6A 3MFMA 1Q51A 2Q34A 2F6IA 5DKPA 4MI2A 3M6NA 3PE8A 3H02A 4FZWC 3BEZA 4FNDA 3TV5A 1EF9A 3GMAA 1ON3A 3U9SB 4JSBA 4FN7A 4WCZA 4JCRA 1YG6A 3ZW9A 2ZL0A 4KD6A 4NEKA 2VSUC 3TT7A 4I42A 4MOUA 5DTWA 4FNBA 5CTCA 5KJPA 5DUFA 4L8KA 2BZRA 3MOYA 3SLLA 2J5GD 3ISAA 3PGQA 4NNQA 3HE2A 2F9IB 2F9IA 3U9RB 1Q52A 3N6RB 3H81A 1WDLA 2HW5A 1UYRA 3Q7HA 2Q2XA 2VSSA 4L6WA 4G2RA 1JXZA 4OG1A 1UIYA 2FZSA 4JJTA 4RYFH 3G64A 4ASIA 3DORA 5JBXA 3OC7A 4ZDEA 1N6EA 1SZOA 3ZWBA 4FJWD 5MGBA 3TVWA 3FF6A 3KTJA 4JCQA 3V5EA 4B3IA 1TYFA 3U9TB 3ZWCA 3I47A 1PIXA 3PEAA 3QWDA 4Q1IA 4IZDA 1VRGA 1Y7OA 2CBYA 2J5II 4HC8A 3M6MA 1YG8A 3KTHA 2A7SA 1O8UA 2IEXA 2A81A 2D3TA 4B3JA 5CTBA 3NJBA 3T8AA 4WZ8B 3TVUA 2VSSE 3TLFA 4ZDFA 3JU1A 1PJHA 3T89A 2FBMA 4HNKA 4EMPA 2ZL3A 3LKEA 2VX2A 4OMRA 4ZDBA 2F9YA 4WYOB 2NP9A 5G1QA 1K39A 1OD4A 3Q0GA 4GHNA 3R9TA 1FC9A 3QYRA 2DEOA 2GTRA 2A7KA 3DJAA 1W2XA 3P2LA 3QXZA 4LK5A 3HINA 3GLMA 5KDRB 2DUBA 3HRXA 4FB8A 1HNOA 5G1RA 3R9SA 1EY3A 3MT6A 2PPYA 2VSUF 3GF7A 1WDMA 4U18A 1DCIA 4YLHA 5FUSA 4FN8A 3K8XA 2QQ3A 1RJNA 4U0GH 1NZYB 3H0UA 3KQFA 5G1SA 1HNUA 3T8BA 1J7XA 2CE3A 3KTGA 5DL1A 5E0SH 5INIA 3H0SA 4JCSA 1FC7A 2X58A 3QKAA 5INFA 5FIFA 4ZDCA 3FDUA 2ZL4A 2X24A 3Q0JA 2WTBA 4RYFA 3RSIA 4ELWA 3HLN1 3HP0A 5DTPA 3P5MA 1FC6A 1ON9A 3MYBA 3QXIA 1OD2A 3LAOA 3WG5A 2Q35A 3RSTA 5DUCA 1HZDA 5IKLB 4EMLA 3K50A 4Z0MA 1EF8A 4JWVA 2J5SA 4RCNA 5DZKA 4QIIA 3TRRA 2ZQRA 4K2NA 4Q0GA 1MJ3A 3NJDA 3STAA 2W3PA 3QMJA 3V5IA 4OLQA 2J5IA 3BF0A 4ELXA 2C8TA 1NZYA 2VSUA 5JBWA 1SG4A 4FZWA 4IZCA 1TG6A 4MXIA 4GM2A 3H0QA 4K29A 1UYVA 4QIJA 3PZKA 3QK8A 1XX4A 3KTKA 1XNWA 4EMMA 4JVTA 3R6HA
chains in the Genus database with same CATH superfamily
4U0HA 5E0SA 3TDCA 3OT6A 5DU6A 5INGA 4KPKA 1RJMA 4F47A 4DI1A 5KDRA 2VSUE 4I52A 3ST9A 3P85A 3VIVA 1N6FA 4QFEA 3GF3A 4JOTA 1X0UA 5E0NX 4ZDDA 3IB9A 2J5GA 3Q1TA 3RRVA 3R0OA 5DU8A 4JCTA 3ZWAA 3KTIA 4KWBA 5DZKH 4U0GA 3QREA 4JYJA 2FW2A 3BPTA 3ZW8A 1DUBA 2J5IB 4IZBA 2F6QA 3IBBA 2ZL2A 3SWXA 4ELSA 3T88A 2EJ5A 2UZFA 2ZQQA 3BPPA 3IAVA 5C90A 1WDKA 1FCFA 3TZ3A 4I4ZA 1UYSA 5DU4A 3H0JA 4KNPA 2VSSF 1WZ8A 2VREA 3GKBA 4JYLA 3T3WA 1UYTA 4U19A 4JFCA 3R9QA 4ZU2A 1XNYA 2PG8A 2F9YB 2PBPA 3L3SA 1K32A 1N6DA 4K3WA 1XNVA 5C9GA 4B3HA 3TT6A 3OMEA 4U1AA 1XO6A 3MFMA 1Q51A 2Q34A 2F6IA 5DKPA 4MI2A 3M6NA 3PE8A 3H02A 4FZWC 3BEZA 4FNDA 3TV5A 1EF9A 3GMAA 1ON3A 3U9SB 4JSBA 4FN7A 4WCZA 4JCRA 1YG6A 3ZW9A 2ZL0A 4KD6A 4NEKA 2VSUC 3TT7A 4I42A 4MOUA 5DTWA 4FNBA 5CTCA 5KJPA 5DUFA 4L8KA 2BZRA 3MOYA 3SLLA 2J5GD 3ISAA 3PGQA 4NNQA 3HE2A 2F9IB 2F9IA 3U9RB 1Q52A 3N6RB 3H81A 1WDLA 2HW5A 1UYRA 3Q7HA 2Q2XA 2VSSA 4L6WA 4G2RA 1JXZA 4OG1A 1UIYA 2FZSA 4JJTA 4RYFH 3G64A 4ASIA 3DORA 5JBXA 3OC7A 4ZDEA 1N6EA 1SZOA 3ZWBA 4FJWD 5MGBA 3TVWA 3FF6A 3KTJA 4JCQA 3V5EA 4B3IA 1TYFA 3U9TB 3ZWCA 3I47A 1PIXA 3PEAA 3QWDA 4Q1IA 4IZDA 1VRGA 1Y7OA 2CBYA 2J5II 4HC8A 3M6MA 4NARA 1YG8A 3KTHA 2A7SA 1O8UA 2IEXA 2A81A 2D3TA 4B3JA 5CTBA 3NJBA 3T8AA 4WZ8B 3TVUA 2VSSE 3TLFA 4ZDFA 3JU1A 1PJHA 3T89A 2FBMA 4HNKA 4EMPA 2ZL3A 3LKEA 2VX2A 4OMRA 4ZDBA 2F9YA 4WYOB 2NP9A 5G1QA 1K39A 1OD4A 3Q0GA 4GHNA 3R9TA 1FC9A 3QYRA 2DEOA 2GTRA 2A7KA 3DJAA 1W2XA 3P2LA 3QXZA 4LK5A 3HINA 3GLMA 5KDRB 2DUBA 3HRXA 4FB8A 1HNOA 5G1RA 3R9SA 1EY3A 3MT6A 2PPYA 2VSUF 3GF7A 1WDMA 4U18A 1DCIA 4YLHA 5FUSA 5HUQA 4FN8A 3K8XA 2QQ3A 1RJNA 4U0GH 1NZYB 3H0UA 3KQFA 5G1SA 1HNUA 3T8BA 1J7XA 2CE3A 3KTGA 5DL1A 5E0SH 5INIA 3H0SA 4JCSA 1FC7A 2X58A 3QKAA 5INFA 5FIFA 4ZDCA 3FDUA 2ZL4A 2X24A 3Q0JA 2WTBA 4RYFA 3RSIA 4ELWA 3HLN1 3HP0A 5DTPA 3P5MA 1FC6A 1ON9A 3MYBA 2YJGA 3QXIA 1OD2A 3LAOA 3WG5A 2Q35A 3RSTA 5DUCA 1HZDA 5IKLB 4EMLA 4HDTA 3K50A 4Z0MA 1EF8A 4JWVA 2J5SA 4RCNA 4J2UA 5DZKA 4QIIA 3TRRA 2ZQRA 4K2NA 4Q0GA 1MJ3A 3NJDA 3STAA 2W3PA 3QMJA 3V5IA 4OLQA 2J5IA 3BF0A 4ELXA 2C8TA 1NZYA 2VSUA 5JBWA 1SG4A 4FZWA 4IZCA 1TG6A 4MXIA 4GM2A 3H0QA 4K29A 1UYVA 4QIJA 3PZKA 3QK8A 1XX4A 3KTKA 1XNWA 4EMMA 4JVTA 3R6HA
chains in the Genus database with same CATH topology
4U0HA 5E0SA 3TDCA 3OT6A 5DU6A 5INGA 4KPKA 1RJMA 4F47A 4DI1A 5KDRA 2VSUE 4I52A 3ST9A 3P85A 3VIVA 1N6FA 4QFEA 3GF3A 4JOTA 1X0UA 5E0NX 4ZDDA 3IB9A 2J5GA 3Q1TA 3RRVA 3R0OA 5DU8A 4JCTA 3ZWAA 3KTIA 4KWBA 5DZKH 4U0GA 3QREA 4JYJA 2FW2A 3BPTA 3ZW8A 1DUBA 2J5IB 4IZBA 2F6QA 3IBBA 2ZL2A 3SWXA 4ELSA 3T88A 2EJ5A 2UZFA 2ZQQA 3BPPA 3IAVA 5C90A 1WDKA 1FCFA 3TZ3A 4I4ZA 1UYSA 5DU4A 3H0JA 4KNPA 2VSSF 1WZ8A 2VREA 3GKBA 4JYLA 3T3WA 1UYTA 4U19A 4JFCA 3R9QA 4ZU2A 1XNYA 2PG8A 2F9YB 2PBPA 3L3SA 1K32A 1N6DA 4K3WA 1XNVA 5C9GA 4B3HA 3TT6A 3OMEA 4U1AA 1XO6A 3MFMA 1Q51A 2Q34A 2F6IA 5DKPA 4MI2A 3M6NA 3PE8A 3H02A 4FZWC 3BEZA 4FNDA 3TV5A 1EF9A 3GMAA 1ON3A 3U9SB 4JSBA 4FN7A 4WCZA 4JCRA 1YG6A 3ZW9A 2ZL0A 4KD6A 4NEKA 2VSUC 3TT7A 4I42A 4MOUA 5DTWA 4FNBA 5CTCA 5KJPA 5DUFA 4L8KA 2BZRA 3MOYA 3SLLA 2J5GD 3ISAA 3PGQA 4NNQA 3HE2A 2F9IB 2F9IA 3U9RB 1Q52A 3N6RB 3H81A 1WDLA 2HW5A 1UYRA 3Q7HA 2Q2XA 2VSSA 4L6WA 4G2RA 1JXZA 4OG1A 1UIYA 2FZSA 4JJTA 4RYFH 3G64A 4ASIA 3DORA 5JBXA 3OC7A 4ZDEA 1N6EA 1SZOA 3ZWBA 4FJWD 5MGBA 3TVWA 3FF6A 3KTJA 4JCQA 3V5EA 4B3IA 1TYFA 3U9TB 3ZWCA 3I47A 1PIXA 3PEAA 3QWDA 4Q1IA 4IZDA 1VRGA 1Y7OA 2CBYA 2J5II 4HC8A 3M6MA 4NARA 1YG8A 3KTHA 2A7SA 1O8UA 2IEXA 2A81A 2D3TA 4B3JA 5CTBA 3NJBA 3T8AA 4WZ8B 3TVUA 2VSSE 3TLFA 4ZDFA 3JU1A 1PJHA 3T89A 2FBMA 4HNKA 4EMPA 2ZL3A 3LKEA 2VX2A 4OMRA 4ZDBA 2F9YA 4WYOB 2NP9A 5G1QA 1K39A 1OD4A 3Q0GA 4GHNA 3R9TA 1FC9A 3QYRA 2DEOA 2GTRA 2A7KA 3DJAA 1W2XA 3P2LA 3QXZA 4LK5A 3HINA 3GLMA 5KDRB 2DUBA 3HRXA 4FB8A 1HNOA 5G1RA 3R9SA 1EY3A 3MT6A 2PPYA 2VSUF 3GF7A 1WDMA 4U18A 1DCIA 4YLHA 5FUSA 5HUQA 4FN8A 3K8XA 2QQ3A 1RJNA 4U0GH 1NZYB 3H0UA 3KQFA 5G1SA 1HNUA 3T8BA 1J7XA 2CE3A 3KTGA 5DL1A 5E0SH 5INIA 3H0SA 4JCSA 1FC7A 2X58A 3QKAA 5INFA 5FIFA 4ZDCA 3FDUA 2ZL4A 2X24A 3Q0JA 2WTBA 4RYFA 3RSIA 4ELWA 3HLN1 3HP0A 5DTPA 3P5MA 1FC6A 1ON9A 3MYBA 2YJGA 3QXIA 1OD2A 3LAOA 3WG5A 2Q35A 3RSTA 5DUCA 1HZDA 5IKLB 4EMLA 4HDTA 3K50A 4Z0MA 1EF8A 4JWVA 2J5SA 4RCNA 4J2UA 5DZKA 4QIIA 3TRRA 2ZQRA 4K2NA 4Q0GA 1MJ3A 3NJDA 3STAA 2W3PA 3QMJA 3V5IA 4OLQA 2J5IA 3BF0A 4ELXA 2C8TA 1NZYA 2VSUA 5JBWA 1SG4A 4FZWA 4IZCA 1TG6A 4MXIA 4GM2A 3H0QA 4K29A 1UYVA 4QIJA 3PZKA 3QK8A 1XX4A 3KTKA 1XNWA 4EMMA 4JVTA 3R6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U0H A;  5E0S A;  3TDC A;  3OT6 A;  5DU6 A;  5ING A;  4KPK A;  1RJM A;  4F47 A;  4DI1 A;  5KDR A;  2VSU E;  4I52 A;  3ST9 A;  3P85 A;  3VIV A;  1N6F A;  4QFE A;  3GF3 A;  4JOT A;  1X0U A;  5E0N X;  4ZDD A;  3IB9 A;  2J5G A;  3Q1T A;  3RRV A;  3R0O A;  5DU8 A;  4JCT A;  3ZWA A;  3KTI A;  4KWB A;  5DZK H;  4U0G A;  3QRE A;  4JYJ A;  2FW2 A;  3ZW8 A;  1DUB A;  2J5I B;  4IZB A;  2F6Q A;  3IBB A;  2ZL2 A;  3SWX A;  4ELS A;  3T88 A;  2EJ5 A;  2UZF A;  2ZQQ A;  3BPP A;  3IAV A;  5C90 A;  1WDK A;  1FCF A;  3TZ3 A;  4I4Z A;  1UYS A;  5DU4 A;  3H0J A;  4KNP A;  2VSS F;  1WZ8 A;  2VRE A;  3GKB A;  4JYL A;  3T3W A;  1UYT A;  4U19 A;  4JFC A;  3R9Q A;  4ZU2 A;  1XNY A;  2PG8 A;  2F9Y B;  2PBP A;  3L3S A;  1K32 A;  1N6D A;  4K3W A;  1XNV A;  5C9G A;  4B3H A;  3TT6 A;  3OME A;  4U1A A;  1XO6 A;  3MFM A;  1Q51 A;  2Q34 A;  2F6I A;  5DKP A;  4MI2 A;  3M6N A;  3PE8 A;  3H02 A;  4FZW C;  3BEZ A;  4FND A;  3TV5 A;  1EF9 A;  3GMA A;  1ON3 A;  3U9S B;  4JSB A;  4FN7 A;  4WCZ A;  4JCR A;  1YG6 A;  3ZW9 A;  2ZL0 A;  4KD6 A;  4NEK A;  2VSU C;  3TT7 A;  4I42 A;  4MOU A;  5DTW A;  4FNB A;  5CTC A;  5KJP A;  5DUF A;  4L8K A;  2BZR A;  3MOY A;  3SLL A;  2J5G D;  3ISA A;  3PGQ A;  4NNQ A;  3HE2 A;  2F9I B;  2F9I A;  3U9R B;  1Q52 A;  3N6R B;  3H81 A;  1WDL A;  2HW5 A;  1UYR A;  3Q7H A;  2Q2X A;  2VSS A;  4L6W A;  4G2R A;  1JXZ A;  4OG1 A;  1UIY A;  2FZS A;  4JJT A;  4RYF H;  3G64 A;  4ASI A;  3DOR A;  5JBX A;  3OC7 A;  4ZDE A;  1N6E A;  1SZO A;  3ZWB A;  4FJW D;  5MGB A;  3TVW A;  3FF6 A;  3KTJ A;  4JCQ A;  3V5E A;  4B3I A;  1TYF A;  3U9T B;  3ZWC A;  3I47 A;  1PIX A;  3PEA A;  3QWD A;  4Q1I A;  4IZD A;  1VRG A;  1Y7O A;  2CBY A;  2J5I I;  4HC8 A;  3M6M A;  1YG8 A;  3KTH A;  2A7S A;  1O8U A;  2IEX A;  2A81 A;  2D3T A;  4B3J A;  5CTB A;  3NJB A;  3T8A A;  4WZ8 B;  3TVU A;  2VSS E;  3TLF A;  4ZDF A;  3JU1 A;  1PJH A;  3T89 A;  2FBM A;  4HNK A;  4EMP A;  2ZL3 A;  3LKE A;  2VX2 A;  4OMR A;  4ZDB A;  2F9Y A;  4WYO B;  2NP9 A;  5G1Q A;  1K39 A;  1OD4 A;  3Q0G A;  4GHN A;  3R9T A;  1FC9 A;  3QYR A;  2DEO A;  2GTR A;  2A7K A;  3DJA A;  1W2X A;  3P2L A;  3QXZ A;  4LK5 A;  3HIN A;  3GLM A;  5KDR B;  2DUB A;  3HRX A;  4FB8 A;  1HNO A;  5G1R A;  3R9S A;  1EY3 A;  3MT6 A;  2PPY A;  2VSU F;  3GF7 A;  1WDM A;  4U18 A;  1DCI A;  4YLH A;  5FUS A;  4FN8 A;  3K8X A;  2QQ3 A;  1RJN A;  4U0G H;  1NZY B;  3H0U A;  3KQF A;  5G1S A;  1HNU A;  3T8B A;  1J7X A;  2CE3 A;  3KTG A;  5DL1 A;  5E0S H;  5INI A;  3H0S A;  4JCS A;  1FC7 A;  2X58 A;  3QKA A;  5INF A;  5FIF A;  4ZDC A;  3FDU A;  2ZL4 A;  2X24 A;  3Q0J A;  2WTB A;  4RYF A;  3RSI A;  4ELW A;  3HLN 1;  3HP0 A;  5DTP A;  3P5M A;  1FC6 A;  1ON9 A;  3MYB A;  3QXI A;  1OD2 A;  3LAO A;  3WG5 A;  2Q35 A;  3RST A;  5DUC A;  1HZD A;  5IKL B;  4EML A;  3K50 A;  4Z0M A;  1EF8 A;  4JWV A;  2J5S A;  4RCN A;  5DZK A;  4QII A;  3TRR A;  2ZQR A;  4K2N A;  4Q0G A;  1MJ3 A;  3NJD A;  3STA A;  2W3P A;  3QMJ A;  3V5I A;  4OLQ A;  2J5I A;  3BF0 A;  4ELX A;  2C8T A;  1NZY A;  2VSU A;  5JBW A;  1SG4 A;  4FZW A;  4IZC A;  1TG6 A;  4MXI A;  4GM2 A;  3H0Q A;  4K29 A;  1UYV A;  4QIJ A;  3PZK A;  3QK8 A;  1XX4 A;  3KTK A;  1XNW A;  4EMM A;  4JVT A;  3R6H A; 
#chains in the Genus database with same CATH topology
 4U0H A;  5E0S A;  3TDC A;  3OT6 A;  5DU6 A;  5ING A;  4KPK A;  1RJM A;  4F47 A;  4DI1 A;  5KDR A;  2VSU E;  4I52 A;  3ST9 A;  3P85 A;  3VIV A;  1N6F A;  4QFE A;  3GF3 A;  4JOT A;  1X0U A;  5E0N X;  4ZDD A;  3IB9 A;  2J5G A;  3Q1T A;  3RRV A;  3R0O A;  5DU8 A;  4JCT A;  3ZWA A;  3KTI A;  4KWB A;  5DZK H;  4U0G A;  3QRE A;  4JYJ A;  2FW2 A;  3BPT A;  3ZW8 A;  1DUB A;  2J5I B;  4IZB A;  2F6Q A;  3IBB A;  2ZL2 A;  3SWX A;  4ELS A;  3T88 A;  2EJ5 A;  2UZF A;  2ZQQ A;  3BPP A;  3IAV A;  5C90 A;  1WDK A;  1FCF A;  3TZ3 A;  4I4Z A;  1UYS A;  5DU4 A;  3H0J A;  4KNP A;  2VSS F;  1WZ8 A;  2VRE A;  3GKB A;  4JYL A;  3T3W A;  1UYT A;  4U19 A;  4JFC A;  3R9Q A;  4ZU2 A;  1XNY A;  2PG8 A;  2F9Y B;  2PBP A;  3L3S A;  1K32 A;  1N6D A;  4K3W A;  1XNV A;  5C9G A;  4B3H A;  3TT6 A;  3OME A;  4U1A A;  1XO6 A;  3MFM A;  1Q51 A;  2Q34 A;  2F6I A;  5DKP A;  4MI2 A;  3M6N A;  3PE8 A;  3H02 A;  4FZW C;  3BEZ A;  4FND A;  3TV5 A;  1EF9 A;  3GMA A;  1ON3 A;  3U9S B;  4JSB A;  4FN7 A;  4WCZ A;  4JCR A;  1YG6 A;  3ZW9 A;  2ZL0 A;  4KD6 A;  4NEK A;  2VSU C;  3TT7 A;  4I42 A;  4MOU A;  5DTW A;  4FNB A;  5CTC A;  5KJP A;  5DUF A;  4L8K A;  2BZR A;  3MOY A;  3SLL A;  2J5G D;  3ISA A;  3PGQ A;  4NNQ A;  3HE2 A;  2F9I B;  2F9I A;  3U9R B;  1Q52 A;  3N6R B;  3H81 A;  1WDL A;  2HW5 A;  1UYR A;  3Q7H A;  2Q2X A;  2VSS A;  4L6W A;  4G2R A;  1JXZ A;  4OG1 A;  1UIY A;  2FZS A;  4JJT A;  4RYF H;  3G64 A;  4ASI A;  3DOR A;  5JBX A;  3OC7 A;  4ZDE A;  1N6E A;  1SZO A;  3ZWB A;  4FJW D;  5MGB A;  3TVW A;  3FF6 A;  3KTJ A;  4JCQ A;  3V5E A;  4B3I A;  1TYF A;  3U9T B;  3ZWC A;  3I47 A;  1PIX A;  3PEA A;  3QWD A;  4Q1I A;  4IZD A;  1VRG A;  1Y7O A;  2CBY A;  2J5I I;  4HC8 A;  3M6M A;  4NAR A;  1YG8 A;  3KTH A;  2A7S A;  1O8U A;  2IEX A;  2A81 A;  2D3T A;  4B3J A;  5CTB A;  3NJB A;  3T8A A;  4WZ8 B;  3TVU A;  2VSS E;  3TLF A;  4ZDF A;  3JU1 A;  1PJH A;  3T89 A;  2FBM A;  4HNK A;  4EMP A;  2ZL3 A;  3LKE A;  2VX2 A;  4OMR A;  4ZDB A;  2F9Y A;  4WYO B;  2NP9 A;  5G1Q A;  1K39 A;  1OD4 A;  3Q0G A;  4GHN A;  3R9T A;  1FC9 A;  3QYR A;  2DEO A;  2GTR A;  2A7K A;  3DJA A;  1W2X A;  3P2L A;  3QXZ A;  4LK5 A;  3HIN A;  3GLM A;  5KDR B;  2DUB A;  3HRX A;  4FB8 A;  1HNO A;  5G1R A;  3R9S A;  1EY3 A;  3MT6 A;  2PPY A;  2VSU F;  3GF7 A;  1WDM A;  4U18 A;  1DCI A;  4YLH A;  5FUS A;  5HUQ A;  4FN8 A;  3K8X A;  2QQ3 A;  1RJN A;  4U0G H;  1NZY B;  3H0U A;  3KQF A;  5G1S A;  1HNU A;  3T8B A;  1J7X A;  2CE3 A;  3KTG A;  5DL1 A;  5E0S H;  5INI A;  3H0S A;  4JCS A;  1FC7 A;  2X58 A;  3QKA A;  5INF A;  5FIF A;  4ZDC A;  3FDU A;  2ZL4 A;  2X24 A;  3Q0J A;  2WTB A;  4RYF A;  3RSI A;  4ELW A;  3HLN 1;  3HP0 A;  5DTP A;  3P5M A;  1FC6 A;  1ON9 A;  3MYB A;  2YJG A;  3QXI A;  1OD2 A;  3LAO A;  3WG5 A;  2Q35 A;  3RST A;  5DUC A;  1HZD A;  5IKL B;  4EML A;  4HDT A;  3K50 A;  4Z0M A;  1EF8 A;  4JWV A;  2J5S A;  4RCN A;  4J2U A;  5DZK A;  4QII A;  3TRR A;  2ZQR A;  4K2N A;  4Q0G A;  1MJ3 A;  3NJD A;  3STA A;  2W3P A;  3QMJ A;  3V5I A;  4OLQ A;  2J5I A;  3BF0 A;  4ELX A;  2C8T A;  1NZY A;  2VSU A;  5JBW A;  1SG4 A;  4FZW A;  4IZC A;  1TG6 A;  4MXI A;  4GM2 A;  3H0Q A;  4K29 A;  1UYV A;  4QIJ A;  3PZK A;  3QK8 A;  1XX4 A;  3KTK A;  1XNW A;  4EMM A;  4JVT A;  3R6H A; 
#chains in the Genus database with same CATH homology
 4U0H A;  5E0S A;  3TDC A;  3OT6 A;  5DU6 A;  5ING A;  4KPK A;  1RJM A;  4F47 A;  4DI1 A;  5KDR A;  2VSU E;  4I52 A;  3ST9 A;  3P85 A;  3VIV A;  1N6F A;  4QFE A;  3GF3 A;  4JOT A;  1X0U A;  5E0N X;  4ZDD A;  3IB9 A;  2J5G A;  3Q1T A;  3RRV A;  3R0O A;  5DU8 A;  4JCT A;  3ZWA A;  3KTI A;  4KWB A;  5DZK H;  4U0G A;  3QRE A;  4JYJ A;  2FW2 A;  3BPT A;  3ZW8 A;  1DUB A;  2J5I B;  4IZB A;  2F6Q A;  3IBB A;  2ZL2 A;  3SWX A;  4ELS A;  3T88 A;  2EJ5 A;  2UZF A;  2ZQQ A;  3BPP A;  3IAV A;  5C90 A;  1WDK A;  1FCF A;  3TZ3 A;  4I4Z A;  1UYS A;  5DU4 A;  3H0J A;  4KNP A;  2VSS F;  1WZ8 A;  2VRE A;  3GKB A;  4JYL A;  3T3W A;  1UYT A;  4U19 A;  4JFC A;  3R9Q A;  4ZU2 A;  1XNY A;  2PG8 A;  2F9Y B;  2PBP A;  3L3S A;  1K32 A;  1N6D A;  4K3W A;  1XNV A;  5C9G A;  4B3H A;  3TT6 A;  3OME A;  4U1A A;  1XO6 A;  3MFM A;  1Q51 A;  2Q34 A;  2F6I A;  5DKP A;  4MI2 A;  3M6N A;  3PE8 A;  3H02 A;  4FZW C;  3BEZ A;  4FND A;  3TV5 A;  1EF9 A;  3GMA A;  1ON3 A;  3U9S B;  4JSB A;  4FN7 A;  4WCZ A;  4JCR A;  1YG6 A;  3ZW9 A;  2ZL0 A;  4KD6 A;  4NEK A;  2VSU C;  3TT7 A;  4I42 A;  4MOU A;  5DTW A;  4FNB A;  5CTC A;  5KJP A;  5DUF A;  4L8K A;  2BZR A;  3MOY A;  3SLL A;  2J5G D;  3ISA A;  3PGQ A;  4NNQ A;  3HE2 A;  2F9I B;  2F9I A;  3U9R B;  1Q52 A;  3N6R B;  3H81 A;  1WDL A;  2HW5 A;  1UYR A;  3Q7H A;  2Q2X A;  2VSS A;  4L6W A;  4G2R A;  1JXZ A;  4OG1 A;  1UIY A;  2FZS A;  4JJT A;  4RYF H;  3G64 A;  4ASI A;  3DOR A;  5JBX A;  3OC7 A;  4ZDE A;  1N6E A;  1SZO A;  3ZWB A;  4FJW D;  5MGB A;  3TVW A;  3FF6 A;  3KTJ A;  4JCQ A;  3V5E A;  4B3I A;  1TYF A;  3U9T B;  3ZWC A;  3I47 A;  1PIX A;  3PEA A;  3QWD A;  4Q1I A;  4IZD A;  1VRG A;  1Y7O A;  2CBY A;  2J5I I;  4HC8 A;  3M6M A;  4NAR A;  1YG8 A;  3KTH A;  2A7S A;  1O8U A;  2IEX A;  2A81 A;  2D3T A;  4B3J A;  5CTB A;  3NJB A;  3T8A A;  4WZ8 B;  3TVU A;  2VSS E;  3TLF A;  4ZDF A;  3JU1 A;  1PJH A;  3T89 A;  2FBM A;  4HNK A;  4EMP A;  2ZL3 A;  3LKE A;  2VX2 A;  4OMR A;  4ZDB A;  2F9Y A;  4WYO B;  2NP9 A;  5G1Q A;  1K39 A;  1OD4 A;  3Q0G A;  4GHN A;  3R9T A;  1FC9 A;  3QYR A;  2DEO A;  2GTR A;  2A7K A;  3DJA A;  1W2X A;  3P2L A;  3QXZ A;  4LK5 A;  3HIN A;  3GLM A;  5KDR B;  2DUB A;  3HRX A;  4FB8 A;  1HNO A;  5G1R A;  3R9S A;  1EY3 A;  3MT6 A;  2PPY A;  2VSU F;  3GF7 A;  1WDM A;  4U18 A;  1DCI A;  4YLH A;  5FUS A;  5HUQ A;  4FN8 A;  3K8X A;  2QQ3 A;  1RJN A;  4U0G H;  1NZY B;  3H0U A;  3KQF A;  5G1S A;  1HNU A;  3T8B A;  1J7X A;  2CE3 A;  3KTG A;  5DL1 A;  5E0S H;  5INI A;  3H0S A;  4JCS A;  1FC7 A;  2X58 A;  3QKA A;  5INF A;  5FIF A;  4ZDC A;  3FDU A;  2ZL4 A;  2X24 A;  3Q0J A;  2WTB A;  4RYF A;  3RSI A;  4ELW A;  3HLN 1;  3HP0 A;  5DTP A;  3P5M A;  1FC6 A;  1ON9 A;  3MYB A;  2YJG A;  3QXI A;  1OD2 A;  3LAO A;  3WG5 A;  2Q35 A;  3RST A;  5DUC A;  1HZD A;  5IKL B;  4EML A;  4HDT A;  3K50 A;  4Z0M A;  1EF8 A;  4JWV A;  2J5S A;  4RCN A;  4J2U A;  5DZK A;  4QII A;  3TRR A;  2ZQR A;  4K2N A;  4Q0G A;  1MJ3 A;  3NJD A;  3STA A;  2W3P A;  3QMJ A;  3V5I A;  4OLQ A;  2J5I A;  3BF0 A;  4ELX A;  2C8T A;  1NZY A;  2VSU A;  5JBW A;  1SG4 A;  4FZW A;  4IZC A;  1TG6 A;  4MXI A;  4GM2 A;  3H0Q A;  4K29 A;  1UYV A;  4QIJ A;  3PZK A;  3QK8 A;  1XX4 A;  3KTK A;  1XNW A;  4EMM A;  4JVT A;  3R6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...