3BPPA

1510-n membrane protease k138a mutant specific for a stomatin homolog from pyrococcus horikoshii
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
216
structure length
216
Chain Sequence
b'AKNIVYVAQIKGQITSYTYDQFDRYITIAEQDNAEAIIIELDTPGGRADAMMNIVQRIQQSKIPVIIYVYPPGASAASAGTYIALGSHLIAMAPGTSIGACRPILGYSQNGSIIEAPPAITNYFIAYIKSLAQESGRNATIAEEFITKDLSLTPEEALKYGVIEVVARDINELLKKSNGMKTKIPVNGRYVTLNFTNVEVRYLAPSFKDKLISYIT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1510-N membrane protease
publication title Novel dimer structure of a membrane-bound protease with a catalytic Ser-Lys dyad and its linkage to stomatin
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
total genus 72
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2007-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3bppA00
2F9IA 2VREA 5E0SA 3HLN1 5INIA 1UIYA 3ZWBA 3QMJA 1FC7A 3KTGA 1FC9A 5DL1A 4KPKA 5DZKH 3KTIA 4JYLA 5G1QA 5INFA 2J5IB 3PEAA 1NZYA 2VSUF 1PJHA 3JU1A 2F9IB 4K3WA 3RRVA 2ZQQA 3K8XA 3KTJA 4HNKA 1TYFA 1PIXA 2J5II 4NNQA 1HNOA 2QQ3A 2FBMA 4Q0GA 2X58A 4FB8A 1EF8A 3VIVA 1NZYB 1Q52A 2F6IA 2X24A 2VSSF 2W3PA 4U19A 4ZDFA 3U9TB 5DKPA 5DU6A 4JYJA 3BEZA 4HC8A 5CTBA 1K39A 5IKLB 5INGA 4WYOB 2NP9A 2VSUA 1FCFA 1ON3A 4JCTA 4JCQA 3HRXA 3T89A 2FZSA 3Q0GA 3PZKA 4YLHA 3TV5A 5DUFA 2ZL0A 3OMEA 1W2XA 4FN8A 3Q0JA 4IZCA 5DU4A 4LK5A 3QK8A 3U9SB 5KDRA 4B3JA 2VSSA 3HINA 4QIIA 1XX4A 3H02A 5FIFA 1WDLA 5G1RA 3R6HA 2Q2XA 2VSUE 3GMAA 4L8KA 5DZKA 1EF9A 4ZDBA 3H81A 4FN7A 3QREA 1DCIA 2PG8A 5KDRB 3T3WA 4NEKA 4Z0MA 1UYVA 2J5GD 3IAVA 4DI1A 3QKAA 4JSBA 2ZQRA 3M6MA 3GLMA 3U9RB 2PPYA 2Q34A 3LKEA 4QIJA 4WZ8B 4U18A 3GKBA 2IEXA 1XNVA 2CE3A 1WDMA 2WTBA 1HNUA 1OD2A 3H0QA 3M6NA 1K32A 1ON9A 1Q51A 5DTPA 4FNDA 1UYSA 3TT6A 2VSUC 3SWXA 3GF3A 2A81A 1MJ3A 3DORA 4U0HA 4F47A 3NJDA 4IZDA 1UYRA 3HP0A 3FF6A 4KD6A 1HZDA 1VRGA 3TLFA 3R9TA 3R0OA 1O8UA 2UZFA 3K50A 4FZWA 4FNBA 4B3IA 3T8BA 3V5IA 3TDCA 4GHNA 1Y7OA 2D3TA 3TZ3A 5C90A 2A7KA 2HW5A 3MT6A 4K29A 3NJBA 3BPPA 2Q35A 4RYFA 3TRRA 1RJNA 3IB9A 4B3HA 4MOUA 4GM2A 3WG5A 1SG4A 4MXIA 4ZDDA 3PE8A 2GTRA 4EMPA 3ZW8A 3HE2A 3TT7A 3QXZA 3KTKA 4OLQA 1JXZA 4ASIA 3T8AA 4WCZA 2C8TA 3T88A 5JBXA 4Q1IA 3H0UA 1N6DA 4RCNA 3R9QA 4RYFH 4ELXA 3GF7A 2J5SA 3ZWAA 1OD4A 3QXIA 4ELSA 1UYTA 3KTHA 3KQFA 4JCRA 4ZDCA 4U0GA 4ZU2A 2J5GA 3RSTA 5C9GA 2VSSE 4ELWA 3MFMA 1WDKA 3P2LA 3LAOA 1XNYA 1DUBA 3P5MA 3IBBA 4L6WA 2DEOA 2FW2A 2VX2A 1YG8A 1XNWA 4FZWC 1J7XA 4JWVA 4U0GH 3P85A 1EY3A 3TVUA 3QWDA 4U1AA 3V5EA 2CBYA 3ISAA 4G2RA 5FUSA 3ST9A 3STAA 5E0SH 3L3SA 3N6RB 4JJTA 3SLLA 4I42A 2F9YA 3ZW9A 3Q1TA 5CTCA 4JCSA 3H0SA 2F6QA 5KJPA 3ZWCA 4JOTA 4ZDEA 3MOYA 3H0JA 3TVWA 1YG6A 4QFEA 5DUCA 1FC6A 3QYRA 3R9SA 3BF0A 4IZBA 2F9YB 3FDUA 2A7SA 1RJMA 2PBPA 1N6EA 3DJAA 4I4ZA 4MI2A 4OMRA 4JFCA 4KNPA 3I47A 5DU8A 3Q7HA 5DTWA 3MYBA 5MGBA 4EMLA 4KWBA 1WZ8A 5JBWA 2EJ5A 3RSIA 1N6FA 4EMMA 2DUBA 4JVTA 4OG1A 3OC7A 4FJWD 3G64A 1X0UA 2ZL3A 2ZL4A 4K2NA 1TG6A 4I52A 2ZL2A 2BZRA 5E0NX 1XO6A 3OT6A 5G1SA 2J5IA 1SZOA 3PGQA
chains in the Genus database with same CATH superfamily
2YJGA 2F9IA 2VREA 5E0SA 3HLN1 5INIA 1UIYA 3ZWBA 3QMJA 1FC7A 3KTGA 1FC9A 5DL1A 4KPKA 5DZKH 3KTIA 4HDTA 4JYLA 5G1QA 5INFA 2J5IB 3PEAA 1NZYA 2VSUF 1PJHA 3JU1A 2F9IB 4K3WA 3RRVA 2ZQQA 3K8XA 3KTJA 4HNKA 1TYFA 1PIXA 2J5II 4NNQA 1HNOA 2QQ3A 2FBMA 4Q0GA 2X58A 4FB8A 1EF8A 3VIVA 1NZYB 1Q52A 2F6IA 2X24A 2VSSF 2W3PA 4U19A 4ZDFA 3U9TB 5DKPA 5DU6A 4JYJA 3BEZA 4HC8A 5CTBA 1K39A 5IKLB 5INGA 4WYOB 2NP9A 2VSUA 1FCFA 1ON3A 4JCTA 4JCQA 3HRXA 3T89A 2FZSA 3Q0GA 3PZKA 4YLHA 3TV5A 5DUFA 2ZL0A 3OMEA 1W2XA 4FN8A 3Q0JA 4IZCA 5DU4A 4LK5A 3QK8A 3U9SB 5KDRA 4B3JA 2VSSA 3HINA 4QIIA 5HUQA 1XX4A 3H02A 5FIFA 1WDLA 5G1RA 3R6HA 2Q2XA 2VSUE 3GMAA 4L8KA 5DZKA 1EF9A 4ZDBA 3H81A 4FN7A 3QREA 1DCIA 2PG8A 5KDRB 3T3WA 4NEKA 4Z0MA 1UYVA 2J5GD 3IAVA 4DI1A 3QKAA 4JSBA 2ZQRA 3M6MA 3GLMA 3U9RB 2PPYA 2Q34A 3LKEA 4QIJA 4WZ8B 4U18A 3GKBA 2IEXA 1XNVA 2CE3A 1WDMA 2WTBA 1HNUA 1OD2A 3H0QA 3M6NA 1K32A 1ON9A 1Q51A 5DTPA 4FNDA 1UYSA 3TT6A 2VSUC 3SWXA 3GF3A 2A81A 1MJ3A 3DORA 4U0HA 4F47A 3NJDA 4IZDA 1UYRA 3HP0A 3FF6A 4KD6A 1HZDA 1VRGA 3TLFA 3R9TA 3R0OA 1O8UA 2UZFA 3K50A 4FZWA 4FNBA 4B3IA 3BPTA 3T8BA 3V5IA 3TDCA 4GHNA 1Y7OA 2D3TA 3TZ3A 5C90A 2A7KA 2HW5A 3MT6A 4K29A 3NJBA 3BPPA 2Q35A 4RYFA 3TRRA 1RJNA 3IB9A 4B3HA 4MOUA 4GM2A 3WG5A 1SG4A 4MXIA 4ZDDA 3PE8A 2GTRA 4EMPA 3ZW8A 3HE2A 3TT7A 3QXZA 3KTKA 4OLQA 1JXZA 4ASIA 3T8AA 4WCZA 2C8TA 3T88A 5JBXA 4Q1IA 3H0UA 1N6DA 4RCNA 3R9QA 4RYFH 4ELXA 3GF7A 2J5SA 3ZWAA 1OD4A 3QXIA 4ELSA 1UYTA 3KTHA 3KQFA 4JCRA 4ZDCA 4U0GA 4ZU2A 2J5GA 3RSTA 5C9GA 2VSSE 4ELWA 3MFMA 1WDKA 3P2LA 3LAOA 1XNYA 1DUBA 4J2UA 4NARA 3P5MA 3IBBA 4L6WA 2DEOA 2FW2A 2VX2A 1YG8A 1XNWA 4FZWC 1J7XA 4JWVA 4U0GH 3P85A 1EY3A 3TVUA 3QWDA 4U1AA 3V5EA 2CBYA 3ISAA 4G2RA 5FUSA 3ST9A 3STAA 5E0SH 3L3SA 3N6RB 4JJTA 3SLLA 4I42A 2F9YA 3ZW9A 3Q1TA 5CTCA 4JCSA 3H0SA 2F6QA 5KJPA 3ZWCA 4JOTA 4ZDEA 3MOYA 3H0JA 3TVWA 1YG6A 4QFEA 5DUCA 1FC6A 3QYRA 3R9SA 3BF0A 4IZBA 2F9YB 3FDUA 2A7SA 1RJMA 2PBPA 1N6EA 3DJAA 4I4ZA 4MI2A 4OMRA 4JFCA 4KNPA 3I47A 5DU8A 3Q7HA 5DTWA 3MYBA 5MGBA 4EMLA 4KWBA 1WZ8A 5JBWA 2EJ5A 3RSIA 1N6FA 4EMMA 2DUBA 4JVTA 4OG1A 3OC7A 4FJWD 3G64A 1X0UA 2ZL3A 2ZL4A 4K2NA 1TG6A 4I52A 2ZL2A 2BZRA 5E0NX 1XO6A 3OT6A 5G1SA 2J5IA 1SZOA 3PGQA
chains in the Genus database with same CATH topology
2YJGA 2F9IA 2VREA 5E0SA 3HLN1 5INIA 1UIYA 3ZWBA 3QMJA 1FC7A 3KTGA 1FC9A 5DL1A 4KPKA 5DZKH 3KTIA 4HDTA 4JYLA 5G1QA 5INFA 2J5IB 3PEAA 1NZYA 2VSUF 1PJHA 3JU1A 2F9IB 4K3WA 3RRVA 2ZQQA 3K8XA 3KTJA 4HNKA 1TYFA 1PIXA 2J5II 4NNQA 1HNOA 2QQ3A 2FBMA 4Q0GA 2X58A 4FB8A 1EF8A 3VIVA 1NZYB 1Q52A 2F6IA 2X24A 2VSSF 2W3PA 4U19A 4ZDFA 3U9TB 5DKPA 5DU6A 4JYJA 3BEZA 4HC8A 5CTBA 1K39A 5IKLB 5INGA 4WYOB 2NP9A 2VSUA 1FCFA 1ON3A 4JCTA 4JCQA 3HRXA 3T89A 2FZSA 3Q0GA 3PZKA 4YLHA 3TV5A 5DUFA 2ZL0A 3OMEA 1W2XA 4FN8A 3Q0JA 4IZCA 5DU4A 4LK5A 3QK8A 3U9SB 5KDRA 4B3JA 2VSSA 3HINA 4QIIA 5HUQA 1XX4A 3H02A 5FIFA 1WDLA 5G1RA 3R6HA 2Q2XA 2VSUE 3GMAA 4L8KA 5DZKA 1EF9A 4ZDBA 3H81A 4FN7A 3QREA 1DCIA 2PG8A 5KDRB 3T3WA 4NEKA 4Z0MA 1UYVA 2J5GD 3IAVA 4DI1A 3QKAA 4JSBA 2ZQRA 3M6MA 3GLMA 3U9RB 2PPYA 2Q34A 3LKEA 4QIJA 4WZ8B 4U18A 3GKBA 2IEXA 1XNVA 2CE3A 1WDMA 2WTBA 1HNUA 1OD2A 3H0QA 3M6NA 1K32A 1ON9A 1Q51A 5DTPA 4FNDA 1UYSA 3TT6A 2VSUC 3SWXA 3GF3A 2A81A 1MJ3A 3DORA 4U0HA 4F47A 3NJDA 4IZDA 1UYRA 3HP0A 3FF6A 4KD6A 1HZDA 1VRGA 3TLFA 3R9TA 3R0OA 1O8UA 2UZFA 3K50A 4FZWA 4FNBA 4B3IA 3BPTA 3T8BA 3V5IA 3TDCA 4GHNA 1Y7OA 2D3TA 3TZ3A 5C90A 2A7KA 2HW5A 3MT6A 4K29A 3NJBA 3BPPA 2Q35A 4RYFA 3TRRA 1RJNA 3IB9A 4B3HA 4MOUA 4GM2A 3WG5A 1SG4A 4MXIA 4ZDDA 3PE8A 2GTRA 4EMPA 3ZW8A 3HE2A 3TT7A 3QXZA 3KTKA 4OLQA 1JXZA 4ASIA 3T8AA 4WCZA 2C8TA 3T88A 5JBXA 4Q1IA 3H0UA 1N6DA 4RCNA 3R9QA 4RYFH 4ELXA 3GF7A 2J5SA 3ZWAA 1OD4A 3QXIA 4ELSA 1UYTA 3KTHA 3KQFA 4JCRA 4ZDCA 4U0GA 4ZU2A 2J5GA 3RSTA 5C9GA 2VSSE 4ELWA 3MFMA 1WDKA 3P2LA 3LAOA 1XNYA 1DUBA 4J2UA 4NARA 3P5MA 3IBBA 4L6WA 2DEOA 2FW2A 2VX2A 1YG8A 1XNWA 4FZWC 1J7XA 4JWVA 4U0GH 3P85A 1EY3A 3TVUA 3QWDA 4U1AA 3V5EA 2CBYA 3ISAA 4G2RA 5FUSA 3ST9A 3STAA 5E0SH 3L3SA 3N6RB 4JJTA 3SLLA 4I42A 2F9YA 3ZW9A 3Q1TA 5CTCA 4JCSA 3H0SA 2F6QA 5KJPA 3ZWCA 4JOTA 4ZDEA 3MOYA 3H0JA 3TVWA 1YG6A 4QFEA 5DUCA 1FC6A 3QYRA 3R9SA 3BF0A 4IZBA 2F9YB 3FDUA 2A7SA 1RJMA 2PBPA 1N6EA 3DJAA 4I4ZA 4MI2A 4OMRA 4JFCA 4KNPA 3I47A 5DU8A 3Q7HA 5DTWA 3MYBA 5MGBA 4EMLA 4KWBA 1WZ8A 5JBWA 2EJ5A 3RSIA 1N6FA 4EMMA 2DUBA 4JVTA 4OG1A 3OC7A 4FJWD 3G64A 1X0UA 2ZL3A 2ZL4A 4K2NA 1TG6A 4I52A 2ZL2A 2BZRA 5E0NX 1XO6A 3OT6A 5G1SA 2J5IA 1SZOA 3PGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F9I A;  2VRE A;  5E0S A;  3HLN 1;  5INI A;  1UIY A;  3ZWB A;  3QMJ A;  1FC7 A;  3KTG A;  1FC9 A;  5DL1 A;  4KPK A;  5DZK H;  3KTI A;  4JYL A;  5G1Q A;  5INF A;  2J5I B;  3PEA A;  1NZY A;  2VSU F;  1PJH A;  3JU1 A;  2F9I B;  4K3W A;  3RRV A;  2ZQQ A;  3K8X A;  3KTJ A;  4HNK A;  1TYF A;  1PIX A;  2J5I I;  4NNQ A;  1HNO A;  2QQ3 A;  2FBM A;  4Q0G A;  2X58 A;  4FB8 A;  1EF8 A;  3VIV A;  1NZY B;  1Q52 A;  2F6I A;  2X24 A;  2VSS F;  2W3P A;  4U19 A;  4ZDF A;  3U9T B;  5DKP A;  5DU6 A;  4JYJ A;  3BEZ A;  4HC8 A;  5CTB A;  1K39 A;  5IKL B;  5ING A;  4WYO B;  2NP9 A;  2VSU A;  1FCF A;  1ON3 A;  4JCT A;  4JCQ A;  3HRX A;  3T89 A;  2FZS A;  3Q0G A;  3PZK A;  4YLH A;  3TV5 A;  5DUF A;  2ZL0 A;  3OME A;  1W2X A;  4FN8 A;  3Q0J A;  4IZC A;  5DU4 A;  4LK5 A;  3QK8 A;  3U9S B;  5KDR A;  4B3J A;  2VSS A;  3HIN A;  4QII A;  1XX4 A;  3H02 A;  5FIF A;  1WDL A;  5G1R A;  3R6H A;  2Q2X A;  2VSU E;  3GMA A;  4L8K A;  5DZK A;  1EF9 A;  4ZDB A;  3H81 A;  4FN7 A;  3QRE A;  1DCI A;  2PG8 A;  5KDR B;  3T3W A;  4NEK A;  4Z0M A;  1UYV A;  2J5G D;  3IAV A;  4DI1 A;  3QKA A;  4JSB A;  2ZQR A;  3M6M A;  3GLM A;  3U9R B;  2PPY A;  2Q34 A;  3LKE A;  4QIJ A;  4WZ8 B;  4U18 A;  3GKB A;  2IEX A;  1XNV A;  2CE3 A;  1WDM A;  2WTB A;  1HNU A;  1OD2 A;  3H0Q A;  3M6N A;  1K32 A;  1ON9 A;  1Q51 A;  5DTP A;  4FND A;  1UYS A;  3TT6 A;  2VSU C;  3SWX A;  3GF3 A;  2A81 A;  1MJ3 A;  3DOR A;  4U0H A;  4F47 A;  3NJD A;  4IZD A;  1UYR A;  3HP0 A;  3FF6 A;  4KD6 A;  1HZD A;  1VRG A;  3TLF A;  3R9T A;  3R0O A;  1O8U A;  2UZF A;  3K50 A;  4FZW A;  4FNB A;  4B3I A;  3T8B A;  3V5I A;  3TDC A;  4GHN A;  1Y7O A;  2D3T A;  3TZ3 A;  5C90 A;  2A7K A;  2HW5 A;  3MT6 A;  4K29 A;  3NJB A;  3BPP A;  2Q35 A;  4RYF A;  3TRR A;  1RJN A;  3IB9 A;  4B3H A;  4MOU A;  4GM2 A;  3WG5 A;  1SG4 A;  4MXI A;  4ZDD A;  3PE8 A;  2GTR A;  4EMP A;  3ZW8 A;  3HE2 A;  3TT7 A;  3QXZ A;  3KTK A;  4OLQ A;  1JXZ A;  4ASI A;  3T8A A;  4WCZ A;  2C8T A;  3T88 A;  5JBX A;  4Q1I A;  3H0U A;  1N6D A;  4RCN A;  3R9Q A;  4RYF H;  4ELX A;  3GF7 A;  2J5S A;  3ZWA A;  1OD4 A;  3QXI A;  4ELS A;  1UYT A;  3KTH A;  3KQF A;  4JCR A;  4ZDC A;  4U0G A;  4ZU2 A;  2J5G A;  3RST A;  5C9G A;  2VSS E;  4ELW A;  3MFM A;  1WDK A;  3P2L A;  3LAO A;  1XNY A;  1DUB A;  3P5M A;  3IBB A;  4L6W A;  2DEO A;  2FW2 A;  2VX2 A;  1YG8 A;  1XNW A;  4FZW C;  1J7X A;  4JWV A;  4U0G H;  3P85 A;  1EY3 A;  3TVU A;  3QWD A;  4U1A A;  3V5E A;  2CBY A;  3ISA A;  4G2R A;  5FUS A;  3ST9 A;  3STA A;  5E0S H;  3L3S A;  3N6R B;  4JJT A;  3SLL A;  4I42 A;  2F9Y A;  3ZW9 A;  3Q1T A;  5CTC A;  4JCS A;  3H0S A;  2F6Q A;  5KJP A;  3ZWC A;  4JOT A;  4ZDE A;  3MOY A;  3H0J A;  3TVW A;  1YG6 A;  4QFE A;  5DUC A;  1FC6 A;  3QYR A;  3R9S A;  3BF0 A;  4IZB A;  2F9Y B;  3FDU A;  2A7S A;  1RJM A;  2PBP A;  1N6E A;  3DJA A;  4I4Z A;  4MI2 A;  4OMR A;  4JFC A;  4KNP A;  3I47 A;  5DU8 A;  3Q7H A;  5DTW A;  3MYB A;  5MGB A;  4EML A;  4KWB A;  1WZ8 A;  5JBW A;  2EJ5 A;  3RSI A;  1N6F A;  4EMM A;  2DUB A;  4JVT A;  4OG1 A;  3OC7 A;  4FJW D;  3G64 A;  1X0U A;  2ZL3 A;  2ZL4 A;  4K2N A;  1TG6 A;  4I52 A;  2ZL2 A;  2BZR A;  5E0N X;  1XO6 A;  3OT6 A;  5G1S A;  2J5I A;  1SZO A;  3PGQ A; 
#chains in the Genus database with same CATH topology
 2YJG A;  2F9I A;  2VRE A;  5E0S A;  3HLN 1;  5INI A;  1UIY A;  3ZWB A;  3QMJ A;  1FC7 A;  3KTG A;  1FC9 A;  5DL1 A;  4KPK A;  5DZK H;  3KTI A;  4HDT A;  4JYL A;  5G1Q A;  5INF A;  2J5I B;  3PEA A;  1NZY A;  2VSU F;  1PJH A;  3JU1 A;  2F9I B;  4K3W A;  3RRV A;  2ZQQ A;  3K8X A;  3KTJ A;  4HNK A;  1TYF A;  1PIX A;  2J5I I;  4NNQ A;  1HNO A;  2QQ3 A;  2FBM A;  4Q0G A;  2X58 A;  4FB8 A;  1EF8 A;  3VIV A;  1NZY B;  1Q52 A;  2F6I A;  2X24 A;  2VSS F;  2W3P A;  4U19 A;  4ZDF A;  3U9T B;  5DKP A;  5DU6 A;  4JYJ A;  3BEZ A;  4HC8 A;  5CTB A;  1K39 A;  5IKL B;  5ING A;  4WYO B;  2NP9 A;  2VSU A;  1FCF A;  1ON3 A;  4JCT A;  4JCQ A;  3HRX A;  3T89 A;  2FZS A;  3Q0G A;  3PZK A;  4YLH A;  3TV5 A;  5DUF A;  2ZL0 A;  3OME A;  1W2X A;  4FN8 A;  3Q0J A;  4IZC A;  5DU4 A;  4LK5 A;  3QK8 A;  3U9S B;  5KDR A;  4B3J A;  2VSS A;  3HIN A;  4QII A;  5HUQ A;  1XX4 A;  3H02 A;  5FIF A;  1WDL A;  5G1R A;  3R6H A;  2Q2X A;  2VSU E;  3GMA A;  4L8K A;  5DZK A;  1EF9 A;  4ZDB A;  3H81 A;  4FN7 A;  3QRE A;  1DCI A;  2PG8 A;  5KDR B;  3T3W A;  4NEK A;  4Z0M A;  1UYV A;  2J5G D;  3IAV A;  4DI1 A;  3QKA A;  4JSB A;  2ZQR A;  3M6M A;  3GLM A;  3U9R B;  2PPY A;  2Q34 A;  3LKE A;  4QIJ A;  4WZ8 B;  4U18 A;  3GKB A;  2IEX A;  1XNV A;  2CE3 A;  1WDM A;  2WTB A;  1HNU A;  1OD2 A;  3H0Q A;  3M6N A;  1K32 A;  1ON9 A;  1Q51 A;  5DTP A;  4FND A;  1UYS A;  3TT6 A;  2VSU C;  3SWX A;  3GF3 A;  2A81 A;  1MJ3 A;  3DOR A;  4U0H A;  4F47 A;  3NJD A;  4IZD A;  1UYR A;  3HP0 A;  3FF6 A;  4KD6 A;  1HZD A;  1VRG A;  3TLF A;  3R9T A;  3R0O A;  1O8U A;  2UZF A;  3K50 A;  4FZW A;  4FNB A;  4B3I A;  3BPT A;  3T8B A;  3V5I A;  3TDC A;  4GHN A;  1Y7O A;  2D3T A;  3TZ3 A;  5C90 A;  2A7K A;  2HW5 A;  3MT6 A;  4K29 A;  3NJB A;  3BPP A;  2Q35 A;  4RYF A;  3TRR A;  1RJN A;  3IB9 A;  4B3H A;  4MOU A;  4GM2 A;  3WG5 A;  1SG4 A;  4MXI A;  4ZDD A;  3PE8 A;  2GTR A;  4EMP A;  3ZW8 A;  3HE2 A;  3TT7 A;  3QXZ A;  3KTK A;  4OLQ A;  1JXZ A;  4ASI A;  3T8A A;  4WCZ A;  2C8T A;  3T88 A;  5JBX A;  4Q1I A;  3H0U A;  1N6D A;  4RCN A;  3R9Q A;  4RYF H;  4ELX A;  3GF7 A;  2J5S A;  3ZWA A;  1OD4 A;  3QXI A;  4ELS A;  1UYT A;  3KTH A;  3KQF A;  4JCR A;  4ZDC A;  4U0G A;  4ZU2 A;  2J5G A;  3RST A;  5C9G A;  2VSS E;  4ELW A;  3MFM A;  1WDK A;  3P2L A;  3LAO A;  1XNY A;  1DUB A;  4J2U A;  4NAR A;  3P5M A;  3IBB A;  4L6W A;  2DEO A;  2FW2 A;  2VX2 A;  1YG8 A;  1XNW A;  4FZW C;  1J7X A;  4JWV A;  4U0G H;  3P85 A;  1EY3 A;  3TVU A;  3QWD A;  4U1A A;  3V5E A;  2CBY A;  3ISA A;  4G2R A;  5FUS A;  3ST9 A;  3STA A;  5E0S H;  3L3S A;  3N6R B;  4JJT A;  3SLL A;  4I42 A;  2F9Y A;  3ZW9 A;  3Q1T A;  5CTC A;  4JCS A;  3H0S A;  2F6Q A;  5KJP A;  3ZWC A;  4JOT A;  4ZDE A;  3MOY A;  3H0J A;  3TVW A;  1YG6 A;  4QFE A;  5DUC A;  1FC6 A;  3QYR A;  3R9S A;  3BF0 A;  4IZB A;  2F9Y B;  3FDU A;  2A7S A;  1RJM A;  2PBP A;  1N6E A;  3DJA A;  4I4Z A;  4MI2 A;  4OMR A;  4JFC A;  4KNP A;  3I47 A;  5DU8 A;  3Q7H A;  5DTW A;  3MYB A;  5MGB A;  4EML A;  4KWB A;  1WZ8 A;  5JBW A;  2EJ5 A;  3RSI A;  1N6F A;  4EMM A;  2DUB A;  4JVT A;  4OG1 A;  3OC7 A;  4FJW D;  3G64 A;  1X0U A;  2ZL3 A;  2ZL4 A;  4K2N A;  1TG6 A;  4I52 A;  2ZL2 A;  2BZR A;  5E0N X;  1XO6 A;  3OT6 A;  5G1S A;  2J5I A;  1SZO A;  3PGQ A; 
#chains in the Genus database with same CATH homology
 2YJG A;  2F9I A;  2VRE A;  5E0S A;  3HLN 1;  5INI A;  1UIY A;  3ZWB A;  3QMJ A;  1FC7 A;  3KTG A;  1FC9 A;  5DL1 A;  4KPK A;  5DZK H;  3KTI A;  4HDT A;  4JYL A;  5G1Q A;  5INF A;  2J5I B;  3PEA A;  1NZY A;  2VSU F;  1PJH A;  3JU1 A;  2F9I B;  4K3W A;  3RRV A;  2ZQQ A;  3K8X A;  3KTJ A;  4HNK A;  1TYF A;  1PIX A;  2J5I I;  4NNQ A;  1HNO A;  2QQ3 A;  2FBM A;  4Q0G A;  2X58 A;  4FB8 A;  1EF8 A;  3VIV A;  1NZY B;  1Q52 A;  2F6I A;  2X24 A;  2VSS F;  2W3P A;  4U19 A;  4ZDF A;  3U9T B;  5DKP A;  5DU6 A;  4JYJ A;  3BEZ A;  4HC8 A;  5CTB A;  1K39 A;  5IKL B;  5ING A;  4WYO B;  2NP9 A;  2VSU A;  1FCF A;  1ON3 A;  4JCT A;  4JCQ A;  3HRX A;  3T89 A;  2FZS A;  3Q0G A;  3PZK A;  4YLH A;  3TV5 A;  5DUF A;  2ZL0 A;  3OME A;  1W2X A;  4FN8 A;  3Q0J A;  4IZC A;  5DU4 A;  4LK5 A;  3QK8 A;  3U9S B;  5KDR A;  4B3J A;  2VSS A;  3HIN A;  4QII A;  5HUQ A;  1XX4 A;  3H02 A;  5FIF A;  1WDL A;  5G1R A;  3R6H A;  2Q2X A;  2VSU E;  3GMA A;  4L8K A;  5DZK A;  1EF9 A;  4ZDB A;  3H81 A;  4FN7 A;  3QRE A;  1DCI A;  2PG8 A;  5KDR B;  3T3W A;  4NEK A;  4Z0M A;  1UYV A;  2J5G D;  3IAV A;  4DI1 A;  3QKA A;  4JSB A;  2ZQR A;  3M6M A;  3GLM A;  3U9R B;  2PPY A;  2Q34 A;  3LKE A;  4QIJ A;  4WZ8 B;  4U18 A;  3GKB A;  2IEX A;  1XNV A;  2CE3 A;  1WDM A;  2WTB A;  1HNU A;  1OD2 A;  3H0Q A;  3M6N A;  1K32 A;  1ON9 A;  1Q51 A;  5DTP A;  4FND A;  1UYS A;  3TT6 A;  2VSU C;  3SWX A;  3GF3 A;  2A81 A;  1MJ3 A;  3DOR A;  4U0H A;  4F47 A;  3NJD A;  4IZD A;  1UYR A;  3HP0 A;  3FF6 A;  4KD6 A;  1HZD A;  1VRG A;  3TLF A;  3R9T A;  3R0O A;  1O8U A;  2UZF A;  3K50 A;  4FZW A;  4FNB A;  4B3I A;  3BPT A;  3T8B A;  3V5I A;  3TDC A;  4GHN A;  1Y7O A;  2D3T A;  3TZ3 A;  5C90 A;  2A7K A;  2HW5 A;  3MT6 A;  4K29 A;  3NJB A;  3BPP A;  2Q35 A;  4RYF A;  3TRR A;  1RJN A;  3IB9 A;  4B3H A;  4MOU A;  4GM2 A;  3WG5 A;  1SG4 A;  4MXI A;  4ZDD A;  3PE8 A;  2GTR A;  4EMP A;  3ZW8 A;  3HE2 A;  3TT7 A;  3QXZ A;  3KTK A;  4OLQ A;  1JXZ A;  4ASI A;  3T8A A;  4WCZ A;  2C8T A;  3T88 A;  5JBX A;  4Q1I A;  3H0U A;  1N6D A;  4RCN A;  3R9Q A;  4RYF H;  4ELX A;  3GF7 A;  2J5S A;  3ZWA A;  1OD4 A;  3QXI A;  4ELS A;  1UYT A;  3KTH A;  3KQF A;  4JCR A;  4ZDC A;  4U0G A;  4ZU2 A;  2J5G A;  3RST A;  5C9G A;  2VSS E;  4ELW A;  3MFM A;  1WDK A;  3P2L A;  3LAO A;  1XNY A;  1DUB A;  4J2U A;  4NAR A;  3P5M A;  3IBB A;  4L6W A;  2DEO A;  2FW2 A;  2VX2 A;  1YG8 A;  1XNW A;  4FZW C;  1J7X A;  4JWV A;  4U0G H;  3P85 A;  1EY3 A;  3TVU A;  3QWD A;  4U1A A;  3V5E A;  2CBY A;  3ISA A;  4G2R A;  5FUS A;  3ST9 A;  3STA A;  5E0S H;  3L3S A;  3N6R B;  4JJT A;  3SLL A;  4I42 A;  2F9Y A;  3ZW9 A;  3Q1T A;  5CTC A;  4JCS A;  3H0S A;  2F6Q A;  5KJP A;  3ZWC A;  4JOT A;  4ZDE A;  3MOY A;  3H0J A;  3TVW A;  1YG6 A;  4QFE A;  5DUC A;  1FC6 A;  3QYR A;  3R9S A;  3BF0 A;  4IZB A;  2F9Y B;  3FDU A;  2A7S A;  1RJM A;  2PBP A;  1N6E A;  3DJA A;  4I4Z A;  4MI2 A;  4OMR A;  4JFC A;  4KNP A;  3I47 A;  5DU8 A;  3Q7H A;  5DTW A;  3MYB A;  5MGB A;  4EML A;  4KWB A;  1WZ8 A;  5JBW A;  2EJ5 A;  3RSI A;  1N6F A;  4EMM A;  2DUB A;  4JVT A;  4OG1 A;  3OC7 A;  4FJW D;  3G64 A;  1X0U A;  2ZL3 A;  2ZL4 A;  4K2N A;  1TG6 A;  4I52 A;  2ZL2 A;  2BZR A;  5E0N X;  1XO6 A;  3OT6 A;  5G1S A;  2J5I A;  1SZO A;  3PGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...