3BPPA

1510-n membrane protease k138a mutant specific for a stomatin homolog from pyrococcus horikoshii
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
216
structure length
216
Chain Sequence
AKNIVYVAQIKGQITSYTYDQFDRYITIAEQDNAEAIIIELDTPGGRADAMMNIVQRIQQSKIPVIIYVYPPGASAASAGTYIALGSHLIAMAPGTSIGACRPILGYSQNGSIIEAPPAITNYFIAYIKSLAQESGRNATIAEEFITKDLSLTPEEALKYGVIEVVARDINELLKKSNGMKTKIPVNGRYVTLNFTNVEVRYLAPSFKDKLISYIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel dimer structure of a membrane-bound protease with a catalytic Ser-Lys dyad and its linkage to stomatin
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
molecule keywords 1510-N membrane protease
total genus 72
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2007-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3bppA00
4JSBA 5KDRA 3RSIA 2NP9A 4FN8A 3QMJA 4WZ8B 3KTIA 4U18A 4IZCA 3TRRA 1EF9A 3SWXA 1XNWA 4Q0GA 4L6WA 1RJNA 5DU4A 3GF3A 3LAOA 1NZYA 1N6EA 3QKAA 4ZDCA 5E0SH 1HNUA 2X24A 2F9IB 1HZDA 1K32A 2BZRA 5MGBA 1FCFA 1WDLA 4L8KA 1SZOA 2CBYA 4YLHA 3BEZA 4QIJA 4ZDDA 4DI1A 4JYJA 1EF8A 4I4ZA 1TG6A 1XO6A 3PEAA 3KTJA 5DU8A 3G64A 3PGQA 3KTHA 2J5IB 1X0UA 4JCSA 4RYFH 5IKLB 4OMRA 3I47A 4RYFA 1EY3A 5FUSA 5DL1A 1DUBA 2Q35A 2VSSE 5G1QA 2J5SA 3V5EA 4OG1A 2PBPA 5INGA 4HC8A 3R9SA 4ZDFA 2VSUF 3PZKA 4U19A 4U0HA 3MT6A 2J5GD 5DTWA 2ZL2A 3RRVA 2VREA 1JXZA 1Q52A 2PPYA 3L3SA 4WYOB 3HLN1 3OC7A 5CTCA 4EMPA 3P2LA 2VSSA 4IZBA 3TVWA 4JCRA 2A7KA 2VSUA 3QYRA 4FZWC 3ZWAA 3QXZA 2ZL3A 3P85A 3U9SB 4FN7A 1SG4A 2FBMA 4NNQA 1WDMA 1XX4A 3T88A 3LKEA 3H0SA 4F47A 4JOTA 3TV5A 1N6DA 5G1RA 1UYVA 3R9QA 2GTRA 5DTPA 4B3IA 3MOYA 5DUCA 4KNPA 5CTBA 3TLFA 2Q2XA 3FF6A 1Q51A 1K39A 2F6IA 3H0JA 3HRXA 4Q1IA 4ELWA 4MXIA 3JU1A 3SLLA 4QIIA 2ZQRA 4JYLA 5G1SA 2WTBA 3ZW8A 4EMMA 3H02A 3N6RB 1XNYA 3KQFA 1RJMA 3NJBA 1DCIA 4LK5A 4U0GH 3QREA 4IZDA 5DUFA 4U0GA 1FC6A 3IB9A 3P5MA 3R9TA 5C9GA 3R6HA 2VSUC 5KDRB 4QFEA 4Z0MA 3GKBA 3T8BA 2FZSA 3R0OA 2UZFA 3QK8A 5INFA 3OMEA 3T8AA 1UIYA 4ASIA 1Y7OA 5DZKA 1VRGA 3Q7HA 2CE3A 4KPKA 2W3PA 4JWVA 3ZW9A 2PG8A 1YG6A 1NZYB 2C8TA 4K2NA 2F9IA 2Q34A 3HINA 3H81A 4OLQA 2VX2A 3M6MA 3QWDA 2ZQQA 2QQ3A 2ZL0A 3ZWCA 1YG8A 3MYBA 1FC7A 3ZWBA 4FNBA 5C90A 4FJWD 4I52A 3TVUA 5E0SA 3FDUA 5JBXA 2ZL4A 4B3JA 3U9TB 4JCQA 1OD4A 3U9RB 2J5IA 4HNKA 3M6NA 2A7SA 3STAA 2FW2A 1J7XA 4NEKA 4U1AA 3IAVA 3RSTA 4JCTA 3Q1TA 2J5GA 4ZDBA 3TDCA 5KJPA 5E0NX 3NJDA 4ZDEA 5JBWA 4ELXA 3K8XA 1ON9A 3VIVA 4MOUA 4MI2A 3V5IA 3TZ3A 3K50A 4GHNA 2IEXA 5DZKH 3T89A 3GLMA 5DU6A 2DUBA 1HNOA 3BF0A 4WCZA 5INIA 3GMAA 1O8UA 2EJ5A 1UYRA 2VSUE 2DEOA 3BPPA 4B3HA 3DJAA 3Q0JA 4K3WA 3GF7A 4FNDA 1XNVA 4K29A 3HE2A 3QXIA 3WG5A 3DORA 4KD6A 4GM2A 1PJHA 4ZU2A 1PIXA 4I42A 3PE8A 3MFMA 3H0UA 1ON3A 1WZ8A 3Q0GA 2D3TA 4G2RA 3KTKA 1N6FA 3ST9A 2J5II 2X58A 1UYTA 1TYFA 5DKPA 3T3WA 4EMLA 2F9YA 1OD2A 1W2XA 4JJTA 3KTGA 3TT6A 1UYSA 2VSSF 5FIFA 4ELSA 4FB8A 1FC9A 4FZWA 3IBBA 2F6QA 4KWBA 3HP0A 2HW5A 3OT6A 4JFCA 3ISAA 2A81A 3H0QA 3TT7A 1MJ3A 2F9YB 1WDKA 4JVTA 4RCNA
chains in the Genus database with same CATH superfamily
4JSBA 5KDRA 3RSIA 2NP9A 4FN8A 3QMJA 4WZ8B 3KTIA 4U18A 4IZCA 3TRRA 1EF9A 3SWXA 1XNWA 4Q0GA 4L6WA 1RJNA 5DU4A 3GF3A 3LAOA 1NZYA 1N6EA 3QKAA 4ZDCA 5E0SH 1HNUA 2X24A 2F9IB 1HZDA 1K32A 2BZRA 5MGBA 1FCFA 1WDLA 4L8KA 1SZOA 2CBYA 4YLHA 3BEZA 4QIJA 4ZDDA 4DI1A 4JYJA 1EF8A 4I4ZA 1TG6A 1XO6A 3PEAA 3KTJA 5DU8A 3G64A 3PGQA 3KTHA 2J5IB 1X0UA 4JCSA 4RYFH 5IKLB 4OMRA 3I47A 4RYFA 1EY3A 5FUSA 5DL1A 1DUBA 2Q35A 2VSSE 5G1QA 2J5SA 3V5EA 4OG1A 2PBPA 5INGA 4HC8A 3R9SA 4ZDFA 2VSUF 3PZKA 4U19A 4U0HA 3MT6A 2J5GD 5DTWA 2ZL2A 3RRVA 2VREA 1JXZA 1Q52A 2PPYA 3L3SA 4WYOB 3HLN1 3OC7A 5CTCA 4EMPA 3P2LA 2VSSA 4IZBA 3TVWA 4JCRA 2A7KA 2VSUA 3QYRA 4FZWC 3ZWAA 3QXZA 2ZL3A 3P85A 3U9SB 4FN7A 1SG4A 2FBMA 4NNQA 1WDMA 1XX4A 3T88A 3LKEA 3H0SA 4F47A 4JOTA 3TV5A 1N6DA 5G1RA 1UYVA 3R9QA 2GTRA 5DTPA 4B3IA 3MOYA 5DUCA 4KNPA 5CTBA 3TLFA 2Q2XA 3FF6A 1Q51A 1K39A 2F6IA 3H0JA 3HRXA 4Q1IA 4ELWA 4MXIA 3JU1A 3SLLA 4QIIA 2ZQRA 4JYLA 5G1SA 2WTBA 3ZW8A 4EMMA 3H02A 3N6RB 1XNYA 3KQFA 1RJMA 3NJBA 5HUQA 1DCIA 4LK5A 4U0GH 3QREA 4IZDA 5DUFA 2YJGA 4U0GA 1FC6A 3IB9A 3P5MA 3R9TA 5C9GA 3R6HA 2VSUC 5KDRB 4QFEA 4Z0MA 3GKBA 3T8BA 2FZSA 3R0OA 2UZFA 3QK8A 5INFA 3OMEA 3T8AA 1UIYA 4ASIA 1Y7OA 5DZKA 1VRGA 3Q7HA 2CE3A 4KPKA 2W3PA 4JWVA 3ZW9A 2PG8A 1YG6A 4NARA 1NZYB 2C8TA 4K2NA 2F9IA 2Q34A 3HINA 3H81A 4OLQA 2VX2A 3M6MA 3QWDA 2ZQQA 2QQ3A 2ZL0A 3ZWCA 1YG8A 3MYBA 1FC7A 3ZWBA 4FNBA 5C90A 4FJWD 4I52A 3TVUA 3BPTA 5E0SA 3FDUA 5JBXA 2ZL4A 4B3JA 3U9TB 4JCQA 1OD4A 3U9RB 2J5IA 4HNKA 3M6NA 2A7SA 3STAA 2FW2A 1J7XA 4NEKA 4U1AA 3IAVA 3RSTA 4JCTA 3Q1TA 2J5GA 4ZDBA 3TDCA 5KJPA 5E0NX 3NJDA 4ZDEA 5JBWA 4ELXA 3K8XA 1ON9A 3VIVA 4MOUA 4MI2A 3V5IA 3TZ3A 3K50A 4GHNA 2IEXA 5DZKH 3T89A 3GLMA 5DU6A 2DUBA 1HNOA 3BF0A 4WCZA 3GMAA 5INIA 1O8UA 2EJ5A 1UYRA 2VSUE 2DEOA 3BPPA 4B3HA 3DJAA 3Q0JA 4K3WA 3GF7A 4FNDA 1XNVA 4K29A 4J2UA 3HE2A 3QXIA 4HDTA 3WG5A 3DORA 4KD6A 4GM2A 1PJHA 4ZU2A 1PIXA 4I42A 3PE8A 3MFMA 3H0UA 1ON3A 1WZ8A 3Q0GA 2D3TA 4G2RA 3KTKA 1N6FA 3ST9A 2J5II 2X58A 1UYTA 1TYFA 5DKPA 3T3WA 4EMLA 2F9YA 1OD2A 1W2XA 4JJTA 3KTGA 3TT6A 1UYSA 2VSSF 5FIFA 4ELSA 4FB8A 1FC9A 4FZWA 3IBBA 2F6QA 4KWBA 3HP0A 2HW5A 3OT6A 4JFCA 3ISAA 2A81A 3H0QA 3TT7A 1MJ3A 2F9YB 1WDKA 4JVTA 4RCNA
chains in the Genus database with same CATH topology
4JSBA 5KDRA 3RSIA 2NP9A 4FN8A 3QMJA 4WZ8B 3KTIA 4U18A 4IZCA 3TRRA 1EF9A 3SWXA 1XNWA 4Q0GA 4L6WA 1RJNA 5DU4A 3GF3A 3LAOA 1NZYA 1N6EA 3QKAA 4ZDCA 5E0SH 1HNUA 2X24A 2F9IB 1HZDA 1K32A 2BZRA 5MGBA 1FCFA 1WDLA 4L8KA 1SZOA 2CBYA 4YLHA 3BEZA 4QIJA 4ZDDA 4DI1A 4JYJA 1EF8A 4I4ZA 1TG6A 1XO6A 3PEAA 3KTJA 5DU8A 3G64A 3PGQA 3KTHA 2J5IB 1X0UA 4JCSA 4RYFH 5IKLB 4OMRA 3I47A 4RYFA 1EY3A 5FUSA 5DL1A 1DUBA 2Q35A 2VSSE 5G1QA 2J5SA 3V5EA 4OG1A 2PBPA 5INGA 4HC8A 3R9SA 4ZDFA 2VSUF 3PZKA 4U19A 4U0HA 3MT6A 2J5GD 5DTWA 2ZL2A 3RRVA 2VREA 1JXZA 1Q52A 2PPYA 3L3SA 4WYOB 3HLN1 3OC7A 5CTCA 4EMPA 3P2LA 2VSSA 4IZBA 3TVWA 4JCRA 2A7KA 2VSUA 3QYRA 4FZWC 3ZWAA 3QXZA 2ZL3A 3P85A 3U9SB 4FN7A 1SG4A 2FBMA 4NNQA 1WDMA 1XX4A 3T88A 3LKEA 3H0SA 4F47A 4JOTA 3TV5A 1N6DA 5G1RA 1UYVA 3R9QA 2GTRA 5DTPA 4B3IA 3MOYA 5DUCA 4KNPA 5CTBA 3TLFA 2Q2XA 3FF6A 1Q51A 1K39A 2F6IA 3H0JA 3HRXA 4Q1IA 4ELWA 4MXIA 3JU1A 3SLLA 4QIIA 2ZQRA 4JYLA 5G1SA 2WTBA 3ZW8A 4EMMA 3H02A 3N6RB 1XNYA 3KQFA 1RJMA 3NJBA 5HUQA 1DCIA 4LK5A 4U0GH 3QREA 4IZDA 5DUFA 2YJGA 4U0GA 1FC6A 3IB9A 3P5MA 3R9TA 5C9GA 3R6HA 2VSUC 5KDRB 4QFEA 4Z0MA 3GKBA 3T8BA 2FZSA 3R0OA 2UZFA 3QK8A 5INFA 3OMEA 3T8AA 1UIYA 4ASIA 1Y7OA 5DZKA 1VRGA 3Q7HA 2CE3A 4KPKA 2W3PA 4JWVA 3ZW9A 2PG8A 1YG6A 4NARA 1NZYB 2C8TA 4K2NA 2F9IA 2Q34A 3HINA 3H81A 4OLQA 2VX2A 3M6MA 3QWDA 2ZQQA 2QQ3A 2ZL0A 3ZWCA 1YG8A 3MYBA 1FC7A 3ZWBA 4FNBA 5C90A 4FJWD 4I52A 3TVUA 3BPTA 5E0SA 3FDUA 5JBXA 2ZL4A 4B3JA 3U9TB 4JCQA 1OD4A 3U9RB 2J5IA 4HNKA 3M6NA 2A7SA 3STAA 2FW2A 1J7XA 4NEKA 4U1AA 3IAVA 3RSTA 4JCTA 3Q1TA 2J5GA 4ZDBA 3TDCA 5KJPA 5E0NX 3NJDA 4ZDEA 5JBWA 4ELXA 3K8XA 1ON9A 3VIVA 4MOUA 4MI2A 3V5IA 3TZ3A 3K50A 4GHNA 2IEXA 5DZKH 3T89A 3GLMA 5DU6A 2DUBA 1HNOA 3BF0A 4WCZA 3GMAA 5INIA 1O8UA 2EJ5A 1UYRA 2VSUE 2DEOA 3BPPA 4B3HA 3DJAA 3Q0JA 4K3WA 3GF7A 4FNDA 1XNVA 4K29A 4J2UA 3HE2A 3QXIA 4HDTA 3WG5A 3DORA 4KD6A 4GM2A 1PJHA 4ZU2A 1PIXA 4I42A 3PE8A 3MFMA 3H0UA 1ON3A 1WZ8A 3Q0GA 2D3TA 4G2RA 3KTKA 1N6FA 3ST9A 2J5II 2X58A 1UYTA 1TYFA 5DKPA 3T3WA 4EMLA 2F9YA 1OD2A 1W2XA 4JJTA 3KTGA 3TT6A 1UYSA 2VSSF 5FIFA 4ELSA 4FB8A 1FC9A 4FZWA 3IBBA 2F6QA 4KWBA 3HP0A 2HW5A 3OT6A 4JFCA 3ISAA 2A81A 3H0QA 3TT7A 1MJ3A 2F9YB 1WDKA 4JVTA 4RCNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JSB A;  5KDR A;  3RSI A;  2NP9 A;  4FN8 A;  3QMJ A;  4WZ8 B;  3KTI A;  4U18 A;  4IZC A;  3TRR A;  1EF9 A;  3SWX A;  1XNW A;  4Q0G A;  4L6W A;  1RJN A;  5DU4 A;  3GF3 A;  3LAO A;  1NZY A;  1N6E A;  3QKA A;  4ZDC A;  5E0S H;  1HNU A;  2X24 A;  2F9I B;  1HZD A;  1K32 A;  2BZR A;  5MGB A;  1FCF A;  1WDL A;  4L8K A;  1SZO A;  2CBY A;  4YLH A;  3BEZ A;  4QIJ A;  4ZDD A;  4DI1 A;  4JYJ A;  1EF8 A;  4I4Z A;  1TG6 A;  1XO6 A;  3PEA A;  3KTJ A;  5DU8 A;  3G64 A;  3PGQ A;  3KTH A;  2J5I B;  1X0U A;  4JCS A;  4RYF H;  5IKL B;  4OMR A;  3I47 A;  4RYF A;  1EY3 A;  5FUS A;  5DL1 A;  1DUB A;  2Q35 A;  2VSS E;  5G1Q A;  2J5S A;  3V5E A;  4OG1 A;  2PBP A;  5ING A;  4HC8 A;  3R9S A;  4ZDF A;  2VSU F;  3PZK A;  4U19 A;  4U0H A;  3MT6 A;  2J5G D;  5DTW A;  2ZL2 A;  3RRV A;  2VRE A;  1JXZ A;  1Q52 A;  2PPY A;  3L3S A;  4WYO B;  3HLN 1;  3OC7 A;  5CTC A;  4EMP A;  3P2L A;  2VSS A;  4IZB A;  3TVW A;  4JCR A;  2A7K A;  2VSU A;  3QYR A;  4FZW C;  3ZWA A;  3QXZ A;  2ZL3 A;  3P85 A;  3U9S B;  4FN7 A;  1SG4 A;  2FBM A;  4NNQ A;  1WDM A;  1XX4 A;  3T88 A;  3LKE A;  3H0S A;  4F47 A;  4JOT A;  3TV5 A;  1N6D A;  5G1R A;  1UYV A;  3R9Q A;  2GTR A;  5DTP A;  4B3I A;  3MOY A;  5DUC A;  4KNP A;  5CTB A;  3TLF A;  2Q2X A;  3FF6 A;  1Q51 A;  1K39 A;  2F6I A;  3H0J A;  3HRX A;  4Q1I A;  4ELW A;  4MXI A;  3JU1 A;  3SLL A;  4QII A;  2ZQR A;  4JYL A;  5G1S A;  2WTB A;  3ZW8 A;  4EMM A;  3H02 A;  3N6R B;  1XNY A;  3KQF A;  1RJM A;  3NJB A;  1DCI A;  4LK5 A;  4U0G H;  3QRE A;  4IZD A;  5DUF A;  4U0G A;  1FC6 A;  3IB9 A;  3P5M A;  3R9T A;  5C9G A;  3R6H A;  2VSU C;  5KDR B;  4QFE A;  4Z0M A;  3GKB A;  3T8B A;  2FZS A;  3R0O A;  2UZF A;  3QK8 A;  5INF A;  3OME A;  3T8A A;  1UIY A;  4ASI A;  1Y7O A;  5DZK A;  1VRG A;  3Q7H A;  2CE3 A;  4KPK A;  2W3P A;  4JWV A;  3ZW9 A;  2PG8 A;  1YG6 A;  1NZY B;  2C8T A;  4K2N A;  2F9I A;  2Q34 A;  3HIN A;  3H81 A;  4OLQ A;  2VX2 A;  3M6M A;  3QWD A;  2ZQQ A;  2QQ3 A;  2ZL0 A;  3ZWC A;  1YG8 A;  3MYB A;  1FC7 A;  3ZWB A;  4FNB A;  5C90 A;  4FJW D;  4I52 A;  3TVU A;  5E0S A;  3FDU A;  5JBX A;  2ZL4 A;  4B3J A;  3U9T B;  4JCQ A;  1OD4 A;  3U9R B;  2J5I A;  4HNK A;  3M6N A;  2A7S A;  3STA A;  2FW2 A;  1J7X A;  4NEK A;  4U1A A;  3IAV A;  3RST A;  4JCT A;  3Q1T A;  2J5G A;  4ZDB A;  3TDC A;  5KJP A;  5E0N X;  3NJD A;  4ZDE A;  5JBW A;  4ELX A;  3K8X A;  1ON9 A;  3VIV A;  4MOU A;  4MI2 A;  3V5I A;  3TZ3 A;  3K50 A;  4GHN A;  2IEX A;  5DZK H;  3T89 A;  3GLM A;  5DU6 A;  2DUB A;  1HNO A;  3BF0 A;  4WCZ A;  5INI A;  3GMA A;  1O8U A;  2EJ5 A;  1UYR A;  2VSU E;  2DEO A;  3BPP A;  4B3H A;  3DJA A;  3Q0J A;  4K3W A;  3GF7 A;  4FND A;  1XNV A;  4K29 A;  3HE2 A;  3QXI A;  3WG5 A;  3DOR A;  4KD6 A;  4GM2 A;  1PJH A;  4ZU2 A;  1PIX A;  4I42 A;  3PE8 A;  3MFM A;  3H0U A;  1ON3 A;  1WZ8 A;  3Q0G A;  2D3T A;  4G2R A;  3KTK A;  1N6F A;  3ST9 A;  2J5I I;  2X58 A;  1UYT A;  1TYF A;  5DKP A;  3T3W A;  4EML A;  2F9Y A;  1OD2 A;  1W2X A;  4JJT A;  3KTG A;  3TT6 A;  1UYS A;  2VSS F;  5FIF A;  4ELS A;  4FB8 A;  1FC9 A;  4FZW A;  3IBB A;  2F6Q A;  4KWB A;  3HP0 A;  2HW5 A;  3OT6 A;  4JFC A;  3ISA A;  2A81 A;  3H0Q A;  3TT7 A;  1MJ3 A;  2F9Y B;  1WDK A;  4JVT A;  4RCN A; 
#chains in the Genus database with same CATH topology
 4JSB A;  5KDR A;  3RSI A;  2NP9 A;  4FN8 A;  3QMJ A;  4WZ8 B;  3KTI A;  4U18 A;  4IZC A;  3TRR A;  1EF9 A;  3SWX A;  1XNW A;  4Q0G A;  4L6W A;  1RJN A;  5DU4 A;  3GF3 A;  3LAO A;  1NZY A;  1N6E A;  3QKA A;  4ZDC A;  5E0S H;  1HNU A;  2X24 A;  2F9I B;  1HZD A;  1K32 A;  2BZR A;  5MGB A;  1FCF A;  1WDL A;  4L8K A;  1SZO A;  2CBY A;  4YLH A;  3BEZ A;  4QIJ A;  4ZDD A;  4DI1 A;  4JYJ A;  1EF8 A;  4I4Z A;  1TG6 A;  1XO6 A;  3PEA A;  3KTJ A;  5DU8 A;  3G64 A;  3PGQ A;  3KTH A;  2J5I B;  1X0U A;  4JCS A;  4RYF H;  5IKL B;  4OMR A;  3I47 A;  4RYF A;  1EY3 A;  5FUS A;  5DL1 A;  1DUB A;  2Q35 A;  2VSS E;  5G1Q A;  2J5S A;  3V5E A;  4OG1 A;  2PBP A;  5ING A;  4HC8 A;  3R9S A;  4ZDF A;  2VSU F;  3PZK A;  4U19 A;  4U0H A;  3MT6 A;  2J5G D;  5DTW A;  2ZL2 A;  3RRV A;  2VRE A;  1JXZ A;  1Q52 A;  2PPY A;  3L3S A;  4WYO B;  3HLN 1;  3OC7 A;  5CTC A;  4EMP A;  3P2L A;  2VSS A;  4IZB A;  3TVW A;  4JCR A;  2A7K A;  2VSU A;  3QYR A;  4FZW C;  3ZWA A;  3QXZ A;  2ZL3 A;  3P85 A;  3U9S B;  4FN7 A;  1SG4 A;  2FBM A;  4NNQ A;  1WDM A;  1XX4 A;  3T88 A;  3LKE A;  3H0S A;  4F47 A;  4JOT A;  3TV5 A;  1N6D A;  5G1R A;  1UYV A;  3R9Q A;  2GTR A;  5DTP A;  4B3I A;  3MOY A;  5DUC A;  4KNP A;  5CTB A;  3TLF A;  2Q2X A;  3FF6 A;  1Q51 A;  1K39 A;  2F6I A;  3H0J A;  3HRX A;  4Q1I A;  4ELW A;  4MXI A;  3JU1 A;  3SLL A;  4QII A;  2ZQR A;  4JYL A;  5G1S A;  2WTB A;  3ZW8 A;  4EMM A;  3H02 A;  3N6R B;  1XNY A;  3KQF A;  1RJM A;  3NJB A;  5HUQ A;  1DCI A;  4LK5 A;  4U0G H;  3QRE A;  4IZD A;  5DUF A;  2YJG A;  4U0G A;  1FC6 A;  3IB9 A;  3P5M A;  3R9T A;  5C9G A;  3R6H A;  2VSU C;  5KDR B;  4QFE A;  4Z0M A;  3GKB A;  3T8B A;  2FZS A;  3R0O A;  2UZF A;  3QK8 A;  5INF A;  3OME A;  3T8A A;  1UIY A;  4ASI A;  1Y7O A;  5DZK A;  1VRG A;  3Q7H A;  2CE3 A;  4KPK A;  2W3P A;  4JWV A;  3ZW9 A;  2PG8 A;  1YG6 A;  4NAR A;  1NZY B;  2C8T A;  4K2N A;  2F9I A;  2Q34 A;  3HIN A;  3H81 A;  4OLQ A;  2VX2 A;  3M6M A;  3QWD A;  2ZQQ A;  2QQ3 A;  2ZL0 A;  3ZWC A;  1YG8 A;  3MYB A;  1FC7 A;  3ZWB A;  4FNB A;  5C90 A;  4FJW D;  4I52 A;  3TVU A;  3BPT A;  5E0S A;  3FDU A;  5JBX A;  2ZL4 A;  4B3J A;  3U9T B;  4JCQ A;  1OD4 A;  3U9R B;  2J5I A;  4HNK A;  3M6N A;  2A7S A;  3STA A;  2FW2 A;  1J7X A;  4NEK A;  4U1A A;  3IAV A;  3RST A;  4JCT A;  3Q1T A;  2J5G A;  4ZDB A;  3TDC A;  5KJP A;  5E0N X;  3NJD A;  4ZDE A;  5JBW A;  4ELX A;  3K8X A;  1ON9 A;  3VIV A;  4MOU A;  4MI2 A;  3V5I A;  3TZ3 A;  3K50 A;  4GHN A;  2IEX A;  5DZK H;  3T89 A;  3GLM A;  5DU6 A;  2DUB A;  1HNO A;  3BF0 A;  4WCZ A;  3GMA A;  5INI A;  1O8U A;  2EJ5 A;  1UYR A;  2VSU E;  2DEO A;  3BPP A;  4B3H A;  3DJA A;  3Q0J A;  4K3W A;  3GF7 A;  4FND A;  1XNV A;  4K29 A;  4J2U A;  3HE2 A;  3QXI A;  4HDT A;  3WG5 A;  3DOR A;  4KD6 A;  4GM2 A;  1PJH A;  4ZU2 A;  1PIX A;  4I42 A;  3PE8 A;  3MFM A;  3H0U A;  1ON3 A;  1WZ8 A;  3Q0G A;  2D3T A;  4G2R A;  3KTK A;  1N6F A;  3ST9 A;  2J5I I;  2X58 A;  1UYT A;  1TYF A;  5DKP A;  3T3W A;  4EML A;  2F9Y A;  1OD2 A;  1W2X A;  4JJT A;  3KTG A;  3TT6 A;  1UYS A;  2VSS F;  5FIF A;  4ELS A;  4FB8 A;  1FC9 A;  4FZW A;  3IBB A;  2F6Q A;  4KWB A;  3HP0 A;  2HW5 A;  3OT6 A;  4JFC A;  3ISA A;  2A81 A;  3H0Q A;  3TT7 A;  1MJ3 A;  2F9Y B;  1WDK A;  4JVT A;  4RCN A; 
#chains in the Genus database with same CATH homology
 4JSB A;  5KDR A;  3RSI A;  2NP9 A;  4FN8 A;  3QMJ A;  4WZ8 B;  3KTI A;  4U18 A;  4IZC A;  3TRR A;  1EF9 A;  3SWX A;  1XNW A;  4Q0G A;  4L6W A;  1RJN A;  5DU4 A;  3GF3 A;  3LAO A;  1NZY A;  1N6E A;  3QKA A;  4ZDC A;  5E0S H;  1HNU A;  2X24 A;  2F9I B;  1HZD A;  1K32 A;  2BZR A;  5MGB A;  1FCF A;  1WDL A;  4L8K A;  1SZO A;  2CBY A;  4YLH A;  3BEZ A;  4QIJ A;  4ZDD A;  4DI1 A;  4JYJ A;  1EF8 A;  4I4Z A;  1TG6 A;  1XO6 A;  3PEA A;  3KTJ A;  5DU8 A;  3G64 A;  3PGQ A;  3KTH A;  2J5I B;  1X0U A;  4JCS A;  4RYF H;  5IKL B;  4OMR A;  3I47 A;  4RYF A;  1EY3 A;  5FUS A;  5DL1 A;  1DUB A;  2Q35 A;  2VSS E;  5G1Q A;  2J5S A;  3V5E A;  4OG1 A;  2PBP A;  5ING A;  4HC8 A;  3R9S A;  4ZDF A;  2VSU F;  3PZK A;  4U19 A;  4U0H A;  3MT6 A;  2J5G D;  5DTW A;  2ZL2 A;  3RRV A;  2VRE A;  1JXZ A;  1Q52 A;  2PPY A;  3L3S A;  4WYO B;  3HLN 1;  3OC7 A;  5CTC A;  4EMP A;  3P2L A;  2VSS A;  4IZB A;  3TVW A;  4JCR A;  2A7K A;  2VSU A;  3QYR A;  4FZW C;  3ZWA A;  3QXZ A;  2ZL3 A;  3P85 A;  3U9S B;  4FN7 A;  1SG4 A;  2FBM A;  4NNQ A;  1WDM A;  1XX4 A;  3T88 A;  3LKE A;  3H0S A;  4F47 A;  4JOT A;  3TV5 A;  1N6D A;  5G1R A;  1UYV A;  3R9Q A;  2GTR A;  5DTP A;  4B3I A;  3MOY A;  5DUC A;  4KNP A;  5CTB A;  3TLF A;  2Q2X A;  3FF6 A;  1Q51 A;  1K39 A;  2F6I A;  3H0J A;  3HRX A;  4Q1I A;  4ELW A;  4MXI A;  3JU1 A;  3SLL A;  4QII A;  2ZQR A;  4JYL A;  5G1S A;  2WTB A;  3ZW8 A;  4EMM A;  3H02 A;  3N6R B;  1XNY A;  3KQF A;  1RJM A;  3NJB A;  5HUQ A;  1DCI A;  4LK5 A;  4U0G H;  3QRE A;  4IZD A;  5DUF A;  2YJG A;  4U0G A;  1FC6 A;  3IB9 A;  3P5M A;  3R9T A;  5C9G A;  3R6H A;  2VSU C;  5KDR B;  4QFE A;  4Z0M A;  3GKB A;  3T8B A;  2FZS A;  3R0O A;  2UZF A;  3QK8 A;  5INF A;  3OME A;  3T8A A;  1UIY A;  4ASI A;  1Y7O A;  5DZK A;  1VRG A;  3Q7H A;  2CE3 A;  4KPK A;  2W3P A;  4JWV A;  3ZW9 A;  2PG8 A;  1YG6 A;  4NAR A;  1NZY B;  2C8T A;  4K2N A;  2F9I A;  2Q34 A;  3HIN A;  3H81 A;  4OLQ A;  2VX2 A;  3M6M A;  3QWD A;  2ZQQ A;  2QQ3 A;  2ZL0 A;  3ZWC A;  1YG8 A;  3MYB A;  1FC7 A;  3ZWB A;  4FNB A;  5C90 A;  4FJW D;  4I52 A;  3TVU A;  3BPT A;  5E0S A;  3FDU A;  5JBX A;  2ZL4 A;  4B3J A;  3U9T B;  4JCQ A;  1OD4 A;  3U9R B;  2J5I A;  4HNK A;  3M6N A;  2A7S A;  3STA A;  2FW2 A;  1J7X A;  4NEK A;  4U1A A;  3IAV A;  3RST A;  4JCT A;  3Q1T A;  2J5G A;  4ZDB A;  3TDC A;  5KJP A;  5E0N X;  3NJD A;  4ZDE A;  5JBW A;  4ELX A;  3K8X A;  1ON9 A;  3VIV A;  4MOU A;  4MI2 A;  3V5I A;  3TZ3 A;  3K50 A;  4GHN A;  2IEX A;  5DZK H;  3T89 A;  3GLM A;  5DU6 A;  2DUB A;  1HNO A;  3BF0 A;  4WCZ A;  3GMA A;  5INI A;  1O8U A;  2EJ5 A;  1UYR A;  2VSU E;  2DEO A;  3BPP A;  4B3H A;  3DJA A;  3Q0J A;  4K3W A;  3GF7 A;  4FND A;  1XNV A;  4K29 A;  4J2U A;  3HE2 A;  3QXI A;  4HDT A;  3WG5 A;  3DOR A;  4KD6 A;  4GM2 A;  1PJH A;  4ZU2 A;  1PIX A;  4I42 A;  3PE8 A;  3MFM A;  3H0U A;  1ON3 A;  1WZ8 A;  3Q0G A;  2D3T A;  4G2R A;  3KTK A;  1N6F A;  3ST9 A;  2J5I I;  2X58 A;  1UYT A;  1TYF A;  5DKP A;  3T3W A;  4EML A;  2F9Y A;  1OD2 A;  1W2X A;  4JJT A;  3KTG A;  3TT6 A;  1UYS A;  2VSS F;  5FIF A;  4ELS A;  4FB8 A;  1FC9 A;  4FZW A;  3IBB A;  2F6Q A;  4KWB A;  3HP0 A;  2HW5 A;  3OT6 A;  4JFC A;  3ISA A;  2A81 A;  3H0Q A;  3TT7 A;  1MJ3 A;  2F9Y B;  1WDK A;  4JVT A;  4RCN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...