3BPSE

Pcsk9:egf-a complex
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
41
structure length
41
Chain Sequence
MGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular basis for LDL receptor recognition by PCSK9.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/lipid transport
molecule keywords Proprotein convertase subtilisin/kexin type 9
total genus 7
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 2007-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF12662 cEGF Complement Clr-like EGF-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 3bpsE00
4Y6DB 3N8YA 2WPLE 1LQDA 2WFTA 1TLEA 2BOHA 1EAIC 1IQGL 1JL9A 2Y82B 1CX2A 2I9AA 4X8SL 4ZHAB 3GCXE 1EGFA 1HZ8A 3LTGD 2Y5FL 2WFXB 1FAKL 4RRWA 1F0SB 3KQDL 4BTUA 3TZIA 2W3IB 1HAEA 3SW2A 2W2ME 1K37A 5JB8E 4ISHL 1PFXL 2NPRA 1J9CL 2M74A 3ZYGA 4M10A 2XC5L 1U67A 2OYEP 1EPGA 1NFUB 1CEJA 3MDLA 2WPKE 2KV4A 5IKTA 4JZEL 5I46L 1EQHA 1MQ6L 2J4IB 3TBDA 3F6UL 4OTYA 3HS7A 4XBMA 5JBBE 2BO2A 2MHPA 5KIRA 3BT2A 1EZQB 4X8UL 1DVAL 1IQNL 2DDUA 4D0FA 4X8TL 1Z6EL 5JB9E 2ADXA 2FLBL 5IKRA 1L3YA 1G2LB 2BOUA 4JZDL 4JYUL 1IQML 2JKHL 2XBVL 3ZYJB 4M11A 1DQBA 2YGPA 3LAQA 3U73A 5L30L 2P3FN 3LC5B 1CQEA 1KIGL 2VWLL 2VVVL 1FE2A 1EPIA 2W2NE 3ELAL 2BMGA 4ZH8B 3FCSB 3HO4A 1NFYB 3QCWA 1URKA 1F0RB 1G1RA 4Z0KB 2WG4B 4Z6AL 2BQWA 3M37L 4BXSA 2BQ7A 1LMJA 2BZ6L 3ZYIB 3P5BL 1KLOA 3M36L 1EPHA 2WPJE 3U7UG 1KLIL 1G1TA 2VJ3A 3K9XA 2P94L 2PHBB 4BTTA 2G00L 3NTBA 2XC0L 2UWOB 3NT1A 1LPGA 2BQ6A 4BXWA 3N8YB 1PGEA 1UZKA 2Y7ZB 3N8ZA 2J34B 1W8BL 2P26A 1HT8A 2J38B 4O02B 4LMFA 1YGCL 1G1SA 4YZUB 4BDXA 1P9JA 3IJEB 5JVYA 1CCVA 1YUKB 2J95B 4X8VL 2W3KB 1FFMA 1UZPA 2W86A 4JYVL 5JW1A 3PGHA 1ATAA 1BF9A 3SOQA 2XBYL 1IGXA 3LN0A 2Y5GL 5JVZA 2I9BA 3BT1A 2P3UA 1CVUA 2VWOL 1HT5A 4Y7AB 3F1SB 1HREA 1ATEA 4COXA 1G1QA 1NQLB 1IVOC 2EI8B 1RFNB 4Y7BB 1Z6CA 1MQ5L 2CJIB 1JBUL 1HCGB 1NT0A 4AQTA 1IQLL 1EPJA 4O1ZA 3CA7A 5F19A 2BOXA 2WPME 1ATBA 2WPHE 6COXA 1Q4GA 1KSNB 4E1GA 4Z0LA 5KN5C 2OYUP 2MGRA 1KLJL 1FJSL 1X7AL 5EGMB 3N8XA 1K36A 3HO5A 2W2PE 2VH6B 2P28B 4Y71B 4CSYA 5FDQA 1XKBA 1DX5I 2XBWL 4NA9L 4MMZB 2GD4A 2YGOA 1YUFA 1ZAQA 4XL1A 5CKMA 4ISIL 3GCWE 3BPSE 1IQJL 1FAXL 3RR3A 4JZFL 2P3TA 4YT7L 3KQCL 2J2UB 2FZZL 5K0HB 5CISA 4BDWA 3ENSA 4RS0A 1COUA 1JV2B 4NG9L 1PXXA 3LC3B 3LN1A 4CUEA 4RUTA 2W2QE 1AUTL 2Y38A 3V64C 3OLUA 2RA0L 2XC4L 1ADXA 1IOEL 1B9WA 2WG3C 1SZBA 2Y5HL 1FSBA 5F1AA 3TGFA 3QH0A 1HRFA 2TGFA 1IOXA 2P95L 4FM5A 3CENL 1WU1B 1F7MA 4RRXA 3NJPC 1NFWB 2MGPA 3LIWB 3NTGA 1HJ7A 3EGFA 3HS6A 5CKNA 1YUGA 2F9BL 1IQHL 4LORA 1A3PA 2K2SB 3HS5A 1HX2A 3LTFB 3CFWA 2Y81B 3CS7L 1DDXA 3DEMA 2WYJB 4D90A 4G1MB 1CCFA 5CKQA 4OTJA 3N8VA 1TOZA 2BOKL 1W7XL 1UZQA 2W26B 4PH9A 1C5MF 3FFGL 3KRKA 2K2TA 1I0UA 1TPGA 4Y76B 1IJQA 5JBAE 1APQA 1L5GB 2PUQL 5L2YL 2W2OE 1IGZA 5E8DA 1MOXC 4BTIA 4MMYB 1CVWL 1XKAL 2AYLA 2VVCK 1NPEB 1N1IA 1GK5A 2KB9A 3KQEL 3C9AC 2FLRL 3HO3A 1IP0A 3GISX 3Q3KB 3KK6A 2B7DL 1APOA 1EBVA 4C16A 4RRZA 5JBCE 1IQIL 3FBYA 3IITB 3POYA 4ZXXL 4MMXB 4A7IA 2Y7XB 1IQKL 1U8CB 4YT6L 1NZIA 1UZJA 3Q7DA 1YO8A 1QFKL 4NGAL 1P0SL 3KL6B 3SOVA 3OLTA 1G2MB 3SOBB 1WHFA 2Q1JB 2J94B 2UWLB 1M1XB 4D0EA 3H5CB 5IKVA 1LPZA 2WYGB 2Y80B 4XLWA 2KL7A 1DIYA 1PRHA 1WHEA 2VWMK 1NFXB 1XFEA 3TH3L 3TK6B 1O5DL 1F7EA 2VWNL 3N8WA 1XDTR 2RNLA 3QMOA 3MQEA 2PR3B 1N7DA 2RHPA 5IKQA 1LPKA 4Y79B 1EQGA 3R05A 4ZAEB 2P3FL 2UWPB 1V3XB 4ZXYL 4RRYA 5COXA 5L2ZL 3ASIA 2FLGA 3TK5B 2WPIE 4CUFA 2D1JB 1FF7A 3N8WB 4TGFA 2FD6A 2P93L 2XBXL 3HPTA 2H9EL 1IQEL 1EMOA 1EMNA 2VH0B 3KCGL 1ATDA 2EI6B 2VVUL 2EI7B 2P16L 3V65B 1PTHA 1HAFA 3KQBL 1OB1C 1IQFL 4CUDA
chains in the Genus database with same CATH superfamily
4Y6DB 3N8YA 2WPLE 1LQDA 2WFTA 1TLEA 2BOHA 2KNIA 1EAIC 1IQGL 1JL9A 2Y82B 1CX2A 2I9AA 4X8SL 4ZHAB 3GCXE 1EGFA 1HZ8A 3LTGD 2Y5FL 2WFXB 1FAKL 4RRWA 1F0SB 3KQDL 4BTUA 3TZIA 2W3IB 1HAEA 3SW2A 2W2ME 1K37A 5JB8E 4ISHL 1PFXL 2NPRA 1J9CL 2M74A 3ZYGA 4M10A 2XC5L 1U67A 2OYEP 1EPGA 1NFUB 1CEJA 3MDLA 2WPKE 2KV4A 5IKTA 4JZEL 5I46L 1EQHA 4A94C 1MQ6L 2J4IB 2WZPP 3TBDA 3F6UL 4OTYA 3HS7A 4XBMA 5JBBE 2BO2A 2MHPA 5KIRA 3BT2A 1EZQB 4X8UL 1DVAL 1IQNL 2DDUA 4D0FA 4X8TL 1Z6EL 5JB9E 2ADXA 2FLBL 5IKRA 1L3YA 1G2LB 2BOUA 4JZDL 4JYUL 1IQML 2JKHL 2XBVL 3ZYJB 4M11A 1DQBA 3LAQA 2YGPA 3U73A 5L30L 2P3FN 3LC5B 1CQEA 1KIGL 2VWLL 2VVVL 1FE2A 1EPIA 2W2NE 3ELAL 2BMGA 4ZH8B 3FCSB 3HO4A 1NFYB 3QCWA 1URKA 1F0RB 1G1RA 4Z0KB 2WG4B 4Z6AL 2BQWA 3M37L 4BXSA 2BQ7A 1LMJA 2BT8A 2BZ6L 3ZYIB 3P5BL 1KLOA 3M36L 1V1IA 1EPHA 2WPJE 3U7UG 1KLIL 1G1TA 2VJ3A 3K9XA 2P94L 2PHBB 4BTTA 2G00L 3NTBA 2XC0L 2UWOB 3NT1A 1LPGA 2BQ6A 4BXWA 3N8YB 1PGEA 1UZKA 2Y7ZB 3N8ZA 2J34B 1W8BL 2P26A 1HT8A 2J38B 4O02B 4LMFA 1YGCL 1G1SA 4YZUB 4BDXA 1P9JA 3IJEB 5JVYA 1CCVA 1YUKB 2J95B 4X8VL 2W3KB 1FFMA 1UZPA 2W86A 4JYVL 5JW1A 3PGHA 1ATAA 1BF9A 3SOQA 4GU3A 2XBYL 1IGXA 3LN0A 2Y5GL 5JVZA 2I9BA 3BT1A 2P3UA 1CVUA 2VWOL 1HT5A 4Y7AB 3F1SB 1HREA 1ATEA 4COXA 1G1QA 1NQLB 1IVOC 1V1HA 2EI8B 1RFNB 4Y7BB 1Z6CA 1MQ5L 2CJIB 1JBUL 1HCGB 1NT0A 4AQTA 1IQLL 1EPJA 3CA7A 4O1ZA 5F19A 2BOXA 2WPME 1LK9A 1ATBA 2WPHE 6COXA 1Q4GA 1KSNB 4E1GA 4Z0LA 5KN5C 2OYUP 2MGRA 1KLJL 1FJSL 1X7AL 5EGMB 3N8XA 1K36A 3HO5A 2W2PE 2VH6B 2P28B 4Y71B 4CSYA 5FDQA 1XKBA 1DX5I 2XBWL 4NA9L 2BSFA 2HOXA 4MMZB 2GD4A 2YGOA 1YUFA 1ZAQA 4XL1A 5CKMA 4ISIL 3GCWE 3BPSE 1IQJL 1FAXL 3RR3A 4JZFL 2P3TA 4YT7L 3KQCL 2J2UB 2FZZL 5K0HB 5CISA 2BT7A 4BDWA 3ENSA 4RS0A 1COUA 1JV2B 4GU4A 4NG9L 1PXXA 3LC3B 3LN1A 4CUEA 4RUTA 2W2QE 1AUTL 2Y38A 3V64C 3OLUA 2RA0L 2XC4L 1ADXA 1IOEL 1B9WA 2WG3C 1SZBA 2Y5HL 1FSBA 5F1AA 3TGFA 3QH0A 1HRFA 2TGFA 1IOXA 2P95L 4FM5A 3CENL 1WU1B 1F7MA 2H9EC 4RRXA 3NJPC 1NFWB 2MGPA 3NTGA 3LIWB 1HJ7A 3EGFA 3HS6A 3S6XA 5CKNA 1YUGA 2F9BL 1IQHL 4LORA 1A3PA 2K2SB 3HS5A 1HX2A 3LTFB 3CFWA 2Y81B 3CS7L 1DDXA 3DEMA 2WYJB 4D90A 4G1MB 1QIUA 1CCFA 5CKQA 4OTJA 3N8VA 1KKEA 1TOZA 2BOKL 2VRSA 1W7XL 1UZQA 2W26B 4PH9A 1C5MF 3FFGL 3KRKA 2K2TA 1I0UA 1TPGA 4Y76B 1IJQA 5JBAE 1APQA 1L5GB 2PUQL 5L2YL 2JJLA 2W2OE 1IGZA 5E8DA 1MOXC 4BTIA 4MMYB 1CVWL 1XKAL 2AYLA 2VVCK 1NPEB 1N1IA 1GK5A 2KB9A 3KQEL 3C9AC 2FLRL 3HO3A 1IP0A 3GISX 3Q3KB 3KK6A 2B7DL 1APOA 1EBVA 4C16A 4RRZA 5JBCE 1IQIL 3FBYA 3IITB 3POYA 4ZXXL 4MMXB 4A7IA 2Y7XB 1IQKL 1U8CB 4YT6L 1NZIA 1UZJA 3Q7DA 1YO8A 1QFKL 4NGAL 1P0SL 3KL6B 3SOVA 3OLTA 1G2MB 3SOBB 1WHFA 2Q1JB 2J94B 2UWLB 1M1XB 4D0EA 3H5CB 5IKVA 1LPZA 2HORA 2WYGB 2Y80B 4XLWA 2KL7A 1LMMA 1DIYA 1PRHA 1WHEA 2VWMK 1NFXB 1XFEA 3TH3L 3TK6B 1O5DL 1F7EA 2VWNL 3N8WA 1XDTR 2RNLA 3QMOA 3MQEA 2PR3B 1N7DA 2RHPA 5IKQA 1LPKA 4Y79B 1EQGA 3R05A 4ZAEB 2P3FL 2UWPB 1V3XB 4ZXYL 4RRYA 5COXA 5L2ZL 3ASIA 2FLGA 3TK5B 2WPIE 4CUFA 2D1JB 1FF7A 3N8WB 4TGFA 2FD6A 2P93L 2XBXL 3HPTA 2H9EL 1IQEL 1EMOA 1EMNA 2VH0B 3KCGL 1ATDA 2EI6B 2VVUL 2YGQA 2EI7B 2P16L 3V65B 1PTHA 1HAFA 3KQBL 1OB1C 1IQFL 4CUDA
chains in the Genus database with same CATH topology
4Y6DB 3N8YA 2WPLE 1LQDA 2WFTA 1TLEA 2BOHA 2KNIA 1EAIC 1IQGL 1JL9A 2Y82B 1CX2A 2I9AA 4X8SL 4ZHAB 3GCXE 1EGFA 1HZ8A 3LTGD 2Y5FL 2WFXB 1FAKL 4RRWA 1F0SB 3KQDL 4BTUA 3TZIA 2W3IB 1HAEA 3SW2A 2W2ME 1K37A 5JB8E 4ISHL 1PFXL 2NPRA 1J9CL 2M74A 3ZYGA 4M10A 2XC5L 1U67A 2OYEP 1EPGA 1NFUB 1CEJA 3MDLA 2WPKE 2KV4A 5IKTA 4JZEL 5I46L 1EQHA 4A94C 1MQ6L 2J4IB 2WZPP 3TBDA 3F6UL 4OTYA 3HS7A 4XBMA 5JBBE 2BO2A 2MHPA 5KIRA 3BT2A 1EZQB 4X8UL 1DVAL 1IQNL 2DDUA 4D0FA 4X8TL 1Z6EL 5JB9E 2ADXA 2FLBL 5IKRA 1L3YA 1G2LB 2BOUA 4JZDL 4JYUL 1IQML 2JKHL 2XBVL 3ZYJB 4M11A 1DQBA 2YGPA 3LAQA 3U73A 5L30L 2P3FN 3LC5B 1CQEA 1KIGL 2VWLL 2VVVL 1FE2A 1EPIA 2W2NE 3ELAL 2BMGA 4ZH8B 3FCSB 3HO4A 1NFYB 3QCWA 1URKA 1F0RB 1G1RA 4Z0KB 2WG4B 4Z6AL 2BQWA 3M37L 4BXSA 2BQ7A 1LMJA 2BZ6L 3ZYIB 3P5BL 1KLOA 3M36L 1EPHA 2WPJE 3U7UG 1KLIL 1G1TA 2VJ3A 3K9XA 2P94L 2PHBB 4BTTA 2G00L 3NTBA 2XC0L 2UWOB 3NT1A 1LPGA 2BQ6A 4BXWA 3N8YB 1PGEA 1UZKA 2Y7ZB 3N8ZA 2J34B 1W8BL 2P26A 1HT8A 2J38B 4O02B 4LMFA 1YGCL 1G1SA 4YZUB 4BDXA 1P9JA 3IJEB 5JVYA 1CCVA 1YUKB 2J95B 4X8VL 2W3KB 1FFMA 1UZPA 2W86A 4JYVL 5JW1A 3PGHA 1ATAA 1BF9A 3SOQA 2XBYL 1IGXA 3LN0A 2Y5GL 5JVZA 2I9BA 3BT1A 2P3UA 1CVUA 2VWOL 1HT5A 4Y7AB 3F1SB 1HREA 1ATEA 4COXA 1G1QA 1NQLB 1IVOC 2EI8B 1RFNB 4Y7BB 1Z6CA 1MQ5L 2CJIB 1JBUL 1HCGB 1NT0A 4AQTA 1IQLL 1EPJA 3CA7A 4O1ZA 5F19A 2BOXA 2WPME 1ATBA 2WPHE 6COXA 1Q4GA 1KSNB 4E1GA 4Z0LA 5KN5C 2OYUP 2MGRA 1KLJL 1FJSL 1X7AL 5EGMB 3N8XA 1K36A 3HO5A 2W2PE 2VH6B 2P28B 4Y71B 4CSYA 5FDQA 1XKBA 1DX5I 2XBWL 4NA9L 4MMZB 2GD4A 2YGOA 1YUFA 1ZAQA 4XL1A 5CKMA 4ISIL 3GCWE 3BPSE 1IQJL 1FAXL 3RR3A 4JZFL 2P3TA 4YT7L 3KQCL 2J2UB 2FZZL 5K0HB 5CISA 4BDWA 3ENSA 4RS0A 1COUA 1JV2B 4NG9L 1PXXA 3LC3B 3LN1A 4CUEA 4RUTA 2W2QE 1AUTL 2Y38A 3V64C 3OLUA 2RA0L 2XC4L 1ADXA 1IOEL 1B9WA 2WG3C 1SZBA 2Y5HL 1FSBA 5F1AA 3TGFA 3QH0A 1HRFA 2TGFA 1IOXA 2P95L 4FM5A 3CENL 1WU1B 1F7MA 2H9EC 4RRXA 3NJPC 1NFWB 2MGPA 3LIWB 3NTGA 1HJ7A 3EGFA 3HS6A 3S6XA 5CKNA 1YUGA 2F9BL 1IQHL 4LORA 1A3PA 2K2SB 3HS5A 1HX2A 3LTFB 3CFWA 2Y81B 3CS7L 1DDXA 3DEMA 2WYJB 4D90A 4G1MB 1CCFA 5CKQA 4OTJA 3N8VA 1TOZA 2BOKL 1W7XL 1UZQA 2W26B 4PH9A 1C5MF 3FFGL 3KRKA 2K2TA 1I0UA 1TPGA 4Y76B 1IJQA 5JBAE 1APQA 1L5GB 2PUQL 5L2YL 2W2OE 1IGZA 5E8DA 1MOXC 4BTIA 4MMYB 1CVWL 1XKAL 2AYLA 2VVCK 1NPEB 1N1IA 1GK5A 2KB9A 3KQEL 3C9AC 2FLRL 3HO3A 1IP0A 3GISX 3Q3KB 3KK6A 2B7DL 1APOA 1EBVA 4C16A 4RRZA 5JBCE 1IQIL 3FBYA 3IITB 3POYA 4ZXXL 4MMXB 4A7IA 2Y7XB 1IQKL 1U8CB 4YT6L 1NZIA 1UZJA 3Q7DA 1YO8A 1QFKL 4NGAL 1P0SL 3KL6B 3SOVA 3OLTA 1G2MB 3SOBB 1WHFA 2Q1JB 2J94B 2UWLB 1M1XB 4D0EA 3H5CB 5IKVA 1LPZA 2WYGB 2Y80B 4XLWA 2KL7A 1LMMA 1DIYA 1PRHA 1WHEA 2VWMK 1NFXB 1XFEA 3TH3L 3TK6B 1O5DL 1F7EA 2VWNL 3N8WA 1XDTR 2RNLA 3QMOA 3MQEA 2PR3B 1N7DA 2RHPA 5IKQA 1LPKA 4Y79B 1EQGA 3R05A 4ZAEB 2P3FL 2UWPB 1V3XB 4ZXYL 4RRYA 5COXA 5L2ZL 3ASIA 2FLGA 3TK5B 2WPIE 4CUFA 2D1JB 1FF7A 3N8WB 4TGFA 2FD6A 2P93L 2XBXL 3HPTA 2H9EL 1IQEL 1EMOA 1EMNA 2VH0B 3KCGL 1ATDA 2EI6B 2VVUL 2YGQA 2EI7B 2P16L 3V65B 1PTHA 1HAFA 3KQBL 1OB1C 1IQFL 4CUDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y6D B;  3N8Y A;  2WPL E;  1LQD A;  2WFT A;  1TLE A;  2BOH A;  1EAI C;  1IQG L;  1JL9 A;  2Y82 B;  1CX2 A;  2I9A A;  4X8S L;  4ZHA B;  3GCX E;  1EGF A;  1HZ8 A;  3LTG D;  2Y5F L;  2WFX B;  1FAK L;  4RRW A;  1F0S B;  3KQD L;  4BTU A;  3TZI A;  2W3I B;  1HAE A;  3SW2 A;  2W2M E;  1K37 A;  5JB8 E;  4ISH L;  1PFX L;  2NPR A;  1J9C L;  2M74 A;  3ZYG A;  4M10 A;  2XC5 L;  1U67 A;  2OYE P;  1EPG A;  1NFU B;  1CEJ A;  3MDL A;  2WPK E;  2KV4 A;  5IKT A;  4JZE L;  5I46 L;  1EQH A;  1MQ6 L;  2J4I B;  3TBD A;  3F6U L;  4OTY A;  3HS7 A;  4XBM A;  5JBB E;  2BO2 A;  2MHP A;  5KIR A;  3BT2 A;  1EZQ B;  4X8U L;  1DVA L;  1IQN L;  2DDU A;  4D0F A;  4X8T L;  1Z6E L;  5JB9 E;  2ADX A;  2FLB L;  5IKR A;  1L3Y A;  1G2L B;  2BOU A;  4JZD L;  4JYU L;  1IQM L;  2JKH L;  2XBV L;  3ZYJ B;  4M11 A;  1DQB A;  2YGP A;  3LAQ A;  3U73 A;  5L30 L;  2P3F N;  3LC5 B;  1CQE A;  1KIG L;  2VWL L;  2VVV L;  1FE2 A;  1EPI A;  2W2N E;  3ELA L;  2BMG A;  4ZH8 B;  3FCS B;  3HO4 A;  1NFY B;  3QCW A;  1URK A;  1F0R B;  1G1R A;  4Z0K B;  2WG4 B;  4Z6A L;  2BQW A;  3M37 L;  4BXS A;  2BQ7 A;  1LMJ A;  2BZ6 L;  3ZYI B;  3P5B L;  1KLO A;  3M36 L;  1EPH A;  2WPJ E;  3U7U G;  1KLI L;  1G1T A;  2VJ3 A;  3K9X A;  2P94 L;  2PHB B;  4BTT A;  2G00 L;  3NTB A;  2XC0 L;  2UWO B;  3NT1 A;  1LPG A;  2BQ6 A;  4BXW A;  3N8Y B;  1PGE A;  1UZK A;  2Y7Z B;  3N8Z A;  2J34 B;  1W8B L;  2P26 A;  1HT8 A;  2J38 B;  4O02 B;  4LMF A;  1YGC L;  1G1S A;  4YZU B;  4BDX A;  1P9J A;  3IJE B;  5JVY A;  1CCV A;  1YUK B;  2J95 B;  4X8V L;  2W3K B;  1FFM A;  1UZP A;  2W86 A;  4JYV L;  5JW1 A;  3PGH A;  1ATA A;  1BF9 A;  3SOQ A;  2XBY L;  1IGX A;  3LN0 A;  2Y5G L;  5JVZ A;  2I9B A;  3BT1 A;  2P3U A;  1CVU A;  2VWO L;  1HT5 A;  4Y7A B;  3F1S B;  1HRE A;  1ATE A;  4COX A;  1G1Q A;  1NQL B;  1IVO C;  2EI8 B;  1RFN B;  4Y7B B;  1Z6C A;  1MQ5 L;  2CJI B;  1JBU L;  1HCG B;  1NT0 A;  4AQT A;  1IQL L;  1EPJ A;  4O1Z A;  3CA7 A;  5F19 A;  2BOX A;  2WPM E;  1ATB A;  2WPH E;  6COX A;  1Q4G A;  1KSN B;  4E1G A;  4Z0L A;  5KN5 C;  2OYU P;  2MGR A;  1KLJ L;  1FJS L;  1X7A L;  5EGM B;  3N8X A;  1K36 A;  3HO5 A;  2W2P E;  2VH6 B;  2P28 B;  4Y71 B;  4CSY A;  5FDQ A;  1XKB A;  1DX5 I;  2XBW L;  4NA9 L;  4MMZ B;  2GD4 A;  2YGO A;  1YUF A;  1ZAQ A;  4XL1 A;  5CKM A;  4ISI L;  3GCW E;  3BPS E;  1IQJ L;  1FAX L;  3RR3 A;  4JZF L;  2P3T A;  4YT7 L;  3KQC L;  2J2U B;  2FZZ L;  5K0H B;  5CIS A;  4BDW A;  3ENS A;  4RS0 A;  1COU A;  1JV2 B;  4NG9 L;  1PXX A;  3LC3 B;  3LN1 A;  4CUE A;  4RUT A;  2W2Q E;  1AUT L;  2Y38 A;  3V64 C;  3OLU A;  2RA0 L;  2XC4 L;  1ADX A;  1IOE L;  1B9W A;  2WG3 C;  1SZB A;  2Y5H L;  1FSB A;  5F1A A;  3TGF A;  3QH0 A;  1HRF A;  2TGF A;  1IOX A;  2P95 L;  4FM5 A;  3CEN L;  1WU1 B;  1F7M A;  4RRX A;  3NJP C;  1NFW B;  2MGP A;  3LIW B;  3NTG A;  1HJ7 A;  3EGF A;  3HS6 A;  5CKN A;  1YUG A;  2F9B L;  1IQH L;  4LOR A;  1A3P A;  2K2S B;  3HS5 A;  1HX2 A;  3LTF B;  3CFW A;  2Y81 B;  3CS7 L;  1DDX A;  3DEM A;  2WYJ B;  4D90 A;  4G1M B;  1CCF A;  5CKQ A;  4OTJ A;  3N8V A;  1TOZ A;  2BOK L;  1W7X L;  1UZQ A;  2W26 B;  4PH9 A;  1C5M F;  3FFG L;  3KRK A;  2K2T A;  1I0U A;  1TPG A;  4Y76 B;  1IJQ A;  5JBA E;  1APQ A;  1L5G B;  2PUQ L;  5L2Y L;  2W2O E;  1IGZ A;  5E8D A;  1MOX C;  4BTI A;  4MMY B;  1CVW L;  1XKA L;  2AYL A;  2VVC K;  1NPE B;  1N1I A;  1GK5 A;  2KB9 A;  3KQE L;  3C9A C;  2FLR L;  3HO3 A;  1IP0 A;  3GIS X;  3Q3K B;  3KK6 A;  2B7D L;  1APO A;  1EBV A;  4C16 A;  4RRZ A;  5JBC E;  1IQI L;  3FBY A;  3IIT B;  3POY A;  4ZXX L;  4MMX B;  4A7I A;  2Y7X B;  1IQK L;  1U8C B;  4YT6 L;  1NZI A;  1UZJ A;  3Q7D A;  1YO8 A;  1QFK L;  4NGA L;  1P0S L;  3KL6 B;  3SOV A;  3OLT A;  1G2M B;  3SOB B;  1WHF A;  2Q1J B;  2J94 B;  2UWL B;  1M1X B;  4D0E A;  3H5C B;  5IKV A;  1LPZ A;  2WYG B;  2Y80 B;  4XLW A;  2KL7 A;  1DIY A;  1PRH A;  1WHE A;  2VWM K;  1NFX B;  1XFE A;  3TH3 L;  3TK6 B;  1O5D L;  1F7E A;  2VWN L;  3N8W A;  1XDT R;  2RNL A;  3QMO A;  3MQE A;  2PR3 B;  1N7D A;  2RHP A;  5IKQ A;  1LPK A;  4Y79 B;  1EQG A;  3R05 A;  4ZAE B;  2P3F L;  2UWP B;  1V3X B;  4ZXY L;  4RRY A;  5COX A;  5L2Z L;  3ASI A;  2FLG A;  3TK5 B;  2WPI E;  4CUF A;  2D1J B;  1FF7 A;  3N8W B;  4TGF A;  2FD6 A;  2P93 L;  2XBX L;  3HPT A;  2H9E L;  1IQE L;  1EMO A;  1EMN A;  2VH0 B;  3KCG L;  1ATD A;  2EI6 B;  2VVU L;  2EI7 B;  2P16 L;  3V65 B;  1PTH A;  1HAF A;  3KQB L;  1OB1 C;  1IQF L;  4CUD A; 
#chains in the Genus database with same CATH topology
 4Y6D B;  3N8Y A;  2WPL E;  1LQD A;  2WFT A;  1TLE A;  2BOH A;  2KNI A;  1EAI C;  1IQG L;  1JL9 A;  2Y82 B;  1CX2 A;  2I9A A;  4X8S L;  4ZHA B;  3GCX E;  1EGF A;  1HZ8 A;  3LTG D;  2Y5F L;  2WFX B;  1FAK L;  4RRW A;  1F0S B;  3KQD L;  4BTU A;  3TZI A;  2W3I B;  1HAE A;  3SW2 A;  2W2M E;  1K37 A;  5JB8 E;  4ISH L;  1PFX L;  2NPR A;  1J9C L;  2M74 A;  3ZYG A;  4M10 A;  2XC5 L;  1U67 A;  2OYE P;  1EPG A;  1NFU B;  1CEJ A;  3MDL A;  2WPK E;  2KV4 A;  5IKT A;  4JZE L;  5I46 L;  1EQH A;  4A94 C;  1MQ6 L;  2J4I B;  2WZP P;  3TBD A;  3F6U L;  4OTY A;  3HS7 A;  4XBM A;  5JBB E;  2BO2 A;  2MHP A;  5KIR A;  3BT2 A;  1EZQ B;  4X8U L;  1DVA L;  1IQN L;  2DDU A;  4D0F A;  4X8T L;  1Z6E L;  5JB9 E;  2ADX A;  2FLB L;  5IKR A;  1L3Y A;  1G2L B;  2BOU A;  4JZD L;  4JYU L;  1IQM L;  2JKH L;  2XBV L;  3ZYJ B;  4M11 A;  1DQB A;  3LAQ A;  2YGP A;  3U73 A;  5L30 L;  2P3F N;  3LC5 B;  1CQE A;  1KIG L;  2VWL L;  2VVV L;  1FE2 A;  1EPI A;  2W2N E;  3ELA L;  2BMG A;  4ZH8 B;  3FCS B;  3HO4 A;  1NFY B;  3QCW A;  1URK A;  1F0R B;  1G1R A;  4Z0K B;  2WG4 B;  4Z6A L;  2BQW A;  3M37 L;  4BXS A;  2BQ7 A;  1LMJ A;  2BT8 A;  2BZ6 L;  3ZYI B;  3P5B L;  1KLO A;  3M36 L;  1V1I A;  1EPH A;  2WPJ E;  3U7U G;  1KLI L;  1G1T A;  2VJ3 A;  3K9X A;  2P94 L;  2PHB B;  4BTT A;  2G00 L;  3NTB A;  2XC0 L;  2UWO B;  3NT1 A;  1LPG A;  2BQ6 A;  4BXW A;  3N8Y B;  1PGE A;  1UZK A;  2Y7Z B;  3N8Z A;  2J34 B;  1W8B L;  2P26 A;  1HT8 A;  2J38 B;  4O02 B;  4LMF A;  1YGC L;  1G1S A;  4YZU B;  4BDX A;  1P9J A;  3IJE B;  5JVY A;  1CCV A;  1YUK B;  2J95 B;  4X8V L;  2W3K B;  1FFM A;  1UZP A;  2W86 A;  4JYV L;  5JW1 A;  3PGH A;  1ATA A;  1BF9 A;  3SOQ A;  4GU3 A;  2XBY L;  1IGX A;  3LN0 A;  2Y5G L;  5JVZ A;  2I9B A;  3BT1 A;  2P3U A;  1CVU A;  2VWO L;  1HT5 A;  4Y7A B;  3F1S B;  1HRE A;  1ATE A;  4COX A;  1G1Q A;  1NQL B;  1IVO C;  1V1H A;  2EI8 B;  1RFN B;  4Y7B B;  1Z6C A;  1MQ5 L;  2CJI B;  1JBU L;  1HCG B;  1NT0 A;  4AQT A;  1IQL L;  1EPJ A;  3CA7 A;  4O1Z A;  5F19 A;  2BOX A;  2WPM E;  1LK9 A;  1ATB A;  2WPH E;  6COX A;  1Q4G A;  1KSN B;  4E1G A;  4Z0L A;  5KN5 C;  2OYU P;  2MGR A;  1KLJ L;  1FJS L;  1X7A L;  5EGM B;  3N8X A;  1K36 A;  3HO5 A;  2W2P E;  2VH6 B;  2P28 B;  4Y71 B;  4CSY A;  5FDQ A;  1XKB A;  1DX5 I;  2XBW L;  4NA9 L;  2BSF A;  2HOX A;  4MMZ B;  2GD4 A;  2YGO A;  1YUF A;  1ZAQ A;  4XL1 A;  5CKM A;  4ISI L;  3GCW E;  3BPS E;  1IQJ L;  1FAX L;  3RR3 A;  4JZF L;  2P3T A;  4YT7 L;  3KQC L;  2J2U B;  2FZZ L;  5K0H B;  5CIS A;  2BT7 A;  4BDW A;  3ENS A;  4RS0 A;  1COU A;  1JV2 B;  4GU4 A;  4NG9 L;  1PXX A;  3LC3 B;  3LN1 A;  4CUE A;  4RUT A;  2W2Q E;  1AUT L;  2Y38 A;  3V64 C;  3OLU A;  2RA0 L;  2XC4 L;  1ADX A;  1IOE L;  1B9W A;  2WG3 C;  1SZB A;  2Y5H L;  1FSB A;  5F1A A;  3TGF A;  3QH0 A;  1HRF A;  2TGF A;  1IOX A;  2P95 L;  4FM5 A;  3CEN L;  1WU1 B;  1F7M A;  2H9E C;  4RRX A;  3NJP C;  1NFW B;  2MGP A;  3NTG A;  3LIW B;  1HJ7 A;  3EGF A;  3HS6 A;  3S6X A;  5CKN A;  1YUG A;  2F9B L;  1IQH L;  4LOR A;  1A3P A;  2K2S B;  3HS5 A;  1HX2 A;  3LTF B;  3CFW A;  2Y81 B;  3CS7 L;  1DDX A;  3DEM A;  2WYJ B;  4D90 A;  4G1M B;  1QIU A;  1CCF A;  5CKQ A;  4OTJ A;  3N8V A;  1KKE A;  1TOZ A;  2BOK L;  2VRS A;  1W7X L;  1UZQ A;  2W26 B;  4PH9 A;  1C5M F;  3FFG L;  3KRK A;  2K2T A;  1I0U A;  1TPG A;  4Y76 B;  1IJQ A;  5JBA E;  1APQ A;  1L5G B;  2PUQ L;  5L2Y L;  2JJL A;  2W2O E;  1IGZ A;  5E8D A;  1MOX C;  4BTI A;  4MMY B;  1CVW L;  1XKA L;  2AYL A;  2VVC K;  1NPE B;  1N1I A;  1GK5 A;  2KB9 A;  3KQE L;  3C9A C;  2FLR L;  3HO3 A;  1IP0 A;  3GIS X;  3Q3K B;  3KK6 A;  2B7D L;  1APO A;  1EBV A;  4C16 A;  4RRZ A;  5JBC E;  1IQI L;  3FBY A;  3IIT B;  3POY A;  4ZXX L;  4MMX B;  4A7I A;  2Y7X B;  1IQK L;  1U8C B;  4YT6 L;  1NZI A;  1UZJ A;  3Q7D A;  1YO8 A;  1QFK L;  4NGA L;  1P0S L;  3KL6 B;  3SOV A;  3OLT A;  1G2M B;  3SOB B;  1WHF A;  2Q1J B;  2J94 B;  2UWL B;  1M1X B;  4D0E A;  3H5C B;  5IKV A;  1LPZ A;  2HOR A;  2WYG B;  2Y80 B;  4XLW A;  2KL7 A;  1LMM A;  1DIY A;  1PRH A;  1WHE A;  2VWM K;  1NFX B;  1XFE A;  3TH3 L;  3TK6 B;  1O5D L;  1F7E A;  2VWN L;  3N8W A;  1XDT R;  2RNL A;  3QMO A;  3MQE A;  2PR3 B;  1N7D A;  2RHP A;  5IKQ A;  1LPK A;  4Y79 B;  1EQG A;  3R05 A;  4ZAE B;  2P3F L;  2UWP B;  1V3X B;  4ZXY L;  4RRY A;  5COX A;  5L2Z L;  3ASI A;  2FLG A;  3TK5 B;  2WPI E;  4CUF A;  2D1J B;  1FF7 A;  3N8W B;  4TGF A;  2FD6 A;  2P93 L;  2XBX L;  3HPT A;  2H9E L;  1IQE L;  1EMO A;  1EMN A;  2VH0 B;  3KCG L;  1ATD A;  2EI6 B;  2VVU L;  2YGQ A;  2EI7 B;  2P16 L;  3V65 B;  1PTH A;  1HAF A;  3KQB L;  1OB1 C;  1IQF L;  4CUD A; 
#chains in the Genus database with same CATH homology
 4Y6D B;  3N8Y A;  2WPL E;  1LQD A;  2WFT A;  1TLE A;  2BOH A;  2KNI A;  1EAI C;  1IQG L;  1JL9 A;  2Y82 B;  1CX2 A;  2I9A A;  4X8S L;  4ZHA B;  3GCX E;  1EGF A;  1HZ8 A;  3LTG D;  2Y5F L;  2WFX B;  1FAK L;  4RRW A;  1F0S B;  3KQD L;  4BTU A;  3TZI A;  2W3I B;  1HAE A;  3SW2 A;  2W2M E;  1K37 A;  5JB8 E;  4ISH L;  1PFX L;  2NPR A;  1J9C L;  2M74 A;  3ZYG A;  4M10 A;  2XC5 L;  1U67 A;  2OYE P;  1EPG A;  1NFU B;  1CEJ A;  3MDL A;  2WPK E;  2KV4 A;  5IKT A;  4JZE L;  5I46 L;  1EQH A;  4A94 C;  1MQ6 L;  2J4I B;  2WZP P;  3TBD A;  3F6U L;  4OTY A;  3HS7 A;  4XBM A;  5JBB E;  2BO2 A;  2MHP A;  5KIR A;  3BT2 A;  1EZQ B;  4X8U L;  1DVA L;  1IQN L;  2DDU A;  4D0F A;  4X8T L;  1Z6E L;  5JB9 E;  2ADX A;  2FLB L;  5IKR A;  1L3Y A;  1G2L B;  2BOU A;  4JZD L;  4JYU L;  1IQM L;  2JKH L;  2XBV L;  3ZYJ B;  4M11 A;  1DQB A;  2YGP A;  3LAQ A;  3U73 A;  5L30 L;  2P3F N;  3LC5 B;  1CQE A;  1KIG L;  2VWL L;  2VVV L;  1FE2 A;  1EPI A;  2W2N E;  3ELA L;  2BMG A;  4ZH8 B;  3FCS B;  3HO4 A;  1NFY B;  3QCW A;  1URK A;  1F0R B;  1G1R A;  4Z0K B;  2WG4 B;  4Z6A L;  2BQW A;  3M37 L;  4BXS A;  2BQ7 A;  1LMJ A;  2BZ6 L;  3ZYI B;  3P5B L;  1KLO A;  3M36 L;  1EPH A;  2WPJ E;  3U7U G;  1KLI L;  1G1T A;  2VJ3 A;  3K9X A;  2P94 L;  2PHB B;  4BTT A;  2G00 L;  3NTB A;  2XC0 L;  2UWO B;  3NT1 A;  1LPG A;  2BQ6 A;  4BXW A;  3N8Y B;  1PGE A;  1UZK A;  2Y7Z B;  3N8Z A;  2J34 B;  1W8B L;  2P26 A;  1HT8 A;  2J38 B;  4O02 B;  4LMF A;  1YGC L;  1G1S A;  4YZU B;  4BDX A;  1P9J A;  3IJE B;  5JVY A;  1CCV A;  1YUK B;  2J95 B;  4X8V L;  2W3K B;  1FFM A;  1UZP A;  2W86 A;  4JYV L;  5JW1 A;  3PGH A;  1ATA A;  1BF9 A;  3SOQ A;  2XBY L;  1IGX A;  3LN0 A;  2Y5G L;  5JVZ A;  2I9B A;  3BT1 A;  2P3U A;  1CVU A;  2VWO L;  1HT5 A;  4Y7A B;  3F1S B;  1HRE A;  1ATE A;  4COX A;  1G1Q A;  1NQL B;  1IVO C;  2EI8 B;  1RFN B;  4Y7B B;  1Z6C A;  1MQ5 L;  2CJI B;  1JBU L;  1HCG B;  1NT0 A;  4AQT A;  1IQL L;  1EPJ A;  3CA7 A;  4O1Z A;  5F19 A;  2BOX A;  2WPM E;  1ATB A;  2WPH E;  6COX A;  1Q4G A;  1KSN B;  4E1G A;  4Z0L A;  5KN5 C;  2OYU P;  2MGR A;  1KLJ L;  1FJS L;  1X7A L;  5EGM B;  3N8X A;  1K36 A;  3HO5 A;  2W2P E;  2VH6 B;  2P28 B;  4Y71 B;  4CSY A;  5FDQ A;  1XKB A;  1DX5 I;  2XBW L;  4NA9 L;  4MMZ B;  2GD4 A;  2YGO A;  1YUF A;  1ZAQ A;  4XL1 A;  5CKM A;  4ISI L;  3GCW E;  3BPS E;  1IQJ L;  1FAX L;  3RR3 A;  4JZF L;  2P3T A;  4YT7 L;  3KQC L;  2J2U B;  2FZZ L;  5K0H B;  5CIS A;  4BDW A;  3ENS A;  4RS0 A;  1COU A;  1JV2 B;  4NG9 L;  1PXX A;  3LC3 B;  3LN1 A;  4CUE A;  4RUT A;  2W2Q E;  1AUT L;  2Y38 A;  3V64 C;  3OLU A;  2RA0 L;  2XC4 L;  1ADX A;  1IOE L;  1B9W A;  2WG3 C;  1SZB A;  2Y5H L;  1FSB A;  5F1A A;  3TGF A;  3QH0 A;  1HRF A;  2TGF A;  1IOX A;  2P95 L;  4FM5 A;  3CEN L;  1WU1 B;  1F7M A;  2H9E C;  4RRX A;  3NJP C;  1NFW B;  2MGP A;  3LIW B;  3NTG A;  1HJ7 A;  3EGF A;  3HS6 A;  3S6X A;  5CKN A;  1YUG A;  2F9B L;  1IQH L;  4LOR A;  1A3P A;  2K2S B;  3HS5 A;  1HX2 A;  3LTF B;  3CFW A;  2Y81 B;  3CS7 L;  1DDX A;  3DEM A;  2WYJ B;  4D90 A;  4G1M B;  1CCF A;  5CKQ A;  4OTJ A;  3N8V A;  1TOZ A;  2BOK L;  1W7X L;  1UZQ A;  2W26 B;  4PH9 A;  1C5M F;  3FFG L;  3KRK A;  2K2T A;  1I0U A;  1TPG A;  4Y76 B;  1IJQ A;  5JBA E;  1APQ A;  1L5G B;  2PUQ L;  5L2Y L;  2W2O E;  1IGZ A;  5E8D A;  1MOX C;  4BTI A;  4MMY B;  1CVW L;  1XKA L;  2AYL A;  2VVC K;  1NPE B;  1N1I A;  1GK5 A;  2KB9 A;  3KQE L;  3C9A C;  2FLR L;  3HO3 A;  1IP0 A;  3GIS X;  3Q3K B;  3KK6 A;  2B7D L;  1APO A;  1EBV A;  4C16 A;  4RRZ A;  5JBC E;  1IQI L;  3FBY A;  3IIT B;  3POY A;  4ZXX L;  4MMX B;  4A7I A;  2Y7X B;  1IQK L;  1U8C B;  4YT6 L;  1NZI A;  1UZJ A;  3Q7D A;  1YO8 A;  1QFK L;  4NGA L;  1P0S L;  3KL6 B;  3SOV A;  3OLT A;  1G2M B;  3SOB B;  1WHF A;  2Q1J B;  2J94 B;  2UWL B;  1M1X B;  4D0E A;  3H5C B;  5IKV A;  1LPZ A;  2WYG B;  2Y80 B;  4XLW A;  2KL7 A;  1LMM A;  1DIY A;  1PRH A;  1WHE A;  2VWM K;  1NFX B;  1XFE A;  3TH3 L;  3TK6 B;  1O5D L;  1F7E A;  2VWN L;  3N8W A;  1XDT R;  2RNL A;  3QMO A;  3MQE A;  2PR3 B;  1N7D A;  2RHP A;  5IKQ A;  1LPK A;  4Y79 B;  1EQG A;  3R05 A;  4ZAE B;  2P3F L;  2UWP B;  1V3X B;  4ZXY L;  4RRY A;  5COX A;  5L2Z L;  3ASI A;  2FLG A;  3TK5 B;  2WPI E;  4CUF A;  2D1J B;  1FF7 A;  3N8W B;  4TGF A;  2FD6 A;  2P93 L;  2XBX L;  3HPT A;  2H9E L;  1IQE L;  1EMO A;  1EMN A;  2VH0 B;  3KCG L;  1ATD A;  2EI6 B;  2VVU L;  2YGQ A;  2EI7 B;  2P16 L;  3V65 B;  1PTH A;  1HAF A;  3KQB L;  1OB1 C;  1IQF L;  4CUD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...