3BQ7A

Sam domain of diacylglycerol kinase delta1 (e35g)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
68
structure length
68
Chain Sequence
b'RPVHLWGTEEVAAWLEHLSLCEYKDIFTRHDIRGSGLLHLERRDLKDLGVTKVGHMKRILCGIKELSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diacylglycerol kinase delta
publication title Regulation of Enzyme Localization by Polymerization: Polymer Formation by the SAM Domain of Diacylglycerol Kinase delta1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 23
structure length 68
sequence length 68
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.1.107: Diacylglycerol kinase (ATP).
pdb deposition date 2007-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3bq7A00
1SV0C 1SGGA 2D8CA 3TACB 1B4FA 3HILA 2QB1A 2QARB 1SV4A 2KSOB 1SXDA 1COKA 2QB0A 2YTUA 1OXJA 5JU5A 3KKAC 1KW4A 2ES6A 3BQ7A 5F3XB 1LKYA 3IDWA 2F3NA 2D3DA 2KG5A 2KE7A 2EAPA 1OW5A 1WWUA 1V85A 1PK3A 2QARA 2EAMA 2DL0A 2KMDA 2K60A 5J8YA 5J8YC 2E8PA 2F44A 1JI7A 2KSOA 4PZOA 3TADA 2E8MA 3TADC 2DKXA 2E8OA 2LMRA 1WWVA 1X40A 3BS7A 2F8KA 2E8NA 2ESEA 4IS7A 1X66A 4MHVA 5L1MA 3BS5B 2L5YA 1PK1B 3SENA 3SEIA 5JTIA 2GLEA 2K4PA 2Y9TA 5JRTA 3H8MA 2B6GA 4PZNA 2FE9A 1UCVA 2DKZA 2EANA 1B0XA 1SV0A 2QKQA 4NJ8A 1SXEA 1UQVA 4NL9C 4NL9A 1V38A 1DXSA 1Z1VA 1F0MA 2QB0B 1X9XA 3K1RB 3BS5A 2EAOA 2JV3A 2Y9UA 2LPEA 5KNIA 1LKYB 1PK1A 2KIVA 3KKAA 4RQNA 4RQMA 1RG6A
chains in the Genus database with same CATH superfamily
3MR6A 3AU6A 2W43A 5ALKA 2AGOA 5D49A 2QB1A 4M9HA 1HIWA 5ALOA 8ICXA 1SV4A 3PVXA 2KSOB 1JALA 2V4RA 2YTUA 3LWLA 4XQ8A 2F1IA 3WK6A 4I27A 7ICQA 4JUZA 2WB1C 3ED5A 3NVZA 4U7CA 4ELUA 1LKYA 1MA7A 1RDFA 1TE2A 1NJWA 1T7PA 1U4BA 4QWBA 4F4ZA 4GLXA 3PZPA 3V72A 5AI8A 5ALYA 4FBUA 2G0AA 5GTHU 4FZNA 1SWWA 3HT3A 3RJHA 2HDOA 3BS5B 8ICIA 1DK2A 1SL0A 2P6RA 3ZI4A 2KFNA 3SAHA 2RRDA 4UW9A 3HRDD 1ZQSA 5A0LA 5KG4A 5KG3A 4RU9A 3HP6A 1SL2A 3JPPA 3PSPA 2XY7A 1F44A 2Y9UA 4DFKA 1V9PA 1XC9A 4EEYA 4RQNA 2FLNA 4EYHB 4OO1J 3QU2A 1JUDA 5AK6A 3WK4A 4J9RA 3Q8LA 1NKEA 5J2CA 2W9AA 3D2SA 4NXZA 3QU7A 1QQ7A 2VA2A 4F3OA 3HILA 3IHQB 1X6JA 2W9BA 4Z6EA 1S77D 4PHPA 5AI4A 9ICCA 3WK9A 4PGXA 4QZ8A 2PMZF 3T5LA 3CRXA 3L3FX 9ICEA 3BZKA 9ICAA 2DQNB 2JMGA 3M8SA 3Q8PB 1SB3C 3H7IA 9ICWA 3TFSA 2RHFA 2BPGA 1DK3A 4DSJA 5KFDA 3GV8B 5J2DA 4M9JA 3H4BA 3B0XA 2KFZA 4KLLA 4O0IA 2ASJA 2H3IA 2F44A 3TADC 2YMPA 3AEVA 2KJ9A 5DQGA 4NM2A 4ECTA 4KITB 4Z6FA 2N1RA 2WF5A 4G9BA 4F50A 2K4IA 1PK1B 1ZQIA 5HR6A 1Q8KA 2HHQA 5L1IA 1RQLA 1ZYQA 4P0QB 2WTFA 1N63A 1NNLA 1ZXIA 5DLGA 4DEZA 3J81j 4DSKA 2R8JA 1ZRNA 1EXNA 1S8OA 1MN8A 4I2BA 1U9LA 2XY5A 4KLUA 2EDUA 4O3RA 4PGYA 4RZRA 2J6TA 2W9MA 3GV5B 2JV3A 3N7PD 1NJYA 3L4PA 5EWGA 2WAQC 4DQQA 2PFOA 1KFDA 2QARB 2HOIA 2BR0A 3E2EA 5DDYA 5DQIA 3Q8KA 4ED3A 2JRZA 5ALWA 2YMMA 4QZHA 1QSLA 4DFPA 3VC8A 4BDPA 3C28A 3QZ7A 8ICWA 1ZQZA 2EZZA 3C1YA 1ZD3A 4F8RA 2P6UA 3PO5A 2I5HA 3RB3A 3S6JA 1ZD2P 1V97A 3PX0A 3RBDA 2DPIA 2LM1A 2A1AA 4J9KA 4ZH4A 4NLNA 3H4DA 5ALPA 4UASA 1NK5A 2B0CA 1X40A 5H2FU 4UB5A 5AIBA 4IS7A 3NUQA 5KG1A 2F77X 1XS9D 1Q3VA 1YT3A 1SKSA 3WU2U 4ECQA 4F2SA 1L5UA 4RUAA 4EX7A 2YB1A 2AJQA 2XI9A 3RH5A 1NZBA 1MQ3A 3RH6A 1L8LA 2LYHA 4DQRA 4KMUA 5CHGA 5AK3A 2R18A 4ED6A 4ED1A 2BKEA 2HHUA 3G6YA 2ZJ5A 5BPCA 3GV7B 5AKKA 2MSNA 3OHBA 4FS1A 3SAFA 1Z00B 4F5RA 1AQ6A 5KFBA 1CEZA 3M1YA 4KTQA 5KFMA 3M8RA 1DGJA 3UMCA 1QQ5A 1D8LA 2KIVA 2G08A 1N2XA 3NVWA 4EZ9A 2RLTA 4K4HA 3MDCA 3RAQA 3GIIA 4CE6A 2KHQA 3FAHA 1ZQAA 3V7LA 4B6JA 4P0PB 4ED2A 3B9JA 1URJA 1ZQOA 4OJPA 4O3NA 4RT3A 3OJUA 1NK9A 5KFZA 1KSPA 4I2FA 8ICUA 1ECWA 2C2RA 1UHUA 2G06A 2ASDA 1JRPA 2HOQA 4F4WA 2R8IA 3QEBZ 5EE0A 3EPIA 2BQUA 3RB0A 5DB9A 3VCBA 2PFPA 9ICUA 2VJ5A 4EZ6A 5DG8A 3MGVA 2W8LA 2KE7A 3MFHA 2XO7A 4B9NA 1XO0A 5J2JA 2I9GA 4Q8FA 5IINA 5J8YC 4KLFA 3AMZA 1Z3EB 4PZOA 1WUDA 2NRVA 2E8OA 4ECYA 4IL6U 8ICYA 1DOQA 4F92B 2BQ3A 4P4PA 4UAZA 4Y2QA 4JWNA 2JH1A 2B6GA 4FFDA 2KNJA 2LBOA 4UATA 2A3VA 2JXJA 3O0FA 4RQ8A 3ZDCA 4YN4A 1NZPA 4IR1A 4PJ0U 5AI5A 4F91B 1F0MA 4QNLA 2ZIVB 3JPNA 4X5VA 5KFVA 3C5GA 2KZZA 3PX6A 4J9PA 3DDHA 3HWTA 5AKIA 2ZIVA 3BJYA 2FMPA 1YZ6A 1JXEA 5KL1B 5F9LA 2OCEA 3RJFA 1SV0C 5AKLA 4DFDA 5KFTA 5HMMA 3PW0A 1T3QA 2K4HA 4IRKA 2WF9A 4CF5A 4UARA 1B43A 3QYPA 4M0AA 2E1FA 4QZDA 3PR5B 2WF8A 1BPDA 4QZBA 2A19A 4OCZA 1IIPA 2W04A 4DS4A 3BQ7A 1BPZA 2OWOA 4IQUA 2PI5A 4UB2A 4QZ9A 4IC9A 1MQ2A 3JPSA 1ZQRA 4OJLA 1SZHA 2ZIUA 4DLGA 1IM4A 2F76X 2Y0SF 5BOLA 1BPXA 1ZQNA 3RR7A 5AKJA 3UM9A 2PMZC 4DF8A 1VJ5A 4C8KA 2A1JA 1FEZA 4GC6A 3PW4A 5ALFA 4BX9C 4B9TA 2JZBB 2PFNA 1ED1A 1ZQUA 4CRXA 1C7YA 3ETRA 4ICAA 2ESEA 1PZNA 2ASLA 5KFGA 5L1MA 2JZBA 4BGDA 3D6JA 2C28A 5AI0A 4QWAA 5K4LA 3RB4A 2P35A 4O3SA 2E5SA 4F5OA 4G3IA 4Q45A 1ZOLA 2DKZA 4F71A 1O03A 3F2BA 3SI8A 7ICLA 4YR3A 9ICTA 1V38A 1DXSA 2K4EA 3LDAA 5J0QA 3KBBA 3TAQA 2BCQA 3SR6A 2KKPA 1L6NA 1N5WA 3C23A 5KFSA 4C4TA 3RRGA 3H0LB 3TANA 2ODGA 5AKYA 5KG5A 1KN5A 1CI4A 4QZIA 4IRDA 2O6KA 1S0VA 4J9NA 4O3PA 1NK8A 3UQ0A 2GH1A 3UMGA 4C7ZA 4MEYA 4FO6A 4EX6A 2KK0A 1NK0A 3LWMA 4PL2A 3I76A 3A0BU 1L8OA 2WFAA 5IIMA 3IDWA 4DOAA 2ZTEA 4ECUA 1J2NA 1Z1BA 2BCVA 1KBUA 1RPLA 2KG5A 2BGWA 4EELA 4DSLA 1ZQVA 3I1YA 3F5AA 2KZMA 5CEHA 4Y2XA 5KT7A 4OJ5A 4K4GA 2NRWA 1ZETA 2IMWP 2KSOA 1C20A 2DKXA 2Q0ZX 4QIWF 2H3FA 4JMUA 2JHDA 5ALEA 4I2GA 2XICA 1Z4NA 5AM0A 3QUTA 1KEJA 3HKZF 4F5PA 3FYHA 3MGIA 3FDSA 4MFAA 4O3MA 3SAGA 9ICOA 5IILA 2GLEA 1D8YA 4RUCA 2HSZA 3D2NA 4J03A 2W7OA 3WK7A 1ZQLA 4JB3A 4R65A 4US9A 2FPLA 1BPYA 1ZQYA 3ZDEA 4E0DA 3QU9A 5KFRA 1T3NA 2DFLA 2MAXA 3WK8A 5DGAA 2MRLA 2E1EA 4PHAA 5IIIA 1RM6C 1ZQJA 3BS5A 3IG5A 4GC7A 1ZD4A 1BNOA 1RG6A 4I29A 5G5HA 4Y2SA 4ED8A 2LM4A 9ICVA 4Q44A 3KFUF 1BPBA 5J0XA 4DSIA 4DOBA 4K4IA 3ISBA 4YXJA 4C0ZA 1UA1A 1QSYA 1WG8A 3M6ZA 4YCXA 5L1JA 4M9LA 1J2MA 2HBKA 4OJ6A 4EENA 9ICIA 4HAIA 5JU5A 1Y88A 4F5NA 4DQSA 1XNSA 2MA1A 3FM9A 1TV9A 4C8NA 1XU4A 1BVSA 2R8HA 5DBCA 3WKCA 4NY8A 3C1ZA 5KFHA 2D3DA 3U26A 5KT6A 2R8KA 3T79A 4KX5A 2AQ0A 9ICHA 1QH9A 1UT5A 7ICEA 4DL2A 4ECRA 5KG2A 2HI0A 4UB4A 2VANA 3SYZA 3V6KA 5KT5A 5DB6A 1SKRA 4TUQA 3RF9A 3AUOA 3F53A 1N56A 2RQ5A 5D46A 4A8EA 4M47A 1ZQQA 5AKXA 1ZRMA 1X2IA 4CF3A 2W55A 4NJ8A 1KFTA 1SXEA 5KL8B 4TURA 2HBJA 3M9NB 4R66A 3QUBA 1ZQPA 3PW5A 5AM2A 5HR7A 4I2JA 4DL3A 3HW8A 1U49A 4KLJA 1PK1A 2BPFA 1KLNA 2KKVA 4RT2A 5J0SA 1PVRA 4P0QA 5B66U 2LI6A 1XSPA 3ETLA 3QX7A 2EQYA 3E58A 2CXYA 3T5JA 1U45A 5ALTA 4Y2PA 7ICOA 2BQRA 3MABA 4WJ3B 4IQTA 3AL0B 5BOMA 2KTQA 2XCPA 2I1QA 4C8LA 8ICLA 5KT2A 2FI1A 4I2HA 8ICTA 4MFFA 5KAIU 1S76D 5DQHA 4IR9A 4PGQA 1L3TA 1S5LU 5KFLA 4ECSA 1L7NA 4O5EA 1RXWA 3UPQA 1BPEA 4BWMA 1WWUA 2NV3A 2QARA 4PH5A 4F4YA 2EAMA 5KFWA 2KMDA 3FC4A 4DL6A 2K60A 2YX8A 5AKHA 5DDMA 1NK4A 5J29A 5DGBA 8ICKA 7ICIA 4CF4A 1M6YA 3KHHA 3OSNA 9ICKA 4UQGA 5CR0A 4QW9A 2M9NA 5J0RA 4B9MA 3RJEA 4M2YA 5IIOA 4ELTA 5CWRA 5L9XA 2Y0SC 3RB6A 3H8MA 3T3FA 1UA0A 5J0UA 1XWLA 2P66A 2NRTA 1B0XA 2C2DA 2YB4A 4XRHA 1KTQA 4O5KA 2IHMA 4UBCA 1ZQGA 4NL9A 5J2FA 2R8GA 1JMSA 2JGAA 1Z1VA 5AIAA 5KFJA 5F9NA 4KLDA 4F72A 1KKXA 4NV0A 3K1ZA 2XY6A 2QLTA 2RDJA 4ECXA 4RNMA 4ELVA 2HHWA 4J9LA 3PMNA 5ALQA 3PW7A 4KLOA 3RTVA 5TZVA 2KEYA 3QUCA 3QE9Y 8ICGA 4YD1A 2KVCA 4Y2RA 1NKBA 2JR5A 2YMQA 2VA8A 1UT8A 4QZGA 3PX4A 3RAXA 4M9NA 2F1JA 3H0RB 4JK1A 1Z00A 5L1KA 3IRUA 3KKAC 3KOOA 3GU3A 2IOHA 3N7SC 2F3NA 1KDHA 3HJEA 2ZJ8A 4YXMA 2G09A 1WYGA 1HUZA 3BQTA 4FZLA 3MGHA 3NGDA 4P0PA 2ISPA 3QUQA 1Q3UA 3BQ0A 7ICKA 1KL9A 1X9SA 5J2GA 2DGZA 1LVHA 4UB6U 4DL5A 2F8KA 4F4KA 2WHEA 3MR5A 4Y2YA 3V6HA 1ZQBA 5KTQA 2K4PA 4NLCA 4C80A 1NK7A 1L3SA 3EYZA 2JEJA 5J2KA 2OEHA 2WF6A 2W54A 2FMQA 4J9OA 3PSFA 5JUMA 4EBEA 2FLLA 4QIWC 3M7DA 1N48A 2KJ5A 2K8AA 2KICA 4USAA 2QB0B 5J2AA 3HKZC 5HHIA 4KLGA 1D8BA 4AP9A 5D4BA 2JH7A 2FLPA 2LPEA 4JV2A 4NLBA 4QZFA 1LB2B 2GOLA 3CW2C 1QLNA 2B21A 2V9WA 9ICFA 3H0MB 1BGXT 4MF8A 2AGQA 1ZQCA 2HBMA 1PVPA 3KZIU 3C2MA 1JIHA 5CJ7A 3EW9A 1JXLA 2DBYA 2BCRA 5KFFA 8ICAA 2D6FC 1OXJA 1ZQMA 1ZQEA 4Y2VA 2W7PA 5KFEA 3T5KA 5F3XB 5AKGA 5J2EA 5HNKA 3GIKA 3V6JA 2BCUA 4IRCA 2FPMA 3GQCA 2IA6A 4UAVA 1KRPA 2J6UA 3Q8RB 3HPOA 2JEFA 4DLEA 1OW5A 2YN4A 4RQ6A 3RJJA 5HMLA 3H8JA 4UB3A 2FPKA 5KFCA 3DV9A 1TAUA 1K5OA 3PSTA 4KLTA 2LHTA 2HCFA 4BUGA 2KZ3A 1X42A 5AM4A 4NLGA 1X66A 2H3ZA 1VLBA 4RQ4A 2OXOA 3H8SA 2NO4A 3LK9A 4ECWA 1IV8A 1QTMA 7ICJA 1ZQWA 1QCKA 4C4SA 1RYRA 2G5HB 3N28A 2XGPA 2FJ6A 4RPYA 4NLZA 4FBTA 4YQWA 1TVAA 1NK6A 1NOMA 4CNQA 1HEKA 2W3RA 4DF4A 4XUSA 3IP4B 1X9XA 9ICSA 3NRWA 4PHEA 5J0OA 1ZJNA 5DG9A 3MBYA 4UB1A 4LZDA 2HBLA 3A0HU 1X9WA 2WF7A 5ALJA 4J9SA 1TAMA 2D8CA 4R64A 5J0YA 4B9LA 4YR0A 5DB7A 2HVIA 2CN1A 5J0TA 2GO7A 1MSWD 5KG0A 4R8UB 3M9MB 4IQVA 1X9MA 4FZMA 4ZOHC 2ES6A 4M04A 4QWCA 1SKWA 3RH4A 4TUSA 5FP0A 2KIWA 2YQEA 2IOFK 5CRXA 2ISOA 1D9DA 1RYSA 1Q46A 4YMOA 5KFYA 1ZQDA 2F8LA 1GO3F 3KD3A 5AM3A 3WKEA 4RQ7A 2ZTCA 4M6WB 2PKEA 4PHDA 2DL0A 1Z4OA 5J2IA 1JI7A 4LZGA 1L7PA 4DS5A 3MR2A 1U47A 2BZFA 1N61A 1XO1A 2L5YA 4ED7A 4ED0A 4KLHA 2HHSA 1AROP 3OGUA 5J0PA 9ICRA 2Q4TA 2KOBA 3SEIA 4RQ3A 3PV8A 2HHXA 4DFMA 3PMLA 2HVHA 4YMMA 8ICRA 4YFKA 2XIDA 1KFSA 2ZIXB 2FE9A 4UAYA 1SV0A 2W03A 3L5KA 9ICPA 2ZIXA 3R9KA 1UQVA 8ICFA 2Z7JA 4GXJA 3GFKB 3LVVA 2H5XA 4JV0A 2DUYA 1JROA 2AQ4A 5KG7A 5KNIA 3GIMA 3UMBA 1TK5A 1LKYB 4P4OA 2OYYA 3MFIA 3T5HA 4QW8A 5ALHA 9ICBA 5J2HA 4C8MA 1T94A 3Q8MA 4Q43A 5KFQA 2ZUDA 4RNNA 2K8CB 1B4FA 1ZQKA 3IV6A 4YP3A 3E0FA 4F93B 2MUTB 5KFIA 3SD7A 3KHGA 2H3VA 5KFUA 1SXDA 2OM6A 2ALZA 4BXOB 2MUTA 4KLIA 2G07A 1KW4A 3QNMA 1WCNA 4BXOA 4EEKA 4DOCA 2ZJAA 1TFRA 3RFAA 3C29A 3TQ1A 5E79U 7ICMA 4MF2A 1TK0A 4P2HA 4U6PA 4Z6DA 3CNHA 3M6KA 1O08A 2XGQA 5AK4A 4OJOA 4AYBF 8ICHA 1CUKA 4EYIB 3G6XA 3ZD8A 3HX0A 4MEXA 2UVUA 2UVRA 3PNCA 8ICZA 2E8PA 3AU2A 5KFXA 3UXNA 2FMSA 3NASA 5CP2A 2LMRA 1WWVA 4YMNA 4NWIA 4DFJA 4UB8U 1H38A 1HJPA 2ZUBA 4C4RA 3SENA 1DRGA 3UXPA 2K8BB 4J9QA 1Z19A 1SZPA 5JRTA 7ICGA 4PPXA 1WCLA 4M9GA 1A6SA 5KT4A 2W9BB 5IIKA 4FE3A 2AU0A 3BZCA 4NL9C 3OJSA 3IM1A 1JN3A 4F4XA 1SWVA 4KN4A 4GXIA 4KLEA 2XCAA 1ZQFA 3N97B 1A77A 2GWSA 5EOZA 5AK5A 3DEEA 1FIQA 3NS1A 2AH5A 3ZDDA 8ICCA 3OPXA 8ICVA 2IOFA 3OHAA 2VJ4A 4RQ5A 5J0WA 4J9MA 3THVA 2W9CB 1MC8A 3GDXA 2AGPA 3EWAA 3ZDBA 1ZQXA 1XSNA 2PXIA 2PFQA 7ICRA 4RQ1A 3F5EA 2W9CA 3ZDAA 1PUZA 5DBBA 5ALGA 4BJQA 5C0YA 2NRZA 3TARA 3MR3A 1S0NA 4I28A 2ZIWB 2EZXA 2UVVA 4DWIA 1RQNA 3BDPA 1V85A 2ZTDA 3GZFA 7ICPA 2ZIWA 1A0PA 2KV2A 4DSFA 2F2AB 3AM9A 2E8MA 4CCHA 3G6VA 3EPGA 3NVYA 4P4MA 3NRZA 4UAWA 3ALRA 2BCSA 1S0OA 1D9FA 5KFNA 1P7DA 7ICFA 5EE1A 4Y2TA 4DSEA 2NYVA 3NTUA 5DB8A 4GXKA 3RJKA 5ALUA 3PY8A 2V4QA 2VA3A 5ALXA 1L3UA 4YVZA 1ZD5A 4QJFB 1T4GA 3RJGA 2JEIA 5GTIU 4O9MA 5DKWA 3ISCA 5HP4A 4PL1A 4DL4A 3SV4A 2ZXIA 4RQMA 1ZQTA 2KHVA 2E3TA 4NM1A 1HUOA 1L7OA 2WB1F 4B9VA 1KQQA 1SGGA 2J6SA 4MFCA 5G5GA 9ICNA 4O3QA 5AI6A 5AHXA 1X6IA 2HOFA 3EZ5A 7ICVA 4B9UA 2RP5A 3TFRA 5B5EU 3Q8SB 4GFJA 1IG6A 2LKYA 5J2BA 3TI0A 2LYAA 5AKEA 3KHLA 3Q8QB 4I2DA 2C22A 2YMLA 1A76A 3SV3A 2W11A 3OSPA 2HHVA 1S9FA 9ICMA 3H8WA 4FS2A 2FDRA 1ZQHA 3TAPA 2PI4A 8ICMA 4JWMA 3TADA 4TQSA 3WKAA 1COOA 2W8KA 2E8NA 1UPHA 5EE9A 1FFUA 5KG6A 2AHOB 2OH2A 5EE3A 3UXOA 5KFPA 3QZ8A 5CA7A 9ICXA 1JX4A 1TKDA 9ICLA 3H40A 4CGZA 4Z6CA 3PR4A 5ALMA 4PZNA 2BDUA 5KAFU 7ICTA 9ICGA 3ICXA 1NI3A 3PSIA 2QKQA 8ICSA 1IXRA 4UBBA 2BHNA 3SZ2A 3M9OB 4KMOB 2C2EA 2RDIA 1VDVA 4XA5A 2EAOA 1ZQ1C 4RPXA 3C2LA 1F5SA 3B0YA 2XC9A 3SQIA 1DGSA 3RR8A 3TACB 3PW2A 4QWEA 5AICA 7ICNA 5HHHA 3IG8A 3K75D 5DLFA 8ICJA 2HMXA 1K1QA 2AXTU 4Y2UA 4US8A 2QB0A 2LYBA 3KZXA 4C8OA 3I28A 8ICBA 5ALSA 3N4MB 5ALRA 4YR2A 5KFAA 3JPOA 3F2CA 4QZAA 3N7RC 5ALVA 1TAQA 4O3OA 4EBCA 3WKBA 8ICQA 1BNPA 3KTQA 4DCCA 3PO4A 5KFOA 1RZTA 1B22A 2EAPA 3UQ2A 2EZYA 5DG7A 4ECVA 2CRXA 4DQPA 1N5XA 4I2EA 4IQWA 5L1LA 8ICNA 5ALIA 2BPCA 2F1HA 4JV1A 2ZXHA 3RRHA 8ICEA 8ICPA 5DBAA 2HHTA 1L3VA 3C2KA 4F5QA 5ALZA 2H3QA 3C21A 2Y1JA 3CP8A 4C7YA 2NRXA 4MHVA 3AQEA 4QWDA 3CYMA 4ACOA 3ONNA 2BDPA 5JTIA 2OHFA 1LV5A 1T8EA 2NO5A 4BWJA 1J97A 3RJIA 4TQRA 1OUQA 4DO9A 4O5CA 5AM5A 2EH9A 2IHNA 2UVWA 3LYSA 4AYBC 7ICSA 1UCVA 2DWQA 3V7JA 4LVSA 1NKCA 1RXVA 2KJ8A 5IIJA 5TISU 2WAQF 4CDGA 4RQ0A 1SL1A 3JPRA 1S0MA 3EUB2 1N62A 2HW3A 3SMVA 5KT3A 2CPRA 4OD0A 1PVQA 4QZEA 2KP7A 3AQFA 5ALDA 3TKAA 3JPQA 2W3SA 5ALLA 3KKAA 4YD2A 2IBKA 1TK8A 3QU5A 1YZ7A 2M0NA 2XVTA 2VKQA 4Y2JA 2ZIUB 4GIBA 4RNOA 2DF4B 3QXGA 5AM1A 2ZG6A 5ALNA 4DQIA 1SIJA 4B9SA 5AKZA 2A1JB 4TUPA 1NJXA 3NVVA 5T14A 3F2DA 2YY6A 1COKA 1NJZA 5AI9A 4KLMA 8ICOA 2DPJA 3RBEA 3C5FA 3AN1A 3D2QA 7ICUA 4KLQA 2VIXA 2K89A 2KN7A 3WK5A 4I2CA 4YG2A 1XSLA 1K1SA 3OTQA 4ECZA 1ZJMA 1QSSA 3GILA 4LJXA 4F2RA 1PK3A 3V7KA 3IN5A 3KHRA 3ZD9A 4EBDA 5J8YA 4R8UA 2JEGA 3JPTA 3BS7A 1U48A 4RPZA 5C5JA 5CB1A 4KLSA 4I2AA 3BQ1A 4DL7A 3QEAZ 1S10A 3ORYA 9ICJA 2Y1IA 2Y9TA 1N60A 4UAUA 4RQ2A 1S97A 1L7MA 2I6XA 4NLKA 4I2IA 4KX3A 2EANA 2MU2A 2ZUCA 1FO4A 3WKDA 4M6WA 3GIJA 3K4GA 4QZCA 2KD1A 3MDAA 1QQ6A 5KFKA 5EWEA 2ATLA 1RYUA 1FFVA 5EWFA 4HYKA 3K1RB 9ICQA 2G5IB 3LVWA 4KN7A 4R63A 4Q8EA 3ISDA 1CRXA 3QU4A 3MC1A 2KVSA 7ICHA 3BQ2A
chains in the Genus database with same CATH topology
1SV0C 1SGGA 2D8CA 3TACB 1B4FA 3HILA 2QB1A 2QARB 1SV4A 2KSOB 1SXDA 1COKA 2QB0A 2YTUA 1OXJA 5JU5A 3KKAC 1KW4A 2ES6A 3BQ7A 5F3XB 1LKYA 3IDWA 2F3NA 2D3DA 2KG5A 2KE7A 2EAPA 1OW5A 1WWUA 1V85A 1PK3A 2QARA 2EAMA 2DL0A 2KMDA 2K60A 5J8YA 5J8YC 2E8PA 2F44A 1JI7A 2KSOA 4PZOA 3TADA 2E8MA 3TADC 2DKXA 2E8OA 2LMRA 1WWVA 1X40A 3BS7A 2F8KA 2E8NA 2ESEA 4IS7A 1X66A 4MHVA 5L1MA 3BS5B 2L5YA 1PK1B 3SENA 3SEIA 5JTIA 2GLEA 2K4PA 2Y9TA 5JRTA 3H8MA 2B6GA 4PZNA 2FE9A 1UCVA 2DKZA 2EANA 1B0XA 1SV0A 2QKQA 4NJ8A 1SXEA 1UQVA 4NL9C 4NL9A 1V38A 1DXSA 1Z1VA 1F0MA 2QB0B 1X9XA 3K1RB 3BS5A 2EAOA 2JV3A 2Y9UA 2LPEA 5KNIA 1LKYB 1PK1A 2KIVA 3KKAA 4RQNA 4RQMA 1RG6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SV0 C;  1SGG A;  2D8C A;  3TAC B;  1B4F A;  3HIL A;  2QB1 A;  2QAR B;  1SV4 A;  2KSO B;  1SXD A;  1COK A;  2QB0 A;  2YTU A;  1OXJ A;  5JU5 A;  3KKA C;  1KW4 A;  2ES6 A;  3BQ7 A;  5F3X B;  1LKY A;  3IDW A;  2F3N A;  2D3D A;  2KG5 A;  2KE7 A;  2EAP A;  1OW5 A;  1WWU A;  1V85 A;  1PK3 A;  2QAR A;  2EAM A;  2DL0 A;  2KMD A;  2K60 A;  5J8Y A;  5J8Y C;  2E8P A;  2F44 A;  1JI7 A;  2KSO A;  4PZO A;  3TAD A;  2E8M A;  3TAD C;  2DKX A;  2E8O A;  2LMR A;  1WWV A;  1X40 A;  3BS7 A;  2F8K A;  2E8N A;  2ESE A;  4IS7 A;  1X66 A;  4MHV A;  5L1M A;  3BS5 B;  2L5Y A;  1PK1 B;  3SEN A;  3SEI A;  5JTI A;  2GLE A;  2K4P A;  2Y9T A;  5JRT A;  3H8M A;  2B6G A;  4PZN A;  2FE9 A;  1UCV A;  2DKZ A;  2EAN A;  1B0X A;  1SV0 A;  2QKQ A;  4NJ8 A;  1SXE A;  1UQV A;  4NL9 C;  4NL9 A;  1V38 A;  1DXS A;  1Z1V A;  1F0M A;  2QB0 B;  1X9X A;  3K1R B;  3BS5 A;  2EAO A;  2JV3 A;  2Y9U A;  2LPE A;  5KNI A;  1LKY B;  1PK1 A;  2KIV A;  3KKA A;  4RQN A;  4RQM A;  1RG6 A; 
#chains in the Genus database with same CATH topology
 3MR6 A;  3AU6 A;  2W43 A;  5ALK A;  2AGO A;  5D49 A;  2QB1 A;  4M9H A;  1HIW A;  5ALO A;  8ICX A;  1SV4 A;  3PVX A;  2KSO B;  1JAL A;  2V4R A;  2YTU A;  3LWL A;  4XQ8 A;  2F1I A;  3WK6 A;  4I27 A;  7ICQ A;  4JUZ A;  2WB1 C;  3ED5 A;  3NVZ A;  4U7C A;  4ELU A;  1LKY A;  1MA7 A;  1RDF A;  1TE2 A;  1NJW A;  1T7P A;  1U4B A;  4QWB A;  4F4Z A;  4GLX A;  3PZP A;  3V72 A;  5AI8 A;  5ALY A;  4FBU A;  2G0A A;  5GTH U;  4FZN A;  1SWW A;  3HT3 A;  3RJH A;  2HDO A;  3BS5 B;  8ICI A;  1DK2 A;  1SL0 A;  2P6R A;  3ZI4 A;  2KFN A;  3SAH A;  2RRD A;  4UW9 A;  3HRD D;  1ZQS A;  5A0L A;  5KG4 A;  5KG3 A;  4RU9 A;  3HP6 A;  1SL2 A;  3JPP A;  3PSP A;  2XY7 A;  1F44 A;  2Y9U A;  4DFK A;  1V9P A;  1XC9 A;  4EEY A;  4RQN A;  2FLN A;  4EYH B;  4OO1 J;  3QU2 A;  1JUD A;  5AK6 A;  3WK4 A;  4J9R A;  3Q8L A;  1NKE A;  5J2C A;  2W9A A;  3D2S A;  4NXZ A;  3QU7 A;  1QQ7 A;  2VA2 A;  4F3O A;  3HIL A;  3IHQ B;  1X6J A;  2W9B A;  4Z6E A;  1S77 D;  4PHP A;  5AI4 A;  9ICC A;  3WK9 A;  4PGX A;  4QZ8 A;  2PMZ F;  3T5L A;  3CRX A;  3L3F X;  9ICE A;  3BZK A;  9ICA A;  2DQN B;  2JMG A;  3M8S A;  3Q8P B;  1SB3 C;  3H7I A;  9ICW A;  3TFS A;  2RHF A;  2BPG A;  1DK3 A;  4DSJ A;  5KFD A;  3GV8 B;  5J2D A;  4M9J A;  3H4B A;  3B0X A;  2KFZ A;  4KLL A;  4O0I A;  2ASJ A;  2H3I A;  2F44 A;  3TAD C;  2YMP A;  3AEV A;  2KJ9 A;  5DQG A;  4NM2 A;  4ECT A;  4KIT B;  4Z6F A;  2N1R A;  2WF5 A;  4G9B A;  4F50 A;  2K4I A;  1PK1 B;  1ZQI A;  5HR6 A;  1Q8K A;  2HHQ A;  5L1I A;  1RQL A;  1ZYQ A;  4P0Q B;  2WTF A;  1N63 A;  1NNL A;  1ZXI A;  5DLG A;  4DEZ A;  3J81 j;  4DSK A;  2R8J A;  1ZRN A;  1EXN A;  1S8O A;  1MN8 A;  4I2B A;  1U9L A;  2XY5 A;  4KLU A;  2EDU A;  4O3R A;  4PGY A;  4RZR A;  2J6T A;  2W9M A;  3GV5 B;  2JV3 A;  3N7P D;  1NJY A;  3L4P A;  5EWG A;  2WAQ C;  4DQQ A;  2PFO A;  1KFD A;  2QAR B;  2HOI A;  2BR0 A;  3E2E A;  5DDY A;  5DQI A;  3Q8K A;  4ED3 A;  2JRZ A;  5ALW A;  2YMM A;  4QZH A;  1QSL A;  4DFP A;  3VC8 A;  4BDP A;  3C28 A;  3QZ7 A;  8ICW A;  1ZQZ A;  2EZZ A;  3C1Y A;  1ZD3 A;  4F8R A;  2P6U A;  3PO5 A;  2I5H A;  3RB3 A;  3S6J A;  1ZD2 P;  1V97 A;  3PX0 A;  3RBD A;  2DPI A;  2LM1 A;  2A1A A;  4J9K A;  4ZH4 A;  4NLN A;  3H4D A;  5ALP A;  4UAS A;  1NK5 A;  2B0C A;  1X40 A;  5H2F U;  4UB5 A;  5AIB A;  4IS7 A;  3NUQ A;  5KG1 A;  2F77 X;  1XS9 D;  1Q3V A;  1YT3 A;  1SKS A;  3WU2 U;  4ECQ A;  4F2S A;  1L5U A;  4RUA A;  4EX7 A;  2YB1 A;  2AJQ A;  2XI9 A;  3RH5 A;  1NZB A;  1MQ3 A;  3RH6 A;  1L8L A;  2LYH A;  4DQR A;  4KMU A;  5CHG A;  5AK3 A;  2R18 A;  4ED6 A;  4ED1 A;  2BKE A;  2HHU A;  3G6Y A;  2ZJ5 A;  5BPC A;  3GV7 B;  5AKK A;  2MSN A;  3OHB A;  4FS1 A;  3SAF A;  1Z00 B;  4F5R A;  1AQ6 A;  5KFB A;  1CEZ A;  3M1Y A;  4KTQ A;  5KFM A;  3M8R A;  1DGJ A;  3UMC A;  1QQ5 A;  1D8L A;  2KIV A;  2G08 A;  1N2X A;  3NVW A;  4EZ9 A;  2RLT A;  4K4H A;  3MDC A;  3RAQ A;  3GII A;  4CE6 A;  2KHQ A;  3FAH A;  1ZQA A;  3V7L A;  4B6J A;  4P0P B;  4ED2 A;  3B9J A;  1URJ A;  1ZQO A;  4OJP A;  4O3N A;  4RT3 A;  3OJU A;  1NK9 A;  5KFZ A;  1KSP A;  4I2F A;  8ICU A;  1ECW A;  2C2R A;  1UHU A;  2G06 A;  2ASD A;  1JRP A;  2HOQ A;  4F4W A;  2R8I A;  3QEB Z;  5EE0 A;  3EPI A;  2BQU A;  3RB0 A;  5DB9 A;  3VCB A;  2PFP A;  9ICU A;  2VJ5 A;  4EZ6 A;  5DG8 A;  3MGV A;  2W8L A;  2KE7 A;  3MFH A;  2XO7 A;  4B9N A;  1XO0 A;  5J2J A;  2I9G A;  4Q8F A;  5IIN A;  5J8Y C;  4KLF A;  3AMZ A;  1Z3E B;  4PZO A;  1WUD A;  2NRV A;  2E8O A;  4ECY A;  4IL6 U;  8ICY A;  1DOQ A;  4F92 B;  2BQ3 A;  4P4P A;  4UAZ A;  4Y2Q A;  4JWN A;  2JH1 A;  2B6G A;  4FFD A;  2KNJ A;  2LBO A;  4UAT A;  2A3V A;  2JXJ A;  3O0F A;  4RQ8 A;  3ZDC A;  4YN4 A;  1NZP A;  4IR1 A;  4PJ0 U;  5AI5 A;  4F91 B;  1F0M A;  4QNL A;  2ZIV B;  3JPN A;  4X5V A;  5KFV A;  3C5G A;  2KZZ A;  3PX6 A;  4J9P A;  3DDH A;  3HWT A;  5AKI A;  2ZIV A;  3BJY A;  2FMP A;  1YZ6 A;  1JXE A;  5KL1 B;  5F9L A;  2OCE A;  3RJF A;  1SV0 C;  5AKL A;  4DFD A;  5KFT A;  5HMM A;  3PW0 A;  1T3Q A;  2K4H A;  4IRK A;  2WF9 A;  4CF5 A;  4UAR A;  1B43 A;  3QYP A;  4M0A A;  2E1F A;  4QZD A;  3PR5 B;  2WF8 A;  1BPD A;  4QZB A;  2A19 A;  4OCZ A;  1IIP A;  2W04 A;  4DS4 A;  3BQ7 A;  1BPZ A;  2OWO A;  4IQU A;  2PI5 A;  4UB2 A;  4QZ9 A;  4IC9 A;  1MQ2 A;  3JPS A;  1ZQR A;  4OJL A;  1SZH A;  2ZIU A;  4DLG A;  1IM4 A;  2F76 X;  2Y0S F;  5BOL A;  1BPX A;  1ZQN A;  3RR7 A;  5AKJ A;  3UM9 A;  2PMZ C;  4DF8 A;  1VJ5 A;  4C8K A;  2A1J A;  1FEZ A;  4GC6 A;  3PW4 A;  5ALF A;  4BX9 C;  4B9T A;  2JZB B;  2PFN A;  1ED1 A;  1ZQU A;  4CRX A;  1C7Y A;  3ETR A;  4ICA A;  2ESE A;  1PZN A;  2ASL A;  5KFG A;  5L1M A;  2JZB A;  4BGD A;  3D6J A;  2C28 A;  5AI0 A;  4QWA A;  5K4L A;  3RB4 A;  2P35 A;  4O3S A;  2E5S A;  4F5O A;  4G3I A;  4Q45 A;  1ZOL A;  2DKZ A;  4F71 A;  1O03 A;  3F2B A;  3SI8 A;  7ICL A;  4YR3 A;  9ICT A;  1V38 A;  1DXS A;  2K4E A;  3LDA A;  5J0Q A;  3KBB A;  3TAQ A;  2BCQ A;  3SR6 A;  2KKP A;  1L6N A;  1N5W A;  3C23 A;  5KFS A;  4C4T A;  3RRG A;  3H0L B;  3TAN A;  2ODG A;  5AKY A;  5KG5 A;  1KN5 A;  1CI4 A;  4QZI A;  4IRD A;  2O6K A;  1S0V A;  4J9N A;  4O3P A;  1NK8 A;  3UQ0 A;  2GH1 A;  3UMG A;  4C7Z A;  4MEY A;  4FO6 A;  4EX6 A;  2KK0 A;  1NK0 A;  3LWM A;  4PL2 A;  3I76 A;  3A0B U;  1L8O A;  2WFA A;  5IIM A;  3IDW A;  4DOA A;  2ZTE A;  4ECU A;  1J2N A;  1Z1B A;  2BCV A;  1KBU A;  1RPL A;  2KG5 A;  2BGW A;  4EEL A;  4DSL A;  1ZQV A;  3I1Y A;  3F5A A;  2KZM A;  5CEH A;  4Y2X A;  5KT7 A;  4OJ5 A;  4K4G A;  2NRW A;  1ZET A;  2IMW P;  2KSO A;  1C20 A;  2DKX A;  2Q0Z X;  4QIW F;  2H3F A;  4JMU A;  2JHD A;  5ALE A;  4I2G A;  2XIC A;  1Z4N A;  5AM0 A;  3QUT A;  1KEJ A;  3HKZ F;  4F5P A;  3FYH A;  3MGI A;  3FDS A;  4MFA A;  4O3M A;  3SAG A;  9ICO A;  5IIL A;  2GLE A;  1D8Y A;  4RUC A;  2HSZ A;  3D2N A;  4J03 A;  2W7O A;  3WK7 A;  1ZQL A;  4JB3 A;  4R65 A;  4US9 A;  2FPL A;  1BPY A;  1ZQY A;  3ZDE A;  4E0D A;  3QU9 A;  5KFR A;  1T3N A;  2DFL A;  2MAX A;  3WK8 A;  5DGA A;  2MRL A;  2E1E A;  4PHA A;  5III A;  1RM6 C;  1ZQJ A;  3BS5 A;  3IG5 A;  4GC7 A;  1ZD4 A;  1BNO A;  1RG6 A;  4I29 A;  5G5H A;  4Y2S A;  4ED8 A;  2LM4 A;  9ICV A;  4Q44 A;  3KFU F;  1BPB A;  5J0X A;  4DSI A;  4DOB A;  4K4I A;  3ISB A;  4YXJ A;  4C0Z A;  1UA1 A;  1QSY A;  1WG8 A;  3M6Z A;  4YCX A;  5L1J A;  4M9L A;  1J2M A;  2HBK A;  4OJ6 A;  4EEN A;  9ICI A;  4HAI A;  5JU5 A;  1Y88 A;  4F5N A;  4DQS A;  1XNS A;  2MA1 A;  3FM9 A;  1TV9 A;  4C8N A;  1XU4 A;  1BVS A;  2R8H A;  5DBC A;  3WKC A;  4NY8 A;  3C1Z A;  5KFH A;  2D3D A;  3U26 A;  5KT6 A;  2R8K A;  3T79 A;  4KX5 A;  2AQ0 A;  9ICH A;  1QH9 A;  1UT5 A;  7ICE A;  4DL2 A;  4ECR A;  5KG2 A;  2HI0 A;  4UB4 A;  2VAN A;  3SYZ A;  3V6K A;  5KT5 A;  5DB6 A;  1SKR A;  4TUQ A;  3RF9 A;  3AUO A;  3F53 A;  1N56 A;  2RQ5 A;  5D46 A;  4A8E A;  4M47 A;  1ZQQ A;  5AKX A;  1ZRM A;  1X2I A;  4CF3 A;  2W55 A;  4NJ8 A;  1KFT A;  1SXE A;  5KL8 B;  4TUR A;  2HBJ A;  3M9N B;  4R66 A;  3QUB A;  1ZQP A;  3PW5 A;  5AM2 A;  5HR7 A;  4I2J A;  4DL3 A;  3HW8 A;  1U49 A;  4KLJ A;  1PK1 A;  2BPF A;  1KLN A;  2KKV A;  4RT2 A;  5J0S A;  1PVR A;  4P0Q A;  5B66 U;  2LI6 A;  1XSP A;  3ETL A;  3QX7 A;  2EQY A;  3E58 A;  2CXY A;  3T5J A;  1U45 A;  5ALT A;  4Y2P A;  7ICO A;  2BQR A;  3MAB A;  4WJ3 B;  4IQT A;  3AL0 B;  5BOM A;  2KTQ A;  2XCP A;  2I1Q A;  4C8L A;  8ICL A;  5KT2 A;  2FI1 A;  4I2H A;  8ICT A;  4MFF A;  5KAI U;  1S76 D;  5DQH A;  4IR9 A;  4PGQ A;  1L3T A;  1S5L U;  5KFL A;  4ECS A;  1L7N A;  4O5E A;  1RXW A;  3UPQ A;  1BPE A;  4BWM A;  1WWU A;  2NV3 A;  2QAR A;  4PH5 A;  4F4Y A;  2EAM A;  5KFW A;  2KMD A;  3FC4 A;  4DL6 A;  2K60 A;  2YX8 A;  5AKH A;  5DDM A;  1NK4 A;  5J29 A;  5DGB A;  8ICK A;  7ICI A;  4CF4 A;  1M6Y A;  3KHH A;  3OSN A;  9ICK A;  4UQG A;  5CR0 A;  4QW9 A;  2M9N A;  5J0R A;  4B9M A;  3RJE A;  4M2Y A;  5IIO A;  4ELT A;  5CWR A;  5L9X A;  2Y0S C;  3RB6 A;  3H8M A;  3T3F A;  1UA0 A;  5J0U A;  1XWL A;  2P66 A;  2NRT A;  1B0X A;  2C2D A;  2YB4 A;  4XRH A;  1KTQ A;  4O5K A;  2IHM A;  4UBC A;  1ZQG A;  4NL9 A;  5J2F A;  2R8G A;  1JMS A;  2JGA A;  1Z1V A;  5AIA A;  5KFJ A;  5F9N A;  4KLD A;  4F72 A;  1KKX A;  4NV0 A;  3K1Z A;  2XY6 A;  2QLT A;  2RDJ A;  4ECX A;  4RNM A;  4ELV A;  2HHW A;  4J9L A;  3PMN A;  5ALQ A;  3PW7 A;  4KLO A;  3RTV A;  5TZV A;  2KEY A;  3QUC A;  3QE9 Y;  8ICG A;  4YD1 A;  2KVC A;  4Y2R A;  1NKB A;  2JR5 A;  2YMQ A;  2VA8 A;  1UT8 A;  4QZG A;  3PX4 A;  3RAX A;  4M9N A;  2F1J A;  3H0R B;  4JK1 A;  1Z00 A;  5L1K A;  3IRU A;  3KKA C;  3KOO A;  3GU3 A;  2IOH A;  3N7S C;  2F3N A;  1KDH A;  3HJE A;  2ZJ8 A;  4YXM A;  2G09 A;  1WYG A;  1HUZ A;  3BQT A;  4FZL A;  3MGH A;  3NGD A;  4P0P A;  2ISP A;  3QUQ A;  1Q3U A;  3BQ0 A;  7ICK A;  1KL9 A;  1X9S A;  5J2G A;  2DGZ A;  1LVH A;  4UB6 U;  4DL5 A;  2F8K A;  4F4K A;  2WHE A;  3MR5 A;  4Y2Y A;  3V6H A;  1ZQB A;  5KTQ A;  2K4P A;  4NLC A;  4C80 A;  1NK7 A;  1L3S A;  3EYZ A;  2JEJ A;  5J2K A;  2OEH A;  2WF6 A;  2W54 A;  2FMQ A;  4J9O A;  3PSF A;  5JUM A;  4EBE A;  2FLL A;  4QIW C;  3M7D A;  1N48 A;  2KJ5 A;  2K8A A;  2KIC A;  4USA A;  2QB0 B;  5J2A A;  3HKZ C;  5HHI A;  4KLG A;  1D8B A;  4AP9 A;  5D4B A;  2JH7 A;  2FLP A;  2LPE A;  4JV2 A;  4NLB A;  4QZF A;  1LB2 B;  2GOL A;  3CW2 C;  1QLN A;  2B21 A;  2V9W A;  9ICF A;  3H0M B;  1BGX T;  4MF8 A;  2AGQ A;  1ZQC A;  2HBM A;  1PVP A;  3KZI U;  3C2M A;  1JIH A;  5CJ7 A;  3EW9 A;  1JXL A;  2DBY A;  2BCR A;  5KFF A;  8ICA A;  2D6F C;  1OXJ A;  1ZQM A;  1ZQE A;  4Y2V A;  2W7P A;  5KFE A;  3T5K A;  5F3X B;  5AKG A;  5J2E A;  5HNK A;  3GIK A;  3V6J A;  2BCU A;  4IRC A;  2FPM A;  3GQC A;  2IA6 A;  4UAV A;  1KRP A;  2J6U A;  3Q8R B;  3HPO A;  2JEF A;  4DLE A;  1OW5 A;  2YN4 A;  4RQ6 A;  3RJJ A;  5HML A;  3H8J A;  4UB3 A;  2FPK A;  5KFC A;  3DV9 A;  1TAU A;  1K5O A;  3PST A;  4KLT A;  2LHT A;  2HCF A;  4BUG A;  2KZ3 A;  1X42 A;  5AM4 A;  4NLG A;  1X66 A;  2H3Z A;  1VLB A;  4RQ4 A;  2OXO A;  3H8S A;  2NO4 A;  3LK9 A;  4ECW A;  1IV8 A;  1QTM A;  7ICJ A;  1ZQW A;  1QCK A;  4C4S A;  1RYR A;  2G5H B;  3N28 A;  2XGP A;  2FJ6 A;  4RPY A;  4NLZ A;  4FBT A;  4YQW A;  1TVA A;  1NK6 A;  1NOM A;  4CNQ A;  1HEK A;  2W3R A;  4DF4 A;  4XUS A;  3IP4 B;  1X9X A;  9ICS A;  3NRW A;  4PHE A;  5J0O A;  1ZJN A;  5DG9 A;  3MBY A;  4UB1 A;  4LZD A;  2HBL A;  3A0H U;  1X9W A;  2WF7 A;  5ALJ A;  4J9S A;  1TAM A;  2D8C A;  4R64 A;  5J0Y A;  4B9L A;  4YR0 A;  5DB7 A;  2HVI A;  2CN1 A;  5J0T A;  2GO7 A;  1MSW D;  5KG0 A;  4R8U B;  3M9M B;  4IQV A;  1X9M A;  4FZM A;  4ZOH C;  2ES6 A;  4M04 A;  4QWC A;  1SKW A;  3RH4 A;  4TUS A;  5FP0 A;  2KIW A;  2YQE A;  2IOF K;  5CRX A;  2ISO A;  1D9D A;  1RYS A;  1Q46 A;  4YMO A;  5KFY A;  1ZQD A;  2F8L A;  1GO3 F;  3KD3 A;  5AM3 A;  3WKE A;  4RQ7 A;  2ZTC A;  4M6W B;  2PKE A;  4PHD A;  2DL0 A;  1Z4O A;  5J2I A;  1JI7 A;  4LZG A;  1L7P A;  4DS5 A;  3MR2 A;  1U47 A;  2BZF A;  1N61 A;  1XO1 A;  2L5Y A;  4ED7 A;  4ED0 A;  4KLH A;  2HHS A;  1ARO P;  3OGU A;  5J0P A;  9ICR A;  2Q4T A;  2KOB A;  3SEI A;  4RQ3 A;  3PV8 A;  2HHX A;  4DFM A;  3PML A;  2HVH A;  4YMM A;  8ICR A;  4YFK A;  2XID A;  1KFS A;  2ZIX B;  2FE9 A;  4UAY A;  1SV0 A;  2W03 A;  3L5K A;  9ICP A;  2ZIX A;  3R9K A;  1UQV A;  8ICF A;  2Z7J A;  4GXJ A;  3GFK B;  3LVV A;  2H5X A;  4JV0 A;  2DUY A;  1JRO A;  2AQ4 A;  5KG7 A;  5KNI A;  3GIM A;  3UMB A;  1TK5 A;  1LKY B;  4P4O A;  2OYY A;  3MFI A;  3T5H A;  4QW8 A;  5ALH A;  9ICB A;  5J2H A;  4C8M A;  1T94 A;  3Q8M A;  4Q43 A;  5KFQ A;  2ZUD A;  4RNN A;  2K8C B;  1B4F A;  1ZQK A;  3IV6 A;  4YP3 A;  3E0F A;  4F93 B;  2MUT B;  5KFI A;  3SD7 A;  3KHG A;  2H3V A;  5KFU A;  1SXD A;  2OM6 A;  2ALZ A;  4BXO B;  2MUT A;  4KLI A;  2G07 A;  1KW4 A;  3QNM A;  1WCN A;  4BXO A;  4EEK A;  4DOC A;  2ZJA A;  1TFR A;  3RFA A;  3C29 A;  3TQ1 A;  5E79 U;  7ICM A;  4MF2 A;  1TK0 A;  4P2H A;  4U6P A;  4Z6D A;  3CNH A;  3M6K A;  1O08 A;  2XGQ A;  5AK4 A;  4OJO A;  4AYB F;  8ICH A;  1CUK A;  4EYI B;  3G6X A;  3ZD8 A;  3HX0 A;  4MEX A;  2UVU A;  2UVR A;  3PNC A;  8ICZ A;  2E8P A;  3AU2 A;  5KFX A;  3UXN A;  2FMS A;  3NAS A;  5CP2 A;  2LMR A;  1WWV A;  4YMN A;  4NWI A;  4DFJ A;  4UB8 U;  1H38 A;  1HJP A;  2ZUB A;  4C4R A;  3SEN A;  1DRG A;  3UXP A;  2K8B B;  4J9Q A;  1Z19 A;  1SZP A;  5JRT A;  7ICG A;  4PPX A;  1WCL A;  4M9G A;  1A6S A;  5KT4 A;  2W9B B;  5IIK A;  4FE3 A;  2AU0 A;  3BZC A;  4NL9 C;  3OJS A;  3IM1 A;  1JN3 A;  4F4X A;  1SWV A;  4KN4 A;  4GXI A;  4KLE A;  2XCA A;  1ZQF A;  3N97 B;  1A77 A;  2GWS A;  5EOZ A;  5AK5 A;  3DEE A;  1FIQ A;  3NS1 A;  2AH5 A;  3ZDD A;  8ICC A;  3OPX A;  8ICV A;  2IOF A;  3OHA A;  2VJ4 A;  4RQ5 A;  5J0W A;  4J9M A;  3THV A;  2W9C B;  1MC8 A;  3GDX A;  2AGP A;  3EWA A;  3ZDB A;  1ZQX A;  1XSN A;  2PXI A;  2PFQ A;  7ICR A;  4RQ1 A;  3F5E A;  2W9C A;  3ZDA A;  1PUZ A;  5DBB A;  5ALG A;  4BJQ A;  5C0Y A;  2NRZ A;  3TAR A;  3MR3 A;  1S0N A;  4I28 A;  2ZIW B;  2EZX A;  2UVV A;  4DWI A;  1RQN A;  3BDP A;  1V85 A;  2ZTD A;  3GZF A;  7ICP A;  2ZIW A;  1A0P A;  2KV2 A;  4DSF A;  2F2A B;  3AM9 A;  2E8M A;  4CCH A;  3G6V A;  3EPG A;  3NVY A;  4P4M A;  3NRZ A;  4UAW A;  3ALR A;  2BCS A;  1S0O A;  1D9F A;  5KFN A;  1P7D A;  7ICF A;  5EE1 A;  4Y2T A;  4DSE A;  2NYV A;  3NTU A;  5DB8 A;  4GXK A;  3RJK A;  5ALU A;  3PY8 A;  2V4Q A;  2VA3 A;  5ALX A;  1L3U A;  4YVZ A;  1ZD5 A;  4QJF B;  1T4G A;  3RJG A;  2JEI A;  5GTI U;  4O9M A;  5DKW A;  3ISC A;  5HP4 A;  4PL1 A;  4DL4 A;  3SV4 A;  2ZXI A;  4RQM A;  1ZQT A;  2KHV A;  2E3T A;  4NM1 A;  1HUO A;  1L7O A;  2WB1 F;  4B9V A;  1KQQ A;  1SGG A;  2J6S A;  4MFC A;  5G5G A;  9ICN A;  4O3Q A;  5AI6 A;  5AHX A;  1X6I A;  2HOF A;  3EZ5 A;  7ICV A;  4B9U A;  2RP5 A;  3TFR A;  5B5E U;  3Q8S B;  4GFJ A;  1IG6 A;  2LKY A;  5J2B A;  3TI0 A;  2LYA A;  5AKE A;  3KHL A;  3Q8Q B;  4I2D A;  2C22 A;  2YML A;  1A76 A;  3SV3 A;  2W11 A;  3OSP A;  2HHV A;  1S9F A;  9ICM A;  3H8W A;  4FS2 A;  2FDR A;  1ZQH A;  3TAP A;  2PI4 A;  8ICM A;  4JWM A;  3TAD A;  4TQS A;  3WKA A;  1COO A;  2W8K A;  2E8N A;  1UPH A;  5EE9 A;  1FFU A;  5KG6 A;  2AHO B;  2OH2 A;  5EE3 A;  3UXO A;  5KFP A;  3QZ8 A;  5CA7 A;  9ICX A;  1JX4 A;  1TKD A;  9ICL A;  3H40 A;  4CGZ A;  4Z6C A;  3PR4 A;  5ALM A;  4PZN A;  2BDU A;  5KAF U;  7ICT A;  9ICG A;  3ICX A;  1NI3 A;  3PSI A;  2QKQ A;  8ICS A;  1IXR A;  4UBB A;  2BHN A;  3SZ2 A;  3M9O B;  4KMO B;  2C2E A;  2RDI A;  1VDV A;  4XA5 A;  2EAO A;  1ZQ1 C;  4RPX A;  3C2L A;  1F5S A;  3B0Y A;  2XC9 A;  3SQI A;  1DGS A;  3RR8 A;  3TAC B;  3PW2 A;  4QWE A;  5AIC A;  7ICN A;  5HHH A;  3IG8 A;  3K75 D;  5DLF A;  8ICJ A;  2HMX A;  1K1Q A;  2AXT U;  4Y2U A;  4US8 A;  2QB0 A;  2LYB A;  3KZX A;  4C8O A;  3I28 A;  8ICB A;  5ALS A;  3N4M B;  5ALR A;  4YR2 A;  5KFA A;  3JPO A;  3F2C A;  4QZA A;  3N7R C;  5ALV A;  1TAQ A;  4O3O A;  4EBC A;  3WKB A;  8ICQ A;  1BNP A;  3KTQ A;  4DCC A;  3PO4 A;  5KFO A;  1RZT A;  1B22 A;  2EAP A;  3UQ2 A;  2EZY A;  5DG7 A;  4ECV A;  2CRX A;  4DQP A;  1N5X A;  4I2E A;  4IQW A;  5L1L A;  8ICN A;  5ALI A;  2BPC A;  2F1H A;  4JV1 A;  2ZXH A;  3RRH A;  8ICE A;  8ICP A;  5DBA A;  2HHT A;  1L3V A;  3C2K A;  4F5Q A;  5ALZ A;  2H3Q A;  3C21 A;  2Y1J A;  3CP8 A;  4C7Y A;  2NRX A;  4MHV A;  3AQE A;  4QWD A;  3CYM A;  4ACO A;  3ONN A;  2BDP A;  5JTI A;  2OHF A;  1LV5 A;  1T8E A;  2NO5 A;  4BWJ A;  1J97 A;  3RJI A;  4TQR A;  1OUQ A;  4DO9 A;  4O5C A;  5AM5 A;  2EH9 A;  2IHN A;  2UVW A;  3LYS A;  4AYB C;  7ICS A;  1UCV A;  2DWQ A;  3V7J A;  4LVS A;  1NKC A;  1RXV A;  2KJ8 A;  5IIJ A;  5TIS U;  2WAQ F;  4CDG A;  4RQ0 A;  1SL1 A;  3JPR A;  1S0M A;  3EUB 2;  1N62 A;  2HW3 A;  3SMV A;  5KT3 A;  2CPR A;  4OD0 A;  1PVQ A;  4QZE A;  2KP7 A;  3AQF A;  5ALD A;  3TKA A;  3JPQ A;  2W3S A;  5ALL A;  3KKA A;  4YD2 A;  2IBK A;  1TK8 A;  3QU5 A;  1YZ7 A;  2M0N A;  2XVT A;  2VKQ A;  4Y2J A;  2ZIU B;  4GIB A;  4RNO A;  2DF4 B;  3QXG A;  5AM1 A;  2ZG6 A;  5ALN A;  4DQI A;  1SIJ A;  4B9S A;  5AKZ A;  2A1J B;  4TUP A;  1NJX A;  3NVV A;  5T14 A;  3F2D A;  2YY6 A;  1COK A;  1NJZ A;  5AI9 A;  4KLM A;  8ICO A;  2DPJ A;  3RBE A;  3C5F A;  3AN1 A;  3D2Q A;  7ICU A;  4KLQ A;  2VIX A;  2K89 A;  2KN7 A;  3WK5 A;  4I2C A;  4YG2 A;  1XSL A;  1K1S A;  3OTQ A;  4ECZ A;  1ZJM A;  1QSS A;  3GIL A;  4LJX A;  4F2R A;  1PK3 A;  3V7K A;  3IN5 A;  3KHR A;  3ZD9 A;  4EBD A;  5J8Y A;  4R8U A;  2JEG A;  3JPT A;  3BS7 A;  1U48 A;  4RPZ A;  5C5J A;  5CB1 A;  4KLS A;  4I2A A;  3BQ1 A;  4DL7 A;  3QEA Z;  1S10 A;  3ORY A;  9ICJ A;  2Y1I A;  2Y9T A;  1N60 A;  4UAU A;  4RQ2 A;  1S97 A;  1L7M A;  2I6X A;  4NLK A;  4I2I A;  4KX3 A;  2EAN A;  2MU2 A;  2ZUC A;  1FO4 A;  3WKD A;  4M6W A;  3GIJ A;  3K4G A;  4QZC A;  2KD1 A;  3MDA A;  1QQ6 A;  5KFK A;  5EWE A;  2ATL A;  1RYU A;  1FFV A;  5EWF A;  4HYK A;  3K1R B;  9ICQ A;  2G5I B;  3LVW A;  4KN7 A;  4R63 A;  4Q8E A;  3ISD A;  1CRX A;  3QU4 A;  3MC1 A;  2KVS A;  7ICH A;  3BQ2 A; 
#chains in the Genus database with same CATH homology
 1SV0 C;  1SGG A;  2D8C A;  3TAC B;  1B4F A;  3HIL A;  2QB1 A;  2QAR B;  1SV4 A;  2KSO B;  1SXD A;  1COK A;  2QB0 A;  2YTU A;  1OXJ A;  5JU5 A;  3KKA C;  1KW4 A;  2ES6 A;  3BQ7 A;  5F3X B;  1LKY A;  3IDW A;  2F3N A;  2D3D A;  2KG5 A;  2KE7 A;  2EAP A;  1OW5 A;  1WWU A;  1V85 A;  1PK3 A;  2QAR A;  2EAM A;  2DL0 A;  2KMD A;  2K60 A;  5J8Y A;  5J8Y C;  2E8P A;  2F44 A;  1JI7 A;  2KSO A;  4PZO A;  3TAD A;  2E8M A;  3TAD C;  2DKX A;  2E8O A;  2LMR A;  1WWV A;  1X40 A;  3BS7 A;  2F8K A;  2E8N A;  2ESE A;  4IS7 A;  1X66 A;  4MHV A;  5L1M A;  3BS5 B;  2L5Y A;  1PK1 B;  3SEN A;  3SEI A;  5JTI A;  2GLE A;  2K4P A;  2Y9T A;  5JRT A;  3H8M A;  2B6G A;  4PZN A;  2FE9 A;  1UCV A;  2DKZ A;  2EAN A;  1B0X A;  1SV0 A;  2QKQ A;  4NJ8 A;  1SXE A;  1UQV A;  4NL9 C;  4NL9 A;  1V38 A;  1DXS A;  1Z1V A;  1F0M A;  2QB0 B;  1X9X A;  3K1R B;  3BS5 A;  2EAO A;  2JV3 A;  2Y9U A;  2LPE A;  5KNI A;  1LKY B;  1PK1 A;  2KIV A;  3KKA A;  4RQN A;  4RQM A;  1RG6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...