3BQ7A

Sam domain of diacylglycerol kinase delta1 (e35g)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
68
structure length
68
Chain Sequence
RPVHLWGTEEVAAWLEHLSLCEYKDIFTRHDIRGSGLLHLERRDLKDLGVTKVGHMKRILCGIKELSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diacylglycerol kinase delta
publication title Regulation of Enzyme Localization by Polymerization: Polymer Formation by the SAM Domain of Diacylglycerol Kinase delta1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 23
structure length 68
sequence length 68
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.1.107: Diacylglycerol kinase (ATP).
pdb deposition date 2007-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3bq7A00
2DKXA 2L5YA 1Z1VA 3TADA 3BS5A 2ES6A 2QB0A 1LKYA 1COKA 3K1RB 5J8YC 1PK3A 5JU5A 5F3XB 1PK1B 2QARA 5JRTA 1WWUA 2FE9A 1SV0C 2D3DA 2B6GA 1RG6A 3KKAC 1DXSA 1OXJA 1SXEA 4RQNA 1F0MA 1X9XA 1SXDA 2GLEA 2Y9UA 2KMDA 2EANA 2Y9TA 4MHVA 1PK1A 2LPEA 2EAPA 1X66A 2QB1A 1UCVA 4IS7A 2E8OA 2ESEA 1V38A 2D8CA 5J8YA 4NL9C 1V85A 1SV0A 2EAMA 5JTIA 3IDWA 5L1MA 3TADC 2DL0A 2K4PA 2QKQA 2LMRA 3KKAA 2E8NA 1WWVA 4PZNA 1JI7A 2K60A 2KIVA 1SGGA 3BQ7A 5KNIA 4NJ8A 3HILA 3H8MA 2KG5A 4PZOA 1X40A 2QB0B 2E8MA 1B0XA 4NL9A 3TACB 3SENA 2F44A 2KSOB 2KE7A 4RQMA 1B4FA 3SEIA 1UQVA 1OW5A 2F8KA 2DKZA 3BS5B 2E8PA 2JV3A 2KSOA 2EAOA 1LKYB 1KW4A 2QARB 2F3NA 2YTUA 3BS7A 1SV4A
chains in the Genus database with same CATH superfamily
4EBCA 4YMNA 9ICPA 1L3UA 2RDJA 2XVTA 2BPGA 5IIJA 5JU5A 5B66U 3PR4A 1SV0C 5AI6A 4YXMA 1NK5A 5G5HA 1TK8A 4M04A 3NVVA 1Z1BA 2ZIVA 5KFPA 5DBBA 4KLHA 1XS9D 1Z00B 4J9NA 4JWMA 5AI9A 3WK9A 3CNHA 2V4RA 3M9NB 2WAQC 3ISCA 1GO3F 4F4ZA 1XNSA 4RZRA 4FO6A 4QWEA 2W8LA 4TQRA 1UT5A 3TADC 5KFKA 2OM6A 3EPIA 1X9MA 2AHOB 2YX8A 2D6FC 5KFMA 4E0DA 5KNIA 3N28A 4O5CA 5C5JA 1K1QA 3KFUF 1SB3C 7ICNA 1Z4OA 2AJQA 4FBUA 2FLPA 3QEAZ 5KL1B 4BXOA 4FBTA 3RF9A 2B21A 1S77D 2EQYA 1YZ6A 3GQCA 5KFGA 2F44A 1CUKA 3QUQA 2P6RA 1ZQCA 3HPOA 2OHFA 2G5IB 3JPTA 4YR0A 1KTQA 5KFYA 3SEIA 2KNJA 1OW5A 2F8KA 4RQ6A 3BS5B 5DB9A 3JPRA 3A0BU 2JEIA 1JRPA 3EUB2 5CJ7A 3LK9A 4DQSA 2Y0SF 5ALNA 8ICVA 2VA2A 4IR9A 3RRGA 2VANA 4AP9A 4ED3A 4KLDA 1URJA 4RUAA 2BCVA 2G08A 1VJ5A 4QZCA 4B9MA 1X42A 4YVZA 3NVWA 4YFKA 3V72A 2ZIWA 1ZJMA 2F1JA 5JRTA 5DBCA 3G6YA 4DSFA 3T79A 4U7CA 3OPXA 1X9XA 4UATA 3RAXA 2Y9TA 3QX7A 4IL6U 4US9A 5KAFU 2WFAA 4QZHA 1FFVA 2EAPA 5KFQA 5ALZA 1DK2A 2ZTEA 2BCQA 2JH7A 3LDAA 4USAA 4DFPA 1UCVA 1J2NA 5EOZA 3H0LB 2P66A 1QLNA 1V38A 4Z6EA 2HHWA 4YN4A 4F4YA 2FMQA 2HBJA 1U45A 5ALDA 3PMLA 4QNLA 1SL0A 5IIMA 9ICQA 4RU9A 4QWBA 3GIMA 4QW8A 1S10A 3GDXA 5AI4A 5T14A 1KRPA 4NJ8A 1ZQWA 4QIWF 4M6WA 4ELVA 2XO7A 1WCNA 1BPDA 4ZH4A 4DSKA 4ED8A 1A77A 3QE9Y 1HUZA 5KFBA 1AQ6A 1B0XA 2PMZC 4RPZA 2BHNA 3CP8A 1U49A 1ZJNA 3UM9A 3EZ5A 4JV2A 1WUDA 1SKWA 4WJ3B 7ICRA 2JZBA 2BQUA 3OHAA 3MR3A 1JROA 2C28A 2DKZA 1TFRA 3S6JA 2ZUCA 3GV8B 3OTQA 2ZIXB 5DDMA 2E1EA 3RB6A 4KLFA 2HI0A 4EX7A 2V4QA 2KN7A 4I2CA 3M1YA 4CNQA 1S5LU 5J2JA 5EE1A 4NLZA 3ALRA 2KOBA 4IRDA 4F8RA 2MAXA 2F1IA 2K4IA 4C8NA 4DQQA 1UPHA 2B6GA 5KFNA 1O08A 3AL0B 1PVRA 5D4BA 1F5SA 1ZETA 4B9LA 1ZQEA 4K4HA 4B9VA 3UMBA 1SIJA 1RZTA 4DOCA 5HP4A 4C7YA 4DL2A 4NLBA 3NS1A 4ED1A 5AM5A 4F2RA 2JEFA 4F71A 4J9RA 4O3MA 4EYHB 2K4HA 2EAMA 4GC6A 4IQTA 4F5QA 1RXVA 4HYKA 1Z00A 1UA0A 5G5GA 3ZI4A 4O3QA 4YQWA 1ZYQA 1ZQVA 4OCZA 2XCAA 2ASLA 4P0QB 2F2AB 2XGQA 1WCLA 1L7MA 5AIBA 3T5HA 4Z6DA 4F2SA 4CDGA 3AN1A 5L1LA 3OJUA 1LV5A 3PSPA 3M7DA 2BKEA 3SENA 3JPNA 4I2AA 4NV0A 3TARA 2A1AA 2G5HB 3F2CA 1B43A 1HUOA 1L3TA 4C4TA 2KEYA 4IRKA 2FPKA 1D9FA 2P6UA 4Q45A 1Q3VA 3AM9A 5KFFA 3PVXA 1HEKA 4GXJA 3PZPA 1ZD4A 4NLNA 1LKYB 4F72A 1KW4A 5AICA 2PKEA 8ICNA 2F76X 1RDFA 2AGQA 4QZAA 2KV2A 4RNNA 4ZOHC 3UXPA 3BS5A 2XY5A 8ICHA 2ISPA 3WK8A 2PFNA 2ZJ8A 1WWUA 2IMWP 3ICXA 1HJPA 2WF9A 2PFOA 4UAVA 2XIDA 1N48A 1O03A 3SYZA 1Q46A 2Y1IA 2KHVA 5ALHA 7ICVA 4RPXA 1NKCA 1NK0A 1ZQNA 2MA1A 4EX6A 4ECRA 4RUCA 2KFZA 2C2EA 8ICOA 3IHQB 4Y2UA 2OEHA 4F92B 7ICOA 1S76D 4AYBC 4QWDA 4IS7A 1S0VA 3MGHA 4MF8A 5AM3A 1HIWA 4ELTA 2CPRA 5AK6A 9ICOA 5J0OA 1MN8A 2WF6A 8ICUA 4KX5A 1RYSA 1ZRNA 4GIBA 3H8MA 3G6VA 3UQ2A 2HBLA 4YG2A 1QTMA 3KD3A 2QB0B 3ETLA 2I5HA 3Q8PB 1NZBA 1MQ3A 5ALLA 5J2EA 3SMVA 2KZZA 4X5VA 2O6KA 2HHSA 1KDHA 5CR0A 4QZGA 2W9CB 2BPCA 1ZQRA 2W7OA 3HWTA 5TISU 2W8KA 1IV8A 4F4KA 2W11A 2JV3A 4M0AA 3MFHA 4DOBA 1X2IA 3QU7A 3SQIA 1JXEA 2NRZA 2NYVA 7ICMA 3TFSA 4CF4A 2QARB 2HOFA 2H3ZA 1MQ2A 5KG0A 4RQ3A 1L5UA 4F91B 2KVSA 8ICMA 5KFDA 2DKXA 2HHQA 4I28A 5AKYA 2XC9A 5AKJA 3HT3A 3FM9A 3C2LA 3ZDAA 1ZQSA 2ZIXA 2JR5A 3Q8QB 2W3SA 4DL3A 2VJ5A 4K4IA 2FMSA 4ELUA 2NV3A 3QU9A 2LM4A 3KKAC 4OJOA 2HDOA 7ICLA 4ECQA 3T3FA 3QEBZ 5L1JA 1NJXA 5J0WA 1XWLA 2LPEA 3H0MB 2FDRA 3F53A 2NRVA 2XGPA 3TI0A 4PGXA 5EWFA 3MGIA 3BQTA 2ESEA 2J6SA 5IIOA 3PNCA 4C80A 2FLNA 4UB6U 4B9NA 3SV3A 2OWOA 4PL1A 4M47A 3FDSA 7ICPA 4F5PA 4IQUA 4F5RA 5J2BA 1A6SA 5ALRA 1L7PA 5DGAA 2BDPA 1P7DA 5AM2A 2H3IA 4O3OA 2KZ3A 4ICAA 5AKGA 2RRDA 3Q8RB 2ASDA 1U47A 4NL9A 3D2QA 3GIKA 3TQ1A 4ED0A 3DEEA 9ICGA 1SKRA 2WB1C 3L3FX 4C0ZA 4C8MA 3ZDCA 4KX3A 4JB3A 4QWAA 3LVVA 3NVYA 5ALFA 3AQEA 5CEHA 1WG8A 2BDUA 2FJ6A 3GZFA 2BQRA 8ICBA 4TQSA 2PI4A 4JV1A 4NY8A 2HW3A 1T4GA 5KTQA 9ICNA 1LKYA 3DDHA 1PK3A 1LVHA 3PW5A 2FMPA 2FE9A 2DGZA 1EXNA 4C8KA 2JHDA 3MR5A 1NJZA 1TKDA 5KT5A 8ICTA 4O3PA 9ICLA 4QZFA 2EANA 4DF4A 4ECXA 3IRUA 3U26A 7ICGA 2LM1A 1K5OA 5KFXA 5ALVA 4UB1A 1L3VA 3PW0A 3PW2A 4B9SA 4ECZA 5J0XA 4FFDA 2IA6A 1RXWA 4K4GA 3WKEA 3HKZC 5HMLA 2JGAA 3WK6A 8ICZA 1QH9A 4DFJA 5ALOA 4Y2QA 3WK4A 2MUTB 3OJSA 4M9LA 4TUPA 4RQ4A 5AKLA 4R8UB 3M8RA 4KN4A 5ALKA 4UAWA 3H7IA 4UB8U 3RJGA 1JUDA 3UXNA 1CRXA 2I1QA 4IC9A 3B0YA 4DSIA 1Q3UA 5J2CA 2DQNB 3K75D 4RQMA 1ZQIA 4BWJA 2KD1A 5AI5A 2BPFA 4P4PA 2WF7A 2XY7A 4MEYA 2EAOA 4OO1J 4QZEA 5E79U 3RRHA 2Y0SC 7ICQA 2JH1A 7ICTA 5ALXA 2W9BA 9ICWA 2DF4B 1NKBA 1BGXT 3BS7A 4RPYA 3PMNA 3WU2U 3VC8A 9ICIA 4OJLA 1XSLA 1T8EA 4M9JA 1JX4A 1S0MA 4EZ9A 8ICYA 2LBOA 2QARA 3PO4A 2WAQF 2D3DA 4I2IA 5J2AA 5HNKA 4NWIA 5EWEA 2NO4A 3JPPA 3BZKA 2H3FA 4DSEA 2ZIUB 3ED5A 2LYHA 3OSPA 4Y2YA 4GC7A 3L4PA 2NRXA 5KFEA 2E8OA 2HCFA 5ALSA 1ZQTA 2D8CA 3N97B 1XO0A 3FC4A 2G09A 3IDWA 4OJPA 3PSTA 5KFUA 2J6TA 4DL5A 1N60A 2HHVA 3H40A 1AROP 3H4BA 3UXOA 3NGDA 2EH9A 2K4EA 3N7RC 1PZNA 8ICXA 5KFAA 2ZUDA 2I6XA 3O0FA 2A19A 4NLGA 3Q8LA 5AK5A 5L9XA 1ECWA 3HP6A 4J9MA 3JPSA 4Y2JA 2KZMA 3H0RB 4QWCA 4KLGA 1QSYA 3F2BA 1BPXA 2H5XA 1B22A 4XRHA 3EPGA 4B6JA 4EEYA 5J0YA 5KT6A 3AU6A 3NRWA 1KL9A 1DRGA 1TE2A 2H3QA 2F3NA 4GLXA 5DQIA 3C28A 4BWMA 4F3OA 8ICPA 2UVUA 2KJ8A 3LWLA 5AK3A 4C7ZA 2AGPA 5J8YC 1NKEA 4TUSA 2CRXA 2AXTU 4MF2A 3NVZA 2F1HA 1L3SA 2I9GA 1F0MA 3PR5B 7ICSA 4KLIA 3Q8KA 1KKXA 4U6PA 3QZ8A 4FS1A 5DG7A 1BPBA 3BDPA 3QU2A 3SZ2A 2R8JA 1A76A 4DFKA 1ZD5A 1YZ7A 4CCHA 4P0PA 5DQGA 3UMCA 2M0NA 4BJQA 3DV9A 1PUZA 1QSLA 2FPLA 2PMZF 4JMUA 3QXGA 3SAGA 1V97A 4NM2A 3J81j 1ZXIA 1WWVA 2H3VA 3GV7B 2K60A 5J0RA 1X6JA 4O5KA 4ED2A 2AU0A 2YMQA 4DO9A 4KMOB 5KFWA 2A1JB 2KG5A 3PW7A 2CXYA 2YQEA 8ICJA 5K4LA 1DOQA 4J9QA 2XY6A 1ZQPA 3RB4A 2MSNA 3SR6A 2KICA 2LYAA 5EE9A 3SI8A 2NO5A 4I2GA 4DLEA 1Y88A 4UB3A 5KT2A 3FYHA 2KSOB 1TAQA 4R65A 5J2FA 3E2EA 1VLBA 2DPJA 3HRDD 3G6XA 4F4XA 4R8UA 5J0TA 3NTUA 3M6ZA 3K4GA 1BNPA 1NI3A 3TAPA 4P2HA 4Y2XA 2YTUA 5AM4A 5AI8A 2HHTA 2KK0A 5DLGA 2R8KA 2Q0ZX 2BGWA 2CN1A 2YB1A 5ALGA 1JXLA 5DLFA 2KJ5A 1NK7A 3RH5A 1NK8A 3KTQA 2YB4A 3N4MB 1SWWA 2MU2A 1NK4A 4YD1A 1Z19A 3I76A 5F9NA 1KFDA 2IOFA 2JMGA 2VIXA 2W03A 9ICHA 1ZQXA 3Q8SB 2HHXA 1JMSA 2OH2A 5F9LA 1IIPA 4R66A 1SV0A 4R64A 3AMZA 4G3IA 4RQ7A 1RQLA 2E8NA 1SWVA 1S8OA 1JI7A 4EENA 3V7KA 3UMGA 3PX4A 5KFSA 3WK5A 8ICSA 4M9NA 1ZQGA 3M8SA 9ICUA 2YMLA 1X40A 3IG8A 1N62A 3JPQA 4F5OA 4F50A 5KT4A 2K89A 3C5FA 3T5LA 4GFJA 4PL2A 3TAQA 3V7JA 3R9KA 3N7PD 3QU4A 3V6KA 2ZIVB 2J6UA 3OGUA 5J0SA 3JPOA 2W55A 1ZD3A 1M6YA 2UVVA 4M2YA 2NRWA 2L5YA 2P35A 7ICJA 4AYBF 3LWMA 1MA7A 2YN4A 5DBAA 4NXZA 5F3XB 1PK1B 1L8LA 4BUGA 1SL1A 1ZQDA 3KZIU 2W9MA 3RH4A 3E58A 4Z6CA 2BCRA 4DQPA 1L8OA 2OXOA 2KMDA 4UB2A 1TK0A 5AKIA 4CF5A 5L1KA 2K8CB 4DS4A 3WKCA 2VJ4A 2EZZA 3GIIA 8ICFA 3WK7A 2F77X 3KBBA 1U4BA 2WTFA 3KHGA 7ICUA 5HHIA 2LI6A 2HSZA 3ZDDA 5IIIA 2NRTA 4DQRA 4QZ8A 3NUQA 3GILA 2HOIA 2IHMA 5AM0A 3C2KA 1DGSA 4F4WA 4QW9A 4YMMA 4RNMA 2ZIWB 3H8SA 1ZQKA 2A1JA 4FZNA 4UARA 2ZJAA 2DUYA 5KG1A 1S0OA 4DEZA 1BPZA 4CRXA 3RB3A 5H2FU 5AKZA 1ZOLA 4EBEA 2RHFA 2KSOA 4I29A 3C1ZA 2W43A 1NK9A 5KFTA 1ZQUA 8ICRA 4CE6A 2Q4TA 3PW4A 4P0QA 3WKBA 3I1YA 1Z1VA 2IOFK 4O0IA 4A8EA 4ACOA 2C2RA 2HMXA 3MGVA 5DG9A 2FI1A 9ICBA 5KT7A 3RJJA 2GH1A 4LZDA 2ZXIA 3M6KA 2ZTCA 4Y2PA 4RQNA 1X6IA 4YCXA 4CF3A 2R8HA 3T5JA 5KG3A 9ICRA 3RBDA 3QNMA 3SAHA 4ECTA 1IG6A 4PH5A 4JWNA 3MDAA 4I2DA 1KQQA 4DL4A 1ZQJA 3C1YA 4P4MA 5A0LA 3MFIA 4KLSA 1N2XA 1NK6A 3KHLA 2OYYA 1RPLA 1PVQA 4PHPA 1V85A 5C0YA 3OSNA 4KLTA 5L1MA 1N5WA 4M9GA 2W9AA 2GO7A 3T5KA 4KMUA 1XSPA 3ZD8A 3BZCA 1SGGA 2WB1F 9ICMA 4R63A 1N63A 1ZQYA 3HILA 4Q8EA 2EDUA 3RJIA 4IQVA 4ECVA 3KHHA 3C5GA 4I2HA 2ZXHA 1JALA 1KEJA 1Z4NA 5IILA 4US8A 1IM4A 4Q8FA 1XO1A 1ZD2P 4O9MA 4LVSA 4UAYA 5DQHA 5CB1A 1TV9A 3CRXA 4Q44A 1B4FA 2WF5A 3RJEA 9ICVA 1UQVA 3MABA 1T7PA 4Y2VA 5ALYA 4P4OA 2G07A 2E8PA 1ZQAA 4ED7A 3TKAA 2JEGA 5HMMA 2JXJA 4RQ5A 2V9WA 5CP2A 1FEZA 1Q8KA 2HVIA 5KG5A 1QQ5A 1L7NA 1ZQZA 4GXKA 2QB0A 2IOHA 4J9KA 1L7OA 5IIKA 5AKHA 1COOA 4EEKA 2AQ4A 3LVWA 1ZQMA 2Y1JA 4FZMA 5DB7A 2KHQA 4JUZA 7ICKA 2W9CA 2Y9UA 3HKZF 5FP0A 4MHVA 4ECYA 3RJKA 4MFCA 1PK1A 1S0NA 2ZG6A 4IR1A 5AK4A 4DSJA 1RYUA 3PX0A 3A0HU 5AM1A 8ICAA 2XICA 5KT3A 1KLNA 1J2MA 3QU5A 1J97A 3LYSA 1ZQLA 3EYZA 1MSWD 4DWIA 5KFZA 2K4PA 3ZD9A 1UHUA 7ICEA 1XC9A 4FZLA 4KITB 2BZFA 3D6JA 5IINA 5J2GA 1KFSA 4B9UA 2C2DA 5J0UA 4DOAA 4TUQA 2HBMA 5D46A 2GWSA 1TAUA 4I2FA 4PHEA 3PX6A 2ATLA 5ALTA 2HOQA 1TAMA 3MC1A 4KTQA 3TACB 5KG6A 5AKEA 4DCCA 4J9LA 5ALJA 4ED6A 3F2DA 4DF8A 4BDPA 3RFAA 2E1FA 2LKYA 4OJ6A 1NOMA 3CW2C 4F5NA 4I2BA 3ZDBA 4UQGA 1ZQQA 4UAZA 2K8BB 4QIWC 2DPIA 2KKVA 2ASJA 4UB4A 4RT3A 5GTHU 3THVA 3AQFA 2JEJA 2KJ9A 1ZQHA 4Y2SA 2HHUA 1QQ6A 2VKQA 5KAIU 3E0FA 3MDCA 2JRZA 5BOMA 3RBEA 4Z6FA 1KSPA 3F5AA 2PFQA 4C4RA 2W54A 1SL2A 2PFPA 9ICSA 4UASA 3RAQA 4NM1A 3QUCA 3SAFA 2R18A 5KFOA 1DXSA 1OXJA 5HR6A 3ETRA 3OHBA 4F93B 5KFIA 5DG8A 1VDVA 5ALQA 5JUMA 4I2EA 4RNOA 1D8YA 5KFHA 1ZQOA 3PV8A 4C4SA 1K1SA 4ECSA 4DSLA 5B5EU 3SD7A 9ICJA 1QSSA 5DKWA 2PXIA 4NL9C 2N1RA 3D2NA 1PVPA 1SZHA 8ICCA 3KKAA 3TFRA 1BVSA 3BJYA 4Y2TA 3RJFA 1KN5A 2KIVA 8ICEA 3ORYA 3V6HA 3GU3A 3HJEA 2G0AA 2WHEA 2KIWA 4EELA 1S9FA 5KFJA 1RM6C 2MRLA 4KN7A 4QZBA 2E8MA 1A0PA 8ICWA 4UBCA 5KFRA 5TZVA 1IXRA 2QLTA 5HR7A 4RQ0A 3UPQA 2BCSA 1DK3A 3IG5A 3PSIA 4PGQA 3EWAA 2R8GA 3QUTA 7ICIA 4PGYA 4MEXA 1F44A 2PI5A 4MFAA 9ICCA 3RTVA 3IV6A 2MUTA 4DS5A 3PSFA 3MR6A 3PY8A 5J2HA 1COKA 3M9MB 4PPXA 1BPEA 1ZQBA 3C23A 8ICQA 8ICIA 1RG6A 3GV5B 4NLCA 5CWRA 3Q8MA 4TURA 2GLEA 1N61A 5EE0A 4CGZA 2ZTDA 5AKKA 3KHRA 2ODGA 1QCKA 5ALEA 5J0QA 3QZ7A 5D49A 4UBBA 2QB1A 3H8WA 5CA7A 1D8BA 1SZPA 2RP5A 2ZUBA 4QZ9A 1C7YA 7ICFA 3NASA 1V9PA 4XQ8A 2A3VA 4EZ6A 2UVRA 5ALUA 5J2IA 2LYBA 4UW9A 4I27A 3AEVA 4IRCA 9ICEA 2DFLA 3ZDEA 5AI0A 4I2JA 3TANA 3V7LA 3BQ7A 2B0CA 4XA5A 5CHGA 4KLUA 3RR8A 2Z7JA 3RB0A 4B9TA 3B9JA 2DBYA 2ZIUA 2RDIA 2KFNA 2YMPA 4KLEA 4YXJA 4LZGA 4BX9C 4YR2A 5J0PA 3B0XA 5AIAA 4DQIA 1YT3A 4UAUA 5EWGA 1NZPA 4J9PA 1Z3EB 2BCUA 2KKPA 2K8AA 2VA8A 8ICLA 4PHAA 4DL6A 1TVAA 3D2SA 4YMOA 4XUSA 3EW9A 2BR0A 4KLMA 1TK5A 2FPMA 2UVWA 2YY6A 2F8LA 3MBYA 3ISDA 3PO5A 4PHDA 1U9LA 1CI4A 3TADA 3F5EA 1ZRMA 3GFKB 1CEZA 1T3QA 2ES6A 3FAHA 1X9SA 3SV4A 9ICTA 2WF8A 3K1RB 1MC8A 3I28A 4OJ5A 1RQNA 5DGBA 3H8JA 2AGOA 1SXEA 2LHTA 5ALPA 1L6NA 4ECWA 2XI9A 4C8OA 2KP7A 5J2DA 1KBUA 4QZIA 4RQ8A 3K1ZA 1X66A 3QUBA 4O3NA 1JN3A 5KL8B 4C8LA 3KOOA 3C29A 1X9WA 3KZXA 4JV0A 3H4DA 1U48A 3HW8A 2W04A 2QKQA 1SKSA 2LMRA 3IM1A 3WKDA 3UQ0A 3VCBA 2W3RA 4BXOB 2ISOA 4PZNA 9ICAA 5ALWA 5ALIA 4KLLA 4EBDA 8ICKA 2W9BB 5CRXA 5BPCA 2C22A 4Q43A 1ZQFA 5KG2A 2KTQA 3GIJA 1N56A 2AH5A 5AKXA 5KFLA 4PJ0U 3MR2A 3C2MA 1T3NA 3CYMA 1RYRA 4DFMA 2DWQA 3BQ2A 2ALZA 3IP4B 2KE7A 4FS2A 4LJXA 4DLGA 3HX0A 4QZDA 2M9NA 4EYIB 2YMMA 5KG4A 1ED1A 1DGJA 5KG7A 1OUQA 2IBKA 4BGDA 3RH6A 3BQ0A 2GOLA 2OCEA 5J2KA 4YR3A 4J9SA 3RJHA 4MFFA 5GTIU 4DL7A 4NLKA 1FIQA 3C21A 1NJWA 4KLOA 9ICKA 1NJYA 4RT2A 2KVCA 1XSNA 1UA1A 4O3SA 1XU4A 4G9BA 1S97A 4QJFB 3ONNA 9ICXA 1QQ7A 4HAIA 1BPYA 1D9DA 4JK1A 1BNOA 2AQ0A 1FO4A 3V6JA 5J29A 1SXDA 4GXIA 1D8LA 4DFDA 5L1IA 3IN5A 3N7SC 3ISBA 1FFUA 4RQ2A 5J8YA 9ICFA 2VA3A 2E5SA 4M6WB 5JTIA 4ECUA 2DL0A 2R8IA 2ZJ5A 3BQ1A 4O5EA 4OD0A 1NNLA 3QYPA 5EE3A 4KLQA 5DB8A 1C20A 1KFTA 4O3RA 3WKAA 2G06A 3AU2A 3M9OB 4FE3A 4PZOA 2XCPA 5DB6A 7ICHA 2JZBB 2EZYA 5AHXA 2W7PA 4J03A 5KFCA 2BQ3A 3RR7A 5BOLA 1T94A 2HVHA 1JIHA 3NRZA 1H38A 5HHHA 2EZXA 2FLLA 4KLJA 4RQ1A 4Y2RA 4UB5A 5KFVA 8ICGA 2HBKA 5ALMA 3AUOA 2E3TA 4YD2A 4IQWA 1UT8A 3L5KA 2RLTA 4J9OA 1N5XA 2IHNA 4P0PB 1ZQ1C 1WYGA 5DDYA 4M9HA 2RQ5A 4YP3A 1LB2B 1SV4A
chains in the Genus database with same CATH topology
2DKXA 2L5YA 1Z1VA 3TADA 3BS5A 2ES6A 2QB0A 1LKYA 1COKA 3K1RB 5J8YC 1PK3A 5JU5A 5F3XB 1PK1B 2QARA 5JRTA 1WWUA 2FE9A 1SV0C 2D3DA 2B6GA 1RG6A 3KKAC 1DXSA 1OXJA 1SXEA 4RQNA 1F0MA 1X9XA 1SXDA 2GLEA 2Y9UA 2KMDA 2EANA 2Y9TA 4MHVA 1PK1A 2LPEA 2EAPA 1X66A 2QB1A 1UCVA 4IS7A 2E8OA 2ESEA 1V38A 2D8CA 5J8YA 4NL9C 1V85A 1SV0A 2EAMA 5JTIA 3IDWA 5L1MA 3TADC 2DL0A 2K4PA 2QKQA 2LMRA 3KKAA 2E8NA 1WWVA 4PZNA 1JI7A 2K60A 2KIVA 1SGGA 3BQ7A 5KNIA 4NJ8A 3HILA 3H8MA 2KG5A 4PZOA 1X40A 2QB0B 2E8MA 1B0XA 4NL9A 3TACB 3SENA 2F44A 2KSOB 2KE7A 4RQMA 1B4FA 3SEIA 1UQVA 1OW5A 2F8KA 2DKZA 3BS5B 2E8PA 2JV3A 2KSOA 2EAOA 1LKYB 1KW4A 2QARB 2F3NA 2YTUA 3BS7A 1SV4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DKX A;  2L5Y A;  1Z1V A;  3TAD A;  3BS5 A;  2ES6 A;  2QB0 A;  1LKY A;  1COK A;  3K1R B;  5J8Y C;  1PK3 A;  5JU5 A;  5F3X B;  1PK1 B;  2QAR A;  5JRT A;  1WWU A;  2FE9 A;  1SV0 C;  2D3D A;  2B6G A;  1RG6 A;  3KKA C;  1DXS A;  1OXJ A;  1SXE A;  4RQN A;  1F0M A;  1X9X A;  1SXD A;  2GLE A;  2Y9U A;  2KMD A;  2EAN A;  2Y9T A;  4MHV A;  1PK1 A;  2LPE A;  2EAP A;  1X66 A;  2QB1 A;  1UCV A;  4IS7 A;  2E8O A;  2ESE A;  1V38 A;  2D8C A;  5J8Y A;  4NL9 C;  1V85 A;  1SV0 A;  2EAM A;  5JTI A;  3IDW A;  5L1M A;  3TAD C;  2DL0 A;  2K4P A;  2QKQ A;  2LMR A;  3KKA A;  2E8N A;  1WWV A;  4PZN A;  1JI7 A;  2K60 A;  2KIV A;  1SGG A;  3BQ7 A;  5KNI A;  4NJ8 A;  3HIL A;  3H8M A;  2KG5 A;  4PZO A;  1X40 A;  2QB0 B;  2E8M A;  1B0X A;  4NL9 A;  3TAC B;  3SEN A;  2F44 A;  2KSO B;  2KE7 A;  4RQM A;  1B4F A;  3SEI A;  1UQV A;  1OW5 A;  2F8K A;  2DKZ A;  3BS5 B;  2E8P A;  2JV3 A;  2KSO A;  2EAO A;  1LKY B;  1KW4 A;  2QAR B;  2F3N A;  2YTU A;  3BS7 A;  1SV4 A; 
#chains in the Genus database with same CATH topology
 4EBC A;  4YMN A;  9ICP A;  1L3U A;  2RDJ A;  2XVT A;  2BPG A;  5IIJ A;  5JU5 A;  5B66 U;  3PR4 A;  1SV0 C;  5AI6 A;  4YXM A;  1NK5 A;  5G5H A;  1TK8 A;  4M04 A;  3NVV A;  1Z1B A;  2ZIV A;  5KFP A;  5DBB A;  4KLH A;  1XS9 D;  1Z00 B;  4J9N A;  4JWM A;  5AI9 A;  3WK9 A;  3CNH A;  2V4R A;  3M9N B;  2WAQ C;  3ISC A;  1GO3 F;  4F4Z A;  1XNS A;  4RZR A;  4FO6 A;  4QWE A;  2W8L A;  4TQR A;  1UT5 A;  3TAD C;  5KFK A;  2OM6 A;  3EPI A;  1X9M A;  2AHO B;  2YX8 A;  2D6F C;  5KFM A;  4E0D A;  5KNI A;  3N28 A;  4O5C A;  5C5J A;  1K1Q A;  3KFU F;  1SB3 C;  7ICN A;  1Z4O A;  2AJQ A;  4FBU A;  2FLP A;  3QEA Z;  5KL1 B;  4BXO A;  4FBT A;  3RF9 A;  2B21 A;  1S77 D;  2EQY A;  1YZ6 A;  3GQC A;  5KFG A;  2F44 A;  1CUK A;  3QUQ A;  2P6R A;  1ZQC A;  3HPO A;  2OHF A;  2G5I B;  3JPT A;  4YR0 A;  1KTQ A;  5KFY A;  3SEI A;  2KNJ A;  1OW5 A;  2F8K A;  4RQ6 A;  3BS5 B;  5DB9 A;  3JPR A;  3A0B U;  2JEI A;  1JRP A;  3EUB 2;  5CJ7 A;  3LK9 A;  4DQS A;  2Y0S F;  5ALN A;  8ICV A;  2VA2 A;  4IR9 A;  3RRG A;  2VAN A;  4AP9 A;  4ED3 A;  4KLD A;  1URJ A;  4RUA A;  2BCV A;  2G08 A;  1VJ5 A;  4QZC A;  4B9M A;  1X42 A;  4YVZ A;  3NVW A;  4YFK A;  3V72 A;  2ZIW A;  1ZJM A;  2F1J A;  5JRT A;  5DBC A;  3G6Y A;  4DSF A;  3T79 A;  4U7C A;  3OPX A;  1X9X A;  4UAT A;  3RAX A;  2Y9T A;  3QX7 A;  4IL6 U;  4US9 A;  5KAF U;  2WFA A;  4QZH A;  1FFV A;  2EAP A;  5KFQ A;  5ALZ A;  1DK2 A;  2ZTE A;  2BCQ A;  2JH7 A;  3LDA A;  4USA A;  4DFP A;  1UCV A;  1J2N A;  5EOZ A;  3H0L B;  2P66 A;  1QLN A;  1V38 A;  4Z6E A;  2HHW A;  4YN4 A;  4F4Y A;  2FMQ A;  2HBJ A;  1U45 A;  5ALD A;  3PML A;  4QNL A;  1SL0 A;  5IIM A;  9ICQ A;  4RU9 A;  4QWB A;  3GIM A;  4QW8 A;  1S10 A;  3GDX A;  5AI4 A;  5T14 A;  1KRP A;  4NJ8 A;  1ZQW A;  4QIW F;  4M6W A;  4ELV A;  2XO7 A;  1WCN A;  1BPD A;  4ZH4 A;  4DSK A;  4ED8 A;  1A77 A;  3QE9 Y;  1HUZ A;  5KFB A;  1AQ6 A;  1B0X A;  2PMZ C;  4RPZ A;  2BHN A;  3CP8 A;  1U49 A;  1ZJN A;  3UM9 A;  3EZ5 A;  4JV2 A;  1WUD A;  1SKW A;  4WJ3 B;  7ICR A;  2JZB A;  2BQU A;  3OHA A;  3MR3 A;  1JRO A;  2C28 A;  2DKZ A;  1TFR A;  3S6J A;  2ZUC A;  3GV8 B;  3OTQ A;  2ZIX B;  5DDM A;  2E1E A;  3RB6 A;  4KLF A;  2HI0 A;  4EX7 A;  2V4Q A;  2KN7 A;  4I2C A;  3M1Y A;  4CNQ A;  1S5L U;  5J2J A;  5EE1 A;  4NLZ A;  3ALR A;  2KOB A;  4IRD A;  4F8R A;  2MAX A;  2F1I A;  2K4I A;  4C8N A;  4DQQ A;  1UPH A;  2B6G A;  5KFN A;  1O08 A;  3AL0 B;  1PVR A;  5D4B A;  1F5S A;  1ZET A;  4B9L A;  1ZQE A;  4K4H A;  4B9V A;  3UMB A;  1SIJ A;  1RZT A;  4DOC A;  5HP4 A;  4C7Y A;  4DL2 A;  4NLB A;  3NS1 A;  4ED1 A;  5AM5 A;  4F2R A;  2JEF A;  4F71 A;  4J9R A;  4O3M A;  4EYH B;  2K4H A;  2EAM A;  4GC6 A;  4IQT A;  4F5Q A;  1RXV A;  4HYK A;  1Z00 A;  1UA0 A;  5G5G A;  3ZI4 A;  4O3Q A;  4YQW A;  1ZYQ A;  1ZQV A;  4OCZ A;  2XCA A;  2ASL A;  4P0Q B;  2F2A B;  2XGQ A;  1WCL A;  1L7M A;  5AIB A;  3T5H A;  4Z6D A;  4F2S A;  4CDG A;  3AN1 A;  5L1L A;  3OJU A;  1LV5 A;  3PSP A;  3M7D A;  2BKE A;  3SEN A;  3JPN A;  4I2A A;  4NV0 A;  3TAR A;  2A1A A;  2G5H B;  3F2C A;  1B43 A;  1HUO A;  1L3T A;  4C4T A;  2KEY A;  4IRK A;  2FPK A;  1D9F A;  2P6U A;  4Q45 A;  1Q3V A;  3AM9 A;  5KFF A;  3PVX A;  1HEK A;  4GXJ A;  3PZP A;  1ZD4 A;  4NLN A;  1LKY B;  4F72 A;  1KW4 A;  5AIC A;  2PKE A;  8ICN A;  2F76 X;  1RDF A;  2AGQ A;  4QZA A;  2KV2 A;  4RNN A;  4ZOH C;  3UXP A;  3BS5 A;  2XY5 A;  8ICH A;  2ISP A;  3WK8 A;  2PFN A;  2ZJ8 A;  1WWU A;  2IMW P;  3ICX A;  1HJP A;  2WF9 A;  2PFO A;  4UAV A;  2XID A;  1N48 A;  1O03 A;  3SYZ A;  1Q46 A;  2Y1I A;  2KHV A;  5ALH A;  7ICV A;  4RPX A;  1NKC A;  1NK0 A;  1ZQN A;  2MA1 A;  4EX6 A;  4ECR A;  4RUC A;  2KFZ A;  2C2E A;  8ICO A;  3IHQ B;  4Y2U A;  2OEH A;  4F92 B;  7ICO A;  1S76 D;  4AYB C;  4QWD A;  4IS7 A;  1S0V A;  3MGH A;  4MF8 A;  5AM3 A;  1HIW A;  4ELT A;  2CPR A;  5AK6 A;  9ICO A;  5J0O A;  1MN8 A;  2WF6 A;  8ICU A;  4KX5 A;  1RYS A;  1ZRN A;  4GIB A;  3H8M A;  3G6V A;  3UQ2 A;  2HBL A;  4YG2 A;  1QTM A;  3KD3 A;  2QB0 B;  3ETL A;  2I5H A;  3Q8P B;  1NZB A;  1MQ3 A;  5ALL A;  5J2E A;  3SMV A;  2KZZ A;  4X5V A;  2O6K A;  2HHS A;  1KDH A;  5CR0 A;  4QZG A;  2W9C B;  2BPC A;  1ZQR A;  2W7O A;  3HWT A;  5TIS U;  2W8K A;  1IV8 A;  4F4K A;  2W11 A;  2JV3 A;  4M0A A;  3MFH A;  4DOB A;  1X2I A;  3QU7 A;  3SQI A;  1JXE A;  2NRZ A;  2NYV A;  7ICM A;  3TFS A;  4CF4 A;  2QAR B;  2HOF A;  2H3Z A;  1MQ2 A;  5KG0 A;  4RQ3 A;  1L5U A;  4F91 B;  2KVS A;  8ICM A;  5KFD A;  2DKX A;  2HHQ A;  4I28 A;  5AKY A;  2XC9 A;  5AKJ A;  3HT3 A;  3FM9 A;  3C2L A;  3ZDA A;  1ZQS A;  2ZIX A;  2JR5 A;  3Q8Q B;  2W3S A;  4DL3 A;  2VJ5 A;  4K4I A;  2FMS A;  4ELU A;  2NV3 A;  3QU9 A;  2LM4 A;  3KKA C;  4OJO A;  2HDO A;  7ICL A;  4ECQ A;  3T3F A;  3QEB Z;  5L1J A;  1NJX A;  5J0W A;  1XWL A;  2LPE A;  3H0M B;  2FDR A;  3F53 A;  2NRV A;  2XGP A;  3TI0 A;  4PGX A;  5EWF A;  3MGI A;  3BQT A;  2ESE A;  2J6S A;  5IIO A;  3PNC A;  4C80 A;  2FLN A;  4UB6 U;  4B9N A;  3SV3 A;  2OWO A;  4PL1 A;  4M47 A;  3FDS A;  7ICP A;  4F5P A;  4IQU A;  4F5R A;  5J2B A;  1A6S A;  5ALR A;  1L7P A;  5DGA A;  2BDP A;  1P7D A;  5AM2 A;  2H3I A;  4O3O A;  2KZ3 A;  4ICA A;  5AKG A;  2RRD A;  3Q8R B;  2ASD A;  1U47 A;  4NL9 A;  3D2Q A;  3GIK A;  3TQ1 A;  4ED0 A;  3DEE A;  9ICG A;  1SKR A;  2WB1 C;  3L3F X;  4C0Z A;  4C8M A;  3ZDC A;  4KX3 A;  4JB3 A;  4QWA A;  3LVV A;  3NVY A;  5ALF A;  3AQE A;  5CEH A;  1WG8 A;  2BDU A;  2FJ6 A;  3GZF A;  2BQR A;  8ICB A;  4TQS A;  2PI4 A;  4JV1 A;  4NY8 A;  2HW3 A;  1T4G A;  5KTQ A;  9ICN A;  1LKY A;  3DDH A;  1PK3 A;  1LVH A;  3PW5 A;  2FMP A;  2FE9 A;  2DGZ A;  1EXN A;  4C8K A;  2JHD A;  3MR5 A;  1NJZ A;  1TKD A;  5KT5 A;  8ICT A;  4O3P A;  9ICL A;  4QZF A;  2EAN A;  4DF4 A;  4ECX A;  3IRU A;  3U26 A;  7ICG A;  2LM1 A;  1K5O A;  5KFX A;  5ALV A;  4UB1 A;  1L3V A;  3PW0 A;  3PW2 A;  4B9S A;  4ECZ A;  5J0X A;  4FFD A;  2IA6 A;  1RXW A;  4K4G A;  3WKE A;  3HKZ C;  5HML A;  2JGA A;  3WK6 A;  8ICZ A;  1QH9 A;  4DFJ A;  5ALO A;  4Y2Q A;  3WK4 A;  2MUT B;  3OJS A;  4M9L A;  4TUP A;  4RQ4 A;  5AKL A;  4R8U B;  3M8R A;  4KN4 A;  5ALK A;  4UAW A;  3H7I A;  4UB8 U;  3RJG A;  1JUD A;  3UXN A;  1CRX A;  2I1Q A;  4IC9 A;  3B0Y A;  4DSI A;  1Q3U A;  5J2C A;  2DQN B;  3K75 D;  4RQM A;  1ZQI A;  4BWJ A;  2KD1 A;  5AI5 A;  2BPF A;  4P4P A;  2WF7 A;  2XY7 A;  4MEY A;  2EAO A;  4OO1 J;  4QZE A;  5E79 U;  3RRH A;  2Y0S C;  7ICQ A;  2JH1 A;  7ICT A;  5ALX A;  2W9B A;  9ICW A;  2DF4 B;  1NKB A;  1BGX T;  3BS7 A;  4RPY A;  3PMN A;  3WU2 U;  3VC8 A;  9ICI A;  4OJL A;  1XSL A;  1T8E A;  4M9J A;  1JX4 A;  1S0M A;  4EZ9 A;  8ICY A;  2LBO A;  2QAR A;  3PO4 A;  2WAQ F;  2D3D A;  4I2I A;  5J2A A;  5HNK A;  4NWI A;  5EWE A;  2NO4 A;  3JPP A;  3BZK A;  2H3F A;  4DSE A;  2ZIU B;  3ED5 A;  2LYH A;  3OSP A;  4Y2Y A;  4GC7 A;  3L4P A;  2NRX A;  5KFE A;  2E8O A;  2HCF A;  5ALS A;  1ZQT A;  2D8C A;  3N97 B;  1XO0 A;  3FC4 A;  2G09 A;  3IDW A;  4OJP A;  3PST A;  5KFU A;  2J6T A;  4DL5 A;  1N60 A;  2HHV A;  3H40 A;  1ARO P;  3H4B A;  3UXO A;  3NGD A;  2EH9 A;  2K4E A;  3N7R C;  1PZN A;  8ICX A;  5KFA A;  2ZUD A;  2I6X A;  3O0F A;  2A19 A;  4NLG A;  3Q8L A;  5AK5 A;  5L9X A;  1ECW A;  3HP6 A;  4J9M A;  3JPS A;  4Y2J A;  2KZM A;  3H0R B;  4QWC A;  4KLG A;  1QSY A;  3F2B A;  1BPX A;  2H5X A;  1B22 A;  4XRH A;  3EPG A;  4B6J A;  4EEY A;  5J0Y A;  5KT6 A;  3AU6 A;  3NRW A;  1KL9 A;  1DRG A;  1TE2 A;  2H3Q A;  2F3N A;  4GLX A;  5DQI A;  3C28 A;  4BWM A;  4F3O A;  8ICP A;  2UVU A;  2KJ8 A;  3LWL A;  5AK3 A;  4C7Z A;  2AGP A;  5J8Y C;  1NKE A;  4TUS A;  2CRX A;  2AXT U;  4MF2 A;  3NVZ A;  2F1H A;  1L3S A;  2I9G A;  1F0M A;  3PR5 B;  7ICS A;  4KLI A;  3Q8K A;  1KKX A;  4U6P A;  3QZ8 A;  4FS1 A;  5DG7 A;  1BPB A;  3BDP A;  3QU2 A;  3SZ2 A;  2R8J A;  1A76 A;  4DFK A;  1ZD5 A;  1YZ7 A;  4CCH A;  4P0P A;  5DQG A;  3UMC A;  2M0N A;  4BJQ A;  3DV9 A;  1PUZ A;  1QSL A;  2FPL A;  2PMZ F;  4JMU A;  3QXG A;  3SAG A;  1V97 A;  4NM2 A;  3J81 j;  1ZXI A;  1WWV A;  2H3V A;  3GV7 B;  2K60 A;  5J0R A;  1X6J A;  4O5K A;  4ED2 A;  2AU0 A;  2YMQ A;  4DO9 A;  4KMO B;  5KFW A;  2A1J B;  2KG5 A;  3PW7 A;  2CXY A;  2YQE A;  8ICJ A;  5K4L A;  1DOQ A;  4J9Q A;  2XY6 A;  1ZQP A;  3RB4 A;  2MSN A;  3SR6 A;  2KIC A;  2LYA A;  5EE9 A;  3SI8 A;  2NO5 A;  4I2G A;  4DLE A;  1Y88 A;  4UB3 A;  5KT2 A;  3FYH A;  2KSO B;  1TAQ A;  4R65 A;  5J2F A;  3E2E A;  1VLB A;  2DPJ A;  3HRD D;  3G6X A;  4F4X A;  4R8U A;  5J0T A;  3NTU A;  3M6Z A;  3K4G A;  1BNP A;  1NI3 A;  3TAP A;  4P2H A;  4Y2X A;  2YTU A;  5AM4 A;  5AI8 A;  2HHT A;  2KK0 A;  5DLG A;  2R8K A;  2Q0Z X;  2BGW A;  2CN1 A;  2YB1 A;  5ALG A;  1JXL A;  5DLF A;  2KJ5 A;  1NK7 A;  3RH5 A;  1NK8 A;  3KTQ A;  2YB4 A;  3N4M B;  1SWW A;  2MU2 A;  1NK4 A;  4YD1 A;  1Z19 A;  3I76 A;  5F9N A;  1KFD A;  2IOF A;  2JMG A;  2VIX A;  2W03 A;  9ICH A;  1ZQX A;  3Q8S B;  2HHX A;  1JMS A;  2OH2 A;  5F9L A;  1IIP A;  4R66 A;  1SV0 A;  4R64 A;  3AMZ A;  4G3I A;  4RQ7 A;  1RQL A;  2E8N A;  1SWV A;  1S8O A;  1JI7 A;  4EEN A;  3V7K A;  3UMG A;  3PX4 A;  5KFS A;  3WK5 A;  8ICS A;  4M9N A;  1ZQG A;  3M8S A;  9ICU A;  2YML A;  1X40 A;  3IG8 A;  1N62 A;  3JPQ A;  4F5O A;  4F50 A;  5KT4 A;  2K89 A;  3C5F A;  3T5L A;  4GFJ A;  4PL2 A;  3TAQ A;  3V7J A;  3R9K A;  3N7P D;  3QU4 A;  3V6K A;  2ZIV B;  2J6U A;  3OGU A;  5J0S A;  3JPO A;  2W55 A;  1ZD3 A;  1M6Y A;  2UVV A;  4M2Y A;  2NRW A;  2L5Y A;  2P35 A;  7ICJ A;  4AYB F;  3LWM A;  1MA7 A;  2YN4 A;  5DBA A;  4NXZ A;  5F3X B;  1PK1 B;  1L8L A;  4BUG A;  1SL1 A;  1ZQD A;  3KZI U;  2W9M A;  3RH4 A;  3E58 A;  4Z6C A;  2BCR A;  4DQP A;  1L8O A;  2OXO A;  2KMD A;  4UB2 A;  1TK0 A;  5AKI A;  4CF5 A;  5L1K A;  2K8C B;  4DS4 A;  3WKC A;  2VJ4 A;  2EZZ A;  3GII A;  8ICF A;  3WK7 A;  2F77 X;  3KBB A;  1U4B A;  2WTF A;  3KHG A;  7ICU A;  5HHI A;  2LI6 A;  2HSZ A;  3ZDD A;  5III A;  2NRT A;  4DQR A;  4QZ8 A;  3NUQ A;  3GIL A;  2HOI A;  2IHM A;  5AM0 A;  3C2K A;  1DGS A;  4F4W A;  4QW9 A;  4YMM A;  4RNM A;  2ZIW B;  3H8S A;  1ZQK A;  2A1J A;  4FZN A;  4UAR A;  2ZJA A;  2DUY A;  5KG1 A;  1S0O A;  4DEZ A;  1BPZ A;  4CRX A;  3RB3 A;  5H2F U;  5AKZ A;  1ZOL A;  4EBE A;  2RHF A;  2KSO A;  4I29 A;  3C1Z A;  2W43 A;  1NK9 A;  5KFT A;  1ZQU A;  8ICR A;  4CE6 A;  2Q4T A;  3PW4 A;  4P0Q A;  3WKB A;  3I1Y A;  1Z1V A;  2IOF K;  4O0I A;  4A8E A;  4ACO A;  2C2R A;  2HMX A;  3MGV A;  5DG9 A;  2FI1 A;  9ICB A;  5KT7 A;  3RJJ A;  2GH1 A;  4LZD A;  2ZXI A;  3M6K A;  2ZTC A;  4Y2P A;  4RQN A;  1X6I A;  4YCX A;  4CF3 A;  2R8H A;  3T5J A;  5KG3 A;  9ICR A;  3RBD A;  3QNM A;  3SAH A;  4ECT A;  1IG6 A;  4PH5 A;  4JWN A;  3MDA A;  4I2D A;  1KQQ A;  4DL4 A;  1ZQJ A;  3C1Y A;  4P4M A;  5A0L A;  3MFI A;  4KLS A;  1N2X A;  1NK6 A;  3KHL A;  2OYY A;  1RPL A;  1PVQ A;  4PHP A;  1V85 A;  5C0Y A;  3OSN A;  4KLT A;  5L1M A;  1N5W A;  4M9G A;  2W9A A;  2GO7 A;  3T5K A;  4KMU A;  1XSP A;  3ZD8 A;  3BZC A;  1SGG A;  2WB1 F;  9ICM A;  4R63 A;  1N63 A;  1ZQY A;  3HIL A;  4Q8E A;  2EDU A;  3RJI A;  4IQV A;  4ECV A;  3KHH A;  3C5G A;  4I2H A;  2ZXH A;  1JAL A;  1KEJ A;  1Z4N A;  5IIL A;  4US8 A;  1IM4 A;  4Q8F A;  1XO1 A;  1ZD2 P;  4O9M A;  4LVS A;  4UAY A;  5DQH A;  5CB1 A;  1TV9 A;  3CRX A;  4Q44 A;  1B4F A;  2WF5 A;  3RJE A;  9ICV A;  1UQV A;  3MAB A;  1T7P A;  4Y2V A;  5ALY A;  4P4O A;  2G07 A;  2E8P A;  1ZQA A;  4ED7 A;  3TKA A;  2JEG A;  5HMM A;  2JXJ A;  4RQ5 A;  2V9W A;  5CP2 A;  1FEZ A;  1Q8K A;  2HVI A;  5KG5 A;  1QQ5 A;  1L7N A;  1ZQZ A;  4GXK A;  2QB0 A;  2IOH A;  4J9K A;  1L7O A;  5IIK A;  5AKH A;  1COO A;  4EEK A;  2AQ4 A;  3LVW A;  1ZQM A;  2Y1J A;  4FZM A;  5DB7 A;  2KHQ A;  4JUZ A;  7ICK A;  2W9C A;  2Y9U A;  3HKZ F;  5FP0 A;  4MHV A;  4ECY A;  3RJK A;  4MFC A;  1PK1 A;  1S0N A;  2ZG6 A;  4IR1 A;  5AK4 A;  4DSJ A;  1RYU A;  3PX0 A;  3A0H U;  5AM1 A;  8ICA A;  2XIC A;  5KT3 A;  1KLN A;  1J2M A;  3QU5 A;  1J97 A;  3LYS A;  1ZQL A;  3EYZ A;  1MSW D;  4DWI A;  5KFZ A;  2K4P A;  3ZD9 A;  1UHU A;  7ICE A;  1XC9 A;  4FZL A;  4KIT B;  2BZF A;  3D6J A;  5IIN A;  5J2G A;  1KFS A;  4B9U A;  2C2D A;  5J0U A;  4DOA A;  4TUQ A;  2HBM A;  5D46 A;  2GWS A;  1TAU A;  4I2F A;  4PHE A;  3PX6 A;  2ATL A;  5ALT A;  2HOQ A;  1TAM A;  3MC1 A;  4KTQ A;  3TAC B;  5KG6 A;  5AKE A;  4DCC A;  4J9L A;  5ALJ A;  4ED6 A;  3F2D A;  4DF8 A;  4BDP A;  3RFA A;  2E1F A;  2LKY A;  4OJ6 A;  1NOM A;  3CW2 C;  4F5N A;  4I2B A;  3ZDB A;  4UQG A;  1ZQQ A;  4UAZ A;  2K8B B;  4QIW C;  2DPI A;  2KKV A;  2ASJ A;  4UB4 A;  4RT3 A;  5GTH U;  3THV A;  3AQF A;  2JEJ A;  2KJ9 A;  1ZQH A;  4Y2S A;  2HHU A;  1QQ6 A;  2VKQ A;  5KAI U;  3E0F A;  3MDC A;  2JRZ A;  5BOM A;  3RBE A;  4Z6F A;  1KSP A;  3F5A A;  2PFQ A;  4C4R A;  2W54 A;  1SL2 A;  2PFP A;  9ICS A;  4UAS A;  3RAQ A;  4NM1 A;  3QUC A;  3SAF A;  2R18 A;  5KFO A;  1DXS A;  1OXJ A;  5HR6 A;  3ETR A;  3OHB A;  4F93 B;  5KFI A;  5DG8 A;  1VDV A;  5ALQ A;  5JUM A;  4I2E A;  4RNO A;  1D8Y A;  5KFH A;  1ZQO A;  3PV8 A;  4C4S A;  1K1S A;  4ECS A;  4DSL A;  5B5E U;  3SD7 A;  9ICJ A;  1QSS A;  5DKW A;  2PXI A;  4NL9 C;  2N1R A;  3D2N A;  1PVP A;  1SZH A;  8ICC A;  3KKA A;  3TFR A;  1BVS A;  3BJY A;  4Y2T A;  3RJF A;  1KN5 A;  2KIV A;  8ICE A;  3ORY A;  3V6H A;  3GU3 A;  3HJE A;  2G0A A;  2WHE A;  2KIW A;  4EEL A;  1S9F A;  5KFJ A;  1RM6 C;  2MRL A;  4KN7 A;  4QZB A;  2E8M A;  1A0P A;  8ICW A;  4UBC A;  5KFR A;  5TZV A;  1IXR A;  2QLT A;  5HR7 A;  4RQ0 A;  3UPQ A;  2BCS A;  1DK3 A;  3IG5 A;  3PSI A;  4PGQ A;  3EWA A;  2R8G A;  3QUT A;  7ICI A;  4PGY A;  4MEX A;  1F44 A;  2PI5 A;  4MFA A;  9ICC A;  3RTV A;  3IV6 A;  2MUT A;  4DS5 A;  3PSF A;  3MR6 A;  3PY8 A;  5J2H A;  1COK A;  3M9M B;  4PPX A;  1BPE A;  1ZQB A;  3C23 A;  8ICQ A;  8ICI A;  1RG6 A;  3GV5 B;  4NLC A;  5CWR A;  3Q8M A;  4TUR A;  2GLE A;  1N61 A;  5EE0 A;  4CGZ A;  2ZTD A;  5AKK A;  3KHR A;  2ODG A;  1QCK A;  5ALE A;  5J0Q A;  3QZ7 A;  5D49 A;  4UBB A;  2QB1 A;  3H8W A;  5CA7 A;  1D8B A;  1SZP A;  2RP5 A;  2ZUB A;  4QZ9 A;  1C7Y A;  7ICF A;  3NAS A;  1V9P A;  4XQ8 A;  2A3V A;  4EZ6 A;  2UVR A;  5ALU A;  5J2I A;  2LYB A;  4UW9 A;  4I27 A;  3AEV A;  4IRC A;  9ICE A;  2DFL A;  3ZDE A;  5AI0 A;  4I2J A;  3TAN A;  3V7L A;  3BQ7 A;  2B0C A;  4XA5 A;  5CHG A;  4KLU A;  3RR8 A;  2Z7J A;  3RB0 A;  4B9T A;  3B9J A;  2DBY A;  2ZIU A;  2RDI A;  2KFN A;  2YMP A;  4KLE A;  4YXJ A;  4LZG A;  4BX9 C;  4YR2 A;  5J0P A;  3B0X A;  5AIA A;  4DQI A;  1YT3 A;  4UAU A;  5EWG A;  1NZP A;  4J9P A;  1Z3E B;  2BCU A;  2KKP A;  2K8A A;  2VA8 A;  8ICL A;  4PHA A;  4DL6 A;  1TVA A;  3D2S A;  4YMO A;  4XUS A;  3EW9 A;  2BR0 A;  4KLM A;  1TK5 A;  2FPM A;  2UVW A;  2YY6 A;  2F8L A;  3MBY A;  3ISD A;  3PO5 A;  4PHD A;  1U9L A;  1CI4 A;  3TAD A;  3F5E A;  1ZRM A;  3GFK B;  1CEZ A;  1T3Q A;  2ES6 A;  3FAH A;  1X9S A;  3SV4 A;  9ICT A;  2WF8 A;  3K1R B;  1MC8 A;  3I28 A;  4OJ5 A;  1RQN A;  5DGB A;  3H8J A;  2AGO A;  1SXE A;  2LHT A;  5ALP A;  1L6N A;  4ECW A;  2XI9 A;  4C8O A;  2KP7 A;  5J2D A;  1KBU A;  4QZI A;  4RQ8 A;  3K1Z A;  1X66 A;  3QUB A;  4O3N A;  1JN3 A;  5KL8 B;  4C8L A;  3KOO A;  3C29 A;  1X9W A;  3KZX A;  4JV0 A;  3H4D A;  1U48 A;  3HW8 A;  2W04 A;  2QKQ A;  1SKS A;  2LMR A;  3IM1 A;  3WKD A;  3UQ0 A;  3VCB A;  2W3R A;  4BXO B;  2ISO A;  4PZN A;  9ICA A;  5ALW A;  5ALI A;  4KLL A;  4EBD A;  8ICK A;  2W9B B;  5CRX A;  5BPC A;  2C22 A;  4Q43 A;  1ZQF A;  5KG2 A;  2KTQ A;  3GIJ A;  1N56 A;  2AH5 A;  5AKX A;  5KFL A;  4PJ0 U;  3MR2 A;  3C2M A;  1T3N A;  3CYM A;  1RYR A;  4DFM A;  2DWQ A;  3BQ2 A;  2ALZ A;  3IP4 B;  2KE7 A;  4FS2 A;  4LJX A;  4DLG A;  3HX0 A;  4QZD A;  2M9N A;  4EYI B;  2YMM A;  5KG4 A;  1ED1 A;  1DGJ A;  5KG7 A;  1OUQ A;  2IBK A;  4BGD A;  3RH6 A;  3BQ0 A;  2GOL A;  2OCE A;  5J2K A;  4YR3 A;  4J9S A;  3RJH A;  4MFF A;  5GTI U;  4DL7 A;  4NLK A;  1FIQ A;  3C21 A;  1NJW A;  4KLO A;  9ICK A;  1NJY A;  4RT2 A;  2KVC A;  1XSN A;  1UA1 A;  4O3S A;  1XU4 A;  4G9B A;  1S97 A;  4QJF B;  3ONN A;  9ICX A;  1QQ7 A;  4HAI A;  1BPY A;  1D9D A;  4JK1 A;  1BNO A;  2AQ0 A;  1FO4 A;  3V6J A;  5J29 A;  1SXD A;  4GXI A;  1D8L A;  4DFD A;  5L1I A;  3IN5 A;  3N7S C;  3ISB A;  1FFU A;  4RQ2 A;  5J8Y A;  9ICF A;  2VA3 A;  2E5S A;  4M6W B;  5JTI A;  4ECU A;  2DL0 A;  2R8I A;  2ZJ5 A;  3BQ1 A;  4O5E A;  4OD0 A;  1NNL A;  3QYP A;  5EE3 A;  4KLQ A;  5DB8 A;  1C20 A;  1KFT A;  4O3R A;  3WKA A;  2G06 A;  3AU2 A;  3M9O B;  4FE3 A;  4PZO A;  2XCP A;  5DB6 A;  7ICH A;  2JZB B;  2EZY A;  5AHX A;  2W7P A;  4J03 A;  5KFC A;  2BQ3 A;  3RR7 A;  5BOL A;  1T94 A;  2HVH A;  1JIH A;  3NRZ A;  1H38 A;  5HHH A;  2EZX A;  2FLL A;  4KLJ A;  4RQ1 A;  4Y2R A;  4UB5 A;  5KFV A;  8ICG A;  2HBK A;  5ALM A;  3AUO A;  2E3T A;  4YD2 A;  4IQW A;  1UT8 A;  3L5K A;  2RLT A;  4J9O A;  1N5X A;  2IHN A;  4P0P B;  1ZQ1 C;  1WYG A;  5DDY A;  4M9H A;  2RQ5 A;  4YP3 A;  1LB2 B;  1SV4 A; 
#chains in the Genus database with same CATH homology
 2DKX A;  2L5Y A;  1Z1V A;  3TAD A;  3BS5 A;  2ES6 A;  2QB0 A;  1LKY A;  1COK A;  3K1R B;  5J8Y C;  1PK3 A;  5JU5 A;  5F3X B;  1PK1 B;  2QAR A;  5JRT A;  1WWU A;  2FE9 A;  1SV0 C;  2D3D A;  2B6G A;  1RG6 A;  3KKA C;  1DXS A;  1OXJ A;  1SXE A;  4RQN A;  1F0M A;  1X9X A;  1SXD A;  2GLE A;  2Y9U A;  2KMD A;  2EAN A;  2Y9T A;  4MHV A;  1PK1 A;  2LPE A;  2EAP A;  1X66 A;  2QB1 A;  1UCV A;  4IS7 A;  2E8O A;  2ESE A;  1V38 A;  2D8C A;  5J8Y A;  4NL9 C;  1V85 A;  1SV0 A;  2EAM A;  5JTI A;  3IDW A;  5L1M A;  3TAD C;  2DL0 A;  2K4P A;  2QKQ A;  2LMR A;  3KKA A;  2E8N A;  1WWV A;  4PZN A;  1JI7 A;  2K60 A;  2KIV A;  1SGG A;  3BQ7 A;  5KNI A;  4NJ8 A;  3HIL A;  3H8M A;  2KG5 A;  4PZO A;  1X40 A;  2QB0 B;  2E8M A;  1B0X A;  4NL9 A;  3TAC B;  3SEN A;  2F44 A;  2KSO B;  2KE7 A;  4RQM A;  1B4F A;  3SEI A;  1UQV A;  1OW5 A;  2F8K A;  2DKZ A;  3BS5 B;  2E8P A;  2JV3 A;  2KSO A;  2EAO A;  1LKY B;  1KW4 A;  2QAR B;  2F3N A;  2YTU A;  3BS7 A;  1SV4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...