3BQ7A

Sam domain of diacylglycerol kinase delta1 (e35g)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
68
structure length
68
Chain Sequence
RPVHLWGTEEVAAWLEHLSLCEYKDIFTRHDIRGSGLLHLERRDLKDLGVTKVGHMKRILCGIKELSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Regulation of Enzyme Localization by Polymerization: Polymer Formation by the SAM Domain of Diacylglycerol Kinase delta1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Diacylglycerol kinase delta
total genus 23
structure length 68
sequence length 68
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.1.107: Diacylglycerol kinase (ATP).
pdb deposition date 2007-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3bq7A00
2DKXA 1OW5A 4NL9A 2YTUA 1WWUA 1SV4A 1PK1A 2QB1A 1DXSA 2KSOA 1PK3A 2KIVA 3TADA 3KKAC 1OXJA 2KMDA 1UCVA 1V85A 4IS7A 2LMRA 3SENA 5JU5A 1SXEA 3IDWA 2E8OA 3BS5A 1B0XA 2D8CA 2EAOA 2D3DA 1V38A 4PZOA 1SXDA 1JI7A 3SEIA 5JTIA 2L5YA 2KE7A 3HILA 1SV0A 2LPEA 2EAMA 2KSOB 2QB0A 3BQ7A 2ES6A 3BS5B 1UQVA 5KNIA 2EANA 2EAPA 4RQNA 1X40A 5L1MA 2K4PA 1SGGA 2E8MA 2ESEA 1F0MA 2DKZA 5J8YC 2QKQA 4RQMA 1WWVA 2E8PA 1LKYA 1Z1VA 2K60A 4PZNA 2B6GA 5J8YA 1RG6A 2QARA 3K1RB 1X9XA 3BS7A 3TACB 2GLEA 2KG5A 2FE9A 4NJ8A 2Y9UA 2QB0B 1X66A 1SV0C 2Y9TA 2F44A 4NL9C 1B4FA 3H8MA 1KW4A 1PK1B 2QARB 2JV3A 2DL0A 1COKA 3KKAA 4MHVA 3TADC 5F3XB 5JRTA 1LKYB 2F8KA 2F3NA 2E8NA
chains in the Genus database with same CATH superfamily
2YN4A 2OM6A 3D2NA 3RJHA 3F2BA 7ICLA 5AI0A 5J0QA 5J0XA 4QJFB 4PGYA 4NLBA 4KLOA 2KJ5A 1SZPA 4ED0A 4M0AA 1KFTA 1L8OA 3T5JA 4JUZA 2P66A 3H8SA 4O3QA 3WKDA 4P0QB 5JU5A 4EEKA 4ECUA 4ECVA 5L1JA 2J6SA 4NV0A 3OJSA 1NNLA 4HAIA 4B9MA 3C2MA 5AKZA 1H38A 5J2DA 1UT8A 5DB6A 5ALNA 3RJEA 4TQSA 2BR0A 4EEYA 3M9OB 1JX4A 2FMSA 3E2EA 4Y2YA 4ED3A 5IIIA 1X9WA 1PVQA 1KBUA 4F2RA 4UATA 1UA0A 4KITB 8ICRA 3M6KA 3RH5A 2G0AA 2IHMA 8ICGA 1KDHA 4UAZA 2PFPA 1WWVA 1IXRA 4BDPA 5ALWA 7ICQA 5J8YA 1RG6A 1ZQCA 3D2QA 2KKPA 1N62A 2EZZA 5J2CA 3CP8A 3M1YA 2H3VA 4NJ8A 4I2DA 1TFRA 2A1JA 4NL9C 3LDAA 5HP4A 1S0NA 4B9LA 1Z4OA 1ZD5A 2RRDA 2YMMA 5ALOA 4RPXA 1ZQEA 5KG4A 2JEGA 3SAHA 4UB6U 5F3XB 2AU0A 1SKSA 1HIWA 4YXJA 4DSIA 4B6JA 4EX6A 2XGPA 2HHTA 4KLDA 1SZHA 4PHAA 4DQQA 4CNQA 4RNMA 3OJUA 4DWIA 5KAIU 1B22A 3RJGA 4K4HA 2MSNA 2XICA 4FS1A 3AMZA 5KFNA 2LMRA 4ELTA 1FFVA 1N61A 5J2EA 2CXYA 2ISOA 5KFIA 3ETRA 5KG2A 3PR4A 1XWLA 2FLPA 1EXNA 5E79U 3WK4A 5ALMA 2LBOA 2QLTA 2A19A 3NS1A 4PZOA 3M8RA 2W7PA 5G5GA 4NY8A 2KOBA 5KFEA 3C21A 3KBBA 4KLLA 4EZ9A 2H3QA 2P35A 4RQNA 3GU3A 1SL1A 2JMGA 2E5SA 2ZIVB 4F2SA 2ZG6A 1L3TA 3PNCA 2BDPA 4UB4A 1LKYA 5AK3A 5J29A 3V7KA 1ZQQA 2FDRA 3TFRA 1ZQOA 4F4YA 1KEJA 3K1RB 2AGQA 1X9XA 4PGXA 3FC4A 2DGZA 5DB8A 1VDVA 5KFLA 2RDJA 4EBEA 1QSYA 4DLGA 1NJYA 2F1JA 4FBTA 3AL0B 2A1JB 3QNMA 4IRKA 2V4QA 4JV1A 4PGQA 4F4WA 4UAVA 1PK1B 3SI8A 4JMUA 3D6JA 1RYSA 3M7DA 2ZXIA 5AM3A 1ZQDA 1RQNA 2F8KA 2PMZF 3EW9A 4J9MA 2KIWA 1QSLA 3FAHA 3DV9A 3RJFA 4X5VA 7ICMA 3RAQA 7ICKA 5AI8A 3QU4A 2LM1A 7ICEA 2QB1A 4Q44A 5J2BA 3NRZA 2FMQA 3PW5A 4TUPA 3NGDA 2W03A 4IC9A 4IS7A 2LYHA 4IR9A 5ALIA 3MBYA 9ICLA 4ELVA 1KKXA 7ICJA 8ICKA 2AXTU 2XGQA 2ZIUA 4C7YA 5CB1A 4QZBA 2IMWP 2W43A 2XY5A 2BCQA 1CI4A 2LYAA 2ZTCA 3AEVA 1BPBA 3F5AA 5KFYA 3B0YA 4PHPA 2K8BB 4RZRA 4YXMA 4C0ZA 1RXVA 4G3IA 4F92B 5J0TA 4NLZA 2NRXA 2K60A 2W9CB 2EQYA 4TQRA 2QARA 4DCCA 4YD2A 2G07A 4F4XA 4Y2RA 4GLXA 4XQ8A 4OJ5A 4UB8U 3NVZA 1KSPA 4O5KA 5KT6A 3UPQA 1ZJMA 2K89A 2B0CA 4KLHA 2W7OA 5DQGA 1ZOLA 4O5EA 2EZXA 4ECSA 4O3RA 4GC7A 5KT7A 4EYIB 2HMXA 2VJ5A 3T5LA 3QZ8A 2BHNA 3PZPA 1NK4A 2VJ4A 2ZIVA 5DDMA 4DSKA 2HHVA 4US8A 2AQ0A 4KLMA 4DQRA 2NV3A 7ICUA 5AKKA 3AM9A 4B9TA 1WWUA 4RQ0A 4O5CA 1ZQVA 2GH1A 2W9BA 3QUBA 5L1KA 1L3SA 1X42A 4TUQA 3MC1A 8ICTA 4CGZA 4RPZA 2ODGA 2ZXHA 1NZPA 8ICNA 3UMBA 1U49A 4RQ1A 5DBAA 1TKDA 2D8CA 5AKGA 1ZQXA 4DSJA 4NLNA 1S0VA 5KFPA 5JTIA 4M6WB 1MA7A 2EDUA 3I76A 4GXIA 3PVXA 4F5RA 2NRVA 1X9MA 2YX8A 3AQFA 3C29A 4OJOA 3V7LA 3PY8A 1ZRMA 1T3QA 2AJQA 4DQIA 3ZDEA 2V4RA 9ICUA 3SV3A 2KHVA 3OHBA 4I2BA 2B6GA 2XVTA 1ECWA 3RH4A 4UAYA 3WK5A 4ECYA 4UW9A 3FM9A 4QW8A 3PW0A 3JPRA 4QZ9A 1ZQRA 1WCLA 2JRZA 3EPGA 3CYMA 4GIBA 1X66A 5J2GA 5DQHA 2AGOA 3C5FA 1L6NA 2BDUA 2HHXA 3RF9A 1ZQKA 2DL0A 3ICXA 5DLGA 4P4OA 2NRTA 3TARA 4YG2A 1QSSA 2FJ6A 4F5PA 3EYZA 3M6ZA 4IQVA 4O9MA 3VCBA 1C20A 4DL6A 1NK6A 1XNSA 2KN7A 4F4ZA 1T7PA 2DF4B 4Y2JA 5J0PA 1PK3A 2W9BB 1L8LA 3F2DA 3OHAA 2BCUA 5CHGA 7ICSA 1L7OA 1BNPA 3QX7A 4B9VA 2ZIXA 4E0DA 4OJPA 4RQ2A 1ZQBA 2KKVA 1WG8A 3WKBA 4C8MA 4GXKA 3C2KA 3SD7A 1SWWA 3WKAA 2BCVA 2W11A 3LWMA 1Q3VA 1LB2B 4Q8FA 4J03A 1UQVA 2XI9A 2EANA 4BXOA 1AQ6A 1Z4NA 4JK1A 3RRGA 4YD1A 2I5HA 5J2IA 3QE9Y 4ED2A 4O3NA 1BPXA 1RQLA 1S10A 4NM1A 3BZCA 5KFUA 5DQIA 5ALFA 1A0PA 1RPLA 1J97A 2JEFA 3JPNA 2Y9UA 4NXZA 2OYYA 5KTQA 3RB6A 1S97A 1N60A 2W04A 9ICEA 1CRXA 4CF4A 9ICRA 2QARB 3RR8A 3RH6A 3KOOA 5ALVA 4YMOA 2NO4A 5F9LA 2HOFA 2F3NA 1Z00B 3H7IA 2H3ZA 3T5KA 1JN3A 2FLNA 4RU9A 4DFKA 4F71A 2ZIWA 5J2KA 5BPCA 2DFLA 7ICGA 2KTQA 5H2FU 3KKAC 4IRDA 8ICPA 2ZJAA 3PW2A 1TAUA 1MC8A 3M9MB 3LYSA 4ELUA 5K4LA 3QEBZ 4AYBC 8ICBA 2KVSA 2CRXA 4NLGA 4F50A 3DEEA 1SL0A 4M9LA 2VIXA 3MDAA 4KTQA 1NKBA 3QU7A 1S8OA 1U9LA 2IOFA 2G5HB 3SEIA 4MFFA 2E3TA 4DS4A 2WB1F 2HOIA 2WF8A 3QXGA 9ICPA 2ES6A 2G06A 5CP2A 5L1IA 3E0FA 4Y2UA 1XS9D 5A0LA 4Y2SA 2DKZA 4DO9A 1OUQA 3ETLA 2JHDA 2QKQA 1NK8A 3C23A 2IA6A 4PZNA 1NKCA 1ZQLA 2FLLA 2LHTA 3EZ5A 5ALLA 4RT3A 2E1FA 3SV4A 2PI5A 5AKIA 1ZQFA 5B66U 1F5SA 3MR6A 3HP6A 3RR7A 1B43A 2IOFK 8ICFA 5JUMA 1B4FA 3BZKA 3I28A 3ZD9A 4YFKA 1S9FA 5C0YA 1UA1A 5ALZA 1X9SA 4OO1J 1ZXIA 3H0MB 2AH5A 1RZTA 5KFTA 1NK5A 4OJ6A 3ISDA 5AK6A 5KT3A 4C8OA 2OXOA 4UB1A 4I2FA 1A77A 2HVIA 5AM5A 4Y2PA 3OGUA 5AK4A 5ALRA 2I6XA 5CEHA 2PKEA 2XIDA 5HNKA 4U6PA 4KMUA 3SENA 2JEJA 2JH1A 8ICJA 5KFCA 1MQ2A 2ZUBA 3RTVA 2NRWA 1L7NA 2HBMA 3C1ZA 2V9WA 5KFZA 1BGXT 2PMZC 1VLBA 2MUTA 2M9NA 3L4PA 3UQ0A 3H40A 2C2EA 1D8YA 1T94A 4Y2XA 2QB0A 4I2EA 3BDPA 4QWDA 1RXWA 2O6KA 3MGVA 4J9PA 5ALHA 1IIPA 1TAQA 2E1EA 4Q43A 3N97B 2F76X 1ZQHA 1HJPA 2WF5A 2W9AA 5KFDA 1J2NA 4IL6U 1HUZA 2UVUA 1Q46A 3QZ7A 1XO0A 2WAQC 2W54A 3PX4A 1UPHA 8ICEA 4KLFA 4B9UA 3Q8KA 4DF8A 1QLNA 4F8RA 4Z6FA 4I27A 2ZIXB 2KNJA 2KP7A 3H8MA 5AI4A 3ZDAA 8ICHA 5CRXA 2R8GA 2JV3A 4F93B 4RQ8A 3M9NB 4DEZA 2HOQA 3Q8QB 1D8BA 1JRPA 5DKWA 3ISCA 1QQ5A 3NVVA 4NWIA 3MR5A 4PHDA 4KLJA 3H0LB 5KFJA 2M0NA 4KX3A 2VA8A 4I2CA 4QZAA 2IHNA 4I28A 1SKWA 2WFAA 5HMMA 3AU2A 4LZGA 3AQEA 4M2YA 2KJ9A 3IDWA 1NK9A 3CRXA 3N7SC 4O3SA 2B21A 4M9GA 4QZIA 3HW8A 5KG1A 2FPKA 2GO7A 4MFCA 2R8IA 1SXDA 3C2LA 5KFBA 3PSIA 4R63A 2LPEA 2EAMA 1J2MA 2GOLA 5KT5A 3PO4A 2YB4A 1DK2A 4O0IA 2FPLA 5EWFA 3JPTA 1FFUA 2Q0ZX 5J0SA 5KFOA 3QU2A 4IRCA 4C8LA 1SGGA 5D46A 4NLKA 5EE9A 1Z00A 2G09A 3O0FA 1NK0A 5J0WA 4JWMA 2BCRA 4QZGA 3IRUA 2W55A 8ICCA 1ZRNA 1FO4A 2K8AA 4M04A 3N7RC 3U26A 4PHEA 5AKLA 3HX0A 5T14A 1URJA 3HWTA 5KFHA 5KFMA 3KHHA 4QIWC 2F44A 2DPJA 2NO5A 4RQ4A 1TK5A 8ICQA 4YMMA 4ED8A 4UBBA 9ICIA 4QZ8A 3TADC 1ZQJA 4ED1A 3H4DA 2HBJA 1OW5A 5IIOA 7ICOA 3SYZA 3KHGA 1PK1A 2F1HA 4J9OA 7ICTA 2ZJ5A 1DXSA 5KL8B 4OJLA 3OSPA 3Q8MA 4RPYA 2K4IA 4DL2A 3AU6A 2MAXA 5KG0A 2C2DA 3I1YA 4DFPA 3A0HU 9ICKA 2K4EA 3ED5A 3C1YA 3PMLA 2E8OA 4QWAA 3L3FX 3MGIA 2EAOA 4KX5A 4P0PA 3HILA 4DSEA 3IP4B 4M6WA 5ALPA 3GV7B 8ICLA 5DDYA 3WK9A 3QU5A 3T3FA 2BQRA 2VKQA 1Q3UA 4KN4A 2BQUA 4USAA 2E8PA 3MABA 3GDXA 1S0OA 4CCHA 1TVAA 1N48A 2HBKA 2XC9A 3K1ZA 1D9DA 5AKXA 3BS7A 3TACB 2CN1A 3F53A 5KFKA 3R9KA 3H4BA 4MF2A 2YQEA 4YQWA 4U7CA 2JEIA 2JH7A 3G6XA 2P6UA 3PMNA 5G5HA 2R8JA 3BJYA 4YCXA 2HI0A 4EYHB 5ALYA 2XY6A 2R8KA 4F91B 4EBCA 2ASDA 2Q4TA 3CW2C 3PR5B 5GTHU 3LK9A 4I29A 4IQWA 5ALEA 2J6UA 1LKYB 3DDHA 3PW4A 2ATLA 4F5QA 3UM9A 3RBEA 1BPZA 2Z7JA 1QQ7A 5L9XA 4CDGA 1ZYQA 2Y1JA 1AROP 1DGJA 5AKYA 2W8KA 3RBDA 2KVCA 5DLFA 3ALRA 5KL1B 5EWGA 1OXJA 1UT5A 4QW9A 2KMDA 2OWOA 1PVPA 4B9NA 3QUQA 5BOMA 4Z6DA 3T5HA 1X6IA 5IIKA 1CUKA 1IV8A 4RUAA 1DRGA 1L7PA 1PZNA 4J9QA 3G6VA 2JR5A 2MA1A 1Z1BA 1SKRA 1NZBA 2PFQA 1C7YA 4C8NA 2L5YA 4PPXA 4DFJA 5DGAA 2JGAA 2KSOB 3GIMA 4M9JA 3Q8PB 1KN5A 5KNIA 3BQ2A 2A3VA 2AGPA 3PW7A 1NOMA 5KFVA 5EWEA 4AYBF 1ZQWA 1ZD3A 2HW3A 3KZIU 4I2JA 4QZCA 4KLGA 3IG5A 4C80A 1JALA 1T8EA 4QZEA 3F2CA 4JV0A 2KD1A 2GLEA 2WHEA 2LI6A 2OHFA 5ALQA 1XSNA 3KD3A 4GXJA 1ZQAA 1N63A 5CR0A 4UAUA 5IINA 5CA7A 4TUSA 4J9NA 1RYRA 4KLTA 4EX7A 1S76D 9ICFA 4PJ0U 3J81j 2NRZA 3KZXA 1U48A 4RNNA 5ALJA 4C4TA 4XA5A 2BGWA 8ICMA 3WK7A 3HJEA 4DS5A 2YMQA 4EELA 4M9NA 4A8EA 4F3OA 2BZFA 1Q8KA 2W9CA 9ICCA 3N4MB 2VA2A 1ZQZA 3UMCA 8ICZA 1SV4A 4ECXA 3GQCA 4I2IA 2YMPA 1L3UA 3IN5A 5FP0A 3H8JA 3GV8B 2JZBA 5ALXA 1TE2A 3L5KA 3UXPA 4KLSA 1ZQTA 4F5OA 4O3PA 2C28A 3E58A 1FIQA 2KZ3A 4DSLA 2Y0SC 4ECZA 1ED1A 5HHHA 4MFAA 1U4BA 3QUTA 4Z6EA 2F77X 4BJQA 1ZQ1C 1V38A 4GFJA 2F2AB 2W3SA 2ALZA 1O03A 2R18A 2W9MA 4R8UA 4EENA 1XO1A 1DGSA 5KT2A 2UVWA 3GV5B 3GZFA 3BQ7A 2BCSA 4PL1A 5CJ7A 8ICAA 2W8LA 2LM4A 4C4SA 2ASLA 3A0BU 5C5JA 2DBYA 5DG9A 1UHUA 1Z1VA 5J2HA 3KTQA 4P0PB 1QTMA 5KG6A 1D8LA 4I2GA 5AIAA 2KG5A 4NM2A 4YN4A 1VJ5A 3WU2U 1SL2A 5DB9A 4YMNA 1SB3C 5EE0A 4K4IA 3EUB2 2ZUDA 3ORYA 3GIJA 4DOBA 2WF7A 1BPEA 2CPRA 8ICYA 3ZDCA 3KKAA 7ICPA 3GILA 2YB1A 3PSFA 1NJWA 1KFDA 5AIBA 2ZUCA 3V7JA 9ICBA 5DBCA 1TV9A 5ALUA 3UQ2A 1KQQA 2YTUA 3SZ2A 2MUTB 5AI5A 8ICWA 8ICUA 4BWMA 5HMLA 2KIVA 9ICJA 2N1RA 2XY7A 3JPQA 2DWQA 1L7MA 2H3FA 1JROA 5AM0A 1JMSA 1O08A 4KLEA 5HR6A 4C4RA 4XRHA 5AM1A 3SR6A 5KFQA 3SQIA 4OCZA 3IV6A 5KFSA 3RB3A 4QWBA 1RYUA 3BS5A 2HCFA 2EZYA 2ZIWB 3FDSA 3RJIA 2MU2A 1HUOA 1ZQPA 8ICVA 1BVSA 2HHSA 2D3DA 4ECWA 5AICA 1X2IA 5DBBA 1ZQIA 1N2XA 3MGHA 2ISPA 1JI7A 5J0YA 3NVYA 2XO7A 4CE6A 4F5NA 3F5EA 1WYGA 1S77D 3VC8A 5AK5A 3ZDDA 4LZDA 1X40A 5HHIA 2JZBB 5AHXA 2E8MA 2ESEA 4P0QA 5ALSA 3QEAZ 1FEZA 3NRWA 3UXNA 2KICA 3MR3A 4ICAA 1X6JA 4QIWF 2HHUA 1QH9A 1P7DA 3LVWA 4Q45A 1KRPA 2GWSA 1MQ3A 1RM6C 3HKZF 4PH5A 3V6JA 1CEZA 2VANA 2HHQA 2J6TA 3Q8LA 4FZLA 5KFGA 3WKEA 4QWEA 3TFSA 3RJJA 9ICTA 1ZQMA 2OCEA 4Y2TA 2KEYA 5J2AA 4RQ7A 1IG6A 1KW4A 3BQ1A 2WF9A 2PFOA 4J9LA 1N5WA 5AI6A 4FE3A 1ZD4A 4I2AA 4KLUA 7ICFA 3T79A 1TAMA 4DQSA 2KV2A 5HR7A 4NL9A 1NJXA 3RJKA 1BPDA 2K4HA 1TK8A 2AQ4A 2BPFA 1TK0A 3TAQA 1KL9A 1NI3A 4ED7A 4QZDA 4FFDA 3MFIA 3RB0A 4KMOB 4QZFA 4R64A 4KLQA 3IM1A 3KHRA 4DQPA 3RFAA 2YY6A 3QYPA 1V85A 2FPMA 5DG8A 4RQ6A 4LVSA 3PSPA 2OH2A 5J2JA 5TISU 7ICIA 5EE1A 4RNOA 1S0MA 3KHLA 3G6YA 3UMGA 1MN8A 1L5UA 4ACOA 4ECRA 1D9FA 5AKEA 3C28A 2IBKA 2KHQA 2WB1C 4IR1A 1LVHA 3TQ1A 5KG5A 4DL3A 3H8WA 4YR3A 2KFNA 4BWJA 2PFNA 1F0MA 2C22A 4PL2A 2VA3A 3QUCA 9ICSA 2BPCA 4YP3A 3HKZC 4DL5A 3B0XA 2FMPA 1YZ6A 4UAWA 2HSZA 5AM4A 5AKHA 2FE9A 3V72A 5IIJA 4MEXA 5KT4A 3BQ0A 3TI0A 4QZHA 5L1LA 2W3RA 4G9BA 1KTQA 4M47A 2NYVA 1JXEA 2DPIA 5IIMA 2KZMA 5D4BA 1PVRA 1S5LU 4UASA 9ICNA 3JPPA 9ICWA 1LV5A 3C5GA 4DLEA 4DOAA 3NTUA 1Y88A 4Z6CA 2PI4A 7ICNA 5DGBA 1JXLA 4OD0A 3H0RB 2I9GA 5KFRA 3HRDD 1PUZA 3V6KA 4P2HA 2I1QA 1JIHA 4RT2A 4DL4A 3EPIA 2HHWA 3ZI4A 4WJ3B 5ALTA 4NLCA 1T4GA 1XC9A 7ICRA 1T3NA 5AKJA 2ZJ8A 4O3OA 3THVA 2ZTDA 4ZH4A 2YMLA 5D49A 4UB3A 3NVWA 5KAFU 3B9JA 5KFFA 4YVZA 4K4GA 2P6RA 4FZMA 3GFKB 4YR2A 3TKAA 5AI9A 9ICQA 3BS5B 2BKEA 4ECTA 1KLNA 3NUQA 5AM2A 1ZQYA 3OSNA 4QWCA 4DFMA 1WUDA 1NK7A 2G08A 4RQMA 4M9HA 2UVRA 3ONNA 1IM4A 2XCPA 2C2RA 2RHFA 2D6FC 4AP9A 2IOHA 4ED6A 2RLTA 5KFXA 1L3VA 2HBLA 5CWRA 5TZVA 5KG3A 5KFAA 2QB0B 5KFWA 4UB2A 3S6JA 9ICMA 2Y9TA 2F8LA 4ZOHC 2H3IA 2HDOA 3MFHA 3EWAA 1YZ7A 3GIIA 4MF8A 4J9SA 1Z3EB 2F1IA 1XU4A 1ZQUA 1U47A 4JV2A 4Q8EA 3WK6A 3K75D 8ICIA 3NASA 4FZNA 4IQUA 5J2FA 2EH9A 3IHQB 4J9RA 9ICHA 4TURA 5ALDA 3QU9A 2Y0SF 4P4MA 4P4PA 3Q8RB 2KSOA 3TADA 4C7ZA 3KFUF 3RB4A 3PO5A 2UVVA 2FI1A 4F72A 4Y2VA 2ASJA 3MR2A 1K5OA 5GTIU 3SAGA 3LVVA 8ICOA 4RQ5A 2ZTEA 3SAFA 1QCKA 4LJXA 2K8CB 5IILA 1RDFA 3K4GA 3FYHA 1B0XA 7ICHA 2LKYA 2PXIA 3CNHA 4YR0A 1V9PA 4J9KA 5ALKA 3JPOA 3PX6A 1A6SA 3RAXA 1XSPA 1SV0A 1XSLA 1COOA 1BPYA 1HEKA 3M8SA 2RQ5A 5B5EU 5BOLA 3AN1A 1V97A 4Y2QA 4BX9C 4C8KA 1SIJA 4EZ6A 4BUGA 1BNOA 5J8YC 3BQTA 1NKEA 1N56A 1M6YA 1GO3F 2KZZA 1K1SA 3SMVA 1DOQA 2MRLA 4JB3A 2AHOB 9ICGA 3GIKA 9ICAA 1JUDA 2DUYA 2LYBA 3ZD8A 7ICVA 1YT3A 3WK8A 4FO6A 3OPXA 1SV0C 3V6HA 4EBDA 3Q8SB 3AUOA 3RRHA 4I2HA 3HPOA 1ZETA 4JWNA 4ECQA 1COKA 3ZDBA 2KFZA 4FBUA 5JRTA 4GC6A 2E8NA 2WTFA 2DKXA 5DG7A 1N5XA 3ISBA 1U45A 3N28A 4B9SA 3IG8A 4R8UB 5ALGA 4DF4A 1ZQNA 3TANA 2HVHA 1MSWD 1F44A 1UCVA 4UQGA 3HT3A 3UXOA 1A76A 2KJ8A 1SXEA 1ZQGA 2WF6A 4KN7A 2DQNB 2G5IB 4CRXA 1K1QA 2BQ3A 4MEYA 4RUCA 4KLIA 5EE3A 4CF3A 1WCNA 5J0UA 1KFSA 5KG7A 4O3MA 2R8HA 4CF5A 2RDIA 4IQTA 2KE7A 9ICXA 4DOCA 5J0OA 8ICSA 1SWVA 3PX0A 5F9NA 2XCAA 3PV8A 2EAPA 2JXJA 4FS2A 1ZQSA 5L1MA 2K4PA 5J0RA 4BGDA 4DL7A 2RP5A 4RQ3A 4R65A 1QQ6A 4QNLA 3TAPA 3D2SA 2H5XA 3OTQA 4R66A 4F4KA 3PSTA 5DB7A 4HYKA 4UARA 4UB5A 2WAQF 4UBCA 9ICOA 2Y1IA 2KK0A 4XUSA 3MDCA 1NJZA 4DSFA 1ZJNA 9ICVA 2ZIUB 4BXOB 1DK3A 3WKCA 1ZD2P 3JPSA 2OEHA 4DFDA 2BPGA 3N7PD 3LWLA 2A1AA 4MHVA 4US9A 8ICXA 1Z19A 5EOZA
chains in the Genus database with same CATH topology
2DKXA 1OW5A 4NL9A 2YTUA 1WWUA 1SV4A 1PK1A 2QB1A 1DXSA 2KSOA 1PK3A 2KIVA 3TADA 3KKAC 1OXJA 2KMDA 1UCVA 1V85A 4IS7A 2LMRA 3SENA 5JU5A 1SXEA 3IDWA 2E8OA 3BS5A 1B0XA 2D8CA 2EAOA 2D3DA 1V38A 4PZOA 1SXDA 1JI7A 3SEIA 5JTIA 2L5YA 2KE7A 3HILA 1SV0A 2LPEA 2EAMA 2KSOB 2QB0A 3BQ7A 2ES6A 3BS5B 1UQVA 5KNIA 2EANA 2EAPA 4RQNA 1X40A 5L1MA 2K4PA 1SGGA 2E8MA 2ESEA 1F0MA 2DKZA 5J8YC 2QKQA 4RQMA 1WWVA 2E8PA 1LKYA 1Z1VA 2K60A 4PZNA 2B6GA 5J8YA 1RG6A 2QARA 3K1RB 1X9XA 3BS7A 3TACB 2GLEA 2KG5A 2FE9A 4NJ8A 2Y9UA 2QB0B 1X66A 1SV0C 2Y9TA 2F44A 4NL9C 1B4FA 3H8MA 1KW4A 1PK1B 2QARB 2JV3A 2DL0A 1COKA 3KKAA 4MHVA 3TADC 5F3XB 5JRTA 1LKYB 2F8KA 2F3NA 2E8NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DKX A;  1OW5 A;  4NL9 A;  2YTU A;  1WWU A;  1SV4 A;  1PK1 A;  2QB1 A;  1DXS A;  2KSO A;  1PK3 A;  2KIV A;  3TAD A;  3KKA C;  1OXJ A;  2KMD A;  1UCV A;  1V85 A;  4IS7 A;  2LMR A;  3SEN A;  5JU5 A;  1SXE A;  3IDW A;  2E8O A;  3BS5 A;  1B0X A;  2D8C A;  2EAO A;  2D3D A;  1V38 A;  4PZO A;  1SXD A;  1JI7 A;  3SEI A;  5JTI A;  2L5Y A;  2KE7 A;  3HIL A;  1SV0 A;  2LPE A;  2EAM A;  2KSO B;  2QB0 A;  3BQ7 A;  2ES6 A;  3BS5 B;  1UQV A;  5KNI A;  2EAN A;  2EAP A;  4RQN A;  1X40 A;  5L1M A;  2K4P A;  1SGG A;  2E8M A;  2ESE A;  1F0M A;  2DKZ A;  5J8Y C;  2QKQ A;  4RQM A;  1WWV A;  2E8P A;  1LKY A;  1Z1V A;  2K60 A;  4PZN A;  2B6G A;  5J8Y A;  1RG6 A;  2QAR A;  3K1R B;  1X9X A;  3BS7 A;  3TAC B;  2GLE A;  2KG5 A;  2FE9 A;  4NJ8 A;  2Y9U A;  2QB0 B;  1X66 A;  1SV0 C;  2Y9T A;  2F44 A;  4NL9 C;  1B4F A;  3H8M A;  1KW4 A;  1PK1 B;  2QAR B;  2JV3 A;  2DL0 A;  1COK A;  3KKA A;  4MHV A;  3TAD C;  5F3X B;  5JRT A;  1LKY B;  2F8K A;  2F3N A;  2E8N A; 
#chains in the Genus database with same CATH topology
 2YN4 A;  2OM6 A;  3D2N A;  3RJH A;  3F2B A;  7ICL A;  5AI0 A;  5J0Q A;  5J0X A;  4QJF B;  4PGY A;  4NLB A;  4KLO A;  2KJ5 A;  1SZP A;  4ED0 A;  4M0A A;  1KFT A;  1L8O A;  3T5J A;  4JUZ A;  2P66 A;  3H8S A;  4O3Q A;  3WKD A;  4P0Q B;  5JU5 A;  4EEK A;  4ECU A;  4ECV A;  5L1J A;  2J6S A;  4NV0 A;  3OJS A;  1NNL A;  4HAI A;  4B9M A;  3C2M A;  5AKZ A;  1H38 A;  5J2D A;  1UT8 A;  5DB6 A;  5ALN A;  3RJE A;  4TQS A;  2BR0 A;  4EEY A;  3M9O B;  1JX4 A;  2FMS A;  3E2E A;  4Y2Y A;  4ED3 A;  5III A;  1X9W A;  1PVQ A;  1KBU A;  4F2R A;  4UAT A;  1UA0 A;  4KIT B;  8ICR A;  3M6K A;  3RH5 A;  2G0A A;  2IHM A;  8ICG A;  1KDH A;  4UAZ A;  2PFP A;  1WWV A;  1IXR A;  4BDP A;  5ALW A;  7ICQ A;  5J8Y A;  1RG6 A;  1ZQC A;  3D2Q A;  2KKP A;  1N62 A;  2EZZ A;  5J2C A;  3CP8 A;  3M1Y A;  2H3V A;  4NJ8 A;  4I2D A;  1TFR A;  2A1J A;  4NL9 C;  3LDA A;  5HP4 A;  1S0N A;  4B9L A;  1Z4O A;  1ZD5 A;  2RRD A;  2YMM A;  5ALO A;  4RPX A;  1ZQE A;  5KG4 A;  2JEG A;  3SAH A;  4UB6 U;  5F3X B;  2AU0 A;  1SKS A;  1HIW A;  4YXJ A;  4DSI A;  4B6J A;  4EX6 A;  2XGP A;  2HHT A;  4KLD A;  1SZH A;  4PHA A;  4DQQ A;  4CNQ A;  4RNM A;  3OJU A;  4DWI A;  5KAI U;  1B22 A;  3RJG A;  4K4H A;  2MSN A;  2XIC A;  4FS1 A;  3AMZ A;  5KFN A;  2LMR A;  4ELT A;  1FFV A;  1N61 A;  5J2E A;  2CXY A;  2ISO A;  5KFI A;  3ETR A;  5KG2 A;  3PR4 A;  1XWL A;  2FLP A;  1EXN A;  5E79 U;  3WK4 A;  5ALM A;  2LBO A;  2QLT A;  2A19 A;  3NS1 A;  4PZO A;  3M8R A;  2W7P A;  5G5G A;  4NY8 A;  2KOB A;  5KFE A;  3C21 A;  3KBB A;  4KLL A;  4EZ9 A;  2H3Q A;  2P35 A;  4RQN A;  3GU3 A;  1SL1 A;  2JMG A;  2E5S A;  2ZIV B;  4F2S A;  2ZG6 A;  1L3T A;  3PNC A;  2BDP A;  4UB4 A;  1LKY A;  5AK3 A;  5J29 A;  3V7K A;  1ZQQ A;  2FDR A;  3TFR A;  1ZQO A;  4F4Y A;  1KEJ A;  3K1R B;  2AGQ A;  1X9X A;  4PGX A;  3FC4 A;  2DGZ A;  5DB8 A;  1VDV A;  5KFL A;  2RDJ A;  4EBE A;  1QSY A;  4DLG A;  1NJY A;  2F1J A;  4FBT A;  3AL0 B;  2A1J B;  3QNM A;  4IRK A;  2V4Q A;  4JV1 A;  4PGQ A;  4F4W A;  4UAV A;  1PK1 B;  3SI8 A;  4JMU A;  3D6J A;  1RYS A;  3M7D A;  2ZXI A;  5AM3 A;  1ZQD A;  1RQN A;  2F8K A;  2PMZ F;  3EW9 A;  4J9M A;  2KIW A;  1QSL A;  3FAH A;  3DV9 A;  3RJF A;  4X5V A;  7ICM A;  3RAQ A;  7ICK A;  5AI8 A;  3QU4 A;  2LM1 A;  7ICE A;  2QB1 A;  4Q44 A;  5J2B A;  3NRZ A;  2FMQ A;  3PW5 A;  4TUP A;  3NGD A;  2W03 A;  4IC9 A;  4IS7 A;  2LYH A;  4IR9 A;  5ALI A;  3MBY A;  9ICL A;  4ELV A;  1KKX A;  7ICJ A;  8ICK A;  2AXT U;  2XGQ A;  2ZIU A;  4C7Y A;  5CB1 A;  4QZB A;  2IMW P;  2W43 A;  2XY5 A;  2BCQ A;  1CI4 A;  2LYA A;  2ZTC A;  3AEV A;  1BPB A;  3F5A A;  5KFY A;  3B0Y A;  4PHP A;  2K8B B;  4RZR A;  4YXM A;  4C0Z A;  1RXV A;  4G3I A;  4F92 B;  5J0T A;  4NLZ A;  2NRX A;  2K60 A;  2W9C B;  2EQY A;  4TQR A;  2QAR A;  4DCC A;  4YD2 A;  2G07 A;  4F4X A;  4Y2R A;  4GLX A;  4XQ8 A;  4OJ5 A;  4UB8 U;  3NVZ A;  1KSP A;  4O5K A;  5KT6 A;  3UPQ A;  1ZJM A;  2K89 A;  2B0C A;  4KLH A;  2W7O A;  5DQG A;  1ZOL A;  4O5E A;  2EZX A;  4ECS A;  4O3R A;  4GC7 A;  5KT7 A;  4EYI B;  2HMX A;  2VJ5 A;  3T5L A;  3QZ8 A;  2BHN A;  3PZP A;  1NK4 A;  2VJ4 A;  2ZIV A;  5DDM A;  4DSK A;  2HHV A;  4US8 A;  2AQ0 A;  4KLM A;  4DQR A;  2NV3 A;  7ICU A;  5AKK A;  3AM9 A;  4B9T A;  1WWU A;  4RQ0 A;  4O5C A;  1ZQV A;  2GH1 A;  2W9B A;  3QUB A;  5L1K A;  1L3S A;  1X42 A;  4TUQ A;  3MC1 A;  8ICT A;  4CGZ A;  4RPZ A;  2ODG A;  2ZXH A;  1NZP A;  8ICN A;  3UMB A;  1U49 A;  4RQ1 A;  5DBA A;  1TKD A;  2D8C A;  5AKG A;  1ZQX A;  4DSJ A;  4NLN A;  1S0V A;  5KFP A;  5JTI A;  4M6W B;  1MA7 A;  2EDU A;  3I76 A;  4GXI A;  3PVX A;  4F5R A;  2NRV A;  1X9M A;  2YX8 A;  3AQF A;  3C29 A;  4OJO A;  3V7L A;  3PY8 A;  1ZRM A;  1T3Q A;  2AJQ A;  4DQI A;  3ZDE A;  2V4R A;  9ICU A;  3SV3 A;  2KHV A;  3OHB A;  4I2B A;  2B6G A;  2XVT A;  1ECW A;  3RH4 A;  4UAY A;  3WK5 A;  4ECY A;  4UW9 A;  3FM9 A;  4QW8 A;  3PW0 A;  3JPR A;  4QZ9 A;  1ZQR A;  1WCL A;  2JRZ A;  3EPG A;  3CYM A;  4GIB A;  1X66 A;  5J2G A;  5DQH A;  2AGO A;  3C5F A;  1L6N A;  2BDU A;  2HHX A;  3RF9 A;  1ZQK A;  2DL0 A;  3ICX A;  5DLG A;  4P4O A;  2NRT A;  3TAR A;  4YG2 A;  1QSS A;  2FJ6 A;  4F5P A;  3EYZ A;  3M6Z A;  4IQV A;  4O9M A;  3VCB A;  1C20 A;  4DL6 A;  1NK6 A;  1XNS A;  2KN7 A;  4F4Z A;  1T7P A;  2DF4 B;  4Y2J A;  5J0P A;  1PK3 A;  2W9B B;  1L8L A;  3F2D A;  3OHA A;  2BCU A;  5CHG A;  7ICS A;  1L7O A;  1BNP A;  3QX7 A;  4B9V A;  2ZIX A;  4E0D A;  4OJP A;  4RQ2 A;  1ZQB A;  2KKV A;  1WG8 A;  3WKB A;  4C8M A;  4GXK A;  3C2K A;  3SD7 A;  1SWW A;  3WKA A;  2BCV A;  2W11 A;  3LWM A;  1Q3V A;  1LB2 B;  4Q8F A;  4J03 A;  1UQV A;  2XI9 A;  2EAN A;  4BXO A;  1AQ6 A;  1Z4N A;  4JK1 A;  3RRG A;  4YD1 A;  2I5H A;  5J2I A;  3QE9 Y;  4ED2 A;  4O3N A;  1BPX A;  1RQL A;  1S10 A;  4NM1 A;  3BZC A;  5KFU A;  5DQI A;  5ALF A;  1A0P A;  1RPL A;  1J97 A;  2JEF A;  3JPN A;  2Y9U A;  4NXZ A;  2OYY A;  5KTQ A;  3RB6 A;  1S97 A;  1N60 A;  2W04 A;  9ICE A;  1CRX A;  4CF4 A;  9ICR A;  2QAR B;  3RR8 A;  3RH6 A;  3KOO A;  5ALV A;  4YMO A;  2NO4 A;  5F9L A;  2HOF A;  2F3N A;  1Z00 B;  3H7I A;  2H3Z A;  3T5K A;  1JN3 A;  2FLN A;  4RU9 A;  4DFK A;  4F71 A;  2ZIW A;  5J2K A;  5BPC A;  2DFL A;  7ICG A;  2KTQ A;  5H2F U;  3KKA C;  4IRD A;  8ICP A;  2ZJA A;  3PW2 A;  1TAU A;  1MC8 A;  3M9M B;  3LYS A;  4ELU A;  5K4L A;  3QEB Z;  4AYB C;  8ICB A;  2KVS A;  2CRX A;  4NLG A;  4F50 A;  3DEE A;  1SL0 A;  4M9L A;  2VIX A;  3MDA A;  4KTQ A;  1NKB A;  3QU7 A;  1S8O A;  1U9L A;  2IOF A;  2G5H B;  3SEI A;  4MFF A;  2E3T A;  4DS4 A;  2WB1 F;  2HOI A;  2WF8 A;  3QXG A;  9ICP A;  2ES6 A;  2G06 A;  5CP2 A;  5L1I A;  3E0F A;  4Y2U A;  1XS9 D;  5A0L A;  4Y2S A;  2DKZ A;  4DO9 A;  1OUQ A;  3ETL A;  2JHD A;  2QKQ A;  1NK8 A;  3C23 A;  2IA6 A;  4PZN A;  1NKC A;  1ZQL A;  2FLL A;  2LHT A;  3EZ5 A;  5ALL A;  4RT3 A;  2E1F A;  3SV4 A;  2PI5 A;  5AKI A;  1ZQF A;  5B66 U;  1F5S A;  3MR6 A;  3HP6 A;  3RR7 A;  1B43 A;  2IOF K;  8ICF A;  5JUM A;  1B4F A;  3BZK A;  3I28 A;  3ZD9 A;  4YFK A;  1S9F A;  5C0Y A;  1UA1 A;  5ALZ A;  1X9S A;  4OO1 J;  1ZXI A;  3H0M B;  2AH5 A;  1RZT A;  5KFT A;  1NK5 A;  4OJ6 A;  3ISD A;  5AK6 A;  5KT3 A;  4C8O A;  2OXO A;  4UB1 A;  4I2F A;  1A77 A;  2HVI A;  5AM5 A;  4Y2P A;  3OGU A;  5AK4 A;  5ALR A;  2I6X A;  5CEH A;  2PKE A;  2XID A;  5HNK A;  4U6P A;  4KMU A;  3SEN A;  2JEJ A;  2JH1 A;  8ICJ A;  5KFC A;  1MQ2 A;  2ZUB A;  3RTV A;  2NRW A;  1L7N A;  2HBM A;  3C1Z A;  2V9W A;  5KFZ A;  1BGX T;  2PMZ C;  1VLB A;  2MUT A;  2M9N A;  3L4P A;  3UQ0 A;  3H40 A;  2C2E A;  1D8Y A;  1T94 A;  4Y2X A;  2QB0 A;  4I2E A;  3BDP A;  4QWD A;  1RXW A;  2O6K A;  3MGV A;  4J9P A;  5ALH A;  1IIP A;  1TAQ A;  2E1E A;  4Q43 A;  3N97 B;  2F76 X;  1ZQH A;  1HJP A;  2WF5 A;  2W9A A;  5KFD A;  1J2N A;  4IL6 U;  1HUZ A;  2UVU A;  1Q46 A;  3QZ7 A;  1XO0 A;  2WAQ C;  2W54 A;  3PX4 A;  1UPH A;  8ICE A;  4KLF A;  4B9U A;  3Q8K A;  4DF8 A;  1QLN A;  4F8R A;  4Z6F A;  4I27 A;  2ZIX B;  2KNJ A;  2KP7 A;  3H8M A;  5AI4 A;  3ZDA A;  8ICH A;  5CRX A;  2R8G A;  2JV3 A;  4F93 B;  4RQ8 A;  3M9N B;  4DEZ A;  2HOQ A;  3Q8Q B;  1D8B A;  1JRP A;  5DKW A;  3ISC A;  1QQ5 A;  3NVV A;  4NWI A;  3MR5 A;  4PHD A;  4KLJ A;  3H0L B;  5KFJ A;  2M0N A;  4KX3 A;  2VA8 A;  4I2C A;  4QZA A;  2IHN A;  4I28 A;  1SKW A;  2WFA A;  5HMM A;  3AU2 A;  4LZG A;  3AQE A;  4M2Y A;  2KJ9 A;  3IDW A;  1NK9 A;  3CRX A;  3N7S C;  4O3S A;  2B21 A;  4M9G A;  4QZI A;  3HW8 A;  5KG1 A;  2FPK A;  2GO7 A;  4MFC A;  2R8I A;  1SXD A;  3C2L A;  5KFB A;  3PSI A;  4R63 A;  2LPE A;  2EAM A;  1J2M A;  2GOL A;  5KT5 A;  3PO4 A;  2YB4 A;  1DK2 A;  4O0I A;  2FPL A;  5EWF A;  3JPT A;  1FFU A;  2Q0Z X;  5J0S A;  5KFO A;  3QU2 A;  4IRC A;  4C8L A;  1SGG A;  5D46 A;  4NLK A;  5EE9 A;  1Z00 A;  2G09 A;  3O0F A;  1NK0 A;  5J0W A;  4JWM A;  2BCR A;  4QZG A;  3IRU A;  2W55 A;  8ICC A;  1ZRN A;  1FO4 A;  2K8A A;  4M04 A;  3N7R C;  3U26 A;  4PHE A;  5AKL A;  3HX0 A;  5T14 A;  1URJ A;  3HWT A;  5KFH A;  5KFM A;  3KHH A;  4QIW C;  2F44 A;  2DPJ A;  2NO5 A;  4RQ4 A;  1TK5 A;  8ICQ A;  4YMM A;  4ED8 A;  4UBB A;  9ICI A;  4QZ8 A;  3TAD C;  1ZQJ A;  4ED1 A;  3H4D A;  2HBJ A;  1OW5 A;  5IIO A;  7ICO A;  3SYZ A;  3KHG A;  1PK1 A;  2F1H A;  4J9O A;  7ICT A;  2ZJ5 A;  1DXS A;  5KL8 B;  4OJL A;  3OSP A;  3Q8M A;  4RPY A;  2K4I A;  4DL2 A;  3AU6 A;  2MAX A;  5KG0 A;  2C2D A;  3I1Y A;  4DFP A;  3A0H U;  9ICK A;  2K4E A;  3ED5 A;  3C1Y A;  3PML A;  2E8O A;  4QWA A;  3L3F X;  3MGI A;  2EAO A;  4KX5 A;  4P0P A;  3HIL A;  4DSE A;  3IP4 B;  4M6W A;  5ALP A;  3GV7 B;  8ICL A;  5DDY A;  3WK9 A;  3QU5 A;  3T3F A;  2BQR A;  2VKQ A;  1Q3U A;  4KN4 A;  2BQU A;  4USA A;  2E8P A;  3MAB A;  3GDX A;  1S0O A;  4CCH A;  1TVA A;  1N48 A;  2HBK A;  2XC9 A;  3K1Z A;  1D9D A;  5AKX A;  3BS7 A;  3TAC B;  2CN1 A;  3F53 A;  5KFK A;  3R9K A;  3H4B A;  4MF2 A;  2YQE A;  4YQW A;  4U7C A;  2JEI A;  2JH7 A;  3G6X A;  2P6U A;  3PMN A;  5G5H A;  2R8J A;  3BJY A;  4YCX A;  2HI0 A;  4EYH B;  5ALY A;  2XY6 A;  2R8K A;  4F91 B;  4EBC A;  2ASD A;  2Q4T A;  3CW2 C;  3PR5 B;  5GTH U;  3LK9 A;  4I29 A;  4IQW A;  5ALE A;  2J6U A;  1LKY B;  3DDH A;  3PW4 A;  2ATL A;  4F5Q A;  3UM9 A;  3RBE A;  1BPZ A;  2Z7J A;  1QQ7 A;  5L9X A;  4CDG A;  1ZYQ A;  2Y1J A;  1ARO P;  1DGJ A;  5AKY A;  2W8K A;  3RBD A;  2KVC A;  5DLF A;  3ALR A;  5KL1 B;  5EWG A;  1OXJ A;  1UT5 A;  4QW9 A;  2KMD A;  2OWO A;  1PVP A;  4B9N A;  3QUQ A;  5BOM A;  4Z6D A;  3T5H A;  1X6I A;  5IIK A;  1CUK A;  1IV8 A;  4RUA A;  1DRG A;  1L7P A;  1PZN A;  4J9Q A;  3G6V A;  2JR5 A;  2MA1 A;  1Z1B A;  1SKR A;  1NZB A;  2PFQ A;  1C7Y A;  4C8N A;  2L5Y A;  4PPX A;  4DFJ A;  5DGA A;  2JGA A;  2KSO B;  3GIM A;  4M9J A;  3Q8P B;  1KN5 A;  5KNI A;  3BQ2 A;  2A3V A;  2AGP A;  3PW7 A;  1NOM A;  5KFV A;  5EWE A;  4AYB F;  1ZQW A;  1ZD3 A;  2HW3 A;  3KZI U;  4I2J A;  4QZC A;  4KLG A;  3IG5 A;  4C80 A;  1JAL A;  1T8E A;  4QZE A;  3F2C A;  4JV0 A;  2KD1 A;  2GLE A;  2WHE A;  2LI6 A;  2OHF A;  5ALQ A;  1XSN A;  3KD3 A;  4GXJ A;  1ZQA A;  1N63 A;  5CR0 A;  4UAU A;  5IIN A;  5CA7 A;  4TUS A;  4J9N A;  1RYR A;  4KLT A;  4EX7 A;  1S76 D;  9ICF A;  4PJ0 U;  3J81 j;  2NRZ A;  3KZX A;  1U48 A;  4RNN A;  5ALJ A;  4C4T A;  4XA5 A;  2BGW A;  8ICM A;  3WK7 A;  3HJE A;  4DS5 A;  2YMQ A;  4EEL A;  4M9N A;  4A8E A;  4F3O A;  2BZF A;  1Q8K A;  2W9C A;  9ICC A;  3N4M B;  2VA2 A;  1ZQZ A;  3UMC A;  8ICZ A;  1SV4 A;  4ECX A;  3GQC A;  4I2I A;  2YMP A;  1L3U A;  3IN5 A;  5FP0 A;  3H8J A;  3GV8 B;  2JZB A;  5ALX A;  1TE2 A;  3L5K A;  3UXP A;  4KLS A;  1ZQT A;  4F5O A;  4O3P A;  2C28 A;  3E58 A;  1FIQ A;  2KZ3 A;  4DSL A;  2Y0S C;  4ECZ A;  1ED1 A;  5HHH A;  4MFA A;  1U4B A;  3QUT A;  4Z6E A;  2F77 X;  4BJQ A;  1ZQ1 C;  1V38 A;  4GFJ A;  2F2A B;  2W3S A;  2ALZ A;  1O03 A;  2R18 A;  2W9M A;  4R8U A;  4EEN A;  1XO1 A;  1DGS A;  5KT2 A;  2UVW A;  3GV5 B;  3GZF A;  3BQ7 A;  2BCS A;  4PL1 A;  5CJ7 A;  8ICA A;  2W8L A;  2LM4 A;  4C4S A;  2ASL A;  3A0B U;  5C5J A;  2DBY A;  5DG9 A;  1UHU A;  1Z1V A;  5J2H A;  3KTQ A;  4P0P B;  1QTM A;  5KG6 A;  1D8L A;  4I2G A;  5AIA A;  2KG5 A;  4NM2 A;  4YN4 A;  1VJ5 A;  3WU2 U;  1SL2 A;  5DB9 A;  4YMN A;  1SB3 C;  5EE0 A;  4K4I A;  3EUB 2;  2ZUD A;  3ORY A;  3GIJ A;  4DOB A;  2WF7 A;  1BPE A;  2CPR A;  8ICY A;  3ZDC A;  3KKA A;  7ICP A;  3GIL A;  2YB1 A;  3PSF A;  1NJW A;  1KFD A;  5AIB A;  2ZUC A;  3V7J A;  9ICB A;  5DBC A;  1TV9 A;  5ALU A;  3UQ2 A;  1KQQ A;  2YTU A;  3SZ2 A;  2MUT B;  5AI5 A;  8ICW A;  8ICU A;  4BWM A;  5HML A;  2KIV A;  9ICJ A;  2N1R A;  2XY7 A;  3JPQ A;  2DWQ A;  1L7M A;  2H3F A;  1JRO A;  5AM0 A;  1JMS A;  1O08 A;  4KLE A;  5HR6 A;  4C4R A;  4XRH A;  5AM1 A;  3SR6 A;  5KFQ A;  3SQI A;  4OCZ A;  3IV6 A;  5KFS A;  3RB3 A;  4QWB A;  1RYU A;  3BS5 A;  2HCF A;  2EZY A;  2ZIW B;  3FDS A;  3RJI A;  2MU2 A;  1HUO A;  1ZQP A;  8ICV A;  1BVS A;  2HHS A;  2D3D A;  4ECW A;  5AIC A;  1X2I A;  5DBB A;  1ZQI A;  1N2X A;  3MGH A;  2ISP A;  1JI7 A;  5J0Y A;  3NVY A;  2XO7 A;  4CE6 A;  4F5N A;  3F5E A;  1WYG A;  1S77 D;  3VC8 A;  5AK5 A;  3ZDD A;  4LZD A;  1X40 A;  5HHI A;  2JZB B;  5AHX A;  2E8M A;  2ESE A;  4P0Q A;  5ALS A;  3QEA Z;  1FEZ A;  3NRW A;  3UXN A;  2KIC A;  3MR3 A;  4ICA A;  1X6J A;  4QIW F;  2HHU A;  1QH9 A;  1P7D A;  3LVW A;  4Q45 A;  1KRP A;  2GWS A;  1MQ3 A;  1RM6 C;  3HKZ F;  4PH5 A;  3V6J A;  1CEZ A;  2VAN A;  2HHQ A;  2J6T A;  3Q8L A;  4FZL A;  5KFG A;  3WKE A;  4QWE A;  3TFS A;  3RJJ A;  9ICT A;  1ZQM A;  2OCE A;  4Y2T A;  2KEY A;  5J2A A;  4RQ7 A;  1IG6 A;  1KW4 A;  3BQ1 A;  2WF9 A;  2PFO A;  4J9L A;  1N5W A;  5AI6 A;  4FE3 A;  1ZD4 A;  4I2A A;  4KLU A;  7ICF A;  3T79 A;  1TAM A;  4DQS A;  2KV2 A;  5HR7 A;  4NL9 A;  1NJX A;  3RJK A;  1BPD A;  2K4H A;  1TK8 A;  2AQ4 A;  2BPF A;  1TK0 A;  3TAQ A;  1KL9 A;  1NI3 A;  4ED7 A;  4QZD A;  4FFD A;  3MFI A;  3RB0 A;  4KMO B;  4QZF A;  4R64 A;  4KLQ A;  3IM1 A;  3KHR A;  4DQP A;  3RFA A;  2YY6 A;  3QYP A;  1V85 A;  2FPM A;  5DG8 A;  4RQ6 A;  4LVS A;  3PSP A;  2OH2 A;  5J2J A;  5TIS U;  7ICI A;  5EE1 A;  4RNO A;  1S0M A;  3KHL A;  3G6Y A;  3UMG A;  1MN8 A;  1L5U A;  4ACO A;  4ECR A;  1D9F A;  5AKE A;  3C28 A;  2IBK A;  2KHQ A;  2WB1 C;  4IR1 A;  1LVH A;  3TQ1 A;  5KG5 A;  4DL3 A;  3H8W A;  4YR3 A;  2KFN A;  4BWJ A;  2PFN A;  1F0M A;  2C22 A;  4PL2 A;  2VA3 A;  3QUC A;  9ICS A;  2BPC A;  4YP3 A;  3HKZ C;  4DL5 A;  3B0X A;  2FMP A;  1YZ6 A;  4UAW A;  2HSZ A;  5AM4 A;  5AKH A;  2FE9 A;  3V72 A;  5IIJ A;  4MEX A;  5KT4 A;  3BQ0 A;  3TI0 A;  4QZH A;  5L1L A;  2W3R A;  4G9B A;  1KTQ A;  4M47 A;  2NYV A;  1JXE A;  2DPI A;  5IIM A;  2KZM A;  5D4B A;  1PVR A;  1S5L U;  4UAS A;  9ICN A;  3JPP A;  9ICW A;  1LV5 A;  3C5G A;  4DLE A;  4DOA A;  3NTU A;  1Y88 A;  4Z6C A;  2PI4 A;  7ICN A;  5DGB A;  1JXL A;  4OD0 A;  3H0R B;  2I9G A;  5KFR A;  3HRD D;  1PUZ A;  3V6K A;  4P2H A;  2I1Q A;  1JIH A;  4RT2 A;  4DL4 A;  3EPI A;  2HHW A;  3ZI4 A;  4WJ3 B;  5ALT A;  4NLC A;  1T4G A;  1XC9 A;  7ICR A;  1T3N A;  5AKJ A;  2ZJ8 A;  4O3O A;  3THV A;  2ZTD A;  4ZH4 A;  2YML A;  5D49 A;  4UB3 A;  3NVW A;  5KAF U;  3B9J A;  5KFF A;  4YVZ A;  4K4G A;  2P6R A;  4FZM A;  3GFK B;  4YR2 A;  3TKA A;  5AI9 A;  9ICQ A;  3BS5 B;  2BKE A;  4ECT A;  1KLN A;  3NUQ A;  5AM2 A;  1ZQY A;  3OSN A;  4QWC A;  4DFM A;  1WUD A;  1NK7 A;  2G08 A;  4RQM A;  4M9H A;  2UVR A;  3ONN A;  1IM4 A;  2XCP A;  2C2R A;  2RHF A;  2D6F C;  4AP9 A;  2IOH A;  4ED6 A;  2RLT A;  5KFX A;  1L3V A;  2HBL A;  5CWR A;  5TZV A;  5KG3 A;  5KFA A;  2QB0 B;  5KFW A;  4UB2 A;  3S6J A;  9ICM A;  2Y9T A;  2F8L A;  4ZOH C;  2H3I A;  2HDO A;  3MFH A;  3EWA A;  1YZ7 A;  3GII A;  4MF8 A;  4J9S A;  1Z3E B;  2F1I A;  1XU4 A;  1ZQU A;  1U47 A;  4JV2 A;  4Q8E A;  3WK6 A;  3K75 D;  8ICI A;  3NAS A;  4FZN A;  4IQU A;  5J2F A;  2EH9 A;  3IHQ B;  4J9R A;  9ICH A;  4TUR A;  5ALD A;  3QU9 A;  2Y0S F;  4P4M A;  4P4P A;  3Q8R B;  2KSO A;  3TAD A;  4C7Z A;  3KFU F;  3RB4 A;  3PO5 A;  2UVV A;  2FI1 A;  4F72 A;  4Y2V A;  2ASJ A;  3MR2 A;  1K5O A;  5GTI U;  3SAG A;  3LVV A;  8ICO A;  4RQ5 A;  2ZTE A;  3SAF A;  1QCK A;  4LJX A;  2K8C B;  5IIL A;  1RDF A;  3K4G A;  3FYH A;  1B0X A;  7ICH A;  2LKY A;  2PXI A;  3CNH A;  4YR0 A;  1V9P A;  4J9K A;  5ALK A;  3JPO A;  3PX6 A;  1A6S A;  3RAX A;  1XSP A;  1SV0 A;  1XSL A;  1COO A;  1BPY A;  1HEK A;  3M8S A;  2RQ5 A;  5B5E U;  5BOL A;  3AN1 A;  1V97 A;  4Y2Q A;  4BX9 C;  4C8K A;  1SIJ A;  4EZ6 A;  4BUG A;  1BNO A;  5J8Y C;  3BQT A;  1NKE A;  1N56 A;  1M6Y A;  1GO3 F;  2KZZ A;  1K1S A;  3SMV A;  1DOQ A;  2MRL A;  4JB3 A;  2AHO B;  9ICG A;  3GIK A;  9ICA A;  1JUD A;  2DUY A;  2LYB A;  3ZD8 A;  7ICV A;  1YT3 A;  3WK8 A;  4FO6 A;  3OPX A;  1SV0 C;  3V6H A;  4EBD A;  3Q8S B;  3AUO A;  3RRH A;  4I2H A;  3HPO A;  1ZET A;  4JWN A;  4ECQ A;  1COK A;  3ZDB A;  2KFZ A;  4FBU A;  5JRT A;  4GC6 A;  2E8N A;  2WTF A;  2DKX A;  5DG7 A;  1N5X A;  3ISB A;  1U45 A;  3N28 A;  4B9S A;  3IG8 A;  4R8U B;  5ALG A;  4DF4 A;  1ZQN A;  3TAN A;  2HVH A;  1MSW D;  1F44 A;  1UCV A;  4UQG A;  3HT3 A;  3UXO A;  1A76 A;  2KJ8 A;  1SXE A;  1ZQG A;  2WF6 A;  4KN7 A;  2DQN B;  2G5I B;  4CRX A;  1K1Q A;  2BQ3 A;  4MEY A;  4RUC A;  4KLI A;  5EE3 A;  4CF3 A;  1WCN A;  5J0U A;  1KFS A;  5KG7 A;  4O3M A;  2R8H A;  4CF5 A;  2RDI A;  4IQT A;  2KE7 A;  9ICX A;  4DOC A;  5J0O A;  8ICS A;  1SWV A;  3PX0 A;  5F9N A;  2XCA A;  3PV8 A;  2EAP A;  2JXJ A;  4FS2 A;  1ZQS A;  5L1M A;  2K4P A;  5J0R A;  4BGD A;  4DL7 A;  2RP5 A;  4RQ3 A;  4R65 A;  1QQ6 A;  4QNL A;  3TAP A;  3D2S A;  2H5X A;  3OTQ A;  4R66 A;  4F4K A;  3PST A;  5DB7 A;  4HYK A;  4UAR A;  4UB5 A;  2WAQ F;  4UBC A;  9ICO A;  2Y1I A;  2KK0 A;  4XUS A;  3MDC A;  1NJZ A;  4DSF A;  1ZJN A;  9ICV A;  2ZIU B;  4BXO B;  1DK3 A;  3WKC A;  1ZD2 P;  3JPS A;  2OEH A;  4DFD A;  2BPG A;  3N7P D;  3LWL A;  2A1A A;  4MHV A;  4US9 A;  8ICX A;  1Z19 A;  5EOZ A; 
#chains in the Genus database with same CATH homology
 2DKX A;  1OW5 A;  4NL9 A;  2YTU A;  1WWU A;  1SV4 A;  1PK1 A;  2QB1 A;  1DXS A;  2KSO A;  1PK3 A;  2KIV A;  3TAD A;  3KKA C;  1OXJ A;  2KMD A;  1UCV A;  1V85 A;  4IS7 A;  2LMR A;  3SEN A;  5JU5 A;  1SXE A;  3IDW A;  2E8O A;  3BS5 A;  1B0X A;  2D8C A;  2EAO A;  2D3D A;  1V38 A;  4PZO A;  1SXD A;  1JI7 A;  3SEI A;  5JTI A;  2L5Y A;  2KE7 A;  3HIL A;  1SV0 A;  2LPE A;  2EAM A;  2KSO B;  2QB0 A;  3BQ7 A;  2ES6 A;  3BS5 B;  1UQV A;  5KNI A;  2EAN A;  2EAP A;  4RQN A;  1X40 A;  5L1M A;  2K4P A;  1SGG A;  2E8M A;  2ESE A;  1F0M A;  2DKZ A;  5J8Y C;  2QKQ A;  4RQM A;  1WWV A;  2E8P A;  1LKY A;  1Z1V A;  2K60 A;  4PZN A;  2B6G A;  5J8Y A;  1RG6 A;  2QAR A;  3K1R B;  1X9X A;  3BS7 A;  3TAC B;  2GLE A;  2KG5 A;  2FE9 A;  4NJ8 A;  2Y9U A;  2QB0 B;  1X66 A;  1SV0 C;  2Y9T A;  2F44 A;  4NL9 C;  1B4F A;  3H8M A;  1KW4 A;  1PK1 B;  2QAR B;  2JV3 A;  2DL0 A;  1COK A;  3KKA A;  4MHV A;  3TAD C;  5F3X B;  5JRT A;  1LKY B;  2F8K A;  2F3N A;  2E8N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...