3BQUC

Crystal structure of the 2f5 fab'-3h6 fab complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
209
structure length
186
Chain Sequence
ETTVTQSPASLVTIRCITSTDIDDDMNWYQQKPGEPPRLLISDGNTLRPGVPSRFSSSGYGTDFVFTSEDVADYYCLQSDNLPYTFGGGTNLRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKSPIVKSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2F5 Fab' light chain
publication title Crystal structure of the complex between the F(ab)' fragment of the cross-neutralizing anti-HIV-1 antibody 2F5 and the F(ab) fragment of its anti-idiotypic antibody 3H6.
pubmed doi rcsb
molecule tags Immune system
total genus 34
structure length 186
sequence length 209
ec nomenclature
pdb deposition date 2007-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07654 C1-set Immunoglobulin C1-set domain
C PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bquC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bquC01
1SY6A 1CBVL 2FBJH 4PRAB 3IDYB 2NXZD 4E9LA 1RJZB 1IM3A 1D5MA 3L7EB 4AT6A 1G9MH 3AS1A 4FFZH 4IIQC 4MJ5A 1IEAA 4FXGA 5GRVL 1ITCA 2CLVB 4FFYL 3ZSSA 1DBJH 1UJ3B 5F7DA 5KS9E 5D2LE 3QG7L 3LKRB 4NZTH 2DM7A 1IARB 3FQTB 4XPHL 5JZ7D 1RUAH 3EJZC 2BZDA 3WNPA 3TIEA 4M48L 1Z9MA 3IVKB 3RI5K 5I2IB 3RNQA 1HIML 1HXMA 1INDH 1ULVA 4AL8L 2XFXA 1AC6A 1KTRL 1JHLL 1QSEE 4P4RB 4ELMA 4X5WA 1RHHB 4MAYB 3ARTA 4WRLA 1UM4L 1P2CA 5I18H 1JUFB 5J89A 5JHDE 4UOJA 1G6RA 2WUBH 3FTGA 3IF1B 3H8NA 2IMMA 3F8UB 4U1NB 3WUWB 1FFPA 1S7WA 3C08H 4JFXA 2ADJB 2JELL 3ARFB 4QT5B 5MEOB 3OV6A 4OF5A 4YHOH 1BX2B 3MA7A 2VISB 4O2FB 5A1AA 4XVSH 1FSKB 5C0GB 3VI4E 5IMOB 1AO7E 2FHBA 2PXYD 3BP5B 3QIUD 5CAYB 2BHZA 1U58B 3CVIH 5KJRH 4X98B 4ZS6D 2VDLL 5FO8A 2NXYD 1U8PB 4M7JL 1UWXK 4R8WH 3ZYOA 1U3HB 4HGKC 1JZ3A 3L5XH 2YA1A 2NY6C 3DO7B 4AG4L 1CIUA 3AVEA 1T0MB 3NAAL 3L3JB 2C5DC 5ICXB 4R26L 1TCMA 1GGIL 2M2DA 3H3KA 2QADC 3VD5A 1BLNA 3T8XA 2OR9L 4OD3H 5DVLA 1AFVL 5K93A 2A6JA 5FM4A 3ZDXF 1RIUH 2HRPL 3RA7L 2VZUA 1X6LA 5FYLL 4ZAKD 3WE6A 1XFPA 2GI7A 4RX4D 1OB1A 1N7ML 1T21A 5TDPB 3LKPA 2VIRA 3EJYD 3S37H 4XVUD 1N4XL 3GMMA 5MENE 2EDTA 4I8DA 2HH0H 1FL5A 4OCYH 4P5MB 2DAVA 5BW7C 1CDGA 3QQ9D 1XF4B 2GTWB 1DQDH 4ETQB 4F7TA 4PB9H 3P4MB 1FORH 3RAJH 1MCFA 1NAMH 2IC2A 1YNKH 4R4BB 4K3DL 1UB6A 5FGCB 2M1KA 4OLVH 1PX4A 4PG2A 5IQ9B 3VDAA 5M7QA 1NEZG 4Y4FA 1QFWH 4RMWA 3O6FD 4MA1C 1H0DA 5GRYA 2X1PA 2EE3A 4PJBB 5D2NB 3F58H 1FAIH 1AE6L 2P5WA 4PTTB 4G9FE 2CD0A 5EUKB 5B22A 5D7KE 1A6WH 2F15A 4BA8A 5E99H 3QIWA 5F70A 4U1LA 1HI6B 4P23A 2EEBA 5DRXB 3SHSA 1FNGB 3I50H 2CUIA 5AZ2L 2R0WH 3AXLB 1S8DB 5EC2B 1A5FH 3TO4D 4BH7B 3EUUA 4QTIL 4LGRB 1QACA 3STLB 4M1GL 2ENYA 3MCKB 5C0NC 5JPMB 3U36A 1DDHB 1QYGH 1LK3L 2DQDL 1FZJB 2JF1A 2P5ED 4WJ5B 5HHXL 3VFVB 4Y2DB 1E0OB 2F5AH 3CSYB 4NM8L 1U8NA 1Q0XH 3EHBD 4NWTH 5IIEA 3N1QC 5DI8B 4OD2B 3MMEA 3WFDH 3MLVL 3ZDXE 5IVXF 3QWQB 2VLMD 4JZNA 1EBPA 1MCKA 3WS3A 1G9NH 1PEWA 5A3IC 5C0BD 3U30C 3TNNA 5KTEH 4N68A 2UWEB 4IRSA 5HHMD 3UJTH 5JXAH 4MSWA 3T1WA 4XI5D 4LARL 3SE9H 3PQYA 4MD4B 3G6DH 5D7SL 3V6FB 3VGFA 5DQ9B 2FEDC 3PL6A 3CFBB 3FOMB 1KENH 5T33H 2EDHA 3TA3C 3D0VB 3DSFL 1MH5B 2EDRA 2X10A 4XBPA 3PJSA 1WJ3A 4DZBA 4CGTA 3ROOB 2AXHA 4OFVA 1QLRA 3O8XB 5IHZA 4JM4L 1KG0A 4M9PA 1NMAH 1XH3A 2MWCA 2YPKA 2X70A 4S2SA 3VFUB 3ARSA 4Z7UF 5F1SA 2DMCA 1QFWM 3MROA 4RFEB 1AQDB 1QOKA 5CD5C 4PJ7F 5L0QB 3IDMB 4O5LL 3GMLA 1MAMH 4YE4H 1AIFB 2X89A 1WFTA 4K9EC 1UCBL 4UZGA 3QDJE 1AHWB 4JB9L 2X1WL 3MRJB 4F3FB 4H1LB 1I1AA 2XA3A 5DJDA 4ZS7H 1GZQB 3H9SA 4EVNB 4XMLL 4HUVB 5F7YC 5F44A 3MUY1 5CFHA 5C3TA 4WEBH 4Y5VA 3HZKB 4Z0XB 5SX5H 5JXED 2R4RL 1EGJH 3TN0C 4GRMB 4K7FA 1RUML 1K2DB 3RL1A 4UILH 1YDPA 1MJ8H 4K2UL 4A6YH 3ULUF 3QNXB 5IVXE 3SDDD 1QRKA 4GRWF 4OSUH 2AJXH 3RBSA 4M8VA 4LSUL 1ND0B 7CGTA 3PNWB 1A1MA 4HCRH 3TJHC 3B83A 2C4FT 5E6YA 5C86A 2ESVE 2QHRH 1EHNA 4HUXA 2H45A 4Q9RH 4JAMB 4UNUA 5D7JD 1H3TA 3UTSD 3MRRB 4GMTL 4NZRH 4CW1B 1MLBA 1YJDC 1FC1A 2AJVL 3UTSA 2OL3A 4PRID 4Z7UE 3V4UH 3DUSB 3OKYA 5C09A 3HNVH 2R2BB 1IGFH 1MJUH 2A83B 2ZOKB 4PJ7E 4L4VB 1YEIH 3VFGH 5DJXA 5J57B 4L8SC 3T0EB 3GIZH 3E2HC 3HMXL 4GMSH 1B0RB 1R24B 4K71C 1FV1A 3AS0A 1GJIA 1MJ7H 1DTUA 3BPOB 4ORZC 4IOIB 3VE0A 4K9EL 4X7DC 3ZT7A 3VD4A 3D85A 1B2WL 4F37K 3CUPB 2X40A 3PWUB 1TTUA 3GSWA 3NCJL 4NJ9H 1NDMB 5E95B 2VDML 5I0DA 2NQCA 2H9GB 3LS4L 2EEDA 4EQ2A 3ISWA 4PJ5B 1H5BB 2NY5C 2UUDH 2WBWB 2YC1A 1J5OH 2X4TB 3LKQA 3ULUE 4UIMB 2XXMB 2BFVL 2YPLA 3B8SA 5ITFB 1Z5LB 1AGBA 4WHDA 2X4UA 5E8EB 4EIGB 3MX0A 4H88H 1S9YA 3CFKA 4Y8DC 4MD0B 4FFWC 1JHKH 1UQSB 3RWIA 2NY4C 4RGOL 3ULSA 1MVFA 2COQA 1JGLL 2CO6B 4LRNL 4IS6B 3GKWL 3G04B 2Q86B 4JFQA 2VDOL 2FSEB 3GRWA 4POZD 4MCYA 1S9WA 2EYRA 3LB6C 3TH2T 3VXSB 4ZUUB 2ATPB 3KYOA 5H37G 3DJ9A 1WV7T 5I16A 3PV7A 3R4DA 4J6RH 2HFEB 3VFRB 1L4IA 5F9OL 5BVPH 2F58L 4MX7B 4LASL 1RMFL 4EN3B 1YJDL 1K5NA 3QXAA 4XPAH 3L5JA 5FUCE 4RIRA 2O5ZH 1RULH 3L1OH 5T3ZH 4JRYB 4RA3A 3VXRE 1W72A 3MLTA 5ECJE 3I02A 5LCVH 1D6VL 1XIWA 1J9CT 3UXFA 4LCUB 4N9GA 1IEHA 1OM3L 1KPVA 1F8TH 3GK8H 1YPZB 5DJYA 3MV9E 2NR6D 1YEDA 4GT7A 4PY7B 1KUMA 2P8MB 3Q3GB 3PHQA 5DMIL 1I1RA 2ILLA 1VEOA 3WUWG 2XWBA 3CZFB 4BK4A 4BQBA 1ZWIB 1JI2A 4P3DB 1ORQB 1OW0A 5DT1L 3WFZA 5GS0C 3DXAA 4OB5H 4Y19B 3OZ9H 2BMKB 1R3IL 4HWNA 1WGOA 5B38B 2APFA 3TZVA 1EO7A 2X44D 1FNEA 4NKIH 4NQED 2HYMA 5IOPA 2NY5L 4Y4HA 1SJHB 3GSOA 3SKUD 1Z0MA 3FCTA 4L3CB 5EN2A 3VG0H 4CN6A 2YK1H 4EXKA 1CXLA 5D96C 4U3CA 1P7KA 3BGAA 2LQRA 1FNSL 2OTUA 2JB6A 1FGNL 1S9KC 5CEZH 1QR4A 5GGTL 1K8IA 4JE4B 4Q9BA 1YMHA 2LVCA 4JFYB 5FA4B 3FN0L 3IFNL 3IJSB 2CKBA 5GGQL 1NUNB 3UC0L 2PTTB 3FN9A 4HDIB 3KYKL 3H9HA 5GGVH 5C2BL 1IAIL 3UYRL 1X7QB 4XPBL 4LRIA 1CR9L 5KANG 4MJ6B 3HCVB 3MLYL 3DO3A 3WEXB 5ANME 5ETUB 2NW2A 4GBXA 1MRDL 2DLEA 3G6JA 5EZJB 4L29A 1FIEA 1ODAA 4UT9H 2CKNA 1IRAY 5I6XB 3PP4L 4WI8A 5F9JB 4AENB 3X13B 1RK0B 3FB5A 3VGEA 1QFWI 3S88L 2DQFB 3QXWA 3ARDD 5TF1H 4LQFL 1I8LA 1VERA 3EO0A 1VACA 3QEQD 1PVHA 3G5ZA 4Q9QL 5FAAA 3F65A 3PWLB 2EZ0D 1ZLWK 4Z76B 5LVEA 1QRNE 2FRGP 4LLDA 3MLWH 4CVZB 1EK3A 1PYWA 3OWEA 2VXQL 3QSKB 4I3SL 1YMMA 2HVKB 1CE1H 1XGRB 3BPNC 4HZLB 4UINH 1J0KA 4PJGF 3CPLA 3UPCA 3A6BL 3LV3A 3HRZB 5EIIA 5MEQB 5GS0L 1MFDH 2YSSB 1UEYA 4JY6B 1A2YA 5C7XL 1UC6A 1HOCA 5D93C 1N8ZB 4LHUA 3WNMA 1F3JA 4M3KB 3HZVB 4LVHB 5D9SB 5FDYA 2IPTH 4HIIA 4TTGA 3V6ZA 1X5FA 3O4LE 2HMID 1SQ2N 1JMZA 1CF8H 2E8YA 4W81A 2BVQB 4HPYH 5FHBL 2R9HC 4M43H 4X7TB 4RZCB 4P46C 1INEL 3DBXB 4S1RL 1JZ2A 2Q3AA 4XBGA 4HIJB 5IMKA 4JDZA 4NC1C 3GM0A 5CJOH 1A4JA 2D0FA 3WFHB 1Q0YL 5DQJA 3ZE1F 2WWMC 4V1DA 5JNYB 1CS6A 3QUZC 3LSOA 4OTXL 3IGAA 3PDDA 2AI0H 3T2NH 3SE4C 5H35A 4DW2H 3LAFA 4QRPB 3PDOA 3KXFD 1ZHKB 1FRGH 1L9MA 2VB5A 4XP9L 2H32H 2D31B 1OTSC 1MF2L 3N1MC 5GGUA 4BFBD 5F7NC 4PJ8D 1GGTA 1EH9A 2NY3D 1ZHLB 1JPTL 4DUXA 4L8CB 2EYSB 3MUGB 3DX9A 1WT5C 1A7OH 1YMME 1LO3L 4WI3A 4L4JA 1RU9H 1NAMA 1OGAE 4QRRB 1KCLA 1R3HB 1IBGH 2IAMA 4PRNA 1LE9B 3D48R 4PJGE 3QNZA 4Y1AB 3RJQB 4G43B 1QLEL 2DJ4A 3SPVB 1QFHA 4PS4L 4G3YL 1HKLH 5JA8B 3TWCL 1Y18B 4RAUB 3P30L 1EJ6A 4RGNE 3U0TA 3W82A 3LQAL 1EMTH 1G7HB 1F58L 3FQUA 4U7MA 4H1LG 1DL7H 3W0WB 3D9AH 3MRCB 2BX5A 2IBZY 1Y0LB 1QQDA 2ZG2A 4NCDA 3RGVA 3SDCC 1X5XA 4C54A 1MHEA 3BDXA 1GGCH 5IB2B 3SDYH 1S7VB 2YPVH 1NBVL 3GHBL 1BJ1H 3PABB 1EAPB 2C7UB 4XXCA 5E7BA 1UZ6F 4ZPTB 3LEXA 4V1DE 4F33A 3WFEH 1KLFA 4FZ8L 4MJ2A 1MCNA 4C83A 1FBIH 3ZE1E 3OHXA 1MUJB 3BAEH 3B5GA 1I85C 5J1TC 5CZVH 2WBKA 3MRBA 3REVA 4LU5H 4XB8A 2XICA 4WUUB 4HGMA 2JIXD 3DX7B 4MXQC 1JN6B 1I3VA 4GSDH 4JG0L 3U48A 4NRZA 3K8MA 3BEVA 1ZEAH 3QNYA 2ZOLA 3RUGA 3S3SA 4A2MA 1ZS8B 4M61B 4X9GA 4KQ4H 5EU3A 4KJQD 4BK5A 1CD8A 2IQ9H 2W59A 4Z7VF 4YXLL 3VXME 4IMLA 2ZWLT 4NHCL 1H3GA 2ZUYA 3BI9X 2V17H 2NW3A 4OZGA 5FB8B 5DDHA 3B9KB 1KTDB 4KRPB 4UT6H 3ARBC 4P2QA 2PETA 3T0BA 2BY1A 5DJAB 1NCAH 5IB5A 4ZUTB 4S0TD 3QDMA 4RBPK 3VFSB 5KW9L 1MHCA 4LAQL 1T6VN 2F54E 4RRPG 4IIQB 1I7RA 2OP4H 1T3FB 3BH8A 5KS9B 2AERT 2HTKC 2WINB 4J7RA 2AGJL 1JJUA 4W6YB 2DKMA 2VXUL 4MQXD 4O02H 4X99A 1OP3K 4ZYKA 5JW3L 5CJQL 4HUUA 3E3QE 2OMNA 2ARJQ 3CSGA 5ITBL 1KN4L 2YKLH 4G7VL 1LO2L 1UZ6E 5LBSL 1MNUL 3RWJB 2XWJB 3QJFB 1EGJA 4NN7C 4U7KA 1EJOH 1G7MB 5D6DA 1KJ3H 1F4YH 4M8QB 4OQTA 1DBML 2BVOA 3EFFA 4A6YA 1A7PL 4XCEB 1OT1A 1KNOA 4XHJD 4RA0C 4S1SL 4C58B 3PV6A 2PYFA 5E9DB 4KTEH 5D72L 3EIFA 1DBAL 4QXGH 1D6EA 1MRFL 4JJ5A 1OAQL 4ORGA 4WI4A 2E9JA 3KYNA 5TQ2L 4NN5C 1XR9B 2ZJSL 5IHUH 2DQIH 4HCRA 5JORA 1GH7A 4HEPG 3BKJL 3D0LA 1BIIB 4Z7VE 3OKNA 2AP2A 5L6YH 4B53A 3D3VE 5ENWA 4QXTB 4L4TE 5I19L 3P3YA 1D5IL 1JGUL 3RZCC 2DWEB 5A2IH 2FX7H 4NO0B 1SBBA 2GTZA 4P2QE 4Z95L 4WTZA 2XKUA 4G8GE 5IM7B 3IXAB 3T09A 4I3RL 3FB6A 2NY6B 5A16B 1J0YA 1HINH 2GK0B 5BRZB 4LSSH 3G08B 2OQJB 3IFOA 4PGEB 2FX9L 1LILA 4LFHG 5E2TH 1R6VA 3SO3C 4JZJC 4LHJB 4YFLF 4K3EL 4XWGL 4YZFF 2AJYH 1C5CH 4XPGL 4HKXB 4PJAB 4WW1B 3S96B 2QADB 4OAWA 2J8HA 5JUEH 1KLGA 2X42A 1Y6MR 3GMPB 3FB7A 5GSRA 5LGHL 3CCHA 3ULVD 2EYTA 5DMKB 4M6ML 5EWIH 1DVFD 2CDEA 1ACYH 2I9TA 5B38G 1TZGL 1LNUB 1FG2A 4BH8B 3MFFB 4FFVC 4HV8A 2VDQL 3BGMA 4UDUB 2ATKA 4NYLB 1CGTA 2OR7A 5E1HB 3HUJB 4QRQA 2CLZA 4YHLH 3RDTC 5IBTH 4L3EB 2O61B 1FAKT 2C1PA 2AEPL 1KCUH 5BO1H 3P0VL 3KNBB 4F57H 3IDXH 4GO6B 4YPGB 1KPUB 3ALWA 4QRTB 1IGYA 4XC3H 1Q72H 4GKZB 2AEQL 3PWPB 4NRXB 1A6ZB 2AK4D 2R29H 5I1JH 5EOCL 1T0PB 2CK0L 4OCWH 1X4XA 1EVUA 1A9EB 1EFQA 2Q87A 2GJJA 4N1HB 3NACL 1PX3A 1OSPH 4HXAH 4U1IB 2NTFA 5EO0B 3IDGB 2R2EB 3HS0A 4XMPH 2VDPL 4NQCD 4GOSA 5DJ0B 5KSAC 32C2A 2NNAA 1N3NB 4UI2A 5TE4H 3CK0H 5MP6L 5FGBC 2R2HA 2EXYD 2Y5TA 4YZFE 3QDGB 4TPRH 1QSZA 3JV4B 4CU7A 4KKAC 4GW4A 4WHYG 1IE5A 1E4JA 5FUOH 2ZCKL 4AEIH 3U30B 1J1OL 1QFPA 1CL7I 4L8BA 2EC8A 3RX5A 3NFNA 4OD1H 4FQJH 1VFOA 3GDBA 1X5AA 3KPSE 3K81A 4NM4L 5J3HC 5EO9B 4WIQA 5CLWA 4TVSa 4CMMB 5TGBB 3CX2A 4JFZL 1T2JA 4G42A 4O9HL 2YOCA 3TA3B 2ZNXA 4MDJA 5E2VH 1BEYH 2PO6A 3EDDA 1TCRB 1CLOL 4PLOB 1N0XL 5EU6A 2X7LA 4TULH 4S1QL 4PRPB 5HYJB 4U1HA 1M05A 2Z92B 1J1PH 1S9VA 1R5IB 1BJ1J 2XNAA 3MNVA 1QLFA 3VXPB 5C07E 1AGEB 3KPOB 3BDYH 1KB5A 4ETYA 1YY9D 2X1XR 3MYJA 3QDJB 1OAKH 4X7EC 1J10A 3VI3F 2BY2A 1HNGA 4F7CA 3QEHB 3O2DL 4MNQD 5AYQA 5IROA 4B5EA 2EDXA 2YXMA 4RISL 1R3JA 3L9RB 1U8LA 4NOBA 1OGTB 5SWZE 2X1QA 4LOUD 4NBZB 2CIIB 5GISH 4NOFA 3SKMB 3LMJH 1ERNA 4R4FH 5T3ZE 2UYLA 1OARH 3F7QA 3RKDD 1QKZH 4Z77A 5IWLC 1ONQB 5L2KB 4WUKH 5HJ3A 1AQKL 1BGXH 1MI5B 3UTTD 3OG6B 4KV5F 2DTSA 4L9LA 1RZFH 3TN0B 2G60L 3BEWA 4HQQL 3NH7L 4D3CL 1MFEL 4CUCA 1A8JH 1H8SA 4KJYB 5DJZB 1N26A 1T22A 1I7ZB 2V2WB 2C3WA 5B8CA 1U8MA 2VDKL 3BMVA 3MLXH 1IAKB 5FYKD 5IB4A 4KPHH 3VW3H 1EERB 1A9BB 2XY2A 3T0VA 3MBED 1A6AA 1GRWA 4C56E 2JK5A 3MGAA 4LP5A 4HWEH 3VXQA 4PRHA 5IBUB 3QQ3A 4ODTH 2GJ6B 3QHFL 4QWWD 5DA4A 3LKSA 3VGHA 4XCNA 2EIZB 3DUHA 5LXGH 2F53E 1A6PA 4WU7A 5F97E 5K33A 3QCVL 1DQJB 5J9PB 1S9XB 1VGKB 2J8UB 4D8PA 3S36L 4PJ7B 3OR6A 2A6KA 3EZJB 5IB3A 4JPWL 3MO1A 2BHYA 4P3CH 4QGYA 5DD3L 4L8SB 3VI3E 2GUOA 4PLKD 3QCTH 1WZMA 2QR0A 2VUOA 43CAA 4K71B 1JMXA 3TVMA 3MTRA 4E42A 3FQNA 1RAMA 4CKVX 2OJZL 1I4FA 4U6YA 2HKFH 5DHYB 4PGJA 3HI6L 3V0VA 3D39E 3G5XA 3CVHB 4S11A 4KAQL 3O8XD 3S3JA 1WWWX 1WFNA 3IXTA 1IFHH 3FT4A 4G8IB 3ET9F 3RVVC 4X80H 2H6PB 5HI4C 2AKRB 2B20A 4YWGL 4KV5E 3NA9L 1IVLA 2H32A 5I74C 4EI6A 3RRQA 3RKPA 4ZUWB 3KDMB 3B6SB 4GRWB 2DS4A 5CUSH 4NUGH 3VA6A 5ABDE 2MCPL 1OLLA 2OYPA 5HDBF 3VMNA 3NIFF 1BBDH 5BCAA 4XVJH 1BIHA 1ZT1A 4U6VL 2QHLA 1NCTA 1WZLA 4PRHE 2KBGA 2NY4B 2NYYC 3BT2H 2DBLL 4OUUB 5ADPL 5GHWL 4HWZB 2YZ8A 1JL8A 3O3EA 1NC4B 4NQDA 1QFOA 5E94A 3DMMC 5C08A 2G5BB 3O9WB 5H2BB 5FUZH 3SGJC 5FHAL 3LEYL 3EYOB 1MWAL 1CFSA 3LPFA 1KT2A 3TT3L 2J6EL 2W92A 3MXVH 2NX5E 4HC1H 1ZHNB 4JFHE 4JDVA 4PUBL 1BF8A 1REIA 1INQB 2AEIT 4OLZL 3HAEB 4FRWA 4ZUSB 1IC5L 5CKGA 5C3LD 2RB8A 1MCWW 4ODHL 3QFJA 2EDQA 1FP5A 1KFAH 3G5VB 3GMNB 3QR2A 2R0ZL 4PGDA 5KAQF 2H2PD 3MRHA 3SCMB 3INUL 4E41A 2XQBL 4PJEF 1FPTH 1XZ0B 4PJ9C 3W39B 5SWQA 2GITB 1N6QH 4KI5C 5DK2B 4UQ2B 3MA9H 3FRPA 2DI7A 2H8PB 5C0AB 1I3RB 2NXZC 2ZSVA 1JYVA 5JQHC 3D18A 1YECH 2FX8H 4HFWA 3ZL4L 4DKDC 1RPQA 2VDRH 2A1WH 5HHOA 2V5RA 4OKDA 5KOMC 3U1SH 5GXBB 2HT4D 1MCHA 3D5OF 1ZA6B 3BN3B 4IRJA 4D0CB 3QJHA 1KCRH 3QI9A 4DAGL 1AP2B 4MCZA 4YHZH 3OKMB 4NO2B 5HDBE 3NIFE 5JOPD 4PGCA 4BJLA 3C9NB 4XCCL 1DCLA 4O4YH 3GSXA 1YEEH 3QCUL 4JFFA 1CXKA 2O5XH 5D96B 1HYSD 3TM6A 5BXFB 4PR5A 4D9QD 2BXZA 3QEGL 1IL1B 4NQDE 2HWZL 1XCTB 1DSFL 2VABB 5C08E 4K94H 1RIVL 1NCCL 4TVPD 5EOTA 4XNQA 5GS2D 3NFPB 4EOWH 4CU6A 3UEZA 3O41A 4GUPA 4HHAB 4NCC1 2VXVH 4W6WB 4H0GA 4X6BB 3H0TA 5CJXC 1BF2A 3FQRA 4JCLA 4Q9CA 3S6CA 4APQD 5ANMB 3RWDB 3SBWA 4J3OC 1C12A 5JW4Q 5EBMB 4JO2H 4ELKB 4YQXL 3QYCA 3ZHLA 4H8WC 4JZOB 4PG9B 3VXUA 4I48A 3GMRA 4QEGA 4YHIA 5GSVB 1KEGH 4R7DA 2XPGB 3OKDB 4NZJA 4PJEE 2N7AA 2QQKL 3CMOH 1TQBC 2AVGA 4JFPA 1JNHA 4JDTL 1HHJA 1U8IA 2WBJB 2IAND 2FIRT 4KK8D 5FYJH 5IG7A 1ZGLM 1SY6L 5JIPA 1QRNB 2IANA 2BVEA 5T1LD 2RJMA 3C5SA 5IQ7H 2GW5A 1TJIH 5T1LA 4L8DB 4U6XB 5GZOD 5E8DL 4EN3D 3BPNB 3V5KB 3WLWD 4D0DA 1QA9A 1XEDA 4X6DA 1HWHB 3Q5OA 4ZAKC 5F3BB 1FVDB 1NBZA 2CUMA 4M5YH 1KTLA 4JRYD 4JR9L 1CXEA 5BV7C 3EJYC 1QR1A 2AJSL 5HYQB 3EYUH 5D93B 2YA2A 3PGCA 2B1HL 1DQQA 5GGSA 2D03H 3QQ9C 1UGNA 1ZXQA 1K4CA 1H9VA 5CEYB 1BFVH 4PG2C 3I9GH 4X4YB 3HG1A 4ODWA 4Y4FC 4P46B 1G6RL 2Q6WB 5MEPB 25C8H 5IFHH 2XIDA 4Y19D 3MLUH 5F21B 1NGPH 2HLAB 3SE3A 4AEFA 2HJKA 2OZ4H 1CZ8H 5BZWA 3RBGA 3QIWC 5J56B 4LSPL 5B3NA 4ZO7A 3BIKA 1KELL 5IB1A 3EW3B 4XRCA 1ZT7B 4H8WL 3MZGB 5B4MC 1B6UA 4YAQA 3KPRE 4NKOA 3MV01 4LCIL 4UTBL 1WBZA 4EDXB 1ED3B 3L3DA 3QH3B 1RVFL 1CFNB 1FLRL 4LSQL 1HXYA 2OLDA 3Q5YA 1UXSB 1Q9LA 1CLYH 5DHVH 4ONGH 5I1KL 4PTUA 3V6OE 5E4EC 3FQWB 5FCUL 4H25B 3ILPA 5ESQB 4N8VB 5BZDA 3V7AE 3QXTA 3EHBC 2DIAA 2P5EE 4R7NB 4PLNC 2JE8A 3K80A 4IRSC 5I30H 2MQ3A 2LABA 4ZPVB 4W4OA 2GT9A 1M7DB 1UA6H 4XNUL 2VLME 1LEIA 1SHMA 2B4CC 3PL6C 2BSRB 5C0BE 2VLJD 4Z6AT 3S34L 5JR1L 5I66B 2FR4B 4CL7A 4O00A 5HHME 3UO1H 3WBDA 2G75A 5FO7A 3TBWB 3SDCB 1UKQA 4JVWA 3LEVL 5L8JB 1OAUH 1JFQL 4K23H 1CIDA 4HEME 3STBA 5IMLB 5ID1B 5KZCB 1M71B 3D69B 3V52L 4OLUH 4FXKA 4XCFH 5AUMA 3OAZK 2APBA 2DJUA 1WAAF 1BQLH 1U92A 3U2SB 2NY7H 2XV6B 4FP8L 3VFNA 3MODL 12E8L 1F4WH 3IRZA 1F6AA 2EH8H 3O3BB 2ADGB 1NQBA 4HJ0D 4CNIA 2AQ3A 1MPAH 3RTQD 4MNHA 5SWSD 5TJWK 4YEFA 1FZOB 1U8KA 1I1AC 2P8PB 5IBUG 3SDXF 4AH2B 5SWSA 4G6KH 2CRZA 3B9EA 2EDNA 3MRKA 2HFGL 5DR5H 2BOBA 1J0ZA 4AZ8A 3LN4B 1DBKH 3HA0A 4Y5VC 1YN6A 3B9AA 1LHZA 3LZFL 4AY0A 1RSFA 2IBBA 5I1GL 3IYLW 5D7IB 4JREC 3WIHH 3O3AB 1QFUL 4J12A 2NY2C 1UXWA 1D9KD 5JMRA 1J8HB 3A6CH 5C0CB 1KN2L 4W70A 5DEGB 5EFIB 1OD9A 1D9KA 4Z5RA 2Z35B 1CLZL 5GRJL 4QXUL 3N9GH 4ENEC 5M94B 4JFEB 2I07A 1NANH 3ARBB 1EFXB 4RAVB 4UQ3A 1P4BL 4YGAB 2GK2A 1J88A 3QWRD 3MLZH 1JZ5A 2VL5A 2WANA 3KVQA 3CH1B 4HW6A 3VFOA 2XRAH 2B4CL 5T1DH 3WKNA 3AMLA 1AGFA 4EIZC 3GJFH 3CFJA 3O11A 1I7TB 1BQHB 5IESH 3C87A 4XP6L 4MA8H 4KGLA 4AYFA 1A1NB 4LLQB 3TYGH 1UZ8A 4QOKB 1WAAE 3FB8B 1RZKH 3UTQA 1EO8L 2QLVB 2IH3B 1ZOXA 4NN7B 3KPQB 2EXWD 4TUKL 4PRIE 4JPVH 2APWA 3H7BB 4JGUA 5JPNB 3CC5B 3DX8B 5FOJA 4MNGE 2VR9A 3EYFB 4PV9B 2QQNH 4LCWB 1UFUA 3SDXE 3WKML 5IFAH 2BNQD 4NN5B 1MY5A 5F1IA 3K46A 4OGAD 1ZA3A 3LD8C 5EBLB 2PR4L 1LE5B 3PGDA 1FL6B 2BNQA 3HZMA 3D3VB 2XQYG 2D7OA 1T66C 4HGWA 4JJHA 2OR8A 4PLJC 3OXSB 4GW1B 2DLFH 2BDNH 2V2XB 2F5BH 1A7QL 3HAEG 3RZCB 3QIBD 2VWEC 2AV1B 4GKNB 4U0QB 1KB9J 1XCQB 3MOBH 4Z7WA 5C0RH 3ETBF 4WUUD 3EYVA 2Y6SD 3ZTJG 1HEZB 1MFAH 1I1CA 3BVNB 2ICEA 2WP3T 5DJ8B 4NO5A 5JW5B 1GCFA 1BFOA 1NFDF 1YA5A 3BIAX 3Q1SH 2DLGA 5AD0B 1G7IA 1L6ZA 3O6KH 4LVOB 1CGSH 4M7LL 3VU2A 1ZTXL 3RWGB 4QHKJ 3BZFB 4MA7L 4OF0A 1UEMA 4POZC 3SJVE 3NTCL 5HDQL 1XF1A 1T1WA 2EO9A 2PYEB 2MCG1 2YRZA 4Y7MA 2W1NA 3BHBB 1II4E 1OCWH 2V7NA 1IILE 2WAHA 2J88L 3N50A 8FABB 1S7TA 5DURB 2EDLA 5CILL 4K3JH 1RK1B 3B9KD 4KRPD 4MQ7B 4NQVB 1WCBB 2ZPKH 2OL3L 1D5BA 4FQIL 1XR8A 5EA0H 1QSFD 3BESR 1JWSB 1I9IH 2Y36H 4J8RB 1T89A 1H3WM 4GQ9L 2WK2A 3ELAT 2CDFA 3S9DB 4ONHA 1KBGL 1XIWC 2QV2A 3RDTB 2DQGL 3LN5A 5GGRA 5ID0B 4XXDA 3UTZB 1K85A 5J6HB 1HH9A 2IPKB 3DV6B 3V5DB 3UBXB 1CICA 2E5EA 5DQDH 1VFAB 5E4IA 3WUZA 5C0EB 4AIZB 2EICA 5T1KA 4HG4K 1HK6A 3SQOL 1OW0C 1OAYL 3T65B 1T04A 1E28A 4NNPL 1D5XB 3NBNA 3UROR 3AB0C 1RZ8B 4HKBA 3TZVC 3L3IA 4C4KT 3BZ4B 5CGMA 4D0BB 4DJMA 2RGSA 4QHKI 1L7IL 4PIRF 4TSBH 3ZE2F 5FV1L 2XKNA 5E9DD 4ONFH 5L88H 1NFDE 3SGEH 1F3DH 4NQEE 2AV7A 5KG9A 2NZ9C 3F7VA 1NC2A 5J1AA 5KSAB 3RU8L 4WTXA 3S5LG 2GSGA 2J8OA 5IK3B 3FONB 5DVOA 1LEGB 4M00A 1DLFL 3FMGH 3GRWL 1FYTA 2DL2A 1ZGLA 2A6IA 3P0YH 1CFTB 1S7XB 2CR6A 2HJFA 4X9IA 3QQNA 4LRIC 1BQUA 3BWAB 1G9MC 5INCB 5GS1A 4WCYH 1G7JA 1RUPH 3RNKA 5HHQA 1IC7L 4GBXC 2DOCA 5E8PB 4DKEL 4B50A 2X4RA 3CXDL 3E6FA 3DHJA 3NCYP 4PJXA 43C9B 4DKFH 2DLIA 1YNLH 2CGRH 2XN9B 2NY6D 4JY5H 4ODSL 2X41A 2R8SL 3OPZH 3KPNA 2VZVA 4I0PA 4I2XA 2HTLC 2FO1A 1BD2A 3H3PL 1NMBH 1I8LC 1AH1A 1W72L 2EKSA 4LBEB 3WHE0 2DQCL 4JGJA 4YHPA 5F7WC 5INDA 1TVBB 5BQ7A 2CDGB 4LLUA 2WLZA 4FQCH 2XZQL 1DQMH 4P3WA 4PJCF 1FJ1B 3QEQE 1NEZA 3L5WB 4JKPL 2X4SB 3P9LB 7FABH 4JFDD 2YMXH 2XZAL 4JM2F 4PJDF 3RZWA 3VXOA 1UYWL 1BAFH 1I7UB 2UZIL 2VLKD 2F9BT 3DVNA 2AW2A 5ESVB 4PJDA 4OCXL 5K9OA 1YEHL 1HSBB 3FFDA 4KMTH 5EO1B 3AU1A 2QSQA 3TC9A 2HT2C 1RI8A 4BYHA 3ZE2E 4FQXA 4HH9B 1T0NB 4L3ED 5TH2A 1LQSR 5DWUH 1AJ7H 3HNTL 4RGNC 1FVCA 4UOW1 3P0GB 2FIKB 2C4FU 3GI9H 1T1XB 3MV8A 4WHTB 4WFGD 5C6WH 2D9CA 5DRZB 3AUVA 1MCPL 5I76B 5ALBL 3L6FB 4UIKH 2DYPD 4DVBA 1JYXA 4ERSL 1Q94B 4UU9A 2CKBL 3CIQA 2DYPA 3MRQA 5F88B 1FE8L 2V9QA 3DVFA 4AM0A 3RIFK 3WS6A 2FBJL 5D6CA 4N8VG 5DTFB 4O2EB 3X12B 1G9ML 4GAFB 4FFZL 4LPTA 5F9DC 4YBQD 5KN5A 5F3HB 1DBJL 2HVJA 5IJVB 1I8IA 1DEEA 1MQ8A 2FEEL 3L3OB 5F1NB 2W0LA 4I2XE 3WHE1 3MJGX 5L9DH 3RHWF 1J0IA 3WL9B 4RGMC 4NNXA 1RUAL 4MD5B 1MWAB 1UKTA 3CDGA 5C0ND 3STZA 1J12A 2BCKA 4QHUB 2MPAH 3QDGD 1G0YR 1X5ZA 1YEFH 3KXFE 4CADB 1DR9A 2NY3C 3MLRL 3AS3A 1RZ7L 5LQBL 2LU7A 5DJCB 4KJWC 4PJCE 5C9KA 1JF6A 5I18L 2IAMC 5A3ID 1CWVA 4X5XB 2QKIB 4PJDE 3IJHA 4FG6C 1SEQH 2GJZA 4NKMB 2R0KH 1NPUA 2VOTA 3C08L 3VJ6B 1D5ZB 4RAHA 3IJYB 5FDWA 1U93A 4YHOL 2FEDD 3KPPB 2OZ4A 5I75C 4U6HA 4XVSL 1TNNA 4LEOA 3G6AB 1FH5H 3IFPB 5KSUA 4CDHA 2HRLA 1F6FB 2CRIA 1EEQA 3RGVC 4N8CH 1XGYH 1CD1A 1Q9OB 5IHBA 4ZQKA 2CJUH 4BZYA 4PRPD 4R8WL 5EU4A 2P44B 2DQUL 5DEFA 5FYJE 3L7FA 5I74B 2ORBH 4XXCC 4D9RD 3E3QC 3ZSTA 3VFMB 1MEXL 5DGQA 5CD5D 1NANI 1CU4L 3JTSA 3BW9B 5JIKA 1CFQA 4P9MH 5DD6B 3GIVB 1R5WB 2B8OT 3P11H 5ESAA 3U4EB 3OAYH 3DIFB 3A67H 3VGDA 1L0YA 2R0LH 1KXVC 1EO5A 1X4YA 3L3GB 3W5NA 3ZKSD 5F7MC 1NJ9A 1GGUA 1JGDB 3WXWH 4YH6A 1SYSB 2A6DA 2NX5B 5DJ2A 1FFNB 2DQHL 3QHZL 1P7QB 1N2RB 4LSTH 3DRQA 4OCSH 4X4XB 2R15A 4KWUA 1Q9WA 4X0KA 2FO4A 1T2QH 5JHLH 5BVJB 3D2UB 1DQDL 3ZMRA 1TTFA 4H20H 5KVGL 1BVKA 4PB9L 4YXKH 1T03H 4J3TA 2OTWA 3RAJL 1XGPA 3ARGA 1NAML 2OI9C 5L7XH 4OLVL 4NUJA 1CYGA 4U49A 4ZTOH 1QFWL 2R1YA 3E6HA 4HAFA 3TJHD 4PJ9B 5GJTH 2GJ6D 4ESKA 4NPYA 5K9JL 1KIRA 1FAIL 2VQ1A 1TZIB 5F89B 3VCLA 1P4LA 2V5MA 4XVTH 3RWFA 1IM3B 1D5MB 3SDAA 1RJYA 3SE8L 1GGYA 4AT6B 1IEAB 4FXGB 1KV3A 2FB4H 4F2MB 2NXZB 1SVCP 5F7DB 3LPWA 5HDLA 3CFEA 1W8NA 1CTOA 4PJHA 1VEPA 3OF6A 2R0WL 3MRGB 2FD6H 2HLFC 2VXSH 1PKQE 1QG3A 2D7TH 4EUPA 1H3VA 4TRPH 3TIEB 4BQCA 4RFNB 5C92A 3D87B 5D6DC 5JQ6H 3WIHA 1HXMB 4RQQA 1JK8A 5DGRA 2XFXB 3U0WH 4JO4H 1QYGL 1YYLH 2AJZA 4K8RH 5JIIA 3VWKD 2LTQC 3U7YH 1Q0XL 4FTVD 4NWTL 3WFDL 5FCSH 5HGGS 4KVNH 5GPRA 5KANI 3VWKA 1G6RB 3FTGB 3OKEA 1U2CA 3C8HA 5HVHC 4N8PA 5FV2A 3WN5B 1FFPB 3DI3B 3C09C 2ID5A 4JFXB 3PGFH 5KTEL 2Q7YA 5DZNA 3HPLA 3UJTL 3MA7B 4AQOA 1BWWA 4CAGA 3BD5A 4XP4H 1RJZA 3SE9L 1XF2A 1WBYA 2JCCA 3BN9C 3G6DL 3L7EA 5JLZA 3MV11 4P5TA 4FQQB 2CLVA 1UJ3A 1GIGH 1DN2A 1E6JH 5T33L 3GJFA 2PXYB 1JWMA 3R1GL 5TDOA 4J1UA 1VFUA 4HH8A 4PJEB 2PCPB 4FFWD 2NY4D 1B4RA 3RVXD 4LMQE 1NMAL 4LVEA 4ISVA 1TQBB 1O5DT 5I2IA 1J1XH 3LB6D 5GRUH 4PGBB 3GNMH 1XGTA 4P4RA 2BNRA 3J7HA 1T6WA 3MOAL 4IHOA 1K3IA 1MAML 1RHHA 3UJIL 4BFIA 5IFJA 3UBXG 1BLNB 1JUFA 4UV4H 3T8XB 2AXJA 5BS0D 2CSPA 3ZO0A 4WHYH 4U2YA 3OL2A 4F7EA 4U1NA 4NO3A 4M1CC 5MEOA 1TLKA 4KTDH 5D1XD 4R90H 5DLMH 3ULVC 1BX2A 2UVFA 4ZS7L 4O2FA 4G6AC 1DANU 1T21B 2A74A 5D1XA 3DGGB 4ZAKB 3LKPB 4X5LA 4DVRH 3GMMB 1DN0A 1A3RL 1YC8A 4OQTL 3HZYA 3OG4B 4UILL 1MJ8L 1DQLL 4HAGA 4A6YL 4F7TB 5C0AD 2L7UA 4Q6IB 5HTSA 1VFMA 2ZCLH 4OSUL 1UB6B 3DO7A 1J86A 4Y4FB 3T0WA 5ISZD 1KULA 4XBEH 2RHEA 1H0DB 1OPGH 3SGDH 4V2BA 5GS0D 1M1SA 5ICXA 5ISZA 4HCRL 3TF7C 1BFSA 2DBJA 1SJXA 2ZG3A 2PKDA 3O6LL 1E4WL 2DJSA 4FNLL 3V0AC 5A2KH 3QIWB 2ZUUA 2F8VA 1A6TA 4Q9RL 4EI5A 3MBXL 3L95B 5CSZA 3GBLA 3ZHDA 1K6QH 2B1AL 3WSQH 2D7NA 2AXGA 2ZKHH 2NY0C 5HHPA 2CPCA 4Q0XH 1S5IL 1IGFL 3TBTA 3TO4B 4BELD 4RFOH 3BE1H 1HZHH 3MSPA 3VFGL 4NQCE 3MLSL 4CMHC 1ZLWH 3V0WH 3DRTB 3K4ZA 4GMSL 1U8NB 5D7LD 3QPQC 1WZ1L 5E4EB 3MMEB 1MJ7L 4R4BA 1DBBL 4PJBF 1EA9C 1LP9A 4JZNB 3BISA 3WS3B 5E8OA 4X6EB 1RJLA 5IT2L 4IRSB 1CBVH 3C6SA 4MSWB 3DX6A 2X2YA 3ULVL 3Q6GH 1EEZA 3PQYB 3T0DA 2A9MH 3OB8A 4UBDC 2M26A 4FFYH 4EXPX 3PL6B 1FYHB 1S78C 4XT1C 1HI6A 1TJHL 1UG9A 3PUCA 5DRXA 3JWOH 1G7PB 2VLRA 1J5OL 5I9QB 2EIBA 3OXRA 4XBPB 3PJSB 2PO6C 5HI3C 3Q48A 2EC9T 3ZKNC 4NQTA 2PUQT 3AXLA 4WW2A 1KG0B 4H88L 4HJGB 1EX0A 4M48H 5FKPA 2YPKB 2X70B 1JHKL 1IQWH 1H3XA 1HIMH 1WC7A 3MCKA 3MROB 4M6OL 4AL8H 1U6AH 4LLMA 1DDHA 5I1LA 3VFVA 4L9DA 3LY6A 4KH2A 5DI8A 1UM4H 4JG1L 4ZFGH 3ZDZF 4JKWA 2X09A 3U4BL 2UWEF 4J6RL 1IT9H 4HFUH 4HKZA 1N5AB 3MYZA 3RY5A 5BVPL 5DJDB 5GIRA 1H15B 3H9SB 3LCYA 4LOUC 4MD4A 4C57C 2R9HD 3V6FA 3GHEL 4F15B 1AC0A 4Y5VB 1B4JH 2R56H 5JO5B 4L9LC 1QO3A 1RULL 4JREB 4K7FB 3RL1B 1YDPB 2NY2B 5FGCE 4KMLB 1W0VB 2C4XA 4BSWA 4HS6B 5B8CC 4XAWH 4DTGH 2H1PH 5LCVL 2IGFL 3QUZD 5IUSA 1T80A 4KVCH 4PJBE 1F8TL 4V2CB 3GK8L 5D2NE 3VFUA 4AG4H 2CXGA 1RIHH 1AQDA 2YD9A 5FYKE 4LLYA 4R26H 1SJEA 2ERJC 5C9JB 4YDVA 5T1MA 1CK0H 1OTSD 2BNUB 4J2XA 4OB5L 4AIXA 3OZ9L 3BUYA 4R2GC 3VRIB 1YQ2A 2YXFA 2HRPH 4IMKA 4NKIL 3RA7H 2VXTL 4JKLA 5FYLH 4BKLA 2BK8A 1EAJA 1CG9A 1XF5A 1GZQA 1MLBB 3UTSB 4OCMC 2OL3B 5JDSA 5C09B 5CEZL 2DM4A 3PHOB 3K4AA 5DK0B 3GEWB 5DJXB 1K2DA 1BQSA 2VH5H 2GY7B 4YK4B 2VRAA 4ZTPH 4LIQL 1K8DA 1KB5L 3ZDZE 3TVMC 3AC0A 4X7SH 2UWEE 4K3DH 3TYFA 3VE0B 4EDWH 2W38A 4H0IA 5ALCH 3BOVA 1EZVY 3D85B 4HIXH 3SDCD 1JNNH 1F42A 3MJ9H 4U31A 4GG6A 3PNWA 1KLUA 3LD8B 3GSWB 2ZUVA 1Z9LA 3WIFA 1RD6A 4YBHA 3QAZC 4I1NB 1PG7L 4DQOL 4PB0H 4JAMA 4YPJA 2YC1B 1NGWB 4QGTA 4LCCB 1SYVA 2D7MA 4OM1H 3LKQB 3MRRA 2YPLB 5AZ2H 1S7QA 5TF1L 1AGBB 3MXWL 2X4UB 4CW1A 3VD3A 1PD6A 1X5HA 3V2AR 1S9YB 3CFKB 3DTXA 1N64L 5EU7E 1HDMA 3RWIB 4F9LA 3OKKB 3GGWA 4MXQD 4RCAA 3IKKA 4RBPH 4DEPC 3EYQC 4S1DC 2FJFB 5D5MA 1KYOK 4XAKD 3FFCD 2W9DL 4MCYB 1S9WB 2EYRB 1CE1L 4UINL 1R24A 4IRZL 3FFCA 3MLVH 2P42B 2ED7A 3KYOB 1NKOA 4MDIA 1MFDL 3MV7A 1OP3H 5IBLC 4OZIA 5I16B 4RRPA 3S8WA 2YS4A 3CUPA 5KSBA 1PKOA 1J8HD 2YA0A 5SV4A 5C0CD 3JTTA 2X9XA 3B9DA 3HTLX 5TFSH 3ARXA 2I5YL 5D7SH 2IPTL 3AFLA 2H9GA 2WWKO 3QXAB 4N5UA 3ARBD 1CF8L 1WUNT 4PJ5A 4HPYL 3DSFH 4OZFB 3PWVA 1HWGB 3RY6A 1S7RA 4UNTA 1W72B 2N56A 5AAMA 5KSVA 5E8EA 3OKOA 1XIWB 1ZHBA 3RQ3A 5F71A 4N9GB 2V5TA 1KPVB 2A0LC 1C7SA 2KUTA 3MRIB 1AI1H 1UQSA 1QBMH 4GQPH 1X5JA 2FGWH 5EORL 2IADA 3BP7A 4P4KA 1OAZH 3HFMH 3OJMB 3IU4L 5CEXA 1Q8MA 2UY7A 4AIOA 2AI0L 2ITCA 4HJJH 3UMTA 3T4AA 4DW2L 5J8OA 1UCBH 4IRJC 3C5ZA 3AB0B 3KPLA 3TZVB 2EDJA 1IKFH 3HC0A 4JB9H 5IOPB 3QPXH 5KAQG 3EOBA 3R8BB 3VMOA 3FCTB 5EN2B 4L4VE 4R97C 2YUVA 1SBSH 4I18A 1S7UB 1P7KB 4OGZA 3T0EE 5JOPE 3QFDB 1A7OL 3WD5L 2OTUB 1RU9L 1K8IB 3ECBA 1YMHB 1IBGL 1J87A 5D1ZD 2CKBB 4GXVH 4K2UH 1P84J 2IG2L 4O51A 3F5WB 1ZSDA 1YPZF 2DTML 2LU4A 4D9QE 1MAJA 4RMQA 1HKLL 4PY7A 3Q3GA 3SBWC 2BJML 3RZCD 4TVPE 1WFUA 3ME0A 4MQSB 4LEXL 3U46A 3D9AL 2NW2B 3QISA 4PJ5E 3G6JB 4P3DA 1TDQA 2R1XB 4L29B 1AD9B 4OQ1A 3N06B 4UAOC 1GGCL 3SDYL 2YPVL 2KQNA 4YDJA 5GGSY 3WNNA 3FB5B 3W9DA 4R96A 2C3XA 4MQTB 3WFEL 4L3CA 4Y4KA 2P45B 1UWEH 3SGDI 2YWZA 3LDBC 2AJVH 3EO0B 1VACB 3X14A 5I8CA 3G5ZB 4LPUA 4RNRB 5CZVL 4KXZH 3VXSE 2W60A 1AXSB 4JPKL 2LFGA 1IZKA 3IJSA 4OIIH 1PYWB 3M1BA 1TZHB 4UMGA 2I9LA 5TDNA 1PDKA 2K7QA 3CPLB 2VERN 5HHVL 1KB9K 5EIIB 3WFBL 1ZEAL 3QDHA 4K9EH 3MRPA 4WO4A 1A0QL 1HKFA 4KQ4L 3NIDF 1ZLVK 3WEXA 2IQ9L 4M62L 4PBXA 3BKYH 4Z78A 4UB0L 1HOCB 1A21A 3NCJH 3ZYJA 4G6JL 4XP5L 1F3JB 1VGEH 4JRYE 3V6ZB 3LS4H 4OI9A 5IMMA 4WFEE 1YC7A 2XA8H 3P4OB 4UNVA 1RK0A 1OQXA 4Y5XA 3FN3A 1YPZE 2OXGA 5IMKB 2KDGA 3V7AG 1A4JB 1NCAL 3SE3C 2VITA 4ZSOA 2EDOA 5DQJB 3PWLA 4Y16D 5EB9A 4KHXL 2VDNL 4OBSA 3LSOB 3ABZA 4Z76A 1YN7A 2QTEA 1JGLH 4J3WA 4ALAH 1F45A 2VUYA 2OP4L 4Y19E 1EHXA 4G8EB 2Q76B 5H35B 1XGRA 4JRXD 4P2RA 1FDLH 1A7NL 1MIMH 5KSAD 5MEQA 1IC4H 4RGMB 2F8XC 1JPSL 3U82B 5GGUB 3QHTC 3C60A 1EJOL 2OJEA 4HX1A 1KJ3L 4FN0A 1F4YL 3HRPA 3OTTA 4TUJA 3ARQA 2NY3B 3HZVA 2VC2L 4KKAD 4WI2A 1YJDH 4WHCA 2MKWA 1NAMB 5I1DA 5MERA 4KTEL 4X7TA 4J3VA 2IAMB 1R0AL 2CH8A 1I3UA 5E1AA 4IOSD 1D6VH 1FN4A 4PJFB 2AABL 5IHUL 3P4LA 2DQIL 3IKCA 1OM3H 5J3HD 1JGVL 5AZEH 4X9HA 4M1DH 5F1OB 4YHYB 5JNYA 5I75B 3RGHA 5JDJA 2XKSA 1KGCD 5L6YL 2B0SH 3FQUB 1F2QA 3IS0X 3TIDA 5CWSB 3CVHH 1QQDB 3RGVB 1M6OA 3TBVA 3I84A 5DT1H 4QRPA 1MY7A 1MHEB 1G0DA 2D9QB 4H26A 3RWHA 1R3IH 3EYSH 1HHGA 5EZLA 3VWJD 2J7LA 4AJ0A 1BFTA 2AQ2A 3ULUH 4Y88A 4OLXH 2ED9A 4GRWH 1HINL 3VWJA 3PDGA 4G5ZH 4U1SA 4F33B 3DROA 4L8CA 2EYSA 4ZXBA 3BZEB 5E2TL 4KKCC 4DWHA 1FNSH 2G9HA 1FGNH 4JRWA 3MRBB 4JN1L 2YN3A 4QRRA 5HYSG 4TYUA 3IFNH 1EHLH 3HPJA 4Y1AA 3I6LD 4DK6A 4G43A 1TJGH 3RTQC 2JIXB 5EWIL 3UYRH 3FT2A 2VSCA 3PWNA 1ACYL 4NRZB 2X4QA 4GRLA 4XPBH 1FFRA 3SY0A 3NPZB 3QNYB 2ZOLB 3ES6B 1G7HA 2P7TB 5EUOA 3KGRA 5EU3B 3W0WA 3MRCA 5GRXG 3BJLA 4N0UA 3ARWA 4IMLB 4YHLL 5T3XD 4LF3A 3R06A 4KC3B 2E7HA 5IBTL 3TLRA 1D9KC 1WIUA 3FO1B 1HILB 4OZGB 2RCSH 3PABA 1IEBB 2K3TA 4PREB 5DDHB 2XG4A 3ZTJH 3S88H 4F57L 2OI9B 4ZPTA 4KHTL 1P6AB 4LQFH 1U8JA 4M6NH 1Q72L 5IB5B 2G2RB 3BZDA 3QDMB 1GSMA 4N0CC 1MHCB 4N5EC 1I8KB 3F7PC 2R29L 4QRPE 5I1JL 3PHSA 3QUXA 1I7RB 2OX5A 5AG8A 4OCWL 3DX7A 5IW1A 1L7TL 4MJID 4X99B 2WV3A 3VA2C 1KC5L 4HUUB 1KCSH 4HXAL 4KRNA 5AG9A 3WNOA 1P1ZA 4XMPL 5E5RB 4AQ1B 5KVEL 5E08L 1ZS8A 2ZUWA 4GS7C 2Z4QB 5TE4L 4JANB 3BIBX 2XTJC 4QRRE 4YHNA 2BVOB 3EFFB 1XGUB 4A6YB 3VRJA 1KNOB 4TPRL 5I1EL 1RHFA 5CS7A 2LTQB 3PIQA 2DLTA 2YUZA 4DGVH 5FB8A 1A7RH 3WXVH 4ORGB 3KYNB 4L5FL 5FUOL 5HVHB 4AEIL 3RVVD 3V4PL 5JORB 5H94A 3C09B 2BSED 4OGAC 3U7WL 5DD5L 3D0LB 1EDQA 4OTXH 3TJEL 4I3GA 5KS9A 5D2LA 1OF2B 5HGHA 4LKXA 2W9EL 1BEYL 2GTZB 3WO4C 4XP9H 1LEKA 2A9NL 1MF2H 2NYYD 5I8EA 4TULL 1QSED 4OZFG 5GGRY 1LGVA 3DV4A 1JV5B 2Y6SC 3BRDA 1J1PL 1QSEA 5D1QA 4Q97A 1NMCB 4WUUE 4TSAL 4XCEA 3QZWB 2BP3A 1CDJA 3DMMD 5JHDA 3FOLB 3ZT5A 1OAKL 2DKSA 3PWJA 1P7QD 4OAWB 1AO7D 3CCHB 1TTGA 2EYTB 3MRLA 2VZOA 3MJ9A 5HY9A 1P4IH 1QLEH 1FGVH 5GISL 1NDGA 3DARA 3PE9A 1AO7A 4PS4H 4G3YH 2I9TB 3TWCH 3BSZL 5ELIA 1DVFB 1T7YA 1BIIA 3P30H 1OARL 4HV8B 4R9HA 1JZ4A 3LQAH 3BGMB 4LNRA 2ATKB 1JI1A 4WUKL 1GGBH 2VAJA 4PJ9D 4QXTA 1BGXL 4M5ZL 1OY3B 4QRQB 4JFOA 2CO7B 1T89C 2CLZB 2CRYA 4M7KH 4KI5D 4NO0A 5ACLA 1L0XA 1CQKA 1MRCL 5IM7A 1NBVH 3GHBH 3VW3L 2FBOJ 1CICC 2QSCL 5BRZA 2OQJA 4FZ8H 3ESUF 4S10A 1JBJA 2Y72A 2YZ1A 4X4ME 4HWEL 1U8OA 4PJAF 3GBNL 3IU3A 3NABH 5FYLE 3RVUC 1PGRB 4G6MH 5ICZA 4HD9A 3GSNA 4LSRH 1YQVL 1MLCA 3WDHA 4KK5C 5LXGL 2AK4B 4HUMB 5ICYA 5BOPA 5KVDL 3TBSA 4OV6F 1FFOA 3L5HA 4MZ3A 5K9QG 2NTFB 2LU3A 5T5FL 3GSQA 4FQ1H 2EH7L 4BH8A 1M7XA 3HUJF 5MENA 1YEJL 3WFCH 4KXZI 1FNFA 5DMGC 4P49A 4NQCB 4YXLH 3EZ8A 4P5KA 4OT1H 5E9DE 1T4KA 2R2HB 4NFDA 2Y5TB 4KJPC 2MFNA 2X5PA 4HS8H 4MYWB 3QCTL 3NMEA 5K9KB 3NCBB 3UTOA 1AR1C 2R39A 4I5BA 4GW4B 2ZUSA 2Y06H 3LOWA 3RL2A 1J0JA 4B7IA 4YPGA 1OVZA 4HSQA 3B4NA 3DSNA 4QRTA 2HKFL 4G9FA 3PWPA 4L8BB 4C59B 4NRXA 1A6ZA 3NFNB 5K59F 5KW9H 1IFHL 3T0AA 4I0PC 1ZK9A 2AGJH 1MQKH 4G42B 5JW3H 2EDKA 5MHSE 4YNYB 4MDJB 5CUSL 4NUGL 4U1IA 5BRZE 4RDQG 5ITBH 1BBDL 2VKXA 4NQXA 4ZO9A 1LO2H 3WLBA 5DJ0A 3REWB 1FVEA 4F80A 3OJDA 3W2DL 4DCQB 2DM3A 3CU1A 4GAGH 1M05B 1J11A 3BT2L 5IJKA 4NWUH 4PJAE 4KZEL 2EDEA 4K94C 3MNVB 2XNAB 4N1EA 1JYWA 1QLFB 4X8JA 4JPIA 4XNYH 4S1SH 1KB5B 3VFTA 4F7CB 1DBAH 1U3JA 2Q20A 1R3LB 5D70H 5TQ2H 1LK2B 4NQSA 1R3JB 1U8LB 4FQXC 2NCMA 2ZJSH 4MNQB 3MXVL 5CLTA 4XH2A 3SKOA 2FHFA 3HUJE 1DFBL 2WM0A 1JF1A 4NT6A 4LSVH 4XMKL 2UYLB 2PN5A 4Z77B 4Y4FD 5EO9A 1NCDL 2NMSA 3C8KA 2O5YH 5I19H 4L3EE 3ZKXC 3KPMB 3TBYA 4L9LB 4M7LT 3BEWB 5EBGA 2P5WD 3U9UA 3EO1A 3BPCA 4WFGE 3UTTB 4A2LA 1TCRA 1WISA 3LPGA 2P8LB 1U8MB 3QIWD 1HQ4B 3WS6C 2VZTA 2W07A 5IB4B 1N6QL 3MA9L 3PWPE 4P23D 4F58L 2Z92A 5DFVD 1A6AB 3UPRB 2IH1A 1JNLH 1R5IA 2FX8L 5B4MD 4U3XA 2JK5B 5K59E 4YBQC 3MBEB 3HE6A 2VDRL 1AGEA 2A1WL 3NFSH 2ERJB 3VXQB 4XWGH 3QDJA 1IGTA 4H0HB 3QQ3B 3U1SL 1TQCC 4HBCL 3QUML 1UM6H 5LG1A 5CGYC 3FZUD 1YEKL 4XCNB 4R2GB 4M6MH 4FS0A 1U36A 4O4YL 4NRYB 4ZNEE 1I1YA 1WWCA 4OKVA 4D8PB 3OR6B 3OAZH 2A6KB 5L2KA 2O5XL 3QDGE 4WU5A 3IETA 4NCC2 3M07A 4TN9A 1C7TA 4DGIL 3O2WH 3TN0A 3MO1B 4IRSD 1U95A 1BMGA 4KJYA 1GAFH 5IVXA 4K94L 3ARYA 5DJZA 3PQYD 1I7ZA 2V2WA 1G7QA 2QR0B 43CAB 3PL6D 2AEPH 3QBTB 4QHLB 5F7KC 2VXVL 5SV3A 3TVMB 2K1MA 2A73A 2DIJA 3CD4A 1SVZA 2E6PA 4TUOA 4E42B 3FQNB 2ESVD 1I4FB 4HKJA 4U6YB 4BQ9A 1YYML 4JO2L 3V0VB 2AEQH 3G5XB 5I8OL 2ESVA 3CH8A 3V4VL 3IXTB 1KEGL 3FT4B 4X6FA 3QT2A 5EOCH 3GM8A 3MREA 2H32B 4EI6B 4HUWA 4ZFFA 1MHHB 4I77H 1LD9A 5ADOH 1TVDA 4PRPE 5HYJE 2J8UF 4Z7UA 2X89D 2VDPH 3EOAA 3QULB 1ZT1B 4PJ7A 4Y5YA 2X05A 4MGXA 1UENA 3ARUA 1CXFA 1I1AD 3CMGA 4GFTB 4DEPB 3LRSA 3H9SD 3KJ6H 3O3EB 5J06A 4I4WA 1CVSC 2DI9A 3RWCA 3QXDB 1JHTA 2RIKA 4M5YL 3NVQA 1CFSB 2NY2D 3G9AB 1IQDA 4KROC 1KT2B 5DHYA 5L2KE 4AK1A 3CVHA 1MI5E 1LO5A 1HHKB 3TFKC 5T5NG 5CMAA 4NM4H 2AKRA 15C8H 1S5HB 3ARGC 3BPLC 3UZQA 4ENED 3T4YA 3SEPA 1F11A 4ZUWA 2A38A 1BFVL 5E24E 3I9GL 4O9HH 3MRHB 4E41B 2JLLA 4BZ2H 1U91B 3OAYK 1VADB 25C8L 1ZVHA 1N0XH 5DD0H 5IFHL 4JLRB 1KXQE 3KAAA 1ZVSA 4QHNA 4OUOA 3W9EA 3O3DB 3SDAC 2OZ4L 2NLJA 1CZ8L 2BXYA 1FO0H 2ZSVB 1DEDA 2GJ6E 4HFWB 3HMWH 1A14H 2QSVA 5HHOB 1CQYA 1NC4A 9CGTA 4OLWL 5EBWA 4O58L 5C09D 4IRJB 3QJHB 5HGAB 3O2DH 3O9WA 3U83A 4K7PX 3EYOA 4RISH 1BVZA 2J8UE 1CE6B 4MCZB 4QHMA 1P9MA 4XCYA 4QRUB 1INQA 2FLRT 1CLYL 4WTZG 2YRPA 4ONGL 4JFFB 4R97B 3L3KA 3D85D 3N0PB 2HP4A 2PTUA 3VXRA 3DURA 4PR5B 5I1CL 3VWKC 3SCMA 2VO5A 5E6IA 4HQQH 1BHGA 3JSSA 3W39A 3QZWG 2X4PB 5EOTB 5C0FA 5DEZA 4XNQB 1IMHC 3MV9A 2GITA 3RP1A 2GHWB 3IDYC 1U41A 3MJ8A 3O41B 5DK2A 1T66D 4DZ8A 1UA6L 2E9IA 4PLJD 1F3RB 4P5TC 3FQRB 2PF6A 3S98A 1I3RA 4FA8A 3KWWA 1UJ3C 1C12B 2YPLD 1RZJH 3UO1L 1DJSA 4APQB 3VXUB 3GMRB 3LN9A 4YHIB 2XZCH 4GRWE 1OAUL 4R7DB 3CJJA 4K23L 1ZA6A 5BMFL 1L0QA 4JN2B 2Q8BH 1DLHA 1RZKC 4YO0A 3LIZL 1ZV5A 4JFPB 3RVXC 4OLUL 3WIIH 1JNHB 3RIAF 1HHJB 3HNSH 1U8IB 1BQLL 3F12A 2NY7L 5IG7B 3LDBB 4R4NC 1A22B 1RZGA 1F4WL 4EQ3A 2IANB 3PF2A 4JPWH 2EH8L 3C5SB 1JZ7A 4KKNA 4FQLH 3HKFA 1BZ9B 3P4NB 2ZG1A 5T1LB 5DD3H 5TE7H 1T2XA 4MAUL 1KJ2H 2OBGA 4QYOA 5FK9A 3DUUB 3JXAA 1TXKA 2JB5H 4HHAA 4D0DB 2A2QT 1QA9B 4X6BA 5D1XC 3HLAA 4M02A 1DBKL 2V2TA 1NBZB 2OJZH 5ANMA 4GAYA 5FIEA 4PRDB 2W65A 5EBMA 4WI7A 3BDBA 4ELKA 1AKJA 3WIHL 5EC1A 1TETL 1XIWD 4M7ZC 2OSLA 3UPAA 2YUWA 5GSVA 3PGCB 3OR7A 4PRBB 1DQQB 3DOSA 4YWGH 5GGSB 4YLQT 4E5XA 1K4CB 5F8QC 1EEYB 1T5WA 3HG1B 4ODWB 2XOTA 2MCPH 5IW6A 1NGZB 2WBJA 4QKXB 5C0AE 5TPWH 3S5LA 3P2TA 5EZIL 3DXAD 1UT9A 1PAMA 3TZVD 1QRNA 2NY1D 5BZWB 2MQCA 3VDCA 5EIVA 4Y4HD 3AAZA 1VKXA 2XRAL 1P69B 4UTAL 5ADPH 3HC3L 4EI5C 4U6XA 3K1DA 1CDUA 5IB1B 4XRCB 3V5KA 2NZ9D 3ARPA 1V05A 1WBZB 5F3BA 3IDJA 3LEYH 4EJ1C 3L3DB 1MCLA 4IM8A 4Z0BH 3VFWB 3O4LD 1RZKL 1HXYB 1Q9LB 5HYQA 1IC5H 3O4LA 2J12B 4ODHH 3SKJL 4PTUB 2B2XH 2VN4A 1KCKA 4YR6B 5CEYA 2QQNL 2XQBH 4GBXD 4G6FB 1A4KA 1CN4A 4BSVA 1TVHA 1TPXC 2ICES 3KYMA 1QP1A 1M7IA 5D7LE 3MCLL 3MUZ1 2QQQA 1Q1JL 2GT9B 2E8ZA 5DD1H 1LEIB 2HTLD 2AJ3A 1PZ5A 3E1F1 3TV3H 1BM3L 3FHAA 2DLFL 4U1GB 2VLJB 2CIKA 5FO7B 4WEMB 1P84K 2XTLA 3EFDL 4WW2C 3MOBL 4EDXA 1KCVH 3QH3A 4DAGH 5E5MA 1D7FA 5EIQA 4W68A 1MFAL 1PG7W 1YMMD 5EOCJ 4FMKA 3Q1SL 4XCCH 2V5YA 4FXKB 5AUMB 4U1JA 1MCIA 1A47A 5F7EH 3SOBH 1U92B 1CGSL 3Q0HA 3QCUH 3VFNB 1UVQA 2IJ0C 1OGAA 5FM5M 1F6AB 1F97A 1C5BL 2HT2D 3K2UH 4H25A 4PJGA 4OV5B 1HH6B 4CNIB 3C5JB 1AGDB 1AXTL 2FYYA 1DSFH 4MNHB 4LHUD 1IGCH 4GAJH 4NC2B 3AM8A 1BOGA 4RGND 1U8KB 3K2MC 5GRVK 1F6LL 1MFBL 4NJAL 3RTQB 5SWSB 1CDBA 3K74B 4YHMH 1CL7H 2BOBB 5D71H 2HKHH 2JJTA 1MCDA 2ZPKL 3QO1A 2OM5A 2BSRA 2VAAA 5I66A 1NL0L 1PW3A 5EA0L 3P9MA 1ORSA 1T1YB 2HT3C 4P9HC 1WBXB 1I9IL 2Y36L 1UXWB 2HJLB 4BFGA 2GY5A 4K3HA 4K7PH 4U1KA 4V1DD 4Z9KB 5IMLA 1D9KB 4Z5RB 4NC1E 2Z8VC 3D69A 3H6JA 4HLJA 8CGTA 2I07B 4JDTH 4DFHA 3AS2A 4TSCH 4YBLB 4UQ3B 2GCYA 4WI5A 3K8KA 1UH2A 3MNZA 3QG6A 3O3BA 3VFOB 5HGDB 5L2JA 1VEMA 3G5YA 4IMKC 3WCYA 1AGFB 3CFJB 5E8DH 3MJ7B 3O11B 4AH2A 1T83A 4TSBL 3H3BC 5FFLA 3KLSA 4KJWD 2VNCA 4ONFL 5HD8C 5D7IF 2WZPD 2IAMD 1W8OA 4JR9H 3VXMA 1UZ8B 3UTQB 2DQEH 2VMFA 4FG6D 4GS7B 4PY8J 3O3AA 2XTJB 3FMGL 4OFKA 5EFIA 5FKAB 1I8MA 2FL5A 1Q9KA 1EEUA 3THML 5DUPL 4HT1H 4WCYL 3OSKA 1CT8A 5FGSA 5J1SC 3RGVD 3BD4A 1EFXA 2F54D 3V8CA 4OFPA 1ZA3B 2R4SH 3KHOA 3PGDB 3ARZA 2F54A 3K8LA 2BNQB 3MPCA 3PP3K 4TTDC 5DC4B 5DC9B 4DKFL 2E9WA 3HZMB 1A64A 2W0FA 4JY5L 4ODVL 4LVNC 4GW5B 3FT3B 2C26A 1KELH 4XZUB 4XNXH 3NN8B 4RSVA 2MJWA 4ODUB 1I7TA 4P9HL 4H8WH 5GJSL 5DUMH 4ZO6A 5F93C 2AEWA 2LV4A 4X6CF 4ZODA 4LCIH 3V6BR 3QIBB 2R1WA 2QL1A 3WO4B 1RVFH 3LH2H 4GH7B 1A1NA 4LLQA 4LSQH 4OGXL 4QOKA 3FB8A 3UBXI 4F9LC 4NO5B 1BFOB 4KUZH 5CD3B 3NZ8A 3JWDH 4HPOL 3KPQA 2YBRB 3WJLA 3BRFA 5DF0A 5I1KH 7FABL 3H7BA 5DYOB 4N0YL 3DX8A 3FO9A 1WWBX 4PY8I 1T1WB 2X4NA 4WENB 4LCWA 3GKZA 1FLTX 4KMTL 2DIBA 4WWID 3QUYD 4HG4J 1F4XL 1SEBA 4HK3N 2V7NB 5EBLA 2P47B 1LE5A 4NGHH 3QUYA 5CINH 1FL6A 5D7IE 2Y1VA 4Z7VA 5CSBA 2DMKA 3VFPA 2DRUA 1S7TB 1CDIA 1NSNL 3D3VA 2XG5A 4L4TA 4P2QD 1J8HE 1K4DB 5C0CE 3S34H 1D5BB 4YFLI 2YEZA 5F96H 1HHHB 1MAKA 3Q2CA 3RY6C 3OGOE 1PQZA 2E27H 3QDMD 2IQAA 4G8GA 3LEVH 1QSFB 2CDFB 4JFEE 4GKNA 4KMQA 3LN5B 1BZQK 5GGRB 4FQ2L 2C3VA 4XXDB 4NNYA 3BVNA 1HH9B 4P4KC 4CJ0A 1CICB 4LLAA 1JRHH 4WWKA 1E6OL 5T1KB 5CZKA 5F6IC 4W6XB 3ALXA 1WICA 3UJJH 3MODH 3RWGA 1EPFA 3BZFA 2HLFD 4EBQH 1T04B 5L9DL 5FXCH 3C5ZC 1WFOA 4G9DA 4HKBB 1F02I 3L3IB 3OMZA 1N6UA 4YDLC 3OX8B 4X6CE 5FF6A 4KQ3L 1YEFL 4QOKE 4QY8B 2HFGH 2XKNB 4I18C 3I2CL 1V5JA 1RK1A 1ZVYA 4NQVA 2AV7B 5KG9B 4OF7A 4RMRA 1NC2B 5J1AB 1HNFA 4J8RA 4KUCF 1KTKE 2ITDA 2D7PA 4LCWE 2R0KL 1FYTB 3RDTA 5D1ZC 5ACZA 2A6IB 3BN9D 1UACH 1W0WB 2Z93A 1CLZH 5GRJH 4QXUH 5J6HA 1FO0A 4DUVA 3UBXA 1G7JB 1VFAA 1FH5L 5C0EA 5C0JB 3DECA 2K7PA 1P4BH 4QTHA 5HHQB 4N0FA 3RY4A 4N8CL 3KR3H 3R0NA 1XGYL 5IEKB 4PJXB 3QUMB 5IVZA 2CJUL 1O0VA 3O2DA 3KPNB 4I0PB 4D0BA 5I1HL 5IV2A 1NCNA 2ORBL 2H26A 1QBLL 4XTRD 3ZYIA 2HG5A 3VXTA 4Y4KC 4M93C 4P9ML 3K7UA 4XC1H 4K8RC 4P57A 2EKSB 1I9EA 3SKNA 5CHNA 3P11L 4CVXA 4KKBD 5TQ0H 5ILTL 5INDB 5BQ7B 4LLUB 3S35X 4TUKH 4M1CD 2PYEE 4UDTA 2VQUA 1VB9A 4XNMB 3CXHK 1UH3A 4G6AD 3C8DA 4N90D 1CFTA 1S7XA 1C5DA 1MELA 3DVNB 4G80A 1FNHA 4JFDB 3BWAA 5INCA 5K9OB 4WO4C 3FFDB 4HXBH 2VLKB 3AU1B 3WKMH 1WCQA 4LQ1A 2IMNA 2VTFA 1IGIH 2PR4H 5E8PA 4ZFZA 4LSTL 5TH2B 3KPSA 4OCSL 3LKOB 5CJ5A 2Q1EA 3LQZA 1PEZA 1T2QL 3MV8B 2XN9A 5JHLL 4JY4B 4H20L 1A02N 1T03L 4BZ1L 4Y5XC 4R3SA 1A7QH 3ESVF 3HR5A 4MA1B 1MFNA 2DYPB 4LBEA 5GJTL 1X5LA 5D6CB 5CBAA 4XVTL 2R69H 2DQTH 1B0WA 2CDGA 1M4KA 2FCBA 5C07A 4KDTA 2FB4L 4Y16C 5KN5B 2HVJB 4M7LH 5AWNL 1I8IB 1DEEB 3ZYZA 3CNKA 4O2CA 2LVEA 1KJ2A 5SWZD 4MA7H 1I7UA 5C8JB 3NTCH 2NY0D 3O0RL 5ESVA 1TQCB 5I17B 2FD6L 1T20B 3U0PA 5SWZA 1WLHA 1FC2D 4NNXB 1HSAA 2VXSL 3EOTH 3O4OC 1RZIB 3CDGB 5T3ZD 2YN5A 3C60C 4JRXE 3STZB 2BCKB 3DPBA 4TRPL 1N59A 5JQ6L 3CSBA 4X9BA 2D4DA 4L1HA 4LPVA 3QPQD 3U0WL 4OGYH 1YYLL 1JCKA 4P59H 4AEHH 3U7YL 4MHHG 1RUKH 1PLGL 3L6FA 1E4XH 3MR9A 3NCEB 2R23A 3IJHB 1Q94A 4GQ9H 1N0LA 2GJZB 3WDJA 1BBJB 4IJ3C 5FECB 4C56D 3HI1A 2FLBT 3RPIA 4UBDD 5F7HA 5DTFA 1MCRA 3X12A 4XP4L 1S78D 4C56A 3QEUA 6FABH 5KSUB 1TFHA 4QRSA 2XN9E 2PO6D 4HWBH 5HI3D 5IJVA 3ZKND 5EU6D 1F13A 4J4PA 3SQOH 1OAYH 1CD1B 1MCOL 3D6GA 1V3LA 4LCYA 1KGCE 5CEZD 4GJTB 2F53A 3WL9A 4KZDL 5EU4B 4HULB 3L7FB 2W9LA 3MGOA 3VWJC 4QHUA 3TT1L 1SM3H 3JTSB 4CADA 3FRUA 1CFQB 4ZXBC 4XGZA 4F8QA 5J6GA 3IFLL 1C1EH 2VYRE 4XWOC 5DJCA 1GVIA 1PSKL 5F6HI 5F1KC 4X5XA 2QKIA 4YGVB 4NKMA 1MCCA 1DLFH 1D5ZA 4GRLC 4R90L 1NJ9B 3VGAC 3KPPA 5I15H 3R0MA 4RMUA 3G6AA 2HA1A 5DJ2B 3D39A 4PFEA 3GMQA 4NZUL 5C0DB 1IGJA 2DDQL 4LLWB 2WMPA 3BKML 1ZLSH 3JWOC 4MS8C 4TNWF 4DKEH 4OCRL 1CI5A 3NOIA 5DVNA 3W81A 1MFCH 3DRQB 2P24B 1Q9OA 2DL9A 1Q9WB 4J23A 2GFBA 5A2LH 1A6UH 5J11C 1U8HA 2R8SH 4P2OA 2OTWB 3BPLB 1XGPB 3ARGB 5LGJA 2ZCLL 4OZFH 1WEJL 4NUJB 5C71A 2WQ8A 3EBAA 3MNWB 3E6HB 1Z0NA 4PRHD 3EDKA 4XBEL 3WHXB 3WNKA 4KDVA 1R5WA 1KIRB 3A0OA 3VCLB 1KIPA 1JGEB 1P4LB 4R2GD 4JQIL 3RWFB 3B2UD 3SDAB 1RJYB 3QUXC 3HHRB 5DA0B 3AREA 2L0DA 1OLZA 3L3GA 1IAMA 1EXUA 4NKDA 1OTTC 4NZDA 1UYWH 1VFBB 3CFEB 3MLPA 2XQYK 4PJHB 4WY7H 3X3FL 3WSQL 2E7MA 3I75A 4YDKH 1ZLUH 4ODXA 1YEHH 2ZKHL 5LAXB 2NX5A 3DVGB 4EUPB 3V79C 3VI4F 1N2RA 4CJ1A 4Q0XL 4RQQB 1JK8B 2X9WA 1X5GA 1CD9B 1VPOH 4HK0A 2AJZB 3TVMD 4D9LH 1PZUB 3V0WL 3D2UA 3E2HB 3UDWA 3CLFL 4MA3A 4L3AA 3VWKB 4ERSH 4FTVB 3OKEB 5D8JH 5IGXL 1QVOA 4KI5F 1N6VA 1VSCA 4KY1L 3JZ7A 2Q7YB 5EZOH 3HPLB 1TZIA 5F89A 1AY1L 2C1OB 3Q6GL 1XF2B 1WBYB 2JCCB 2Z91A 4NHUA 3S35H 2WQRA 5JLZB 1JPST 4P5TB 2A9ML 4F2MA 3DWTA 3GJFB 1B0GB 3JWOL 4BM7A 1JWMB 5TDOB 1TNMA 4J1UB 5FO9B 1MHPH 3MRGA 1UJTA 3UAJC 1H3PL 5T3XL 2P46B 3E8UH 4MVBC 4N9OB 4ISVB 1ES0B 2CMRH 1JRHI 3EYQD 4S1DD 5CGTA 1IQWL 3RIAK 3GB7B 5D1QC 1I9JL 4HS3A 4ZOBA 4ELMF 2FATH 1U6AL 3MLRH 4MLIA 4NQDD 1F4AA 1XGTB 1RZ7H 5C08D 2BNRB 1LO0L 5LQBH 2GEEA 4OFDA 4IHOB 5IBLD 4BFIB 5IFJB 4P0DA 2C3GA 4ZFGL 2IALB 3BP4B 1XGQA 1NGQH 1X3DA 2DWDB 4F7EB 2Z8RA 4NO3B 3WN5A 1IT9L 4HFUL 2DB8A 4ZDHA 3QFJD 5BS0B 2VN7A 4LGPB 3VD9A 2V5SA 3T1FB 2A74B 5D1XB 4Z7NF 4E41D 2DQJH 5CJXA 4FQQA 1T5XA 3OBAA 2QBWA 1B4JL 5DO2C 5HPOA 1WSST 2E9BA 2R56L 4TQEH 4XNZC 1DN0B 1QSVA 4YFEA 2PXYA 4M7ZB 3VGGA 3HZYB 5CIPB 4OM0H 2A0LD 2EIEA 3QIUA 4PJEA 4X7FC 1JZ8A 2PCPA 4XAWL 4DTGL 2H1PL 2DQUH 4KVCL 4OI7A 4BUGA 3L3HA 1MEXH 1CU4H 4KI5E 5HHOD 2Z31D 1RIHL 1UADC 2J4WH 3T2PA 4KI1A 4PGBA 1S7SB 2Z31A 4IRJD 5MI0C 5ISZB 3H9ZA 3QI9D 5DFTA 2PW1B 1CK0L 3O3UN 5HSFA 4GKSA 4H5SA 1V3MA 5HGBA 3FQXA 4FABH 5ERWA 1A6TB 2DN7A 4F7PA 3CFCL 3MFGB 4EI5B 3DETC 4JFFD 4F7MA 5CSZB 1SMAA 5DVKA 2V6HA 1ZANL 4QXWA 2AXGB 3DGGA 4ZAKA 4XPFH 2ICWB 2DQHH 3QHZH 3FHQA 4RX4A 5HHPB 5DC0A 3OAUL 4ELME 4PP1C 4YX2H 5DMYA 5J4MA 3KLDA 1NCBH 3DYMA 3TBTB 1GC1H 2VH5L 4ZTPL 4FZEH 2AS5M 5KVGH 4Q6IA 2B7DT 3OB0H 5E03A 3UX9B 1FIGL 3K0WA 4X7SL 4EDWL 3ZKMC 1R3KA 3MACH 5ALCL 5D7LB 1CDHA 1LP9B 3VXUD 4HIXL 2HN7B 4S0SD 3IDIB 1JNNL 1TPXB 5E8OB 1RJLB 3MJ9L 4Z7NE 3EO9H 35C8H 3O6FA 5DUBA 3C6SB 5K9JH 4G8FA 3DX6B 1EEZB 4NBXB 3SE8H 1I3GH 1ZLVH 4E0RB 3KPRD 1RFDH 2GAZA 3C2AH 4LDLB 3F7YA 4PB0L 2VLRB 3KPRA 3L95A 3OXRB 4OM1L 1BWMA 1UWGH 4CDGC 4OLEA 4ZOEA 2QQLH 4WW2B 2EKJA 4Q74A 2JJWA 3IAPA 5FKPB 2A77L 1WC7B 5IJKC 3TO4A 3V6OA 2LE9A 4LLMB 5I1AB 4X7CC 4KK6D 5I1LB 2VKWA 3DRTA 5IF0A 1T7WA 3D25A 5EDXA 3TO2A 1JWUA 2P5EA 3QQ4A 4MXWL 1BREA 4YC2C 3GSNL 4OF6A 3X11A 1ZMYA 4HKZB 4X6EA 3S7GA 5GIRB 2DI8A 1Z2KA 5C0BA 5TFSL 1X5KA 4OJFL 3HG1D 1V7NH 2OXHA 4F9PA 1E4XI 4AMKL 5LGKA 1QO3B 4BQ8A 4LPXA 1XT5A 1G7PA 4MZ2A 1C08A 3QWOA 3R1GH 1NCWL 4BSWB 4ZUVB 3V7MA 1G7LB 3ILQC 4HJGA 1CFVH 1AI1L 2P5WE 1QBAA 3QUZB 1QBML 3QA3A 1PFCA 2FGWL 3FO0L 4NSKB 4HLZG 1OAZL 1UB5A 3HFML 4P23C 3BO8A 3HE6C 2EO1A 5DFVC 3GMOB 4LLYB 5B3JF 3W5MA 1SJEB 3I3EA 4YDVB 3MOAH 4HJJL 1I9RH 5T1MB 3UJIH 1T7VA 3M45A 3T2QA 3BUYB 5TF0A 1IKFL 1PG7X 4JHBA 3TCLA 3FZUC 3QPXL 4OIBA 5GZND 1N5AA 4RWYL 4BKLB 1DUZB 4X9FA 4YIQA 2VQTA 5E8NA 3GUTB 1H15A 4NFCA 1CG9B 1XF5B 2V9TA 1SBSL 4HMCA 4G6FD 5JDSB 3DI2B 5GRZA 4U1MA 5JO5A 3I6KB 1A3RH 4XB7A 1LO4H 4OQTH 4GXVL 1DQLH 1W0VA 5CSGA 5JXEA 4HS6A 1K8DB 4YDIL 4LLVB 3ZTNL 2BY3A 3JBG7 3TYFB 1KJMA 3VD7A 3PQYE 5HYSA 3SDDA 1KYOJ 4GG6B 3HE7D 5BV7L 1FL3A 3QUKB 1KLUB 5C9JA 4JO1L 3GSVA 3HE7A 4QF1B 3O6LH 1E4WH 2BNUA 4FNLH 5IW3A 3WIFB 2Y9RT 3VRIA 4G7YL 4LVNB 4LKCA 3UZEA 4QCIA 4CN4A 3MBXH 1J05A 1I1FA 1SYVB 4KKCD 1HQRB 1OD7A 2N1KA 2B1AH 1S7QB 1UWEL 4R0LA 3RVWC 5D7JA 1WAAA 4ZOAA 1GHFL 4Y5YC 2F74A 2IFGA 5IR1B 1OTUC 3DTXB 3LKNB 4NP4H 1HDMB 1OSZA 3LHPH 4ZD3H 1S5IH 5B3JE 3EJJX 4PRIA 3GGWB 4YUEL 1JYNA 4UUJB 3PHOA 4LAJH 5DK0A 2H3NA 3MRFA 2BVYA 3TPUA 3MLSH 2AK1L 4OIIL 5D5MB 4U7SA 4MNGA 5CP7A 1GPOH 1WZ1H 3SDXA 3FFCB 3U9PL 2ZNWA 3VRLF 1BZ7B 4MDIB 1DBBH 3MV7B 3H9SE 4OZIB 4OZ4A 2SEBA 1U8QA 5KSBB 3HI5H 4HWBA 5EH1A 3T04D 3JTTB 5IT2H 3WDIA 5FA3A 3BKYL 6CGTA 3MQIA 3ULVH 4JEGB 4OZHB 1N5YH 1VGEL 4EUPG 4IOFC 3ULUC 1TJHH 1CGVA 2WIMA 4JQXA 2XA8L 1RY7B 1A3QA 1NGWA 3PWVB 4LCCA 5B39A 1S7RB 4LHQB 1OAXL 5I73C 4LPYA 5FM8A 5KSVB 4N0CD 3OKOB 1ZHBB 2FJHB 3NCFB 4N5ED 3ZZ1A 5DRNA 4LP4A 3U7AA 1KPRA 5FOBA 3OKKA 1QEWA 5H37H 2IADB 3BP7B 4I9WD 4P4KB 1KIUA 1EZVX 4M6OH 3SJVD 4ALAL 3FAXA 2BVTA 2FEEI 2ARJB 2FJFA 5CEXB 5F6IB 3OGCA 3SJVA 2ITCB 2DKUA 3GSUB 3T4AB 2VJXA 4CRPA 4JG1H 1FDLL 5K9QI 5E2UH 3RVTC 3O9WC 1MIML 3C5ZB 3EKCA 3F6LA 4UV7L 5DS8B 3KPLB 4X6CB 1IC4L 3U4BH 3KLHC 3HC0B 3BXNA 2XTJD 1P9MC 3UTSE 2WIIA 4YDLB 2WP3O 3EOBB 5C09E 3MOQA 5JA9A 4JQVA 1YEGH 1YNTA 1E27B 2M8XA 1B90A 1F90L 3IS1X 4I18B 1BVLA 3GHEH 5FUCC 3MCG1 1JPFB 5BJTB 3S4SA 3SCMC 5E6IC 4OZFA 3ECBB 1OP5H 1KIQA 4Z8FL 4O51B 2BVPA 1ZSDB 2IGFH 3VRLE 1HCVA 5IEHA 5A40E 5D1ZB 3QO0B 4PV8A 3MRIA 5AZEL 4M1DL 2OK0H 3GSRA 1XF3A 4WDIA 1B3JA 2B0SL 2NZIA 3U46B 4KFZC 4LNVA 5CJBA 4HIHB 3CVHL 5E2JA 2F19H 3CLEH 1ZAGA 3KLAA 4XPTH