3BQUD

Crystal structure of the 2f5 fab'-3h6 fab complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
222
structure length
217
Chain Sequence
GVQLQQSGPELVKPGASVKMSCKASGYSFTDYFMHWVKQSHGKSLDWIGYINCYTGATNYSQKFKGKATFTVDTSSNTAYMQFNSLTSEDSAVYYCARTSIGYGSSPPFPYWGQGTLVTVSAAKTTPPSVYPLAPGSSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2F5 Fab' light chain
publication title Crystal structure of the complex between the F(ab)' fragment of the cross-neutralizing anti-HIV-1 antibody 2F5 and the F(ab) fragment of its anti-idiotypic antibody 3H6.
pubmed doi rcsb
molecule tags Immune system
total genus 39
structure length 217
sequence length 222
ec nomenclature
pdb deposition date 2007-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bquD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bquD02
4NWUH 3KWWA 1G7PA 1NC2D 2F5BL 2X4UB 3WFHB 4AT6A 1A6ZA 1U6AH 2NW3A 4LVEA 5D7SH 5CLWA 5I17A 4K23L 4QYOA 1CF8L 1OY3B 4GS7B 3KLDA 2NR6D 3MRCA 1Z3GL 5HHVH 1CGVA 4ZG1A 4F33A 1OGAB 3QPXH 4PJGA 1MVUA 1XAUA 4P23C 4HS8L 4Z95L 3S6CA 4GRMB 4TQEH 2RJMA 1MHEB 4OD1H 2HJKB 5J13B 3HAEB 4PJCB 5E0QA 4BSVA 1M71A 2HLFD 5DK2B 1VACA 3QEUB 5ETUB 3SDAB 1CDJA 4XI5D 3W5NA 3D85B 3MLVL 5B22A 4EQ2A 1SM3L 4V1DB 4Y7MA 4X4XB 3OGCA 1X5IA 3GBMH 3T3MF 5JLZB 3G04A 4NUGH 3SO5A 3QZWB 4JEGB 2AW2A 4RAVA 5JOPE 1ACYL 1VSCA 1AC6A 1EAPB 2EDWA 3VFPA 1QO3A 4U3HA 4X99B 4JDZB 3EBAA 4XMKL 1EFXB 4XVSH 3VGDA 3MJ8B 1BGXH 2ADGA 2DQUL 5SV4A 3OG6B 4I18A 2X1PA 4JG0L 3GSWA 2E9IA 5C07E 3BYYA 3K0WA 5D7JB 2Y07H 2APTA 4PJ8C 3SJVB 2OS7A 3HZYB 3SE9H 3CSGA 1MHPH 4HIEB 5IFHL 4ZO9A 2CDGA 3NIFF 4L5FH 4XP1L 1DBJH 1OAUH 1SJHA 2BSSB 3MGTB 4MGXA 3F8UB 5ALBH 1NCCL 3SKMA 3EO0A 1AGDB 2PO6B 3G5XB 4OAWB 1FGVL 4NZTL 5D2NE 4U1SB 3P4OB 5AZEL 1JUFB 3H42H 3HUJA 1R5WB 5FECA 4NKMA 3SGKA 3RHWF 1WEJH 1Z5LA 2YSSA 4MA7L 5ANMA 2ZJSH 4U1GC 2YC1B 3MRLB 4O58H 1DVFB 1BBDL 4D9RD 2I5YH 3UBXI 4JFYA 4X7SL 3T1FB 1ZHNA 4NO0A 3PNWA 1ES0B 1OF2A 1TTFA 2VL5A 2YMXH 4OQTL 4HBCH 5GGSY 4JANB 5JNYB 1D5BA 3IU4L 4PJAF 4YPGA 2R0KL 1WK0A 3QCUL 2ZUSA 4PGBA 4DFIA 4Q6IC 5JA9A 4MD4A 3RIAF 4Z5RB 3ETBF 2HT4C 4O9HL 4F80A 2CUMA 3MV11 1AR1C 3ARVA 1U3JA 3SDDB 2XY1A 4AG4H 4ZUTB 4RFNC 3MRJB 1WWBX 3WFCH 5E56A 1NAMB 4KKCD 4PGEB 3UTTD 5E2TL 4FXGB 6FABH 2B1AL 4XX1G 3G5YA 1TXKA 4K8RD 4WWID 3RI5K 3T04D 3EYOB 2JTDA 3JWOC 1MFCL 4ZO6A 4JRYB 1DTUA 3IDMA 5DVNA 1KPRA 3HG1B 4KY1L 4B7IA 2NY3C 5DUMH 5C08E 5HGBB 4OZIA 1KCVH 2DRUA 1I7RA 5GXBB 3MPCA 3U6RB 3A6OA 1KB5L 4RRPA 3QXAB 5DHYB 5BXFA 2FX8L 3GMQB 2FJGB 4ZSOE 1ZLWK 1DBAL 1T7YA 1MJ7L 4WU5B 4OI7A 1JPSH 4ENED 1QLEH 1EH9A 1EV2E 5FYLE 2XI9A 3QO1B 3A6BL 4K3DH 1JGUH 3MREA 3RVTC 3S5LB 5D1QA 1W0VA 1YUHA 3LV3A 1ZT4A 4XPGH 3HKFA 2DLGA 2OTWA 4MA1C 4LHUD 1CCZA 4QXUL 1IL1B 4DKDC 2ADFL 4PD4K 1AXSB 5ADPH 1UENA 3SGDH 1JZ4A 4X6DE 1MFDL 2VDOL 3U9UB 4PJXF 2EH8L 4LNRA 4OZFB 4J8RA 4MD5A 1A5FL 1UH2A 2X6MA 2PXYC 1XCQA 3QEQB 1B2WH 1KJ2L 3HMXA 3TH3T 3C8KA 2ADJB 3LN4B 1A6AB 5CAYB 1GOFA 2JK5A 5DSCA 1LP9F 4E5XB 1PG7W 3T2PA 4XCEA 1I3RA 5ISZE 2A0LD 2WK2A 1M7DA 5F7EH 1AD9A 2N7BA 1JYXA 3KXFD 3L3HB 3MLUH 4J3OC 3K3QA 4KGJA 4Z0XA 2B0SH 4J6RH 1IC4H 1CR9H 1J87A 3VXSE 4NIKB 4BM7A 3DXAE 5SX4H 3W9EA 1J12A 1UFUA 1G7HA 3TBWA 4ZUWB 3ZKND 3O2WH 1FCGA 5C0BE 5DD3H 3V6FA 1MLBA 2V5TA 4NQTA 5JZ7D 2D9QB 2P8PB 1GGIH 2OM5A 3MBEC 1BM3L 1P4BL 4XPHL 3VGGA 1ZHKA 1WZ1L 4M61B 5CIPA 3EYUH 4Q2ZB 4HKXA 3ARQA 3SDCD 5SX5H 5E5MA 4LF3A 3VXUE 4YDVB 5F44A 4UQ2A 3TVMB 3ZE0E 1X4ZA 3I6KA 4PB0H 3TPUA 1LHZA 4WHYH 3EOYG 3WIIL 2AK4D 2YZ8A 3VCLA 2AXFB 4JQVC 3O6KH 1J0HA 1IJ9A 1L0XA 2QV2A 4PRNA 3X17A 4JPIA 4YHKL 1XF3B 2BNRB 4ZDHA 1CLYL 2JELH 2WINB 4KHXH 1NCAH 1MFNA 3T0EC 3U36A 1MHCA 5EG6C 5GGTL 1IGCH 5HHMB 3RL2A 3C6SB 2M1KA 3U7YL 3ULSA 3O0RH 5FB8B 3C2AL 3QIBA 2OR8A 1UACH 4YWGL 1TJIH 1DSFL 3T77B 4U6XB 3QHFL 3U1SL 4PJFE 2WBJB 4TTGA 1RUAL 3CSBA 5IMLA 4M7LL 4P5MA 4OCWL 1P4IH 2ED8A 2ITCB 3B8SA 3RVXC 4EDXB 4X98A 2AJXL 3HCVB 1N64L 1ZT1B 3MRKB 4YR6A 1RVFL 4APQD 5IMOA 4EZMA 3S34L 4RQQA 1V3KA 5C7XL 4M5YH 2CQVA 5FKPB 3T3PE 4FQJH 3MV7E 3O3BB 3C9NB 3SE8H 1YN7B 3SBWA 1B6UA 2FIKA 1MFBL 1S9WA 5FA3B 3C60D 4KMTH 5KSBF 2HVJB 1UZ6E 4ODSL 4D9LL 3PJSA 3MRDA 1DQML 4NZJA 5DK3A 2HJLA 1AO7B 1VKXB 4WFHD 1MEXH 3DBXA 3KYOA 5T1LD 2X4OB 3WJLC 1QQDA 4WGVB 3VFGH 2EDQA 3O9WC 2X1WL 3P4NA 4XCYA 1A1MA 3MV8B 3TFKC 2DKMA 3SDXA 2GFBA 5ESQB 4NBZB 2OJZL 3RPIB 5EN2B 4JM2A 1ZGLP 5E2VL 3D3VE 3VRLF 1YJDH 4XVJH 1X5JA 1I8IB 3ME0A 3OJVC 4PB9L 2A6JA 4PJIA 1FORH 3RWGA 4MDIB 4Y16C 3W9DA 4H5SA 4DFHA 3K1DA 4HWBL 3QFJA 4YDKL 4JVWA 5B3NA 1XZ0B 3P0VL 1SYVA 1TZIB 1AGEA 3KJ4B 4NQSA 4XPBH 4UDUB 2DYPD 1LK3H 3WD5L 3O45B 1ZHLB 2CDEA 2E8YA 3CVHB 4FQXA 4JJHA 1HK6A 2BHYA 3T65A 1J1XL 5CGMA 4YHML 3AU1B 3FFCB 1S7VB 5IFJB 4GAYA 2YXMA 4L4VE 3QUZD 4XBGA 3EZ8A 4JVUA 4U1HA 3EZJB 5BZDB 2ZUVA 3AROA 1IGIH 4LSDA 4JGMA 2FEDD 1UCBH 2BVEA 1NAKH 5F9JA 5DMIH 2FO4A 4G43A 2F54B 1U8NB 4L3EE 4UILL 2E7LA 5K9QI 3WV0A 4UTAL 1CE6B 2ILLA 4HZAA 4NZDA 5KOMC 3TCLB 4YHNB 1KULA 4PJ9C 4Y8DC 3IJHA 1C5CL 4XNUH 2A6IB 4WU7A 3OKNA 1UXWA 1F11B 2J7LA 2HTKD 4HW6A 5EOTB 1MCDA 1ROWA 2NLJB 2VIRB 4CGTA 2W9DH 4PRPA 4K7PH 1BJ8A 3ZYIA 2P5EA 4HWNA 4MCYB 1ONQA 3LRGA 3H3PL 1AJ7L 1MI5B 4QOKB 1CLZH 3IFLL 3MRMA 4JFQA 3FOLA 1EEUA 3BW9B 4WW1A 5B8CB 5DZNA 1XR9A 5BRZB 2IJ0C 2P5WA 3VDBA 4JFFA 5D72H 2WIMA 4Z7UF 3RVVD 1OM3H 3MJ9A 2ICCA 5F7DB 4GSDH 1MJUL 2Q86A 1KNOB 2CD0A 5HVGB 1NH6A 5IKCB 4PS4H 4F2MB 4L4TD 4UV4H 2P43B 3SKJH 2VLRA 4UAOB 4RWYL 1B88A 4GFTB 4F7CA 2FHCA 1KG0A 5EZJB 5BVPL 4FXLA 1J0IA 4ODBD 1AQKH 2CGRL 2BZDA 3CXDH 4MQXD 3RWCB 4M43H 1NDMB 1CD9B 3BKML 2UWEA 3CGTA 3RTQB 1XF2A 1C12B 5INCB 4WI6A 3LKSA 4PY7A 3I2CL 5FCUL 5IWLC 4X0KB 3QI9A 1MAJA 5TDPA 5JW4R 4KTEH 5DEGB 1JRHI 1A14L 4JREC 3BE1H 4OKVB 1OTUD 5D1XC 1HKLH 2OSLA 4YXKL 2D31A 2MNUA 4I4WA 4ACPA 2BNUB 4PJAA 1OPGH 4BH8A 4NRZB 1FP5A 3AS2A 3KPSB 1RUQH 4M7ZC 2OI9C 5GRUH 1BQSA 4LDLB 5C09A 5CJQL 5FM5M 1QYGH 3DO7A 3ULUF 1IGMH 3VFTA 1A7QH 5I71B 1K8IB 4QTHB 5FDWB 2ERJB 2WIIA 2GJ6E 5ITFB 3RVUD 4Y4HB 3O6FA 1QSED 4ZODA 4DN3H 5C0CD 1T1XB 1MRDH 1T1WA 1NGXB 1J10A 1TQCC 1T22B 1GZQB 2PR4L 3MLWH 5ICYB 1OQXA 3UTSD 5FYKH 2NZ9C 4CN6A 3D25B 1S9KC 5C0DA 1U8KA 4MJIA 3FRUA 1Q0XL 1BVKA 3BP6B 5JOFA 3V7AG 4PRAA 4PJ7F 1UWEL 1N6QL 3O2DL 1FHGA 4NYLA 5IP4A 4ODTL 4WWKA 2X4PB 2GJZA 3DROA 1CQYA 4LQ1A 4XNXH 3KPNA 4K7FB 2J5LB 2WQRA 2YN5A 2YPLD 1CXLA 2BNQA 1IKFL 3CDCA 3H3BC 1FO0A 1S7UA 1OTSC 4FABL 2GTZA 1GGBL 5JMRA 4M6AA 3FQRA 1BIIB 4U33A 1CZ8H 2MSPA 3P2TA 3FMGH 4OZ4B 2XZZA 5ESAB 1C16B 1P5UA 1BJMA 1OSPH 1YPZB 1HHIB 1J8HA 2DWEA 4K9EL 2NXYD 4MNQD 2X09A 5L2KA 4MCZA 1MRFH 5E9DD 2V5SA 4PJXA 5E5UB 3DMMB 3RAJH 5GRXG 3CFIC 1Q9WB 1E6JL 5CUSL 3WSQH 1CD1A 3UTPE 2EYRB 5KANI 1NL0L 2XT1B 1LP9A 1HHKA 1ZWIB 5JQHC 5IM7B 4RSVA 2XA8H 4YDJB 1RZJC 3T0EE 1CGYA 2QKIA 1HH6B 2VZ3A 3IXAA 3NA9L 4DGYL 1K4DA 3QIWD 2WANA 3CLEL 1JNHB 1C7TA 1JGLL 2FGWL 4G8GE 3HPJA 4RISL 5GHWH 2BVOA 3CDGA 3EO1A 4HC1H 1DQLH 3LDBB 4LIQL 1BX2A 4YAQA 4M6OH 4PJDB 4N1HB 1REIA 5GISL 3WKML 4P49A 5J3HD 1DR9A 2E9JA 3WJJC 4BK5A 4HKBB 4QHMA 4U1LA 3VGFA 3EFFB 3FT3B 1FVDB 4QRTB 4QCIA 4LNVA 5HHOD 4BELD 2XQBH 1OAXH 3PHOB 5DJ6A 4NRYA 2ICWI 5FOJA 12E8L 2GJJA 3EFDH 3H0TA 1I1CA 1XGYL 1WQVT 3BGFB 4NO2B 1SJXA 5HYJD 1U95B 1NC2B 1M6OB 1H3XA 3BZ4A 4CMMB 3KS0J 1FZJB 1URLA 1JPTH 3E6FB 3VRJA 3KR3H 2G60L 2C26A 1NCNA 1LO2H 1CU4H 5KSUA 5IMMA 3S4SG 5EZIH 5C3TA 3VI4E 3BT2H 4N8VG 2GTWA 1OT2A 1HSBB 4WI5A 2R69H 2R4RH 1FPTL 1UADC 3TO2A 4UMGA 4NRXA 4DOHB 1H5BB 5I1EH 5CWSB 4IS6A 2R29H 4QF1A 2XTJE 5FGCE 5JW4M 5DJAB 2BY2A 4XNYH 3B4NA 3MA9H 3NFSH 3MRFB 1AHWA 1ZLWH 3PL6C 3X3GL 1A9EB 2VDRL 2UY6A 4HWEL 1NGYB 1N2RB 4XWOD 3QDGA 1IEAA 5C3LD 2VZSA 3LQZB 5TQ0L 1U91A 3G9VA 4L8SC 1JRHL 2L7JA 3VA6A 5DD1H 1NLDH 3NH7L 5DGQA 4U0QB 3PWLA 5TH2B 5IFAL 4HIJB 3DJ9A 1P6FA 1BFVH 1KJVB 4WEBL 3J7HA 4U2YA 1A6WL 5IQ7L 2VLJE 2GUOA 1FNGA 1P7QD 5KSBA 4Z7VE 4JGJA 3D0LB 5GSVB 2ZSWA 3LH2L 1A64A 3OF6A 1CFTB 5SWQA 1JNNH 1HI6B 1AE6H 4OZFH 4XZUA 3VFWB 2GIYA 2IFGA 4PY8I 2DKSA 5DYOA 1WFOA 1CDUA 1R5VB 3S36X 5CJOH 4L8CB 2FYYA 4PLJD 2VDML 5SWSB 3LKRB 1GJIA 5DZOA 4JM4L 4KZEL 5E24E 4WO4C 1FN4A 2ZCLL 1U8MB 1WT5A 4NO3A 4PRBA 2ZWLT 3VFOB 5B21A 4M5ZL 1W72L 3VXME 4XTRC 3ZSSA 3T2QA 4XCCL 1MFEL 4YHLL 1JZ7A 1A7RH 4LU5L 5BS0B 5AWNH 4PD4J 3QXDB 4U6TA 2QQLH 3TNMB 1MLCA 4HGWB 2VDPL 3D9AL 5KSAC 4WDIA 3Q3GB 4K3GA 1I1AC 5EUKB 1CXFA 4ETYA 3ARSA 3VXQB 5JPMA 4D0DB 1RIHL 2EDLA 35C8H 3SE3C 5D2LF 5CEXA 4AEFA 4Z76B 4XGZB 2A74B 1JPGA 1TTUA 3LQAC 3HZMB 1TVHA 4RGOL 1MHHB 3GM0A 4P9MH 2WMPA 3QAZB 1R3LA 4I5BB 5I1KH 1DBMH 2GEEA 2YKLL 4CNIA 4Q6YA 1YQVL 5M95B 1KN4H 4H8WC 3NZHL 4KK8C 3MUGB 2CJUH 4MZ2A 1SY6H 5EA0H 3ESUF 4HMDA 2IGFH 1B0GB 3H9SD 5IGXH 5ID1B 1BD2D 2E7CA 2XWBB 3QG6B 1SJVA 4U2ZA 5I9QB 2JF1A 4FQLH 1R3KA 4MSWA 2OCFD 5MEND 2VUOA 3BMVA 5KSVB 5HPOA 4QNPF 1NMBH 3B2UD 4WVRA 5HI3D 5EIIA 2Y6SC 1U8HA 4H1LB 1IC5H 1NUNB 1T5WA 2C3XA 4MAYC 2Z31B 4HUWB 1KLGB 3FZUC 1UJTA 1BZ9A 3JWNC 5IQ9A 3TV3L 3U79A 3WDHA 1PLGH 1R3HB 4RIRA 2C3VA 3OSKA 3ZHDA 3HC4H 4LLYA 1RZGA 4ZAKA 1S9YA 4WI8A 4RMSA 5E6ZA 3U0PB 3DUUB 4JHWH 2MHAB 4I3RL 1CD0A 5H37G 1UJ3C 3L3GB 5J9PB 5DO2C 3V8CA 4Z7UA 4KROD 3HRPA 2B4CC 3S35L 1KB5B 1ZHBB 2X1OA 1HYSC 2ZCHH 4HJ0D 4IRJC 5I16B 5F9DC 3KYAA 5B39B 1A1NB 4F8TA 1I9RL 1UZ8B 3F7PC 4ZTPL 3EDKA 1LO3L 3IJYA 4KDTA 4P2OC 3ARBC 5GGSA 2QSVA 1IT9L 4QHNA 1YMME 4U7MA 5BJTA 4X7DC 2R9HD 2A6KB 5JIKA 4Y2DD 4FQIL 4U6VL 1U3HB 1PX4A 3O3EB 2BFVH 4QY8B 3TO4A 1F13A 1MCIA 5I8EB 1YEHL 1U0QA 1WCQA 5I76B 4R2GD 3C09C 5H2BA 2YPVL 3RZCB 5GS0D 1WBZB 4JHZA 5JW4Q 4X6EB 1RJYB 2R1WA 3BO8B 4PRIE 1TVBB 4J1UB 4Z78B 2H2SD 1Q72L 3BN9D 4NKDB 3S96A 5B38B 1WICA 4XCNA 1HKFA 3BZFA 3VWJC 5GGVY 5FHBL 1RUKH 4XPFH 1ORQB 3ZHKA 2CMRL 5EUOE 5B3JE 1SHMA 4OD2B 1KPUB 2FJFB 4GQ9H 3VFRA 2HRPL 1NEZB 4ODVH 3STBA 3NABL 1LO0L 1G7IB 5I1CH 4I77H 3G9AB 4M03A 4XHJD 3CVHH 4BSWA 1RHHA 3QUYA 3QIUA 4U6HA 4Q9QL 4NO5B 3TT1H 2JIXA 4Q6IB 5F1IA 4GW4A 5HY9B 3FO2B 3NACH 3GIVA 1EO5A 1U8OB 4JO1H 5C6PB 4PJ7A 1MCWM 4X7TA 2V17L 2ESVB 5IVZB 4M9PA 1GC1H 2AP2A 32C2A 4M3JA 2UZYB 2V2XA 4I2XE 1EJOL 3T0XA 1MJ8L 2BY3A 2NR6C 2EECA 3BMWA 1SEQH 5IESH 2PYEE 1QNZL 3OWEA 5IVXF 3IDJA 4LKCB 4OLEA 5FGRA 5KBNC 2ZUQB 4BFBD 5A2FA 2NXZD 2HLFC 3QDMB 3CDYA 1S3KL 3LKNA 2XZCH 3AM8A 4C4KT 4XI5C 2J6EA 4QRQB 1AGCB 1WIPA 2OK0H 1WUNT 1G6VK 4JDVB 5IB4A 1A7NH 4OGYL 3E2HB 3V79C 4ONGH 1N6VA 2MMXA 1CGSL 1BVLA 4APQB 4I18C 4NZRH 4GXUM 4POUB 1BFOB 5EBWA 4XMPL 2ORBH 5D1ZB 1A7PL 1Z0NA 4QEGA 1NFDE 2HWZH 3STZA 1PBYA 4R7DB 3HI5L 2E27H 3O2VH 1FFOB 1VFBB 2BC4B 2I27N 1LEGB 4G42B 1TJGL 2X89A 4LSTL 4NN5C 5IK3B 1U92B 5MI0C 3VD9A 4Z7WE 2ZG1A 1NBYA 4HKJA 4G80A 1PQZB 4PBXA 2L4OA 3EW3B 3FB6B 5D7IF 1T21A 3FFCE 3OQ3B 1QFWM 4G9DA 4MD0A 4Y4FB 4DZ8A 2ENYA 3EOTH 2OZ4A 4EUPB 1NC4A 1T7VA 3VFUA 5C0RH 4DTGH 1FNEA 1FZOB 1KIPB 3HC0A 5LAXA 3LAFA 5DHVA 2EE3A 3B9KA 3G6JF 5EO1A 5TE6H 3W39A 3BKCH 3HI1B 4Y19B 4W6YB 2NX5D 1J18A 5ICXB 3QG7H 5DUPH 4HWUA 4HF5L 1QKZH 2BSTB 4NCC1 3LPGA 3QNZA 3F62A 1N5YL 3U82B 3IDXH 4HQQH 1I1FB 3OJDA 5BMFL 5J57B 2E9WA 4KJQC 4P3WA 1PW3A 5H8DA 3MGOB 5KG9B 2DYPB 3FFDB 1JPFB 2A38A 2FEEI 1FSKC 1EZVX 4F7MB 2N56A 3C5JB 4K71B 3V6OA 1EO7A 5T3ZE 4R4BB 1QRNA 2RCSH 2GHWB 3WXWH 2YA2A 4RFEA 1S7XB 4ZNCD 2BOBB 3DX9B 5IW6B 1HILA 5I1IH 5DQDH 5FF6A 4ZOEA 4ELMA 1PY4A 1KIUA 4QOKE 2DI9A 3UPAA 4PJHF 2HT3D 5IHUH 4KVNH 5J12C 1VEOA 1OW0A 1G7JB 2IH1B 3JV4A 3D0VA 2VZOA 3STLB 5GIRA 3L3OB 3SGEH 5AYUL 2OYPA 3VJ6B 3TWCL 4OLUH 5ADOL 1X6LA 4KDVA 2XZQH 4K8RC 5A1AA 5H35A 4U1KA 1F4WL 1G7LB 4O51B 5D71H 5HHQA 5D5MF 2BVPB 5EORH 4K3EL 4MA8L 4Y5VA 1AQDA 3HB3D 5TFSL 2AGJH 3VU2A 4UINL 3WKNA 2YUZA 3FO0L 1IZKA 4H0HB 1PZUB 3TZVD 5FXCH 3RWIA 3FO1A 3BGMA 3RGVA 1ZLSL 2WWMC 3LN9A 3F7YA 4TULH 4F7TB 4MJ6B 5F7WC 1RIVL 5CBAB 1CXEA 2AJYL 3TA3A 1NGZB 3QSKB 1ETZA 1OGTB 3PWUA 2Z35B 3DV4B 2CUHA 3IS1X 3EOAA 4CW1B 3GGWB 1HE7A 2AABH 3QWOB 2FATL 4YX2L 4ZQKB 2BX5A 2WBWB 5DJ2A 3U4AA 4XXCC 2CKNA 1VGEH 2W0KA 4X5XA 4C56B 5E8PA 3BDYH 3FN0L 1IFHH 2YUVA 3CFCL 5C0EA 4Y5YB 1OP9A 2EDYA 4KJYA 1YNLL 3OAUL 1CQKA 2Q1EA 2XRAH 5D6CB 4ODWA 3UYPA 1N3NB 1QFOA 4JPVH 2A0LC 4ZO8A 3PQYD 1MCJA 5DS8A 5CZXD 3REWB 1F42A 4CVXA 1XGRA 2DQGH 4R3SB 1KTDA 1A1OA 1JWMA 1QSFE 2V2WB 5DJZB 5I66A 3VGBA 3U2SB 2EICA 2BCKA 5D2LA 1VB9A 5KVDH 3MV9A 2WV3A 2IAMA 2VISA 4GBXD 1WSST 3JTSB 1TJHL 2QR0B 5FYLH 4LCUA 4D0CA 1H3UA 4WHTB 1YEEH 3QQ4A 2F74B 5KS9E 7FABL 4Q0XH 3SHSA 4HZLB 2JCCB 2ID5A 4RDQF 4S2SA 4ZPVB 4QXTA 1N7ML 4X4ME 4KQ4H 3PWVB 4MJ5A 5CMAB 2EKSB 1CBVH 4LRNL 1JF5A 1MFAH 2AEIT 1VGKA 4YDIL 1XIWA 4FQ1H 1EEYA 5MEQB 1IGTB 4Y4KA 2ZOLA 4KXZH 1QR1A 2EZ0D 1WBXA 3GMRB 2OL3H 1HEZB 4WCYL 4L9LC 2LQRA 5J1AA 1GRWA 5HDQL 4ALAL 3MACH 1ZS8A 3D69B 4K94C 2CKBA 5JDSA 5CP7B 4G8IA 1ZA3B 4K23H 3D18B 4DVRH 3OXSB 1CF8H 3CFJB 4OLXL 3AY4A 5IB1A 2BK8A 5JR1L 1S8DB 3V6BR 1MCSA 4K3JL 1NGWA 5D7LE 1UM6H 5IB3A 3GSQB 5CGTA 1RZFL 4Z95H 1TIUA 4NWTH 3OR6B 2APBA 4WHCA 5D1QD 3BOVA 4JFDE 3MOQA 4TOYH 3SBWC 2FEEL 3T8XB 3THML 5BV7C 2IBZX 4PGZA 3WFDL 2FL5B 3MQIA 1RIUL 3FT4B 1NSNH 4PJGE 3E8UL 4J3XA 1II4E 3I02A 3P11L 3UTQB 2YRZA 4M7JH 5E94A 4LDEB 3O8XA 1ZGLB 5CJXC 2EDFA 3C60C 1EGJA 4NGHH 4EI5A 3D1MC 2OJEB 3IAQA 5TGBB 3SCMD 3QIWB 2GSIB 4JFZH 2CSPA 4JFHD 4MXWH 4YZFE 1PZ5B 5HYSB 3WLBB 1T1YA 4F15B 4AH2B 2DQUH 3BQUA 3MRGA 4JG0H 1NCWL 4DW2L 1QTYT 4LVNB 3HNVH 5GGQH 3UJIL 1G6RL 3NCCB 2IMMA 3M07A 5IW3A 1MIEH 4NJ9H 2DQDH 4X6DF 3TPKA 1XCTB 2BSRA 4FQPA 4R90H 3GRWA 1IGJB 5J1TC 1N26A 3GMLA 3MGAA 2DLTA 2FHBA 2HFFB 4NZTH 2IALB 4PV8A 4W6XB 1CT8B 3FHQA 4OLYH 5EO9A 2C7UA 1HDMA 4ZS6D 1FNAA 2DICA 5E6IA 2R23A 4LBEB 1CICA 3I6GB 1KELL 4JFXB 1F3JB 3VDAA 4MA7H 4JZJA 5FHAL 2VXVL 4PG9A 3D2UA 2D7PA 1HCFX 2BRRL 1RUMH 1BBDH 2Q8AL 3V4PL 3GJEA 5IVXA 4U6YA 1XR8B 3QUZC 5D4QA 5EU6B 3BSZL 1KJ3L 3HUJE 4OQTH 1TZHA 4WHYG 5F8QC 1FFNB 1ED3A 3IU4H 5FO9A 4J3SA 1KEGH 3SKUD 5LXGL 2FEDC 5ANME 2E7LC 4G3YH 2EDRA 4OFIA 1ZGLM 3KYNB 4G9FB 4JO2H 1X5XA 2DTML 15C8L 2DM4A 1PAMA 4EN3B 3LN5B 3GMMB 5FO7A 4NQUA 4QRPB 4H1LH 5DMJB 2I24N 1T7XA 3MO1B 2YWZA 5EPMB 5E2TH 3L95A 3VXPA 4QRRB 1KC5L 4RCAA 2B1AH 5IT2L 3ZE0F 4HIXL 2D9CA 4D9RE 5DRNB 1MFCH 3F65A 3SDYL 3FHAA 4KY1H 3D6GA 1CN4A 4ZXBC 4KZDH 5HHNB 2HTKC 4AEHL 2IG2L 1UB6A 5D7IA 1RZKL 4U3CA 3INUL 4N0UE 3HC3L 1UYWL 2DD8H 1EHLL 4GRWB 1DBAH 2JB5L 4H20H 4OTXH 3PWPA 5CEYA 1TNMA 2LU7A 3UTTE 1Q94A 2H41A 3ARFA 3L1OL 3D48R 3G6JA 4RNRB 3B9EA 3ARUA 4PJFF 5EBGA 5JHDA 3V4UL 4EBQL 2DMBA 5GS3A 1W2KT 3PV6B 3G5VB 4QXUH 4EJ1C 2ADFH 2EIZB 1QG3A 4NNYA 4LCYA 4NQDB 3KDMA 4MNHB 3RDTA 3T3PF 1IAOB 1VFUA 1CXHA 4FRWA 2DBJA 4JN2B 1FFPB 5T1KD 1A5FH 2NTFA 3QQ3B 3TT3H 5IEHB 1MWAA 4BZ2H 4O2EA 4S1QL 3CFEB 1UZ6F 3QFJD 4RZCA 2NY0D 2PETA 1QFWH 2YBRA 3RIFF 5TDNB 2CIKB 4GAJL 1PKQA 4OLWL 1U8IA 1GGUA 3O41A 1FYTB 2I9LA 5GQBA 3SPVA 2A9MH 4NN6C 1W72B 4PJHA 4PTTA 2ZSVA 1Q9KA 4YEEA 3GUTA 1RFDL 4YIQA 1LEIB 1LVEA 4WNQA 2OX5A 2NNAB 1GGCL 3QPQD 2P8MA 3ULVD 4CVZB 5CINH 4ONFL 4BFGA 5A16A 4XBPA 1LDPL 1BD2B 4WWKC 2VLME 1FRGL 4TTDD 3JWDL 1AI1L 5HDBE 5HVFB 5D5MA 3MMEB 5CD3A 3CX5J 2WZPD 5MENB 1XGPA 3KXFE 3CZFB 4Y5XB 1X7QB 3KPRD 1M05B 3ZE1E 2VLKB 4ZYKA 2PTVA 4P2RD 1QLRA 3PL6B 2HN7B 2VTFA 3MJ9L 4G7YL 3SGDI 4P2QB 3P4MB 4B0MM 4E0RB 4NWUL 2KL6A 5IF0A 1U6AL 1IQDB 5D7SL 4LLUB 2XWTB 4MVBC 1A4JB 5JORB 3QFDB 3D87B 3S7GA 2NXYC 3BEWB 2F53B 3K8MA 3Q0HA 5HHVL 3TH4T 3LD8B 2EE9A 3QPXL 3VGAC 3C2AH 1NCUA 4WRLA 3MNVB 2DN7A 2BY1A 4XMLH 4TQEL 1QFPA 3QHFH 4OD1L 4HDIB 2AK4E 3X13B 5CEZH 4R0LA 5DFVC 1VA9A 4EUPH 4OLZH 4R96A 3P9LA 5FYJD 4FTVE 5HGAB 4OCWH 3D39B 4CN4A 3RWDA 4Y2DB 5ENWA 3EGSA 4FFWD 1INQA 3N0PB 1EHAA 1FBIH 2P48B 4HUXA 2OTUB 4OBSA 5CP3H 3BPNC 3S34H 3HFMH 1S7SB 1DUYA 3UAJD 1ORSB 1PEWA 4R2GB 2ICWB 1CFSA 3QDJD 5C07A 3VXRE 1WISA 4LPCA 4C83B 1JGEB 4XVSL 2X7LA 2PNDA 3NAAH 3QI9D 4D9LH 1BGXL 2J8UB 1M7IB 1V7MH 3ILQC 3K4ZA 3MNZA 4YK4C 5I73B 3B8YA 2KQMA 4OIBA 1YN6A 4YBQC 3V5DB 1T66C 3QHTC 5EOCL 5HBBA 3M17A 3OZ9L 3ROLB 4JB9L 1GOGA 4PR5A 5SWZB 3HE6D 4L3CA 5D2NA 2Y07L 1I3GL 3BPLB 4XVUD 2QEJA 3SE9L 5E2VH 2RHEA 3OKEA 1HQ4B 1FL6A 4L5FL 3DLQR 1DBJL 1OAUL 4YFLF 3BWAA 4U1NA 1X5HA 1RJLB 4GRLB 3SGJC 3VWKA 2PTTA 4RAUA 5GGRB 3W0WD 2ARWA 3P0VH 1QEWA 5I30H 1IMHC 4WFHE 3H42L 1WAAF 3CXHK 3FQNB 3QEHA 1WEJL 3WD5H 3JVGA 2ZJSL 1AHWC 3RL1B 2O5YH 1PX3A 1LE5A 3CLFH 2ZUUA 3BN3B 4O58L 1J1XH 3HAEG 2I5YL 3VMOA 4YHMH 1MCEA 2IC2A 1AP2A 5TDOA 3DVGB 2YMXL 1FVCB 2Z4QB 4HBCL 4X83A 3L5IA 4I0PA 4OFPA 1FIEA 4MAYB 1K3ZA 3QA3A 5C0IA 1G9NC 1JV5A 1MAKA 3QZWG 2C3HA 4P57A 3F58L 4HFWB 4KK9D 4ZFOA 3NOIA 3VRIA 5E8DH 4D3CL 5LGHH 2VXTH 1JP5A 5C08A 2MWCA 5DRXB 3WFCL 5L2KD 4MX7A 1SMOA 1DP0A 2VE6A 4JRXD 5JIPA 3CDFA 1KLUB 1WGOA 3PHSA 1PKOA 5JW4N 1ZEAL 2FSEA 4JFPA 3OV6A 4QTIH 1C5CH 3OX8A 4G6AD 2WNGA 2V9TA 5DUML 3T3ME 1SBSL 1KCVL 3H7LA 5MP6H 1WT5C 4PLJC 1A02N 5CHNA 5IB2A 2NX5B 5E8NA 4JCLA 5I8KL 3P4LA 4MWFB 4F37K 3H3PH 1T83C 1MCHA 3IFLH 4IHOB 4UUJA 2X9XA 1QLEL 2YPKA 4X6DA 4XNMB 3ZYOA 3LKQB 4YHIB 3HN3A 2YRPA 3LHPH 4K3DL 1JGUL 3BZEA 1EZVY 2PW2B 5KAQG 4HIIA 4LASH 4QHLB 5L8JB 5FCSH 4KAQH 5HGHB 3WXVH 4XNZB 3GJFA 5ADPL 2D7QA 4J23A 5T3XE 2P5WE 3NIFE 1O5DT 5LCVL 1ODAA 3KWWB 1G7PB 1B2WL 4ORGA 4AT6B 1BOYA 3VXSA 2NW3B 3DXAA 5I17B 1A14H 4QYOB 1D9KA 5C0BA 5F7EL 3MRCB 5GRVK 5C6TH 3QUXA 5JO5A 3MLUL 1MPAH 4OUUA 1MVUB 1ZVSB 4L4TE 4J6RL 1IBGH 2WLZA 3LEXA 5BVJB 1IC4L 4LGSB 1CR9L 1QFUH 1D5IH 3BIAX 2CK0H 4BSVB 1YDPB 4ZD3H 2AEQL 4BJLA 4DVBA 3O2WL 4P4KA 5DD3L 3OGCB 2A2QT 2RQ8A 2KQNA 4PJAE 5KJRH 4JKPH 3N1GC 3VXUA 2P8LB 3G04B 1U8PA 5J8OA 3DX8A 1J0JA 4R4ND 4RAVB 5C09E 4EIGB 1GGIL 2CO7B 3DYMA 4LSUH 3MNWA 3VFPB 3ARED 3B2UC 4X9GA 2P42B 3VI4F 5E7BA 1UWEH 3EYUL 1FG2A 3C6LA 4I18B 4RMUA 1K5NA 3CUPA 3IFNH 2A9NL 4OF8A 1JZ2A 1QSEE 5C0CE 3S5LG 3O6KL 2EDBA 2F5AL 1UCTA 4MJIE 3ARDA 4FABH 5C0FA 3GMNB 3RJDA 2BVQB 4KROC 2JELL 4KHXL 4OCRL 4PJFA 3UTSE 5GGUA 4KDTC 2E7BA 1D6VH 3LKOA 5KAQF 4FQ2H 4OZGE 1C7SA 5J6GB 2CDGB 1IGCL 2I25N 3R0NA 3RWEB 1RK1B 3ZTNH 4N8VB 3TJEL 3MZTA 4OZFG 4K9EH 3O0RL 2LTQC 3SKMB 3EO0B 3IF1B 1N6UA 2CDFA 4KC3B 5D9SA 2F9BT 1UACL 3FB5A 3MV7A 4WUUD 2YPLE 4IMLA 4N5UA 3GSNH 3MRQA 5FECB 1DBKH 1E6JH 5DD6B 5HDOA 3ZKSD 4NKMB 1P4IL 2MFNA 4KKBD 3QWRA 2E5EA 2JJSA 5DJ8A 3U0WL 2EIDA 1HIML 2R0LH 4P23A 4EVNA 4HV8B 5GS0C 2BOCA 5JXAH 2AV1A 4M5YL 5IW1A 4AK1A 2PW1B 4FQJL 2H2SC 3BN9C 3SE8L 4NO0B 4DGYH 3PNWB 5C0AD 2NY2D 1OF2B 2VL5B 4M1DH 3U46A 4MNQE 1OWWA 4YPGB 3NCYS 4OM0H 1EEQA 4RISH 5JW5A 5E9DE 3QIUC 4PGBB 3HZVA 3D3VA 4IRSD 1QP1A 4CMHC 2W92A 2WBKA 1MEXL 2A6DA 4UDTA 5JQ6H 3VFGL 3AAZB 1OWRM 1RHFA 4NJAL 5DC4B 3FTGA 5EO0B 5LBSH 2W60A 3G5YB 4YGVA 1ACZA 1I8LC 3T4YA 1JZ6A 12E8H 1YJDL 3IDMB 2VDQL 3CU1A 1XGYH 4JFOB 1X5KA 3KG5A 4ONOA 1KPRB 4DCQA 1U8JA 3VFSA 2D2OA 1VERA 3EDJA 4XX1E 3A6CH 4OZIB 4NQCA 4E41D 1RULL 2M26A 4XAKE 4AQ1B 3VFVA 4RGNB 5BXFB 3QUMA 3ILPA 2Z8RA 3NBNA 4L4VA 2NXZC 5A2JH 3IGAA 1LK3L 1N0LA 4NHUA 2NY1B 2YD2A 5HHOE 3X11B 3MCLH 3MREB 2IBZY 4R6UA 3H7BA 5D1QB 4R7NA 1W0VB 1YUHB 1ZT4B 4G5ZL 5HYJE 1CDYA 4L3EA 2X40A 4OCNC 5K9OB 1IM9A 1BQUA 2YRLA 2JJTC 2X44D 4LIQE 3OTTA 1S9XA 1IGIL 4GRWH 4A6YA 4BZYA 4MD5B 1UCBL 3AB0C 1KBGH 3O11A 2XIDA 1JWUA 1NAKL 4U31A 4F57L 1XCQB 2XPGB 4PYHA 4M00A 3SCMB 1TPXB 5TQ0H 5ICZA 3C8KB 1XGUA 1JRHH 1RZJH 2EDEA 1H8OA 5E4EC 3HRZA 3KLHC 3B9KC 3B9DA 4XCEB 1MAML 4Y8AA 2H9GA 4PJ5D 4YHZL 2VXUL 1AD9B 5T5NG 3KNBA 1A6WH 1J0YA 2ICES 5IQ7H 3U83A 4GXUN 3O4LD 4TVPE 4A2LA 4QKXB 4XNUL 3QDGE 4MMXC 1O7SA 4P46D 4JQXA 4M9OA 4IDLA 1G7HB 5EZLA 5E1AA 1FLTX 3U4BH 2ZUWA 1E4KA 5GS1A 2W9DL 5HSFA 3FQXA 1MJJA 4JM4H 4KZEH 3MLTA 1RMFH 1CLZL 4M8QA 4IJ3B 1WIUA 2ZCLH 1EERB 3MYJA 5D72L 4G6FD 1OM3L 4M5ZH 1ZHKB 5TF0A 3NPZB 2EO9A 4S1RL 2PYFA 4Y1AA 4PS4L 2NW2A 4HKXB 3W11D 1MFEH 1IAKA 5E5MB 2ZPKL 4LF3B 1G6RB 4UV4L 1Q9OA 3SKJL 4UQ2B 3E6HA 3I6KB 4BQCA 4PP1C 3TPUB 5FA4B 4TVSa 1WAAA 1AQKL 1L0YA 1W0WA 3VCLB 4PRNB 4LVHB 4GAFB 4P48A 4WEMB 1KB9J 4M43L 3WS6C 2GT9B 3CFKA 2RFXA 4ZDHB 1MCQA 4OCSH 4U4BA 4HAFA 3MLYH 3WUZA 5E8EA 3CFDA 3O81A 3QNYA 4NSKA 2GJ6A 4KTEL 3CX2A 3U36B 3TGXA 1MHCB 4MA3B 1CG9A 4YHPA 3BE1L 5EUOF 5B3JF 5JDJA 1HKLL 1PYWA 3RL2B 5DMYA 1CFNA 3ULSB 2GSGA 2X4TA 1OPGL 1RUQL 4D9QD 3QIBB 5GRUL 4PTUA 3VXNA 1JN6B 1QYGL 4HS6B 3NZHH 5IMLB 2YD5A 4B5EA 4P5MB 3HB3C 3SKNA 1DDHB 3V2AR 3ZO0A 4DN3L 1KPVA 2YHGA 5KVGH 1MRDL 2ENSA 4YR6B 1NFIA 2ADIA 1RQ5A 2FWOA 3IDYB 3TZVC 3MLWL 4RQQB 1IM3A 3L3KA 4LGPB 3CC5A 1UM4H 4ORZC 5DF0A 3BKYH 2FIKB 1SEBA 1OAQH 1P1ZA 1S9WB 1MIMH 1I4FA 4F3FA 4KRLB 3PJSB 5CD5D 4X4YA 3S3JA 3I9GL 1ADQH 2ITDA 2HJLB 3BIKA 3HE7D 3WIHA 4OSUH 3MBEA 2YD4A 2Q20A 4LOUD 3DBXB 1QQDB 1K4CA 3TYGH 3O3AB 3IT8D 5IJVA 3H9SE 4XCYB 4KMQA 4I3RH 3MV01 2Y36H 3HNTL 3LRSA 5K9KA 2IADB 2WW8A 3SDXB 2GFBB 5FUZH 1XT5A 4JM2B 3FMGL 4QGTA 5FYKD 1OSPL 4IOIB 5T1KB 4PJIB 3VH8A 4JQVA 1KTRL 1OGAD 4KRPC 3RWGB 3BAEH 4OT1L 3BPOB 3W9DB 4H5SB 5DTFA 3M8OL 1IQWH 5IR1B 4Z7WF 3P0GB 3QFJB 3IAPA 3T0EA 1SYVB 3W2DH 4Z7UE 3K2UH 9CGTA 3AMLA 3SDAD 5J11B 1K2DA 1ZAGA 1BVZA 4FQIH 3D85D 4I0CC 3GNMH 3O4OC 1H15B 4GRMA 1P6AB 4G8GA 3WSQL 4U1IA 4V1DD 1OSZA 3HAEA 2I26N 5DK2A 4BH7A 1KOAA 1I8KA 4FQXB 2XA8L 3T65B 3W82A 2YD1A 4GAYB 1FZKA 3E1F1 2ICWJ 1YEJL 3QZWA 1JHKH 5I8OL 4XBGB 1XIWC 4U1HB 5GHWL 4HC1L 1DQLL 2AXHA 1CK0L 4DUXA 2CMRH 1KTLA 1EFXA 4HCRH 4G7VL 1C1EL 3MSPA 5F9JB 3UCRA 4KKAD 2HRPH 2FO4B 1IEBB 4HK3J 3WE6A 4DKFL 2VKWA 1F2XK 4JFED 3GSXA 5D93B 1EVUA 3JV6A 2EZ0C 1CDIA 3LEYL 2JE8A 1QPXA 4P4RB 5TQ2H 3MR9B 1OAXL 1U8QA 1CWVA 3J8F7 1PG7H 3OB0K 3IJHB 2QSQA 2J8UE 2HH0H 4WU7B 2D7NA 4HIEA 2PO6D 5DURB 3KR3L 5E2JA 1MJ8H 1LO2L 1CU4L 5C0GB 2PTUA 5ECJE 2F19H 4PRPB 2ARJB 1FZMA 2P5EB 5DMGD 1ONQB 3CXHJ 1PEZA 4MXQD 4XC3H 1UG9A 3UO1H 4JFQB 1A2YA 3MRMB 5D96C 4WW1B 1S3KH 3MUHL 1XR9B 2B4CH 2R69L 1R5WA 3FRPG 4JFFB 1DVFD 2R4RL 3HTLX 3IDGA 1F90H 2HFTA 2R29L 2Q86B 2IMNA 2FH8A 3G6DL 4MB4A 4CVUA 2YD9A 4BZ1L 4FFVD 2W9EH 3MA9L 4PRHD 1TVDA 2VLRB 1HYRC 5GRYA 1FVEA 3K8LA 1KG0B 1ES0A 3DX6B 2HFEB 4HFUH 1OB1A 5JNYA 2VLJA 5FM5O 3SDDD 4Z7VA 3S3PA 1FQ9C 3QJFA 1CXKA 1XF2B 2UWEB 3AVEA 3RHWK 1YY8A 3A0OA 1TJGH 3LKSB 3IDNA 4PY7B 3QI9B 1G84A 1NLDL 4UNVA 1U42A 2DQFA 4QRUB 3EYVA 1HOCA 4CU8A 1K8DB 2D31B 4PGEA 4I4WB 3HG1D 4FXGA 4BH8B 5I19H 3HE6B 4LPTA 3S35X 4QWWD 4HPOL 1HQRA 3VFTB 1QVOA 1AE6L 2WIIB 2R15A 3RIAK 1EPFA 5HGGS 3VXMA 2Q6WA 3O6LH 3O6FB 1CICC 3PHQA 3S88L 5HGBA 1BBJB 2QBWA 2D0GA 4HF5H 4OKDA 2WUCH 2P1YA 1NFKA 3EAKA 3MLSH 1T1WB 4UOW1 1P53A 4ZS7H 4HMEA 2WSKA 2DTSA 4ZS6C 5DHYA 1VENA 2P4AB 3OHXA 3GMQA 4NFCA 5GSRB 4MHHI 3ZDZE 2UZIH 5LWYH 3IXTA 5C0DB 3U4EB 1U8KB 3FRUB 2XY2A 3JTTA 2MQ3A 5JOFB 4PRAB 5DQJA 2Q87A 2FB4H 4BQ6A 1KXVC 3MJGX 4NYLB 3KPLA 4WWKB 3S5LA 2GJZB 3DROB 5AWNL 5D6DA 3W5MA 1KUMA 3KPNB 4GQPH 3V7AE 2BNQB 8CGTA 5E5RB 2ZOKA 3QEQD 1FO0B 1S7UB 4M4PA 4YGAB 5I1LA 1L7IH 3FQRB 3UX9B 4CUCA 5KS9F 1ND0B 4WI4A 3GM8A 4OF3A 2K7PA 2ADJA 2DWEB 1J8HB 1FLRH 1A6AA 2IPKA 5AYUH 1CGTA 1MREL 1JE6A 4P9ML 5ADOH 5L2KB 4MCZB 4N5ED 5I1KL 3IDIB 1F4WH 1DBML 1H3GA 2EXWD 4PJXB 4UNUA 5D1XA 5I1DA 2CJUL 5EA0L 4FZ8H 4WJ5A 2IGFL 1HN1A 4LDOB 5IGXL 1HHKB 4LSRH 2R56H 3V8OA 1E27A 4PJDF 3DX7A 2QKIB 4NDMB 2ZKHL 4P3CH 3RWFA 3DTXB 3IXAB 4UU9A 1K4DB 1NMBL 4ZFZA 4M1CC 1OCWH 2P8PA 4OLVL 3T09A 1SVCP 3CDGB 3EO1B 4LCWD 1RIVH 1RJCA 3TVMD 1BX2B 2O5XH 4YAQB 1CGXA 2P45B 3LPFA 3HC4L 4JLRA 4ERSH 4Q2ZA 2GY5A 2W91A 1VFAA 2PF6A 4GLRH 4PIRF 1IGYA 1P7KA 3R8BB 4P5TA 1EBPA 2X10A 4YDVA 4DGVH 5KN5A 3TH2T 2BNRD 4U1LB 4GXVH 4JHWL 3WEXA 3BDBA 5HI4C 1YMMA 5DJ6B 3FN0H 5F6IC 3CFCH 4NRYB 2R2BA 5HHMD 3H0TB 4ISVA 2ZCHL 5F96H 1GSMA 4UIMA 2NY0C 1TETL 4YZFF 5F7NC 3BZ4B 1MRCH 3NN8A 3H2WA 4TSAH 3VRJB 4OFYA 4UIKH 5F6HI 3C6SA 5KSUB 3WCYA 2FLBT 4PRIA 3LMJH 1J9CT 4MQSB 4WFFE 1JWSA 1QFHA 2WBJA 2B2XH 3QPQC 5FAAA 3ULVC 5EUOA 1PGRB 4QRSB 2UUDK 3TO2B 1CFBA 1NCDH 1WFNA 4EDXA 3RWHA 4IS6B 4LQFH 4QF1B 3TP4A 1NGQH 3PQYE 5CZVL 1AHWB 3CJJA 3VW3L 3C9NA 1AIFB 2GI7A 3IFOA 1F5WA 3OBAA 1AO7D 5FA3A 4J3VA 5DWUH 4OFDA 5IB5B 5DEFB 3WO3B 2ATKA 3P3YA 1RUPL 1MNUL 5TE7H 4ODVL 3HNSH 1YNKH 4I2XA 4I77L 5H94A 3CVHL 4H1LG 3TT1L 2R0ZH 2BDNL 2PYEA 4LHJB 5C8JA 3PWLB 3QRFM 5AG9A 1A6UH 1KIQA 3NACL 3ALWA 1HWHB 3TYFA 3LS5H 3MV8A 4FMFA 2DJSA 4JO1L 2GUOB 4MNGE 4ALAH 5KSBB 3WJJA 2ZSWB 1GC1L 4HLZH 5SWQB 1I8IA 4NQED 4XZUB 3BH9B 4R0LC 5DYOB 1SEQL 5INDA 5IESL 5JR1H 4U1MA 3DO3A 2FYYB 4KUCD 3HMXH 1OAZL 4KTDL 4OF0A 2W9LA 2Q76B 1VFOA 5B39G 2O61B 5KVFH 3RP1A 3S37X 1FN4B 2ARJQ 2XZCL 3AXLA 3NMEA 3VD3A 4NO3B 2XFXA 4KV5F 4FFWC 1AH1A 2ZG3A 1ZHLA 1OD9A 2OK0L 1EHNA 1FNHA 1A7NL 1RIUH 4Z7WA 3E8UH 4ONGL 2IANE 3CSYB 3P11H 1OP5K 2YZ1A 3LS4H 3FFCA 1DLFH 5GRWA 1MLCB 3RKDC 2HWZL 4D0BA 2NY2B 2F54D 2A77H 2DI8A 3O2VL 1EK3A 1OARH 1LMKA 4NOFA 5B38G 5EWIH 1Q38A 1NCWH 5JPMB 3CFBA 5CIPH 2D4FA 1I85A 1TCRA 1JPGB 3EOTL 3FN3A 1TVHB 1X5GA 1NEZG 5E2UL 5C0JA 4XVUC 1R3LB 4DTGL 1Z0MA 4L8SA 4X6CE 4CNIB 1CTNA 3KLAA 3KYMA 4KKLD 1N59B 1XGQB 3RKPA 5DUPL 4JFHE 1QKZL 1MI5D 2NY4C 1JF6A 3IDXL 3TN0D 1S5IH 5I75B 2NLJA 2VIRA 5BRZD 4HQQL 4LKXA 4GKZB 4MSWB 4G6KL 2V5RA 4YJZL 4QOKA 1M4KA 1X5LA 3QBTB 5EIIB 1DCLA 1U8HB 4BK4A 1T5WB 4ODUA 5FHAH 2RCSL 4WO4A 5IQ9B 3WXWL 4RIRB 2C3VB 4J12A 5F7DA 4ZAKB 1RZGB 5IKCA 4DEPC 5I1IL 5DQDL 1DFBH 1FNFA 1AC0A 3CCHA 1A8JH 5IEKA 3SE4A 3RTQD 2AI0L 1JYVA 2IH3B 5EZJA 5HVWA 5IHUL 1YNTA 5HDBF 3SN6N 2N7AA 1FH5H 1KIRA 2BMKA 2EH7L 1OL0A 5KSAA 1L4IA 3WFEH 4HK0A 1SQ2N 3EYSH 3GSRB 3KPSD 5DEGA 3ZE1F 4OLUL 2XZQL 1KC5H 3IJYB 1U36A 4HIXH 4QHKI 5D71L 2DOCA 2J8HA 5GGSB 4QHNB 4Y4HD 5BJTB 1Y18A 4G6AC 5EORL 2DM7A 3KLSA 1BPVA 4EUPG 3TO4B 4XP4L 5FDWA 8FABA 2YWYA 2AGJL 4R9HA 3QWQB 1RZKH 4WV1B 3HC3H 5J56B 2A1WH 3DRQA 5FYJU 1EHLH 5H2BB 1T1XA 4G8FA 5J6HA 2V7NA 2YD7A 4FQHA 5MHSD 1RJZA 2VDNH 2Z92B 4HK3N 3S96B 2UVFA 4A2MA 2MQ0A 3BZFB 4TULL 3P0YL 5DVMA 1TNNA 3MX0A 3L3JA 3V4UH 4C55A 1K85A 1J88A 1V7NL 4OUOA 5DXWA 3VFRB 3UPRB 2IFFH 1ZE3C 2AABL 2EYTA 4PG2C 3NPSB 4JHAH 4OV5A 4YHOL 3ARGD 2ICEB 3MC0A 3MFFA 5KVEH 4BSWB 3QUYB 1AKJA 1VGEL 2JIXB 2W0LA 2CRIA 1KT2A 2K7QA 4GW4B 2V7HA 3FB8B 1IFHL 3GIVB 2XKUA 3HI6L 4X7TB 1QSFA 5EU3A 5HJ3A 1BIIA 2DM2A 3X14A 1P84J 1QBBA 1T2XA 3U30B 4OZ4A 2V2XB 3DMMD 5KW9L 1T7WA 5EOQH 4LAQL 2JJUA 5LGJB 1KGCD 5DRWA 5C86A 3IDJB 4HMCA 4P4KC 5B4MD 3PGFL 3QRGL 5KS9A 1RFDH 4RMTA 1GGTA 3LKNB 3OB0H 1Q9WA 4P2OA 1LEKB 1GGCH 1F45A 3ARBA 4X4MA 5KVDL 2KBGA 5GGVL 3PP3K 1EXUA 1CE1L 4HGMA 3HA0A 4XB7A 5IB4B 1P9MC 3CH8A 5FYLL 4YDJA 1EMTH 4JO3H 5DD0H 4ETQA 4HD9A 1BVLB 1AI1H 2VNCA 1YEEL 3AREC 3C6LC 5GJSH 2YD8A 5EBWB 3UC0H 2WP3T 4FQQA 4Q0XL 4JG1H 3OJ2C 4B53A 2HT2D 5IMKA 1AFVH 5C9KA 1S7TA 3STZB 3C8HA 3ET9F 2XXMB 4KQ4L 1CBVL 3ARDC 5DFTA 3DHMA 4HIHA 2AEPH 5T3XH 2C1PA 1NBYB 4FQ1L 4PJDA 4G80B 3VWJA 4BFIA 1LO5B 1MCOH 2Y5TB 3MJ9H 4RMWA 3ULVE 1T21B 4MD0B 3HE7B 4G9DB 2OL3L 5DVLA 1T0MA 4LSPH 4DZ8B 1KCSH 4JAMB 1NC4B 3WFZA 3FT3A 5ITBH 3VG9C 5ESVA 1FNEB 3MACL 4NPYA 5FYLD 5LAXB 3RBGA 4RMRA 5DHVB 2D03L 5BQ7B 4JFDA 3B9KB 1J8KA 3W39B 4DVRL 5IBUB 4M48L 1QFWI 3KPRE 1T04A 1IARB 3E6FA 4S10A 2JJSC 1UM6L 1J11A 5GZOC 4P2RE 1SYSA 1KXTB 3BKJH 5FGSA 1K6QH 4X9HA 1CTOA 4NWTL 2FBJH 3OJDB 1NMCB 4KKBC 4YBLB 3BIBX 4TOYL 5CCKH 2G75A 5GJTL 5L0QB 5HXMA 4OV6F 2CO6B 1NSNL 1QRNB 5ISZD 4M7JL 4RFEB 1H3TA 3QULA 5F3HB 1HILB 5C0ND 4NGHL 3MTRA 3MJ7A 4ELMB 4MS8C 3QO0B 4PGCB 4JFZL 4X9IA 4MXWL 4IRSC 4UTBH 2OR9H 4HUUB 4O4YH 4R97C 1AGBA 1RZ8B 3JV4B 3D0VB 5HHXH 5K9JL 5FYJE 5EOCH 5L8LB 2HLAB 3JV5A 4YFLI 1RU9H 2VQ1A 3HNVL 1UB5A 5TJWK 3BDXA 3GI9H 3OZ9H 4F9LC 4JB9H 1J7VR 2EDNA 5GGQL 2VLLA 4JFEB 5H35B 1I3GH 1QHPA 5TH2A 4S1SH 1MIEL 4NJ9L 2DQDL 5HHQB 1KJVA 1QBLH 5IUSA 3QDJE 5EU5A 4WI7A 2NY7L 4R90L 4MB3A 4RGMB 3D0LA 1FO0H 1FC1A 1T3FA 2ZG2A 5SWSD 4IRZH 4KI5D 4IM8A 4Y5VB 1AQDB 1YEKH 5GZND 5C70A 5J7CC 4OLYL 4L8CA 5I74B 1D5MB 1CDGA 5ERWA 3RWIB 2DDQL 4FP8H 3BGMB 3RGVB 2Y4SA 1CVSC 1ULVA 3F7YB 5DT1L 5BS0D 5EOCJ 3C5ZD 4OF5A 3TA3B 3RNQA 1RUML 4CRPA 1W0YT 2I07A 4WI9A 3B5TA 5IG7A 4F9PA 2YK1L 4D8PA 3X12B 4POZD 3ES6A 3FONA 4X80H 4KK6C 3UROR 1JNJA 3EO9L 3QXDA 3REVA 5DJ2B 3W0WE 3TNMA 2YD3A 3DSFH 4X5XB 1KEGL 5JUEL 4PRHB 5E8PB 4G3YL 5L6YH 1F6AA 2QSTA 1WFUA 4JO2L 1UVQA 3F58H 4XP5H 4D3CH 5IHLB 4ZOCA 1QR4A 3VG0L 1F00I 5LJYH 4U0RB 4LLWB 3F5WA 3QH3B 4OF7A 5L2JA 5HYSG 4N0UA 4JQXC 4HXBL 4CADB 1XGRB 4CVXB 1ZEAH 1MHHA 1E4KC 5GS1C 2UY7A 3UTTA 1A1OB 4P46C 2VO5A 4KRPB 3H9HA 4JVPA 5I66B 1SBSH 2HKHH 3KYKH 4KZDL 3DI3B 4OF6A 2BCKB 2JCCF 2OXHA 4I48A 5D2LB 4OZGF 1JI2A 2DD8L 3MV9B 4LSVH 1B0GA 2IAMB 5HYIA 5I8KH 4H20L 4OTXL 2DIAA 3SY0B 1I9IL 4PJBE 4LCUB 3RX7A 4JRXE 4D0CB 3L7EA 5HI5C 2Z31D 4TUKH 4GMSH 1YECL 1KLFA 4F7EA 2NY5C 4S2SB 4QXTB 4YDLC 3QISA 4GW1A 1GIGH 3CH1B 4MJ5B 4O02H 5HVHC 1UA6H 2UUDH 4RX4D 3MCKA 1VGKB 5DQ9A 1XIWB 1X4XA 1EEYB 4LMQE 4UBDD 3WO4B 4WTWA 1KF9B 4Y4KB 2ZOLB 1QR1B 5K9QG 1WBXB 4LHUA 4N1CA 3TBVB 2W07A 5LCVH 2QHRH 3EOBA 2EXYC 4PLKD 4AIZB 4PLOB 3TT3L 5J9PA 4XC1L 4BZ2L 4EEEA 1ZS8B 1MQ8A 2Q3ZA 4PJ8D 2D3VA 4XXCA 5JDSB 4CKVX 1KB5A 4A6YL 4JRWA 2DLEA 1QFWL 4AZ8A 4TVPH 5IB1B 1X44A 3B5HA 1NGWB 4IIQB 1U3HD 2HFGH 2VWEC 3DUSB 2A9ML 4OJFH 4EIZC 3H3KA 1G9NH 4ZNEE 3QHZH 1HHGA 2Y9RT 3KXFA 4H88H 2AEQH 3RZCD 2YUWA 2FJHA 4QY8A 5CINL 1C8PA 1NEUA 4LVOC 2VZ1A 5HHPB 4PBWD 3PDOB 4C4KO 2ATPA 4NM4H 5I76A 4QO1A 2LVCA 2WWKT 3I02B 2VQTA 3UZVB 1CLOH 5E94B 5C6WH 1ZTXH 1RJYA 3BO8A 3JWOL 3O8XB 4HX1B 1TVBA 4LL9A 1WZMA 2DQHH 4N0CC 4EI5B 4NKDA 2QQNL 2F58H 1KJ2A 4F8QA 5I1HH 1K9TA 2FCBA 1KV3A 3EDEA 1T1YB 1QUNA 4LCWB 3BQUB 3DETD 3QXWA 4LOUC 3MRGB 3UJJH 1NEZA 2A9NH 2OR7A 2EDTA 2HT4D 3ZHLA 4BSJA 2Z93B 5I1AA 3MRBB 1OP5H 1LNUB 3SDCA 2F5AH 5TPWL 2ESVD 3BRGC 5K33A 4LLQA 4OCRH 5F9WB 4EDWL 4GS7C 2AK4A 2EE6A 2L0DA 1DQJA 2BSRB 4FTVA 4G6JH 4NNPH 4MAUH 2VN7A 4NKIH 1QPPA 3TJEH 4L9LA 1F4XH 1JBJA 1NMAL 3GMLB 4KK5C 4YO0A 2NY3D 5J13C 1JK8A 2P46B 3QDMD 4XMLL 3SDAC 3C5SA 5EO9B 2C7UB 1OTTD 4UT6H 3VXRA 5CEZL 4LKCA 1EDQA 2OBGA 4OLZL 5E6IB 1B90A 2R23B 4G8EA 1BF2A 3ARWA 3U0WH 1HIMH 3OPZH 1I8MA 4JZJB 2IBBA 5CLTA 1FBIL 4PG9B 3D2UB 3HFML 3WFBH 5D1ZD 2X4RA 2AK1H 5IVXB 1CXIA 5DVOA 4OCYH 3C2SA 4U6YB 1OHQA 3FAWA 1TZHB 5T33L 4MDJA 3DPBA 4APQA 3VFNA 3NAAL 3P77B 4H0GA 2DLFH 1BWMA 3TCXA 1V7ML 5GGTA 4WUUE 2E7MA 4Y4FD 2J2ZA 5IIEA 5CJXA 5D7JC 3C60A 1VPOH 5CEZD 5FO7B 1VFBA 3BUTA 2PXYD 4P2YA 3HPLB 2Y06H 4NJAH 2DAVA 5AUMA 3WN5A 3TEUA 5T1LA 1MSPA 4Y19D 2VDQH 2XTJC 3T0AA 3ZYZA 4PPTA 1V3MA 5C0AE 1GH7A 1FZOA 1J1OH 1KIPA 1U9KA 1HXYB 2IQAA 3RGHA 1DQDH 3UBXA 5KANG 3HI1A 3QXTA 1RULH 3P9MA 5D7IB 1EUUA 4NQEB 1DUZA 5EU4A 5DMGC 5I30L 3V7MA 2BSTA 4NCC2 1P7HL 4WTZG 1WJ3A 3PWPB 4LLDA 5CEYB 1U93A 3TBTA 1T5XB 1DVFC 5M7QA 3ARFB 2NYYD 2O5YL 4N8CH 4FN0A 4NQCE 1NDGA 3CLFL 2DYPA 5KG9A 5JHDB 1HHHA 2C3WA 4GKNB 2IQ9H 1QA9B 4Z9KB 4G5ZH 2V5MA 2R2CA 5EC1A 5MEOA 4KUZH 2BOBA 2DQEH 3FOMA 4E41E 4NNYB 3DX9A 4LCYB 4MJ4A 5FKAB 3KDMB 4AIOA 3RDTB 1BF8A 1BQHA 4GUPA 5E8DL 3UXFA 2NTFB 3QUZA 2F15A 4F57H 3UTPD 1AY1H 5LGHL 2VXTL 3ULUH 4HWBA 5HGDB 4NFDA 3G08A 4O2EB 4PGJA 2ZCKH 5GPRA 4F7PA 4RZCB 1CD8A 3PWJB 3UPCA 1BOGB 5FYKU 3STLA 2YBRB 1MAMH 1PKQB 4YHZH 4KQ3L 2VXUH 1U8IB 3O41B 2I9LB 3VJ6A 3SPVB 4QWWC 3LSOA 4L8BB 4PJHB 4QTIL 3R4DA 4PTTB 5DJ0A 2ZSVB 3GUTB 2LAGB 3RA7H 3TBSB 4YIQB 3PDGA 2AJVH 2BVPA 2YOCA 4WNQB 4Z0BL 2I9TA 5MP6L 5DRZA 3RUGE 4Z7NE 3T08A 4ZUUB 4XBPB 3MBXL 4ZXBA 1GPOL 4N9GA 3SO3B 3GBNH 2CIIB 3TN0B 5D5MB 1KFAL 3IETA 5D6DC 5CD3B 5ACZA 4PJ5E 2JB6A 4IDJH 2QADB 3LHPL 1XGPB 4TUOA 3CK0H 4ONHA 4LASL 3O4LE 3BVNB 4HUNB 4F7TA 4S1RH 4H0IA 1VEPA 4B50A 2DL2A 5CBAA 4KAQL 1RURH 5CSBA 2MOVA 1NGZA 1ZA6A 4ZYKB 2APVA 2ZPKH 2Z35A 2EC9U 4MB5A 3WXVL 4C56D 2J6EH 3PP3H 4ZPTB 4IOFC 5E2WH 2B5IB 3L7FA 3GMOA 4LARL 3KPOB 4HXAH 4MLIA 4L4TA 2FD6H 3O3DB 1MOEA 3O9WD 1HINH 4Y1AE 1F8TH 4Y5YA 1D5ZB 2LU3A 25C8H 2VQUA 1UKQA 1ZK9A 1J0ZA 1GHFH 1RAMA 5C6TL 1WAAE 1MPAL 4Y16D 2PCPA 4PRDB 1IBGL 5FDYA 1QFUL 1D5IL 2VABA 4GW5B 1G7MB 2CK0L 2OZ4H 2NY6C 4R96B 1A47A 4HEPG 4ZD3L 3P9LB 5DJZA 3ZYJA 3RWDB 3CVIH 2J8UF 5KJRL 5DHVH 1CGUA 4HUXB 4JKPL 1JYNA 3BP5A 4XVTL 3T2NL 1HHJA 1IE5A 2BXYA 4YFDB 2NTSP 1DUYB 4LSUL 1QSEA 1CFSB 2KDGA 3IRZA 4NM8H 5C0CA 4OZHE 1A3RH 5MERA 1HSAA 1NANH 5CSZB 2HKFH 1F4AA 4WHTA 4P5TC 4D9QE 2F74A 1U58A 3ZMRA 3TVMC 2VWEE 3UTSA 4LK4A 3F12A 3VMPA 3FCTA 3MNZB 3SKOA 4OZGA 4L29B 3I9GH 4YNYB 1Z9LA 3OKLB 2EKSA 3IFNL 1TCMA 3PXJA 4TPRL 1N5AA 1P4LA 1F97A 3X3FL 3M17B 3IFPA 4YXLH 4PR5B 4L3CB 5D2NB 3HNTH 5K59E 3ARGB 2E6JA 2JLLA 1X3DA 2YPLA 4NQVB 1D6VL 1AD0A 4FQ2L 2X70A 1FL6B 3P9WB 3U9PH 5DUBA 3ZTNL 2O93L 4S0TD 4PJ9D 2EEAA 5GS2H 4UB0L 1NJ9A 2LV4A 4OT1H 3BWAB 3DIFB 3ZL4L 1ZA3A 3VWKB 2Q7NA 2WBJC 3M8OH 1T4KB 2PTTB 1PDKA 4RAUB 3RWJA 1G1CA 1QEWB 4JPKL 1A22B 1X4YA 2VC2L 3GSNL 3GSQA 3MRRA 1DBKL 4MNQA 2BSED 3QEHB 1X5FA 2HG5A 5E9DA 3P73A 2R0LL 3NCJL 5EFIA 4K7PX 1AGFB 2YEZA 4LEOB 1R0AH 1NUDA 1LE5B 2FO1A 2OMBA 3T8XA 5FYKE 3VGHA 5CBEB 5JXAL 4HUKB 1FJ1B 2FL5A 1CFQA 1OGAE 3V0VA 1AP2B 3PUCA 4M1DL 1YEJH 4I0PB 5I8OH 4OM0L 2WQ8A 3ZKXB 3QA3B 4L1DA 3GSUA 5C0IB 4PJCE 1JV5B 2R39A 1CK0H 3ZDZF 4P57B 4G7VH 1C1EH 4ZFOB 2GSIA 3B9AA 3WLBA 4V1DE 5JQ6L 5C08B 4ZMAT 4EI6A 4DKFH 2G5BA 4S1DC 3DGCR 3I50H 1E28A 2VE6B 4XRCA 3NIGF 1H0DB 3LEYH 5LBSL 5CKAA 4DUVA 3K74B 4ZSOB 5LVEA 1HXMA 2FSEB 1H3VA 4JFPB 4KU1A 1DL7L 2H32A 6CGTA 3OX8B 5HHOA 1BLNA 1E0OB 3A6CL 3V4VH 1XCTA 1EO8H 2XN9D 1IGJA 3KJ4C 3DVIA 3PP4L 1BJ1H 5IB2B 5DDHA 3Q5OA 3AMKA 5HYJA 1N8ZB 5E8NB 1T03H 4JFEE 4ZFGH 3SJVE 3OKDA 4OM1L 3VDCA 1YEFH 3SGJA 3WL9A 2IWGA 4X6DB 2NZ9D 2YD6A 3KHQA 3MCLL 2CLZB 5EU6D 4NUJB 4HIIB 4R26L 2OL3B 3G6DH 1CI5A 3ZKQD 1B4JL 4LCCB 1NKRA 4BZ1H 3BRFA 3FO9A 5ISZB 2GITA 3TM6A 4G9FD 1K3IA 3GJFK 2UYLB 1FFNA 4EN3D 1I85C 1YMHA 1KBGL 2R2HA 3I84A 4QRPD 4LSQH 5DD5H 1ZANH 3T2OA 3JXAA 3VXSB 1BJ1J 4QRRD 3DXAB 4WW2B 3ARXA 3T0BA 1RZJL 1WF5A 3LN5A 3GMMA 2EO1A 1TMCB 5CJBA 1D9KB 1P2CB 5JO5B 3MO1A 3QUXB 5EIQA 4JDTH 4L9DA 4OUUB 3JSSA 3FB7A 4KRMB 2HRLA 2Y23A 3LEXB 4HPOH 5DRNA 4ESKA 3PF2A 4KKLC 5CZKA 4GG6B 4NP4H 1P7QA 1LE9A 3S88H 3U4BL 4DVBB 2EC8A 2QQKL 4AYFA 5B8CC 2CKBH 3MLPA 3VXUB 1U8PB 5F7KC 1RMFL 4TUJA 3DX8B 1GL4B 2MCPL 4LPYA 4PP2B 4Q9BA 4YC2B 4N90D 3MNWB 4JRYE 1F4YH 4UT9H 5EBLB 4RRPG 4OCXL 3HG1E 5J4MA 2Z0BA 2H2PD 2ZP0T 3SE4C 5L8KB 3MRPA 4JY4A 1T83A 3KAAA 3BP4A 4P9HH 4R4FH 4Y0GA 3C6LB 4NQDD 3C5ZB 2EE2A 2BJMH 3RTQC 2CLVA 4UQ3A 5HD8D 3LZFH 1G7QA 1E4XI 4MNHA 4YHYB 2W59A 4OCSL 3MLYL 4PJFB 2APFA 5GGUB 5DC9B 3QXVA 4C57C 1EGJH 3LKOB 4HSQA 5CFHA 3LEVH 1FYTD 3NGBB 3CFEA 4I9WD 1GGYA 2P7TA 1MREH 4KPHH 2ERJC 2CDFB 2N4IA 3EUUA 5TDNA 4Y4HC 5D9SB 4U1JB 4X6BA 3FB5B 5F1KC 4TNVF 3MV7B 3DI2B 4BQ9A 3U0TA 4CJ1A 3UDWC 1W72A 1UWGH 4OGAC 3MJ6A 1I3VA 2I60H 3QEQE 3DRTA 4RFOH 1MELA 5DJ8B 1LEIA 2O5ZL 4P23B 5KVGL 1OLLA 3ARPA 1Y6MR 2MKLC 3VMNA 1Q0YL 3GRWH 2BOCB 3EYQD 4CBPA 2AV1B 3RNKA 1F6LL 5IW1B 2ZKHH 3RIFK 1UM4L 3TC9A 3JZ7A 3DURB 3BKYL 3H9SA 3TIDA 5EU7C 1BD2A 1OAQL 3U46B 1QD0A 1I7ZA 1MIML 1NUFA 2VLKD 1RV6X 4OLVH 4V2BA 2J5LC 3HZVB 5MENA 5DJCB 3D3VB 3PL6D 1VDGA 1ADQL 1ZXQA 4OSUL 4P2QD 1M05A 4UDTB 5A3ID 3TYGL 2Y36L 3FTGB 2W60B 5FUZL 3P4MA 1OAKH 1KTKE 3V5HA 4JZOA 2F53D 1L6ZA 4ELKA 1U8JB 5FK9A 2FECI 3VFSB 1TETH 3BAEL 4LLUA 1A4JA 4LCWE 3DMMC 4PJ8B 1IQWL 4WTZA 4B41A 3VFVB 1XH3B 2UZXB 5IV2A 3GEWB 4XAWL 4XPAH 5B4MC 3W2DL 2APWA 1Z9MA 3ILPB 1M1SA 3K2UL 4L4VB 3MNVA 3GMPA 3D39D 3IGAB 4WY7H 3GNML 4CAGA 2BNRE 1ZT7B 1YEDB 4X6CF 3X13A 2R1YB 2CXKA 5HGAA 1B0RA 4AL8H 4Y2DA 5HHME 2K9UA 3H7BB 3BYTA 2C4FU 3LQAL 2FZ3A 2G2RA 5I6XC 1CDBA 2EC9T 4L3EB 4LEXH 1JHKL 1IM9B 2AEWA 5CZVH 2HT2C 4U1GB 3B6SB 4ZOBA 3VW3H 2FH6A 1S9XB 1QHOA 4A6YB 1TFHA 4HCRL 3O11B 1JGEA 5IJKA 3GHBL 1I1AD 1RUPH 1MNUH 2J8UA 5SWZD 5ICZB 4GLRI 1XGUB 2VZTA 2AQ2A 2BDNH 3AS1A 3BGFC 5TQ2L 2H9GB 3N1MC 4XWGL 2K3TA 5EIVA 2DLIA 1PG7L 4RFNB 3ZTJH 5FGBA 1FC2D 4GRLD 1WLHA 1BREA 2HH0L 1HQ4A 43CAA 1AO7E 2V9RA 1I8LA 5EZLB 3BH8B 4FNLL 5E1AB 5E99H 1CL7H 1MWAH 2F19L 1OAZH 4KTDH 3MV8E 1MJJB 3EDFA 1HH9A 4Z8FH 2NY3B 2AV7A 4XC3L 1W8NA 3UO1L 1U2HA 2GKIA 2B1HL 2B4CL 4KTYA 3MYJB 3FQNA 1C08A 5FM8A 1F90L 4Z7QE 3RL1A 2PYFB 2NW2B 4YPJA 1B9ZA 4MAYD 4XH2B 1AKJD 3PDDA 2W9EL 4CU7A 1G9MH 2VDKH 3E6HB 4JQIL 3KPMB 2Z4QA 4HFUL 1E4XL 5AD0B 1D7FA 1FCCA 4BA8A 1W8OA 3OKMA 1A4KB 2E3VA 4MA1B 1S7RB 4LPXA 1MCCA 1U2CA 3CFKB 2RFXB 2W65A 3S98A 3CFDB 3QNYB 5DO2D 2GJ6B 3EDDA 2JJTA 4J4PD 5EZOH 3K81A 4YHPB 3DWTA 1PYWB 1HYSD 3DGGB 1CFNB 3HHRB 4IRJD 3GSOA 4TN9A 1TDQA 2PXYB 2X4TB 3BXNB 1BP3B 5E2UH 5I19L 4JKKA 4GAGH 4PTUB 3VXNB 1V05A 3PGCB 5BZWB 1PSKL 3ZLQC 4DKEL 4P2OD 1S9VA 2XNAA 1XGTA 4KI5C 3O6LL 4LSSH 2F54E 3SKNB 4TRPH 3WS3B 1KSRA 3L9RB 1KPVB 2WUCL 4K07A 1N0XH 3MLSL 4ZS7L 2FWOB 5GRVL 2NX5A 1NGPL 1IM3B 3DOSA 3L3KB 4G6KH 1PFCA 4HJJH 2UZIL 5LWYL 3DV6A 4F9PC 5JXED 1SEBB 1CIUA 1P1ZB 5F88A 2FB4L 1I4FB 4F3FB 2H6PA 4YHIA 1ZV5A 1JGDA 4X4YB 2HAZA 1A21A 2ITDB 2DWDB 1A7BA 3BIKB 2Z91A 5D7LD 4O2FB 3MBEB 1K4CB 3L6FA 5CJ8A 5IJVB 4OIIL 1MI5E 2AI0H 4LP4A 3LRSB 2M8XA 4EXKA 2D0HA 1L7IL 5BRZE 4J3WA 5I8CB 4TSBH 1LO4H 1ZOXA 2V5YA 3AUVA 3WIFA 4WI2A 4YQXL 3CPLA 2EH7H 2FECL 3QAZC 5IBTH 4KKCC 4HWZA 3QT2A 4OGXH 3LKPB 3VH8B 1FLRL 4DZBA 5GRZA 4NOBA 2H26A 2PKDA 3WS6A 1N4XH 5DTFB 4FOMA 1H3WM 3T0EB 1CVRA 3R06A 1MCBA 2X4NA 4NFBA 4XNQB 3ULVF 3NTCH 5JIHA 1ZVSA 4XPTH 1K2DB 3B3IB 5BVJA 3GZKA 1KCRH 4FZ8L 4G8GB 4WGWB 2QSCH 4U1IB 4DN4H 1OSZB 4XP4H 5I9QC 4WUKH 4BH7B 1YDPA 4LLVA 3DARA 4LSRL 4P0DA 1I8KB 2R56L 1X5YA 1T20A 3HMWH 2YXFA 1BZ7B 3V6ZA 1AR2A 4P3CL 5DR5H 3IRPX 4ENEC 1TQBC 2P8LA 2Z31C 3KPSE 3GKZA 5C2BL 1FZKB 3N06B 1OCWL 3L3DA 4H25A 3TJHD 2FGZA 3VA2C 3P0YH 3TZVA 1KTLB 2O5XL 1V7NH 4ERSL 5F6HJ 2DJUA 4FZEH 2HVKA 5BO1L 4GMTH 4UBDC 3WE6B 4DGVL 4YHOH 3GSXB 4GXVL 3JV6B 2W0FB 4PLKC 1U8QB 1FV1B 4JKLA 3HI6H 5MHSE 2D7OA 3GMNA 1GYAA 2BVQA 4N0YL 5F96L 5JW3H 4J3TA 5J89A 3O9WB 5EU7E 1ITBB 3S4SA 1MRCL 4H26B 3EJZD 4TSAL 5J6GA 2GK2A 4UIKL 3A67H 3N1QC 1GZPA 2OLDA 3HS0B 3RWEA 1JNLH 1YYMH 1RK1A 4N8VA 5KW9H 1U3HC 4LAQH 1I75A 4K55A 2XTJB 3CIQA 5FGCB 4LPUA 5HYQA 3IF1A 2DQJH 3QCVH 1FZMB 1S7QA 3LMJL 5HYEA 3PGFH 3QRGH 3PQYA 4Y16B 4JE4B 1A2YB 2B2XL 3RZCC 3ZKNC 4DUWA 2CRYA 5DD6A 4LGRB 4YBHA 3IDGB 4S0SD 4KJQD 1NCDL 3BRDA 1YPZE 5GGVH 1KXQE 4NO0D 4FA8A 4LQFL 1CE1H 4HV8A 2UWEF 1Y0LA 5I2IA 5JZ7C 1H9VA 4K8RL 1NGQL 3IVKB 1AXTL 3IU3A 2PW1A 3PABA 1FVEB 2XQYG 4GBXA 1DQQA 1OB1B 1KGCE 2VLJB 2LAAA 3FJTA 4MNGA 5DWUL 3OKOA 4Z7VB 3SDCC 2HA1A 3QJFB 1L9MA 3DETC 4AMKL 5TE7L 1YY8B 2BHUA 3HNSL 3MROA 3IDNB 4URTB 1YNKL 3Q2CA 2DQFB 2R0ZL 1A6UL 1DN0B 1HOCB 3EYVB 3AAZA 1LQSR 4C59B 4EXPX 3LS5L 3UYRH 5EO0A 3GJFH 4OBRA 1XMWA 1HQRB 2W0PA 1QVOB 1EVTC 2D03H 4JFOA 2BHZA 3BJ91 4PJDE 2E9BA 2H1PH 4RGND 4M48H 3VXMB 2Q6WB 2ZUQC 3PHQB 3QEGH 4PJ9B 1P5VA 3HMXL 2NY1D 2IANA 4JJ5A 1OTTC 2R1XB 3OHXB 4E42A 5KVFL 4QHUA 1RZIA 4JPWH 3IXTB 1UH4A 2N1KA 3E2HC 4HHAB 3JTTB 1LWRA 1EJ6A 5GJTH 3MZGB 5DQJB 4APQC 2WWMD 4OCLC 3X11A 4K7PY 3KPLB 1JCKA 5D1ZC 5FO8A 3PGDA 3LS4L 1FNSL 2G5RA 1DLFL 4J7RA 1UQSA 5K9OA 1MUJB 1R3IL 4M7KL 2ZOKB 2IPTH 2A77L 4PJBF 4HUVB 4X6CA 5I1LB 1QBML 1OARL 1QACA 2NCMA 4Y4FC 4CJ0A 3WN5C 3GKWL 3C08H 3MXVH 5EWIL 4DOHE 1JMXA 2XPGA 5K9JH 5DA0B 3SCMA 2H8PB 1J5OH 1KN2H 3GSNB 3P30H 2IPKB 5FOBA 5ILTL 2VLMD 3MLZH 2VITB 3F7VA 1NBVH 3Q5YA 4JREB 5GRJL 2GYSA 2NY7H 5D1XB 3GO1L 5I1DB 4WJ5B 4HKZA 2BVUA 4LLMA 3TNNA 2H45A 1Q9LA 2Z8VC 4M7ZB 2OI9B 3QJHA 1F58H 5E70A 2XN9B 2C4FT 1S5IL 1B3JA 1E27B 5EC2A 3WNMA 4Z77A 1NLBL 3DX7B 4PJEB 4X5LA 3QNXA 2NY6B 5E6YA 3RWFB 3OXRA 4UU9B 2DDQH 4K71C 4ZFZB 2NYYC 4ZUVA 1T6WA 4K94L 2XWJA 4W70A 1I9JH 4UZGA 5DT1H 1TQCB 3GSVA 3KPQA 5T1MA 4GG6E 4RMVA 4HJGA 3QR2A 4JLRB 4QHKJ 1DEDA 1VFAB 2YK1H 5HPMA 5SWSE 1IGYB 1P7KB 3R1GL 1DFBL 4KI5E 4P5TB 2DB8A 1G9EA 1G6RA 1T7ZA 4YEFA 5KN5B 3EO9H 3WEXB 1JHTA 1JTOA 1UT9A 5FA4A 5JUEH 1LD9A 1YEIH 4I3GA 2D4DA 1YMMB 1R5IB 3KGRA 4FTVD 3G5ZA 2R2BB 1FH5L 4KH2A 4WTXA 3VXTB 3OMZA 4YE4H 1FL3A 5BV7L 2GT9A 4ISVB 4JR9H 3WFEL 2C9AA 4LCIL 3VG0H 3KVQA 4K3HA 4ZUSB 3EYSL 4UIMB 5ELIA 3QIBD 3RX5A 3NN8B 4MA3A 5BS0E 2Q8BL 3WUWB 1GXEA 4HXBH 1RY7B 3VXRD 3IKCA 3IDUA 4KV5E 4PRIB 3N50A 3OKYA 4CN1A 1JN6A 2VAAB 4ZFFB 1JWSB 4HS6A 1Z9SA 5FUOH 3QQ9D 3HR5B 5EUOB 5T5FL 4AM0B 1DDHA 1NBZA 2A1WL 3MRNA 3RWHB 1DLHA 3NZ8B 1I9IH 1I3UA 2VDNL 5T1DH 3RX8A 3RVVC 1YECH 2SEBA 3IFOB 3QUMH 1SJEA 3VE0B 1I1YA 1BECA 1H3PH 2ATKB 1R6VA 4C54A 5MEPA 3Q6FA 2IFFL 5FV2A 1T1ZA 4JHAL 5H94B 4I2XB 1WZLA 5KVEL 4Y5YC 1I1RA 3B2VH 4MQXC 2PYEB 3RPKA 5C8JB 3VFMA 4JM2D 3ECBA 1KIQB 2H3NA 3GI8H 3O3AA 3TYFB 3V52L 2VZUA 4Q9RH 4XP6L 3BUYA 2IADA 2YS4A 4XC1H 3ZKMD 1F2QA 2VH5L 1OTUC 4AEIH 2C1OA 4A6YH 5D7KD 4CDGC 4IOIA 5T1KA 4L1HA 3CMOH 5EOQL 5INDB 4U1MB 2FR4A 3CD4A 5IR1A 5DJYB 4HAGA 4ZOAA 3QUKB 3LRHA 2VAJA 3RVUC 5DEZA 4Z7OE 5L88H 1MQKH 3AXLB 4FQXD 4QT5A 1KEMH 1NFDB 2XFXB 1H15A 4U49A 1NCBH 1DANU 4FFYH 2V9QA 1KENH 4Z7WB 1EMTL 4JO3L 5DD0L 1V5JA 5IOPB 1LDSA 2VR9A 5GJSL 2NPLX 3JWOH 3UC0L 2E7HA 4JG1L 2MPAH 4HPYL 43C9A 4N0FA 4NT6A 1AFVL 2QQNH 4D0BB 5E4IA 2VR4A 4PGDB 2AEPL 5AZ2H 2DQIH 3IJSA 5T3XL 1T2QH 4J3UA 4TNWF 1MCOL 4EKXA 1IEBA 3KPRA 2EYSA 3CFBB 1PVHA 4AENB 1TCRB 4LSPL 1KCSL 5TPWH 5ITBL 3K46A 4P2RA 5EBMA 3OL2A 4M6MH 2APXA 4KGLA 5C0JB 4P4RA 1JHLH 3MR9A 2CLRB 4L8SB 5DURD 4EDWH 2NY5H 4NQXB 3AGVA 5ACLA 2IPUG 2NQCA 1KYOK 3KLAB 2XA3A 2XTLA 1R24A 1G0DA 3KYMB 2J4WL 4PRPD 1A9BA 2P5ED 3FQUA 4LLAA 3BD4A 1NMAH 1XFPA 4RMQA 4ZXBD 2R0WL 1A3LH 4ODXA 4DAGL 5E00A 4X5WA 1C5DB 4POYA 1JGVL 4FXKB 5C0GA 3BKJL 5T3XD 1K6QL 4LKXB 2P5WD 4OI9A 4JFFD 2ARJA 2FBJL 4XCFH 3EKCA 3I3EA 2ESVE 5CCKL 2OQJA 4X4ZA 2AJ3B 3L3IA 1MCFA 3BHBA 1UC6A 4ODUB 4MQ7A 2VLRD 3KJ6L 2BVTA 4WO4B 2XV6B 3RUGF 3FT2B 3QIWC 1YY9D 5F1OB 4OI8A 4K9EC 4Z7NF 5DJDA 4F15C 5T33H 3CCHB 5IEKB