3BQUD

Crystal structure of the 2f5 fab'-3h6 fab complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
222
structure length
217
Chain Sequence
GVQLQQSGPELVKPGASVKMSCKASGYSFTDYFMHWVKQSHGKSLDWIGYINCYTGATNYSQKFKGKATFTVDTSSNTAYMQFNSLTSEDSAVYYCARTSIGYGSSPPFPYWGQGTLVTVSAAKTTPPSVYPLAPGSSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the complex between the F(ab)' fragment of the cross-neutralizing anti-HIV-1 antibody 2F5 and the F(ab) fragment of its anti-idiotypic antibody 3H6.
pubmed doi rcsb
molecule tags Immune system
molecule keywords 2F5 Fab' light chain
total genus 39
structure length 217
sequence length 222
ec nomenclature
pdb deposition date 2007-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bquD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bquD02
5TE4H 3HZMA 3O41A 4LLUB 1FZKB 5IHUL 4H20H 4YR6A 4PV9A 5JXEC 4ZUWA 4DWHA 5ALBL 1TXKA 4DN4H 3SGKA 5D71H 5DURB 3LV3A 4PTTB 4WFGD 3QPXH 5GGVY 3MRKB 4PJHE 2OTWB 1FSKC 4HV8B 2E7CA 1HWHB 1BF8A 3F7QA 3G5VB 4LF3A 5DJ8A 1T6WA 3QUXD 4J3UA 3BAEH 5C09B 3Q6FB 3S36X 3HI5H 4OZIB 4GXVH 2LQRA 1BQLL 3EYOA 5F9OH 3QH3B 1KYOK 1KTLA 2N7BA 2HN7B 1UKSA 5GZND 1MAMH 4NUJA 4YEEA 4LPVA 4N0CC 4JCMA 2PW2A 4OZFA 5L2KB 5DEZA 4MB4A 5EU7C 1RK0B 4NDMA 1IQWH 1I1AC 4WO4D 3EFDH 4XB7A 3M1BB 3TESA 1W8OA 3BZFA 3OGCA 4L4VB 2BVPB 5DK0B 1B0WA 4CU8A 4N9GA 2BNUA 1FZOA 4KRPC 4QXGH 1T7VA 4P9HL 4BKLB 3QR2A 1VCAA 3C2AL 3ET9F 5C07D 4UMGA 3LOWA 1KJ2L 2QSCH 4I9WE 4X9FA 3WN5A 4CW1A 3NFSH 5JUEL 5B4MD 4RQQA 2D31B 3SGJC 3LKSB 3QO0A 4Z5RA 4KDTA 1EXUB 2FWOA 4LLAA 4C54A 3MOAL 4HHAB 3IDXH 4KGLA 4BH8B 1KN2L 4G9FD 4ODTH 3QHTC 1IBGH 2C3WA 4MDIA 3V6FA 5JNYB 4PGBB 4BH7A 3EFFA 3AXLB 5C0CB 4Z7QF 4LGSB 3BKYL 4QTHB 4D0DA 4P59L 1WC7B 1E6JL 2VL5A 3DGGA 3QJHB 2EXWC 1X4XA 2J8UA 2DQTL 2UZYB 4NO0A 3B8SA 1KELL 2NNAA 4BZ1L 1CXEA 1YEDA 1U92A 3NACH 4G8EB 5D2NC 3TPUB 5FO7A 3UO1H 5AG9A 4XAKD 2B0SH 2HJKA 1F90H 4J8RA 1JWMA 3UROR 2VZUA 4XGZA 4ZUTB 5L88L 3I02B 3MLTB 1AGEB 3OTTA 2VC2L 2F74A 4ZXBB 4X7SL 4CN1A 4G8GE 2W9DL 5I75C 2AEPH 3CFBA 3ZYZA 5J11B 3TIDB 5FYKL 2WP3O 3O2DA 5C08E 4X0KA 2BOBA 4K7PH 4HUUB 1YYLH 1DBKH 1KXVC 2A6KB 4NN7C 1G6RA 3EJJX 1RVFL 1H8NA 3EOTH 2YPKB 2AK4B 3MUZ1 4ZS7H 4WIQA 4ZNCD 3SCMA 4AQOA 1EVTC 4LGPB 5FGRA 2C3HA 1D6VL 4YQXH 4JR9H 4RMRA 2Y5TB 2VDKL 1G6VK 2VR4A 4XC3L 1HHHA 4YHZL 3GK8H 4JAMA 4JM2B 4O5LH 5B21A 1I1YB 3GNML 5T1LB 4BK4A 4LVOC 3JV6B 2IBZX 3I6LE 2XZAL 4KJYA 4N1HB 3FAXA 2P5WE 2C7UB 5C9KA 2IPTL 4PJIB 4N8PA 2GYSA 4P2YA 1K4DB 1UM6L 2D7QA 2KZ1B 1L6ZA 1S7TB 3DO7B 3O4LE 4PRAA 5T3XL 3A0OA 3L5HA 2I5YH 3OJ2C 4NZTH 1VSCA 2JIXD 3QNYA 3O9WA 3VXRD 4MAUH 3G08A 4K71B 2BMKA 4DVBA 4KV5F 3BEVB 2GSGB 4NSKA 3VFPB 1I9RL 4Y5VA 3HPJA 1MUJA 3C5ZB 5DHVB 3HI1B 1R3HA 1MFCL 2D7PA 4KHXH 1BQSA 4LKCB 3TBYA 1J12A 1X5AA 2ZOLB 3BVNA 4HJJL 3V8CA 4MNQE 4S0TD 4K2UH 3RHWF 4P5TC 1GZQA 1JTOA 3OZ9L 3CZFB 4KRPB 4LMQE 3RGHA 3OKKA 5E6IA 4YHPA 1FG9C 3RWDB 1KJVA 3MV01 3OKMA 2NZ9C 4GFTB 5DFVC 3IU3A 4Z77A 4LHJB 2ZSWA 1TCMA 4PRBA 3O4LB 3QIWD 4WJ5A 4G8IB 1G7IA 4PJEB 4YHOL 3WJJC 3O3BB 1AXTH 4JO2H 15C8L 2YWYA 1FAKT 4PLKC 4PRPB 4PJXA 3WE6A 5EBGA 4DN3H 4J6RH 2NY3C 4FG6C 1ONQB 2O93L 1VA9A 3TNMA 3EGSA 4DUWA 1MHHA 1AY1L 4JFZH 4FS0A 5CGYC 4ELMB 3WFHA 1OWRM 3QP3A 4HC1A 1MSPA 3VXME 3ZHDA 1EBAA 2FO4A 4X7SH 3EO1A 5HJ3B 3UDWC 3UTQB 4PPTA 1JHTB 2CIKB 3GMRB 8CGTA 1WVZA 1EERB 4HH9A 1CT8A 4N90E 5HHPA 3D2UD 1OP3H 2WMPA 2PN5A 3OR6B 4O2FB 4G8GA 4P23B 1WV7T 4LCCB 4MJ2A 5CIPA 1F4AA 3H42L 3MV9E 2RIKA 4NP4H 1AQDA 4YO0B 3ROLB 3MCLH 3CFCL 3QWRA 3WIHH 4KWUA 1NDMA 3A6CH 2KKQA 2UUDH 3NCCB 1RZKH 3FB6B 4PP2A 1SJEA 4JPVL 4ZFGL 3RPIB 5DJ2B 1QBML 3HZYA 2NW3B 5IGXH 2Z93B 3RAJL 4BQBA 1ZGLM 3S3JA 1J8HA 4M6OH 1X3DA 5FV1L 3TZVD 3PL6B 1LP9F 3UPRB 1U93A 1SYSA 4NKDA 5GJTH 3QDJA 5IHZA 5IWLA 1ZANL 1TFHA 3QISA 2YA1A 2X42A 1P7HL 2VL4A 1KG0A 3PL6D 5C0CE 5ICYA 1F3JA 4Q74A 2IH1B 3OBAA 1YEFL 4L3AA 1FZKA 4K94L 1N7ML 2X70B 1NCAL 5DRXA 5AAWA 1PYWB 1VHPA 1GCFA 5C07E 1CL7I 2J3SA 3ESVF 3RVVD 5F3BB 4JRXB 2QKIA 4UNUA 3NFNA 1RULL 1JTPA 5MEQB 4V1DA 2AJSH 3H7BA 2CIIA 2OLDA 5IVXE 2D9QB 4POYA 4OLXL 4CVXB 5JPNA 1IC4L 1H3TA 3QSKB 4UIMB 3VA6A 3QI9D 3GSUB 2RQ8A 3V0VA 3GSQA 1BOGB 5HHME 3M07A 3V4VL 4Y8AA 5JA9A 1KCSL 3W11D 2MPAH 1A6AB 5EO1A 1IGJA 2HAZA 3MBED 4HWBH 4WHYG 4Z7UA 1RK0A 3RY6A 5KVFH 2M26A 4PJ8B 3WJLC 2EH7L 3AFLA 3T77A 1YDPB 1RHFA 3ZKMC 2BERA 1PZ5A 5I1LB 3C08H 5BRZE 1EIBA 5J6GA 4NUGL 4YDKH 3MCKB 2FATL 3T65B 5DK0A 1A9BA 5C71A 2CGRL 4AIZB 2XKNA 2HRPH 5BS0D 2G75B 1A6TA 2GUOB 4JO3H 1JYVA 1RULH 4ORGB 3QQNA 2X4OB 1UM4L 3E8UH 4B5EA 2OR7A 4HWEH 4WCYH 5DT1H 4R0LB 4OQ1A 5F1NB 3MA7B 1QFOA 5KSVA 4XNZB 1JMXA 1FORL 5L0QC 2VXTL 2YSSA 1R3IH 1X7QA 1ZA6B 3D2UB 4GAGL 4F7PA 3QIWC 3FQNB 5GZNC 3FN0H 2X10A 4ZFFB 4PGBA 4BH7B 3X11A 4N0CD 3GBNH 2A9ML 4HUWA 2ZNXA 4MD0A 1AGBB 2OQJB 2R2BB 3K74B 4FN0A 1T80A 4OFVA 5IVZB 4BSWA 1H3WM 1F4WL 2WM0A 2XPGB 5CJXC 3BJ91 4XP4L 1WJ3A 3RWJA 3I6LD 2MCPH 2J8UB 5KSBB 4J3WA 3W0WA 4NO0B 4MNQD 3TVMA 1QFUH 3MV7E 4E41D 3QI9B 5DYOA 3DX6B 3MYJA 4G8EA 1MJJB 1FGNH 1TCRA 1NC4A 3HC3L 2V2XA 4OCNC 4K9EL 4FQLL 3QQ4A 5B4MC 1J8KA 2E6PA 1FNEB 5GQBA 1BBDH 1BD2D 3MLWH 5EZOH 1KCVH 2ID5A 5EUOA 1NEUA 2HH0H 3R0NA 3IF1A 1RI8A 1JGUH 4V1DD 2F8XC 1ORSB 1KT2B 4ZTPL 3VWKA 1EHAA 2LTQB 3GJEA 2EKJA 1H3UA 4YDIH 4NC1C 2A6KA 1U8JB 1G6RB 3WXVH 3BJLA 3AAZA 4U1LB 3O6KH 3CH8A 1KFAH 4KI1A 5HHVH 5DUML 5LQBH 3EJYD 1H8OA 3AREB 3LKNB 5D1ZA 1W72L 1SJXA 3PHQB 3DYPA 1WZKA 2H26B 4I4WA 3V4UL 5TQ0H 1JZ2A 5F3HB 5C0BD 5I8CB 3O6LL 3FQRB 3G6JA 2VLMD 4GMSH 3UZEA 3IGAA 2HLAB 1BBJA 3V4PH 5GHWH 2X4NB 4Q2ZB 1U8IB 5GS1B 4HUXA 4OB5L 2OXGA 1K4DA 1BM3L 2PUQT 4U3CA 1S7TA 3DO7A 3CD4A 1RUMH 1WCBB 1MRCL 5F1IB 4RDQG 4HS3A 4HPOL 1CGWA 4M6OL 4G6JL 5CJQL 3T4AB 3SCMD 3VFPA 1U0QA 2FH6A 3BKCH 1E4JA 4UV4H 1SY6A 2VXTH 2CUIA 5D8JH 4XMPL 4O4YH 1LO4L 5F9AC 4YPJA 4H26B 4LOUD 3RDTC 3LIZH 2GJ6A 1JNHA 3O2VH 2B7DT 1ORQA 3K8LA 3OX8B 1GJIA 4U6YA 4BQ8A 4LLDA 5FA3A 1J0ZA 3O45A 1AKJA 2VLRE 4Q6IA 1MCFA 4X98A 1QKZH 1UJ3C 4WUUA 3UTTA 3EYUH 1P84J 4UILL 1UWEL 1KN4H 3OKMB 1JN6A 2ZUVA 1JV5A 5D70L 3BD3A 1BVLA 3RVXD 5IFJB 2QSQA 1QFWL 4YFLF 5F7EL 1RJLB 1VEPA 1OD9A 1PVHA 2YC1B 3L5IA 3RUGF 5CJOL 3HNTH 1WBYA 1WAAA 2JB5H 3MLVH 2FR4B 5A2FA 3HC3H 4ZSOA 4EDXB 43CAB 4Y19E 1MHHB 4R8WL 5AD0A 3R1GL 4YHOH 1NUFA 3GSWB 4XTRC 4JKKA 1Y18B 2V5YA 1C1EL 1P4IH 3DPBA 4LU5L 1FPTH 4M62L 2G5BB 5D1ZD 2IBZY 5IHUH 1XGRA 1DLFH 3CSGA 2XXCB 2WUBL 4MS8C 4I8DA 5T3ZE 1N2RB 4HUVA 1AHWC 2ERJB 4LCIH 2PTTA 2E6JA 4MCYB 5E24E 2NX5D 5MP6H 1MI5D 2MJWA 2H3NA 2VAAB 2X1WL 1KUMA 2FECI 3LKQB 5CAYB 1PKQB 4WEBH 3C9NB 4YPGB 2IQAA 5TFSH 3ILQD 5LWYL 5B3NA 1FFRA 5K59E 5I71C 4PJIF 3TT1H 2HG5A 4HDIA 5HDBE 1YZZA 1F3RB 5IJVB 2BVOB 3IS0X 2QR0B 4I48A 4Y8DC 5GJSL 1XR9B 3PWPD 4P2CG 1ZVYA 2VLJB 5D7JC 1NGQL 3GIVA 3DIFA 5T33L 4RA3A 9CGTA 3U0TA 1J8HB 3L5XL 1N0LA 3B8YA 5C7XL 3AREC 4U05A 4WW1A 5IHZB 1I8IA 4OZGA 1U8KB 4PV9B 4LARH 4K94C 2OCFD 1F02I 2YD4A 3F8UB 4MNGB 1EV2E 3IFLL 3MLRH 2ARJQ 3S5LB 2ZSVA 1F6AA 4ERSH 4FQJL 3MRKA 3N9GL 5IK3B 4GRWE 1PX4A 3BKML 1VFAB 3GNMH 4HZLA 1CVSC 2J1KA 3KS0J 4LF3B 1E4XL 4RMVA 5F44A 5GGRB 3V7AG 4POZD 3BO8A 3WFBL 3GKZA 4OKDA 4RX4A 1PSKH 1YY9C 4J12A 1A7RL 5E5UB 5IEKB 4E41A 4ZFZA 4KV5E 4L4VD 2F53B 3KPSE 5DEFB 3TVMD 1RIUH 5BMFH 4UIMA 1FYTB 4OD2B 5IJKC 2O5XH 2XACC 2ESVE 1S5IL 3MRNB 1J5OL 1AXIB 1KFAL 4OZFB 2QADB 2H2SD 5L2KA 5DF0A 3U0WL 3D85D 4MA8H 3PQYA 4NDMB 2AJXL 2V17L 3HE7A 3M1BA 3C60C 1A6AA 3HFMH 3L3DB 3Q1SH 1IZKA 3QG7H 4YHKH 3MMEA 2D03H 1IGJB 1MCQA 4RRPA 2EH8L 3IKCA 2XWTB 3LDBB 3OZ9H 5CEZD 3DURA 3BZEA 4JRXE 5ITBH 1ZK9A 4M1DH 2V2TB 3UYRL 4X6CA 4NRXB 3K46A 1NUGA 4Z76A 5JR1H 5EOTB 3T0ED 3RAJH 4B7IA 3K81A 3LAFA 3LKSA 3EOAA 4MQSB 5ISZA 5CKGA 1YEGL 2XA8H 4XP1L 4Z7QE 4LU5H 4U3XA 2FWOB 4HSQA 1ZGLB 4JPWH 3SDXE 2IQ9H 1KSRA 5KSVB 5DQDH 1Q0XL 3DETD 3MJ7A 3S6CA 3GMQB 3LPWA 5C0NC 1X4YA 3AROA 4JN2B 1TZGL 1X7QB 1ZA6A 3QIWB 3GSNA 4K8RC 3D87B 3MRCB 4HBCL 1RZGB 4QWWC 3RNKA 3X11B 5JA8B 3QUYB 1RY7B 3PP4H 1RURH 3H9SE 5C0GA 1MPAL 2F5AL 3O8XD 1CFVL 4LSQL 4U1GB 5IBLD 1U91A 4Z95L 4NBZB 4Q9QL 1U92B 4MLIA 5CD3B 5FEBA 2B4CC 1IAIL 3FCTB 3FOMA 1QFWH 4WFFE 2DLHA 3TVMB 4A6YA 1FL5A 1K4CB 5SWZB 2NY4C 3VMNA 3RPKA 3DX6A 3MYJB 4GJTB 5DFTA 5A3ID 5E95B 1CK0L 1Q9OB 1BWMA 3QQ4B 5DMJB 1RZJH 1PGRB 3AMLA 4WTXA 1BQUA 1UXWA 5SX5H 1JWUB 1G6RH 1FNEA 5TH2A 3PL6C 2BOBB 3KXFD 3T0EC 3F7VA 3HMWL 2N4IA 1FNAA 3QWRD 3ILQC 4KUZL 4FOMA 1HH9A 5EU7E 3HUJF 3ESUF 3IU4L 1WTLA 3Q3GB 4D8PA 2LAGB 5L7XH 3SEPA 2ZPKL 3NMEA 3OPZH 4P3CL 3UBXI 1LGVA 4Y4KA 2Q87A 1U6AH 1NAMB 2A9NH 1UWEH 3AS2A 1D3CA 1OB1A 1S7WB 5FIEA 5T1LA 3WUWG 4F33A 3MRQA 4PJEE 1YEIL 3BRGC 4QWWD 5D1QA 4I4WB 1XGQA 2LFGA 4Y7MA 4WNQA 4TSAL 4WHTA 3IJHA 4ODHH 3U82B 5I1DA 5D5MF 1CFSA 1JI2A 3VD5A 3QNYB 4HUXB 1AP2A 4IOFC 3REWB 3S7GA 3KPRD 4IEFB 3DUHA 1RK1A 4PJAE 4LSRH 4NSKB 1HHGA 4MJIA 3GUTA 3FT3A 1P7QD 1FH5L 4FFWC 5ID0A 4JPWL 1AE6H 1XGUA 3NFPA 3QCUL 1JGLL 1U8NA 1S9XA 2XOTA 4H1LB 4DOHB 3V0AC 1OT1A 4WI7A 3T4AA 4E0RB 2ILLA 3BIBX 3K3QA 3GB7B 3O0RH 2E7MA 3C2AH 5M95B 2IBGA 2R9HD 2RCSH 4GG8A 2VABB 4YDJB 4XMKH 4JKWA 1NBZB 3CFEA 4PJ7F 4H26A 1MIEH 3C6SB 1OAYL 2P5EA 3AY4C 3CZFA 2GJ6B 5FM4A 4FFZH 3H8NA 4PJFA 4F37K 4U6YB 3C60D 3H9ZA 2SEBA 3GBLA 4KMTH 4QHUA 3ZYJA 3RIFK 4Z0XA 3UC0L 5E70A 1S9VA 3G6JF 1M6OA 3MUHL 1F8TL 2ZSWB 3RY6C 1YYLL 1ZSDB 5EOQH 2XTJD 2GSIB 4OCMC 1OTSD 4G8IA 1G7IB 5I16A 1JV5B 1INQA 3O3BA 4H88H 5CEXA 3PWVA 2AAVA 2XNAB 1FNGB 3UTPD 5B38G 1D5MB 4M6ML 3TBSB 3TNMB 1T5XA 4WTWA 4YHIB 3WO4B 3MSPA 3TBWB 4HJGB 1KEMH 2YC1A 4ELMA 2XA3A 3BT2H 4FQIH 2FR4A 1NMAH 3DBXA 1EAJA 3O4LD 4XP9H 2GJ6D 1CQKA 1NCWH 5F97E 1A14L 25C8H 2DM7A 4R6UA 4KQ4H 2MOVA 1ZT4A 4MHHG 1MJ8H 3VXUB 3DTXB 4Q97A 2LTQC 4PRDA 4G8GB 2IGFH 3IU4H 4DK3A 5CIPB 1JMZA 4NOBA 3UC0H 4QRSA 3BWAA 1N2RA 4KRMB 1D5IL 4PGZA 4ZAKD 4K3DH 3ZTJH 1WFUA 1P7KA 5E2WH 1W0VA 1IILE 3TWCL 4XP6L 2M1KA 4LP5A 1Z3GH 2GTWB 3SDYH 3WNKA 1CCZA 4HEME 4YPGA 3EYVA 1MQKL 2EKSA 3O3UN 2IF7A 1ZT1A 3VCLB 2MPAL 5D93B 4P4KA 4ODBD 1EMTH 1ZLWH 4HDIB 4HCRH 5I9QB 1V7MH 5JOFA 5LGHH 3VFRB 5MEND 5KG9A 2EICA 2HTKC 2XY2A 2D03L 4XCNA 4OUOA 4QOKE 3FN9A 4MA3A 1CFQB 3UPRA 2W0FB 5I1CH 1MF2H 3DIFB 4LNVA 3MBXH 4M9PA 5FHBH 3ARVA 1G7JA 2Q7YB 1RFDL 2MKWA 3SE8H 4Q6IC 2CGRH 4PB0L 4QCIA 1MLBA 4MS8D 4J23A 1G7LB 2F54E 2FD6L 2X70A 4NQEE 4AEHL 4OLWH 1SVZA 2YEZB 4HKJB 5C0BE 1Z9MA 4DN3L 3IRZA 5GSRA 2P4AB 1UA6L 1T0NA 3S5LA 1KTDA 2DAVA 3MREB 4JFOB 4JFEB 5BW7A 1VFAA 5MEQA 4KK6D 4NN5C 4LLMB 4CVXA 3DV6A 4NQUA 5E1AA 5E5MA 4OB5H 5IW1B 2LV4A 2XWBA 2FLRT 2EXWD 1SVCP 5C6TL 1RUPL 4E41B 5IBLC 1RIHL 1BP3B 4RGNB 1FYTA 1Y6NR 4I0PD 3ZE1E 4NNXA 3MA9H 5EBWA 2AXFA 2EDHA 3SE9L 4PRIE 4DUVA 4NQVA 4PJ8A 2VQTA 5EC1A 5B39B 4OLXH 2X7LB 5AUMA 1INEL 1MELA 3SGEI 5I1LA 1C5DB 2EE3A 4PJ7E 2XV6B 3B9VA 1G6RL 3BZEB 1N26A 4AIZA 5DC9B 1PG7H 1QP1A 4IRZH 3LRSA 3NN8B 4HUKB 1OWWA 4FQ1H 4HKZB 5D7JB 1UENA 4TUKH 1NCBL 3TJHC 5DHVH 2QQQA 1IKFL 1ZANH 1G1YA 2NY0D 4NT6B 3GRWH 1MCOL 1NBYA 4V2CB 4ZFFA 3AB0C 4X6BA 4JFPB 3SHSA 3RWIB 3K2UH 5DQDL 3S3PA 1A1MA 4ZOEA 4F15B 1MFAH 3QIWA 3M8OH 1I75A 1MRDL 3BUYB 3GSNB 1MJ7H 3LMJH 4BSWB 3I3DA 5DLMH 1RZGA 5D2NB 1JVKA 3NA4A 1BGXH 2BOCB 1H5BB 4RX4D 2YBRB 5TQ0L 3ZE1F 4LSUH 1EO8L 4LVHB 1FVEB 4PJBE 5GZOD 4S1QL 3QI9A 5DYOB 5CWSB 1YYMH 5GSVB 4QRQA 1KIUA 5FM5M 3BUTA 5IOPA 4ELKB 4DZBB 1WSST 2EEAA 5E8NA 1NC2A 5C0AB 1CE1L 1VGKB 1R3JB 1UB6B 3G6DH 1A1NB 4XPFH 3TCLB 1V3MA 1QSFE 5M7QA 3V6OA 3MRHA 3HN3A 1EH9A 1NCNA 5ESQA 3DUUB 5AWNH 1NL0L 4U6XB 1A6UL 1JRHH 3DX8A 5E8EB 5TH2B 4ALAH 4Y4HA 1KJ3L 3RY5A 4R4FL 3F7VB 4TTDD 3IDNA 4Y16D 2Z4QB 3BQUB 3VXRA 1CTNA 1ODAA 5E1HB 2ATPA 2R4SL 3HR6A 3VFSA 4ZOCA 5K93A 3BZ4A 5EORL 1QYGL 2O5ZH 3PHQA 4UNVA 3FQWA 1OB1B 4PRHD 3QEHA 2HKHL 4M1GL 2VLLA 2WW8A 3MRQB 3STBA 2P7TA 5C3TA 5E2TH 5B22A 4LIQE 4Z6AT 5ECJE 1FG2A 3UZVB 5HI4C 2Z0BA 4FNLH 3CVHH 4WHTB 2CO6B 3PQYE 1BJMA 3BT2L 4HX1B 2R0ZL 4P5MB 2ESVA 5CEZE 2NY1B 1N5YL 1WCBA 1U3HB 3BQUD 3GFUA 4HS3B 5INDB 4GKNB 2EE2A 1OGAA 3FMGL 5TPWH 1DVFA 3OR7A 1RK1B 2AQ1A 4H5SB 1BQHB 2IANB 4LL9A 3BDXA 1NGZA 1FHGA 4R7NB 4PJCB 4Z18A 4KRLB 2EXYD 4K7FA 1QR4A 1G7HB 5TGBB 4OF6A 4XMPH 5SX5K 3U7YH 1VEOA 2IMMA 3QNZA 5BRZD 1DSFH 2CRIA 1JK8A 1CFTB 3GGWA 5DSCB 4RSVA 3EIFA 4F7MB 4WDIA 5A2JH 3HE7D 4JY4A 3O0RL 4QHUB 1JN6B 1CZ8H 2VISB 1JIBA 3VE0A 5HD8D 4J3XA 2RBLA 5H94B 2YK1H 1BVLB 3OXSB 1N8ZB 1HHIA 1RIVH 1INQB 3FAWA 1QO3A 5EZJB 5KANG 3KLDA 3PGCA 3OG6B 1D5MA 4OQTH 2E7BA 1MCIA 1NFIA 4HK0B 5I1KL 2OJEA 4XXCC 1YMHA 2HFEB 2ZJSL 3IFPB 2DQCH 2ADJB 3MXWH 3MV9B 4FXLA 3LEXB 1IGML 1HINH 3MUGB 4UIKL 2G5BA 5D7LD 1XGRB 4FQ1L 4HGMA 1KEML 1L4IA 2FIRT 4LSTH 4DGIL 1BF2A 3LKQA 1JUFB 3BWAB 5E2VL 3C9NA 1DBAL 1DQMH 5IF0B 4NHCH 3HNVL 2Q7NA 4DKEL 3O11B 4GXUM 1BFOA 1F4YL 4M02A 2ATKA 5F7YC 4DW2H 5H35B 1OP9A 5FUOH 5IJVA 4P5TA 1CD9B 2QR0A 2AJXH 2NX5B 4UV7L 1YNTA 3DX7B 2R4RH 5F7FA 1OAYH 1EJOH 5KVEH 2O5XL 2HLFD 5JOFB 1MRDH 4X7CC 3U9UB 1IC1A 5CINH 2ZWLT 1IGYA 1NCDH 5ITBL 1MCJA 2W0FA 4CADB 4NZUH 1FBIH 1A1OA 3S96A 2BNRD 2J8HA 1XGYH 3GO1L 4P9MH 1U8KA 4Y16C 3SBWA 1Y0LB 4XPAH 1X9QA 1R5IA 1MLBB 1I85C 1K8DA 1RUML 3U4BL 3D0LA 1TLKA 4HZLB 3WXWL 4AEHH 5KN5A 2VXUL 1F45A 1AFVH 1RD6A 5CLWA 4RIRB 1FDLL 3P4OA 4HS8L 4OIAA 4WTZG 5CGTA 3EO9L 3UDWA 4KROB 3U6RB 3T09A 2YMXL 3MJ9H 5FUZL 3BIKB 3L6FB 5IBTL 1MCPL 4AENA 5IEKA 3QUMA 1AJ7H 4PJCE 5E94A 5E5MB 1RIVL 4NZDA 3MRNA 4LKXA 1MI5A 2CSPA 1QFPA 3PQYB 3WJJA 1SY6L 2IALB 3HE7B 1OARH 3W5MA 3WFDL 3L3DA 4PG9B 2AXFB 1P4LA 2FYYA 5I1JL 3IKCB 2JCCE 2YD5A 5B39A 1W72B 2V2TA 4NRXA 1RIHH 5IEHB 4OT1L 4YXHH 2I07B 3MNWB 2EXYC 4H0IA 4Z76B 1MWAL 5TE7L 3EOAB 1MHEB 4PRPD 1IGTB 2FSEB 5HDQL 4Y0GA 2Z35A 4GBXA 1QSEB 4NKIH 3D69A 4ZQKB 4XMLL 4EUPB 1FAIL 4JFHE 1C16B 4WI4A 2NW2B 3KPRB 4R26H 4G6FB 5GGTA 1PEWA 2R1XB 4HIEB 1FGVL 4HPYL 2DLFH 3I2CL 4ZAKC 4NT6A 2XIDA 4G9FE 2A1WH 3S37H 3WD5H 1FL3B 3O9WC 2YHGA 3ZZ1A 1L9NA 1UYWL 1D6EA 2CXKA 5EZLA 4FQJH 5C0GB 1DLHA 1BREA 3I3EA 2VXVH 4FQIL 5D2NA 1QSFB 1NUDA 3MV7A 5CD3A 3WBDA 1AGDB 4ODXB 5D7KD 1YA5A 3FCTA 3BRDA 5MEPB 3BEWA 4HIXL 1YNKL 1ZLWK 3MRLA 1FVEA 3MJ6A 4S2SB 4U6VH 4KZDH 5CWSA 2FATH 5DGRA 4QRQB 3UTSD 4K3DL 3F62A 4KAQL 3SDXB 1T22B 1RVFH 5GGVH 1IL1B 3P4NA 1Z3GL 2ADFH 4MD4A 3PHSA 5E2WL 3MNZB 1RZ8B 4YIQA 1EO5A 3Q3GA 3DX8B 3U7YL 3VWJC 1QFWM 4X7TB 2XY1A 4OV5A 1VENA 4Y1AA 4PJ7A 1EMTL 1XGPA 5FKAB 3BYYA 1PZUB 3QEQE 3SKMB 4JZNB 4Y2OA 5FUZH 3ROOA 1IC7H 4NQXB 4F58L 3VFSB 1BM3H 3O8XC 4HT1H 2I26N 3TN0B 4LGRB 4NCC1 3U30B 5BRZA 1XGQB 1RHHA 5HGGS 4NQDD 4WNQB 3T3PF 1BX2A 3ULSB 1EHXA 1IE5A 4R96B 3VMPA 4HD9A 4M6MH 2CJUH 2MKLC 3O6ML 4PD4K 1UEYA 4OLUH 7FABL 3P30L 1AD0A 1KTRL 1UFUA 5L6YL 4HX1A 1JPST 3DV4B 3X14A 1HHGB 4MJIB 4F3FB 3MROA 4FTVE 1BIIA 3X3GH 5ID0B 2G5RA 1SEQH 5INDA 4JHAH 2AJUL 3V6ZA 1OGAB 2EDQA 2LU4A 4JHZA 4PG2C 2QSVA 1H3XA 5J12C 5IG7A 1EVUA 3U1SL 5HSFA 5T1MA 3UJJL 4V1DE 4YBLC 1NFDE 2ZUQC 4RMTA 1JHKH 3ARDC 4M4RA 2VH5L 3GB7A 2F54A 4AIOA 3D0VA 4EIZC 3QCUH 1EFXD 5K9OB 3MFFB 5C07A 4R7NA 4I77H 3DX9B 3C6SA 4JY6B 1G7HA 4HH8A 3ARPA 4U7SA 1EFXA 1JGDA 3GIZL 5CFHA 1NLDH 3DXAD 4KTDL 2F54D 2AV1A 2IFGA 4C83B 4XCYB 1N6QL 1CFTA 4MQTB 5C0BB 2YPVL 3MLXL 1EHNA 1ZSDA 1N6UA 1K6QH 4OGXH 2GSIA 3AUVA 1YNKH 3QDJE 4HIXH 2DLTA 3ZT6A 5FECB 5TE6L 5I16B 2YMXH 2VISA 3MJ9L 4N90D 4R2GC 4UTBH 3RL1B 4GXUN 3BQUC 1RU9H 1A7QH 3CMOH 1ED3B 5C6PB 2A9NL 3LS4H 1QO3B 2AS5M 4FP8H 4W81A 5MI0B 3S35H 1PLGH 1DUZB 2OJEB 3W2DH 3QBTB 5IMLA 4WW2A 1MFAL 2DQCL 2WBJA 5F9JB 2XYCA 4I2XB 1U8OA 4XXDA 3T3ME 3MJGX 3NH7H 3JZ7A 4PGCA 2P48B 1IFHH 1IZJA 1IEAB 4I2XE 5IMKB 5F89A 5I1AB 1HYSC 2MQCA 1W0VB 4POZC 1H3GA 2B4CL 5AEAA 1QFWI 3LEYH 2VDPL 1KN4L 2FDBP 4G6MH 1F6FB 5C6TH 4XPFL 1H9VA 1NPUA 4JRYA 1BFOB 4P4KB 1NGXB 2AK4D 3FOLB 5GJTL 2VQUA 5A16A 2ORBL 5KG9B 2DBLL 2YA0A 3LEVL 5DD6B 3RX5A 4QYOB 1INEH 4KGJA 5EDXA 1JPSL 3TWCH 3NTCH 5DMIH 3BPLC 5KZCB 3HRPA 3ZKXB 3OB8A 3B5GA 4PR5B 1GXEA 4IMLA 4LPYA 4AM0B 2BCKA 4LRIA 4LSDA 5I30L 3ECBA 1KPUB 4E9LA 5CMAA 3BMVA 1VGEL 4WUKL 3JV0A 1BZ7A 4BFEA 3SE4C 1Z6JT 2IH3B 3TZVA 5GSRB 4OCSL 3VRIB 3RQ3A 5FHBL 3EOBA 1A22B 4NZJA 4NM8H 3VG0L 3GKWH 4TNVF 4P99A 2HKHH 3BPCA 4M1GH 5C0RL 2HWZL 5J1AA 5JW4Q 4KKAD 4X80L 1UA6H 4Z7OF 1SYVB 1U95A 1M1SA 4M00A 2D0HA 2Y07L 3B43A 5C86A 1A7NL 3U6RA 1S9WB 3SQBA 3L6FA 4OSUH 5GIRB 4GO6B 4P46D 4O5LL 1CICC 2E8ZA 4M7KL 5I1EH 12E8H 4NNXB 4KROD 5EBWB 5IHBA 4FTVA 4LHUB 1T89A 2J5LC 2VDML 2ZUWA 4OZHA 2ZNWA 4NQVB 2DQUL 5EC1B 2O26U 1XH3A 5DQ9A 2DQHH 1DVFD 1FVDB 4EI5B 1U3YA 1WT5C 2PYEB 4DCQB 5D7KE 3VDBA 3AS1A 5KS9A 4OM0L 3G6DL 4NIKB 1RUPH 5EU3B 1CLCA 1RZJC 4HIHB 3O6FB 3GMOA 3RI5F 2R56H 3F12A 3UO1L 1JPTL 3SDAA 4UQ2B 4ERSL 3MXVH 1HXYB 1ZHLB 2BFVH 2C9AA 4HKZA 4G43A 4IHOA 1FFQA 3N85H 2W65B 5FM5O 3ARWA 4C57C 3UTPE 5D1QC 1UCBH 3WDJA 4LVNC 3RVWD 3T2NL 3BPOB 5J12B 2DQEL 4WWID 4QRRB 1A9EA 1FPTL 1X5IA 1DBBH 3H3PL 4M62H 3A6OA 5ITFB 3BUYA 3GSNH 4YNYA 1FLRH 5J9PB 2BOCA 2NY3B 5DZOA 4JFQB 3P73B 1HIMH 1BJ8A 2YBRA 5DHYA 1DLHB 1QNZL 3NABH 3C6LB 4GOSA 2Z92B 4LCYB 1NCTA 2DDQH 1VERA 2JJUA 4OFDA 2NXZB 2FLBT 2FX7H 2ICWI 4OGXL 1TZHA 2LVEA 5SWZE 2PW1A 4AG4H 4DZBA 3E0GA 5E8NB 1HEZA 1RUAH 2V5MA 2KBGA 3STLB 2QLVB 3MODH 5I76B 1DL7L 5D7LB 1EUUA 4HXBL 4S2SA 2D7NA 1VACB 2ZOKB 3TCLA 5JHLL 2CO7B 2YUZA 1Z0NA 2J6EA 3AY4A 5EUOF 2B20A 3HA0A 5HYJD 3FO2A 3MRHB 5FF6B 3SDXA 4HWBA 4BFBD 3MV11 1EO8H 5LG1A 5E8EA 1MWAB 3TF7C 1MFDL 5FGCE 5DWUL 4GW1A 1O5DT 2APFA 3P40A 3O2DH 3RIFF 4JDZB 2OSLA 3D6GA 5ERWB 5EU5B 1JWSB 1QSEE 3SGDI 1NFKA 4Y1AB 3BZ4B 4P4RB 3E6HA 2Y07H 3U9PH 3INUL 3QJFA 4XNYH 1NAML 4LEXH 3S5LG 1YEEL 4P48A 1RZKC 3VRJB 4AH2B 3G5YA 3D1MC 4LSRL 4LP4A 4XVJH 1RURL 3DYOA 1WUNT 1S7VB 1Z0MA 1FGVH 5HYQA 3LS4L 4L8DA 3BSZH 4QY8B 3ULSA 4R96A 1MFBL 1ACYL 4P9HH 3VFWB 2F8VA 2CJUL 3O6MH 4XT1C 4I5BB 5FOBB 2YXMA 1VFBA 1INDH 1Q9LB 4QEGA 4YWGL 3QG6B 1N7MH 1DVFB 3RZCB 3X14B 4I3SL 4P2QA 2EEDA 5J89A 4KUCD 2DMCA 5TE4L 3VWJD 2DTMH 2YA2A 1G0XA 2P1YA 4PP1D 4PJCA 5IG7B 5TF1H 5T1MB 1BWWA 3K0WA 1MCHA 2Q8AH 2VXSH 2WNGA 4Z7NE 5CP7B 1AO7A 4O51B 5SWQB 1DQDL 4PRID 3WV0A 2F5BH 1JK8B 1JP5A 5I8KL 1YUHB 4U1GC 1JHLL 3DROB 3MR9B 2OXHA 2ZUYA 4GRWH 4XVJL 2VIRA 1MRFH 4KQ3H 3KWWB 4LAQL 1EFXB 4U1NA 1UGNA 2H32B 4PY7B 5T3ZH 1DVFC 1IC4H 1MREH 4IRJA 3R0MA 5KSAB 4XHJD 1LO0L 5GRXG 3MFGB 5F7HA 4GAJL 5EZJA 2AW2A 4WI2A 2Q20A 3NIGF 2DLGA 1O0VA 5EZIH 1NFIB 1TITA 3T0EB 2GTZB 2X1PA 1LE9B 2BDNL 3OGOE 3IFPA 4ZNEA 5EO0A 1DUZA 5T5NG 5F93C 1IMHC 2AJVL 3FO9A 1IAIM 3KHOA 3CMOL 3ZE2F 3ALPA 5LGJA 3GI8H 2X4RA 4YDVB 5LCVH 3VXMB 4GAGH 4NBYB 4Y5YA 2FL5B 3TO4A 4U1IB 3MACL 4QHLA 4YHKL 4YQXL 5BJTA 4XPGL 4U1KB 1JUFA 3OHXA 5LGHL 1DBML 5IMKA 5ALCL 4NJ9L 5I1AA 1CU4L 1F6LL 3IDGA 3VD4A 3P4MA 5GRYA 1NGQH 5JDSB 2CXGA 1PQZB 1S7XA 2RB8A 2HVKB 5CIPH 4KROC 1HH6B 4PRNA 2FX8L 3F7YA 5M94B 3AS0A 5FGSA 3QIBD 3FB8B 4NC0B 4DGIH 3AS3A 5GGSA 3V5HA 5I15H 1IQDB 4P2OB 5CZKA 2ZKHH 2AKRA 1JRHI 3ZKQD 4J1UB 1U3HD 2VLRA 2J7LA 1YC7A 1NMAL 3N06B 5MHSE 3CFDB 4MXQD 5E8OB 1KCSH 4MNQB 1FIEA 1J10A 2FHBA 3O2WH 4H1LH 4KQ4L 3VXPA 2OI9B 4UTAL 2R29L 5D6DA 4HG4J 4DTGH 2BCKB 4X5WA 2NXZC 4EBQL 1H3VA 2BJMH 5CMAB 3J8F7 4OFPA 2F58L 2IG2H 3IDIB 1ZKAA 3ZDYE 5DWUH 3P4OB 4NZRH 4Z7VA 3VRIA 4MD5A 1Q94B 3I9GH 4MCZB 4XPTH 1MCDA 4NUGH 1HK6A 2P49B 4Z8FL 5ACZB 4RAUB 5I1HL 3HI5L 2VXUH 1KIRA 2G60H 2Z31B 4YBLB 3WHXB 4AENB 4JQXC 1I9IH 3QUMB 3KLHD 1IGCH 1QRNB 4PGEB 1P4BL 2RCSL 2G2RB 4LQFH 1NAMH 4QHNA 5CBEA 2LU3A 4LIQH 3UPAA 4LCWA 2D7MA 2MSPA 1NCCL 4AT6B 4KI5F 3EDFA 1QHOA 4ODSH 4P2OC 1XH3B 4DKEH 3C87A 1T7WA 1FVDA 1MCWW 1NUNB 4EI5A 3BP6A 1FV1A 1RPQA 4M8VA 4NQCA 4ZUUA 1RSFA 3U2SA 5KS9B 2I07A 4OUUA 3KXFA 5FYLD 3O6FC 3MV8A 4OCYL 3GMOB 1OF2A 2FSEA 4G5ZL 2AI0H 3F12B 4UINL 3I6KA 3OJVC 3S9DB 2NXZD 4M7ZB 5LCVL 4HW6A 3JWDL 5FAAA 4JB9L 3QPQC 3QQ3A 2Y72A 1B0GA 3ZDYF 4G43B 2NW2A 4IHOB 2X4TB 1SBSL 2R1XA 1OD7A 1XF5B 1CD8A 2OTPA 1JPTH 3VXRE 1KIQB 1HYSD 5I1GH 3ARQA 2WZPD 1DTUA 3P11H 1QBAA 2LABA 3WUWA 4QXUH 4LPUA 4U2YA 2V9RA 5C0AE 1LK2B 1HQ4B 3GSNL 1QSFA 1AC6A 5SWSE 3RWCA 4MA1C 5DI8A 4P3DA 5MEPA 2EDDA 3WEXB 2KUTA 3C6LC 3I84A 3C6LA 3LZFL 3S34H 1J0HA 1YJDH 2HRLA 3NCYP 3WKMH 3SKNA 4P4KC 4LLYB 3RGVA 4LCWD 3P0YL 4EZMA 2ZOKA 4JLRA 4UB0L 1M7DB 4GG6A 3DVFA 1S9YA 4Z7WA 2VLKD 4QXGL 1RZ8A 4YIQB 3I3BA 3PGFH 4U1SB 3ARFD 3E6FB 3UAJC 3MODL 4X7EC 4K07A 5EO9A 3HMXH 1MJUL 2B2XH 1L6XA 4PJ7B 2JIXB 1KENL 4JDZA 1ERNA 1XGPB 3DECA 1WCQA 1M05B 1KGCD 1VPOL 2VLKB 2HMIC 3MGTA 3KPRE 2ZCLH 3H9SD 4QGTA 3EJZD 4UT9H 1TVHB 4FXGB 4P4RA 4Y5XB 3L1OL 2R0KL 2GCYA 5KS9E 5HD8C 3GRWA 3C09C 5ESAA 1LILA 4Y19D 4JPKH 1I3UA 3DGCR 3FO0H 3VRJA 4AH2A 3P9MA 2ICES 4X7FC 1S7VA 2YUVA 3IJYA 2DWDB 5BZWB 4MA7L 3GHBH 5A1AA 1C08B 1CN4A 3EZJB 1QPXA 3H0TA 4XNYL 5DK2A 1ZMYA 3DV4A 4XVUC 4YC2C 3RA7L 5ALBH 3MROB 2VR5A 1AC0A 4EEEA 3LKPA 4JFEE 5T1KD 2A0LC 4PREB 1MAKA 3QG6A 3VWKD 1KGCE 1WIUA 4L8CA 3RZCA 1KCRH 5HDOA 4EI5C 3OAZH 3X3GL 4ETQB 1A6UH 2CD0A 5C07B 2Y6SD 3VXOA 3KG5A 1DBMH 1L9MA 3A6CL 5F7KC 1A7RH 3I9GL 5D1QD 2BNQA 4ZTOH 1UM5H 3U36A 4R3SB 1GAFH 1ZHKA 5KVGH 3OKEA 4C83A 3SO3B 5C0EB 4QOKB 1F4WH 5FYKH 3SPVB 4HWNA 2E9JA 1LEKB 5HGAA 1R3KB 1NFDF 3JTSA 3KWWA 3EYQD 3QIUC 1E4KC 2BNRA 2QTEA 2VTFA 1OP5H 2AXHA 2B5IB 3BP5B 1ED3A 5E08H 3LD8C 5IHLB 2M8XA 1FL6B 1I4FB 5ICZA 2IPTH 4BQCA 1F11B 3VFTB 1TVBA 1T1XA 1NMBH 3NCBB 2GTZA 1A7OL 3QPQD 4GRLC 5IWLC 4JO4L 2FCBA 5IMLB 3ARDD 2P8LB 1JZ8A 2D7TH 1F97A 3VXUE 3BD5A 3C8KB 4UT7H 2V5SA 2YZ1A 4W4OA 2OMNA 5DZLA 5T3XH 3BD4A 1IEAA 3IETA 4DW2L 3VXMA 3NGBC 3QUYC 1X5LA 2FRGP 2IFFH 2R1YA 2AJUH 5E00B 2YXFA 3OHXB 3B9KA 5I1GL 1ETZA 1UQSA 3GI8L 4R90H 4JDVA 1G7PA 1D5ZB 2GY7B 3NACL 2Q3ZA 2CPCA 5I75B 1WZ1L 1NGXA 2P47B 5SX4H 3EDJA 5D9SB 2VDPH 3L95A 3IDMB 1P7QB 3IYLW 3GSVA 1OW0C 5CEYA 2XXMB 1GGIH 1AIFA 1XGTB 3SE4A 3EW3B 1JBJA 3HC0A 2X05A 3ZT7A 3NGBB 2AKRB 3GSOB 4AEIL 1SEBA 2ZJSH 4TYUA 5GGRY 3D18B 3EBAA 5FO9B 1VADA 1M71A 3QCVH 5KSUB 4KPHL 2EYSA 3QZWB 4WY7H 1XEDA 1FZJB 2Q1EA 4Q9RL 3TZVB 4FQ2L 1JNJA 3DVNB 5HHXL 3MBEA 3TH3T 2C4XA 1BZ9A 1HXMB 1NANH 3E1F1 1DBJL 5TDPB 2YD2A 3ZMRA 2ZCKH 1QLEH 1RJZB 2B39A 2HJFA 1VFOA 4OIBA 2VRAA 1SYVA 1CQYA 4XCEA 3UYRH 5I30H 5IB1B 4NRZB 5D71L 1TJGL 2H9GA 4G9DA 4CKVX 2Y7QB 1IGIH 1R5WA 3RWGB 2IG2L 3WHXA 4KDVA 3UJIH 5DJXB 3RTQA 4I77L 4LVNB 3KJ6H 4I18A 4Y4KC 3VFUB 3MACH 3QUML 5I19H 5IW6B 4WU7B 4OZHB 4PJAA 4DGYH 1RZ7L 4LCWB 5DQ9B 4YFDB 3QHFL 1HI6A 4KVCH 1YEJL 2WLZA 5CJ5A 3VFNA 4G3YH 3NA9H 2P5WB 1B90A 2OP4H 4XVTH 1NCWL 4QT5B 4WW2C 2H6PA 4GQ9L 2GT9B 1DN0B 1U8LA 2BXZA 2W60A 3JTTB 3OKDA 4F7TB 1V3JA 2CK2A 1EGJL 2Y6SC 5KOVC 1FV1B 1RZKL 3LCYA 3SDAB 2VZVA 4KKNA 4X6EB 5L2KD 2X41A 2CUHA 2V9QA 1U2HA 3VRLE 5C0DB 4Y1AE 4O00A 1EFQA 2RAMA 3J7HA 3K7UA 1UCTA 4U1JA 3MC0A 2O5YH 3CVHA 3GHEH 5T1KB 2PYFA 1KV3A 5DUMH 5LQBL 4CVZA 1QBLL 5GS0D 2EDTA 1NKRA 3CGTA 2WQRA 2BJML 1ZLSH 4QGYA 2CLVA 3ZHKA 3R4DA 5C08B 4YZFE 3TBVA 3WL9B 2AJVH 3GBNL 3CXDL 3MRDB 5HGDB 3KPLB 3I75B 5JHDD 5C0IA 5HYSB 3Q5YA 1GGUA 5E6ID 5EB9A 3H9SB 1WQVT 3HR5B 3CH1B 4K9EH 2XG4A 4KJQD 5JHDA 4LLVB 4KTDH 4MXQC 4XH2B 4PJBB 5ALCH 3FFDA 3W39A 1KEGH 3LHPL 5HDQH 4XPGH 1YEHL 4WWKD 2IGFL 1MWAA 4ODSL 3O3AA 4KK9D 1LO4H 5EWIL 1IAOA 5BOPA 4DJMA 5CSBA 2CDGB 4TVPL 4DUXA 4U1SA 1AHWA 1HDMA 4XRCB 3EAKA 4O58H 3JV4A 3HC4L 1V05A 1M4KA 4LCUB 1NGPH 4F7CA 5F72S 2ZCHH 3VD7A 4AEFA 1MRFL 1PLGL 4W6WB 3VH8A 2VLKA 3MLPA 5IT2H 1FORH 2IEPA 2VE6B 7FABH 3EYQC 1XFPA 1KELH 5CGMA 1GL4B 4AL8L 3G5YB 1YEJH 3B6SB 2VLRD 1F3DH 1PX3A 1E6OL 3N0PB 5DJ0A 2E5EA 1B4RA 1A64A 3P9MB 2LVCA 1G9MH 2NY6D 2Y1VA 2ZZUT 2R23B 5EN2B 2NR6C 4I5BA 5FOBA 1T21B 5DC4B 1YN7A 5DK2B 2UWEF 3PWPB 4P2QB 5EOQL 4KKLC 1HCVA 1LD9A 1H3PL 4MNHB 3QQ9D 1CDJA 2EEBA 3SDDD 4L8CB 3NAAL 5AZ2H 5H8DA 2EDFA 4CNIB 5SWQA 1AKJD 4N0YH 4KJWD 1OP3K 2X44D 1UB5B 1KPRB 4X7DC 3CVHL 4HJ0C 1RZIB 5JQ6L 3MR9A 3CFCH 3M17B 5J6HA 4PJHB 4XCCH 4U1NB 3BP4A 3U36B 4PY7A 3O2VL 1U8PB 1CDUA 4DGVH 4HIIB 4S1RL 5EFIB 2X1XR 5EU6E 3IDUA 2MHAB 4TTGA 4OTXH 1T4KA 3U4BH 4RGMB 2AJYL 4M5YL 2CRYA 4HAFA 2VDOL 5D1XB 4KI5D 5CJOH 2A0LD 4XNZC 3QUXB 1LE9A 3SJVA 1Z5LA 3INUH 2W07A 1LP9A 4FTVD 1YN6B 4KXZH 5HTSA 3JWDH 3VFTA 5IBUG 1JF5A 2M2DA 1BLNB 4Q9RH 4PP1C 1A5FH 5IV2A 4RBPK 5LGJB 3HC4H 2GK0B 1J1OL 2XI9A 2F19L 4YDVA 1KNOA 3BI9X 3LEYL 3QRGH 3UJTL 2GITB 2GJZA 4EN3C 5FCUH 4XCCL 4L8BA 4C58B 4NQDE 2XZZA 4ZFOA 3WLBA 1IKNA 3L9RA 5BMFL 2Q3AA 3IETB 2IQ9L 5JQHC 3VGGA 1PSKL 3IFOB 3MYZA 1FC1A 5E99H 3U7WL 2PXYA 2FJGA 1DEEA 5F8RC 1B2WH 4UV4L 2Z8WC 3B9KB 1JYNA 5DO2C 4ODWA 1UQSB 5E6IC 4PLOB 5K33A 3LPGA 5H2BB 1D5ZA 4YDLB 4QF1A 3F7YB 3CLEL 4MQXC 3V0WL 3ES6A 4WEBL 3HAEG 3QHFH 2QQLL 2YR3A 1NGWB 3IDMA 1E28B 1EJ6A 1X5XA 1NC4D 3RJQB 3JWNC 1ZLVK 5I17B 3MRIB 5EUKA 4X9HA 4GH7B 4EI6B 3C09B 2EECA 1SEBB 3GMNA 4R4BB 2EDLA 3D18A 5GS0L 4NM4H 2ZCLL 2J4WH 3L7FB 3TJHD 5KSUA 2A74B 3V8OA 3ZDZE 1YPZE 4O2EB 3VXMD 1XIWB 4XPBH 1HKLH 4F7EB 4HWEL 3N9GH 1QRNE 2E27H 4ZYKA 4UT9L 1H5BC 3HNTL 3KR3L 5F7DB 3MBEB 3IS1X 5EU4A 4XB8A 5ACZA 4UT6L 1KIRB 3SKJH 4AZ8A 1RJZA 3GHBL 3DRQA 5T1LD 5DVKA 3VGHA 3MRMA 2JE8A 5DJYB 4ONFH 3CX5K 4GRLB 3GEWB 2ICEB 2DN7A 2VLJD 5HHNB 4NRZA 1OGAE 4N8CL 2B4CH 1PG7L 2VMFA 3ZKSD 4S1SH 1OHQA 4QHNB 5CBEB 2P8PB 1DQDH 3KNBB 6CGTA 3SDCA 4W70A 1NEZB 3RKDD 4FQLH 4M5ZL 1RIUL 4IIQA 3QDMA 4OZFH 3TA3D 4HQQL 1CICB 5DLML 4QHMB 5J57B 5DR5H 5DJDB 3JWOL 4NQCB 4ZUUB 3T1WA 2FB4L 5D5MA 3CPLB 3C5ZD 5I71B 4X6DF 4WO4C 4GSDH 4RNRB 3KYKL 1XR8B 1MJ8L 3G6JE 4F7TA 2A6IA 2DB8A 3PV7A 4FQXA 3AU1A 4GW4B 1HNGA 1LWRA 3QEQB 3L3JB 2BP3A 5EOCL 2ICWJ 4PJ8D 4ONGL 2X40A 1NLBH 4JANB 1Q1JH 1IM3B 5GGUA 1YEIH 1IJ9A 4U1JB 4ELMF 3ARRA 2CDEB 3HHRB 4JFHD 4APQB 4PLNC 1HSAB 3MGOB 1CBVH 4RFOH 1ND0A 1HOCA 5KSBE 2DL2A 1QHPA 5GGTL 5C1MB 5GRVK 3NZ8A 3V5KA 4D9LH 4E5XA 4OD3L 4PJAF 1U41A 3K8MA 4FFVD 5BVJA 4P3DB 2XZCH 3REVB 1GGYA 2RR3A 4DGVL 1WT5A 4K3JL 3WS6C 2E8YA 4A6YL 2F5BL 1MH5B 4BYHA 3IAPA 5EU6B 5IESL 4QXUL 4QOKD 3RGVB 2ICWB 2YUXA 4U1MB 4NPYB 3MRBB 3FT2A 5TDOB 2FX9L 5HGBA 5JHDB 4JLRB 4JPIB 3C5ZC 3GMPB 3NAAH 5AZ2L 3W11C 3HCVB 3LIZL 2DQFB 1J1PH 3B3IB 4OZFG 5E6YA 1FO0L 3TYFB 4XZUB 3B5TA 3VU2A 3QEUA 3QA3B 4ODUB 1QA9A 5IBTH 2R69H 5ICXA 4L5FL 3UTTD 2EDWA 4ZPVA 5BS0E 2CDGA 1AHWB 2ERJC 4XRCA 1M05A 5DEGA 4LHUG 3JV5A 1OGTA 4KDWA 4B53A 3HG1A 4MAUL 4RAVA 3SDAC 5ISZD 1DDHB 3TIEB 1CFBA 2VDQH 4MB3A 2R8SH 2YD8A 4P5KB 1T20B 2X4QB 3C6LD 4ZAKA 4HKBB 4XNQA 3MX0A 5D70H 1XF3A 5F9DC 3VXSD 1OAKL 2PF6A 2HN7A 3WS6A 3ULVF 32C2B 4JPKL 4X83A 3IAGC 2X4SB 3ULVE 5IROA 5I0ZA 3PJSB 3V6OC 4CJ1A 4NNYB 3ULUL 3CNKA 3ARBC 2OMBA 1O7VA 3V4PL 3D85A 5I73C 4PREA 3THML 4PRHA 3PP3K 5JO5A 5MENA 1MLCB 1DFBH 2Q6WA 3BGMB 1JGLH 3K1KC 2DQHL 4N9GB 4PB9H 4D3CH 3MOQA 4EN3D 5D8JL 3X13A 3LQMA 3HI6L 3O6KL 4CW1B 1CDHA 2FEEL 3C60B 1SJVA 4FABH 3QO0B 4HS8H 5IQ9A 3RHWK 1AD9A 5BO1H 3LQZA 1YEKL 4JM2C 4Y4FC 5FYLE 3MRPA 2HT2D 4BH8A 2HT4D 2R0ZH 1RV6X 1LHZA 3BP4B 1PBYA 1T0MA 4KFZC 5JNYA 1U8PA 1CLZH 5C0CA 4N0UA 5EFIA 4JHAL 2FGWL 1MOEA 1RZFH 5I2IB 1YMMD 3W82A 2MHAA 2AVGA 2QV2A 1WC7A 4H88L 2YKLL 4Y4FA 2K7QA 2Y23A 5JHDE 3DGGB 1XCTA 1I4FA 2HJLA 3QIBB 4LARL 2P8MB 4EN3A 5D1XA 5F9WC 4RZCB 4TSAH 2NNAB 3GHEL 2P46B 1SM3H 5KS9F 4Z78A 4CMMA 2I5YL 4NZTL 1PJ9A 2VLJE 1S3KL 4TSBL 4J8RB 3DRTA 2FD6H 5FUOL 5HDLA 1EEYB 4LPXA 1YQ2A 3DMMD 4F57L 3PWJB 1P5UA 3CSPA 5IV2B 4ZXBA 4KK9C 2C3VA 1KNOB 3BW9A 3BESR 4QRRE 1ZHNA 3L3IB 3TIDA 3OG4B 2IADB 3D3VA 4UOJA 3TV3L 5HYJB 2IAMB 5HYIA 3NIFF 1QLRB 5TF0A 1K8IB 4R26L 2Z91B 2FNBA 3MOBL 1FE8H 3OKLB 3SQOH 1ETZB 5CP3A 4Y2DA 1BVKA 4JM2D 3CFJB 3CVIL 4XCFL 1OVZA 4HWZA 3TA3B 5T1DL 3JXAA 1TJGH 1K2DA 4RGOL 3T04D 3QUMH 5I19L 4CRPA 3PP3H 2XN9E 4YDLC 4XP6H 3IRPX 5ADOH 1AFVL 1KEGL 3ES6B 1OGAD 1QLFB 4RFOL 5C0ND 1I1YA 3FFCA 1F00I 1CTOA 2FH8A 5DA4A 3UEZA 5EIIA 4NKQB 4P46A 1K5NA 5DQJA 5GRZA 3ARSA 2VWEE 3EO0B 4RA0C 5HGHA 4GRLD 4P59H 1YEEH 1QSFD 3DSNA 3B2VH 4IOSD 3MRIA 3P11L 2C5DC 2EYSB 4M6NL 4BSVA 3V79C 1I1FA 1I7RB 3ARGD 4XXCA 4BZ1H 3O9WB 4LRNH 2VDLH 3A67H 4QNPF 2BMKB 4DVBB 5C2BL 1IT9L 4M43H 4UOW0 1A6ZB 4N8VA 1MUJB 2XQYG 4GG6F 4YAQA 2HJFB 4ZYKB 1CLYL 2NTFB 2GKIA 3SDDA 5IB1A 1AGCB 4JFFE 2BHYA 1T7XA 3DRQB 2EZ0D 3QFJD 3MRMB 2FZ3B 2R69L 4Y16B 1GZQB 3SKUD 4NP4L 3IDXL 4GRLA 4I18B 5HHNA 4PJDB 4GT7A 5ILTH 1FO0A 3VFUA 1CR9H 3WNOA 3RWDA 1KJVB 3WNNA 5JPMB 1WK0A 3DUSB 3QI9C 4ONFL 5ABDE 5E99L 3U7WH 1GOGA 3O4LA 4HC1L 1MCEA 1MFEL 4GXVL 3VG9B 3JTTA 4WRLA 3SDYL 2AXGB 5GS2D 4WEUD 1HZHH 2DF3A 5DJDA 1FNLA 2VN4A 5D72L 1CD1A 4X6EA 3MLRL 4PJXB 3WE6B 4WHDA 1ZWIA 3P0VH 5C0DA 2ITCB 1ES0A 3D3VE 3R1GH 1D9KA 4OCLC 1NSNL 2N7AA 3U4EA 2DQGH 5BZDA 4LVEA 2ARWA 3NPZB 4IOIA 1YEFH 2HT4C 3MLUH 1B6UA 1BFVH 4JGUA 3ARED 1ACYH 1UACH 3IXTA 4I0PB 3B4NA 2AGJH 1ZA3B 1NCBH 5IT2L 1LK3H 3VGDA 2VDOH 4LCCA 3LS5H 4JY5L 2H32H 2R9HC 5EBMB 4IM8A 3UPCA 4JGJA 3ROLA 2FBJL 5D2LE 3VXTB 4K2UL 1TQBC 3HFML 2ADGB 5CZVH 1JPFA 1NBVH 5BVJB 1NDMB 5HYSA 1RJYB 2GIYA 4K3EL 1SJEB 4X6CF 5GPRA 3L7EB 5FCSH 3CH1A 5DDHB 4XVUD 2V5TA 2NW3A 1I1AD 4XH2A 5HVHB 3GM8A 1PY4A 4XP1H 3MRBA 4JFYA 5C8JA 1SYSB 4PFEA 4ZG1A 1F3DJ 2VDLL 3A67L 3ETBF 2P5ED 1PEZA 2DQFA 4KVCL 1QSZA 4YGVB 4HWUA 5L0QB 3CK0L 4MVBC 5I9QC 1LK3L 3JV4B 4LCUA 1QR1A 1S7RA 2IH1A 3VWJB 3TFKD 2EH8H 4GMTH 4ODUA 4IJ3B 1CZ8L 2ENSA 4Z7OE 2OTWA 2WLYA 4W6YB 4QXTA 1JE6A 4OIIH 4MAYD 3VH8B 3SE3C 3D39A 2O5ZL 1X5GA 5C09A 1OAQH 2QKIB 2P43B 2AJSL 3OB0K 4TVPD 3WSQL 3EYOB 4V1DB 2I9TA 4M7LH 1OSZA 1Q9WB 2IMNA 1KCUL 4G7VL 5C0AD 4D9RE 3WKNA 5SWZD 1A02N 3QO1B 4HKBA 4XNQB 1RFDH 2VKWA 3GSUA 3V0VB 4BQ6A 4XCFH 1XF3B 3DETC 1QEWA 1IKNC 4K8RD 2ICCA 4BZ2H 5HVWA 1EEZA 4X9IA 5JXAL 1MWAH 3KPSA 4YHML 2AK1L 1YN7B 1KPVA 1G9EA 3FMGH 5IIEA 2BVPA 4NNYA 1AH1A 1LNUB 1WTGT 5FFLA 4J3TA 4I18C 4JHBA 2XFXB 5D7IA 3T77B 1BD2E 3RL2A 3PGFL 1AXSA 4OF0A 1P84K 5DUPL 5HHMB 4NC1E 4GLRH 2QHLA 3GBMH 1F13A 4Z5RB 1ZVSB 4OCSH 1A6TB 5A3IC 1R24A 4XBPA 2HA1A 3O3EB 1OW0A 2EDNA 3CAFA 3M17A 3VXSA 2J88H 4R0LA 5IQ9B 5J6HB 4OZGE 4PJGB 4MDIB 3QIUB 3KPNB 4M43L 1MAML 1HNFA 1HCFX 2NLJA 3MRPB 2JKXA 4F7PB 1A8JH 1B0RA 4HIJB 2VDRL 4CN4A 3OL2A 4HXAH 1T0MB 4URTB 1T4KB 3MLZL 4GS7B 2VC2H 4MYWB 2DRUA 6FABL 1N6VA 1CLZL 5DRNA 2IAMD 2IPUG 1CFVH 4LSQH 5C0FB 2PXYD 2C1PB 1V5JA 5EBLB 4LHUD 1Z9SA 2R8SL 2Z8RA 5KSBA 2BSRB 1XGYL 2GW5A 3GO1H 3MO1A 1LO3H 3E2HC 1WBXB 2EIZB 1ADQH 3ARUA 4PJXF 4ZUTA 4S11A 4RGNC 5FB8A 1U9KA 4L1DA 1MAJA 4PGDB 2V2XB 1T0PB 1CI5A 4ISVB 3VFGL 4NQSB 4JR9L 2VKXA 1UCBL 2GITA 2QQNH 3PWJA 2AERT 3VG9C 4KC3B 3RX8A 4G9FB 4X0KB 3N85L 2AABH 3C08L 3WNPA 4U1HB 1WEJL 1CVRA 2F19H 3BW9B 4PJFF 4JKPL 4TNWK 4RCAA 1RZJL 1ZHNB 3IF1B 5IJKA 5IROC 1P69B 1DE4B 1F2QA 5F88A 2XQBH 2EZ0C 2PXYB 3UCRA 3L3OA 5MEOA 2BVUA 5EZOL 2X2YA 2R0LL 1GH7A 1QVOA 1U8JA 3KJ4C 1GOHA 4P0DA 4QF1B 4U1LA 3TA3A 4I3RL 4OI7A 3OJDB 1B2WL 4NQCD 3GJFA 1GGBH 2NZ9D 1T1ZB 1QNZH 3RVUC 1R3IL 3V52L 5F3HA 4QRPE 2EC9T 1QLFA 4PJIA 3VXQB 2LE9A 2XTJE 1RMFH 3FQRA 4C59B 5D7SL 1WIOA 5DVLA 4WFED 4WWKA 5GRVL 4OSUL 5B3JF 3DHJA 3L7FA 3G08B 4PJ9A 1DANU 3UTZA 5BV7B 5CKAA 4JFFB 4ONHB 3H9YA 1XIWA 4F7EA 5JXED 4C4KO 3RVXC 1DUYB 2GJ6E 4Y5VB 4H0HB 3PXHA 3C5ZA 4YDKL 4PJDE 5DHVA 3CUPA 4KMQA 3QXDB 5I0DA 3TGXA 3V95A 3EDKA 5IB5B 5EU4B 4OZGF 3TBYB 3H7LA 1IKFH 1NMCB 3QRFM 2YD3A 3MTRA 4Z7VE 3OJMB 2H2PD 2ICEA 5JLZB 1AGCA 4NO3B 2B5IC 5HHQB 3G5XA 3HUJA 3WFZA 4P9HC 3LN4B 3ILPA 4X4MA 3KNBA 1ORQB 1AR1C 2WK2A 2FZ3A 1N5AB 5FA3B 5L8LB 2DLEA 3E3QC 3G04B 4TPRL 1AJ7L 1OSPL 3UTTB 5HPOA 1MCCA 1H8SA 5DRZB 4D9LL 1Z9OA 3QDMB 5E9DD 4MAYB 3T1FA 2WSKA 4QHMA 3DUSA 4NBXB 1D7FA 3DOSA 5IFJA 3KVQA 1GRWA 1RJLA 3EGSB 2P44B 2Y25A 5HI4D 1AI1H 4G8FB 4GLRI 4FQXB 1CXKA 4FQ2H 1CD1B 2NCMA 3MLYL 1TQCC 3CDGA 4QHKI 3RGVC 43CAA 1SJHB 2CIKA 3GMRA 1ES0B 1A6PA 4KK5D 4JANA 4KTEH 5C9JB 3BRFA 1IM3A 3TT3L 1T66D 4TUOA 4X4YA 4X4ZA 5L9DH 3WDHA 2Y9RT 4DZ8B 4JDTH 4Q0XH 2CDEA 2KL6A 4NKMA 5CJBA 4HPYH 4P23A 3BH9B 4DKAA 1KXQE 5HYJE 3WSQH 1ND0B 1HOCB 2K1MA 3K2UL 1QPPA 2W59A 5F21B 5GRUH 1RAMA 2D0FA 2NPLX 4L4TA 1JPGA 4N68A 3MRGB 3EOTL 1DN2A 2OL3B 5EBMA 2R2CA 3BE1L 4P23D 1OPGL 2IQAB 2MFNA 4K7PL 4RAHA 3REVA 4PUBL 4YXKH 2DJUA 3W0WE 2BVQA 1KC5H 3RPIA 4TVPE 2ADGA 3HZYB 3H3BC 2HG5B 1J87A 1JPFB 2Z93A 1XF4A 3HE7C 4QRTB 3KAAA 1J05B 1I3RA 3VXNB 2JCCF 4JJHA 3TT1L 4I48B 3PDDA 3PL6A 3IDJB 1OM3H 3DXAE 5TDOA 2OTUB 3UP1A 5HGBB 4MMZC 2UV3A 3U0TB 2VB5A 4PLJC 3B3IA 3BN9C 5FYJL 4BK5A 5D2LF 1JZ5A 3QXAA 1F3JB 1KJ2B 3QA3A 5LXGL 3RGVD 4KJWC 1V7NL 3JSSA 1PYWA 2J4WL 4BZYA 1Q0XH 2H8PA 1INDL 3KHQA 2ZSVB 3GSXA 3ORJA 1L0QA 4R97B 3HG1B 4RAVB 2H1PH 4QXTB 3H7BB 1CGSL 3CMGA 4WVRA 3BIAX 5EOCH 1T20A 2JELL 5JPNB 2GJJA 2X4QA 3K1DA 3KYNA 1GZPB 5ENWB 3RZWA 1PW3A 3BO8B 1KTKE 2VO5A 4Z7UE 1BFVL 3RUGE 2A1WL 1BOGA 5JMRA 2PXYC 4XNXH 1CL7H 2OK0H 4P9ML 2A83B 5AZEH 5DEFA 3V52H 3RNQB 1MFDH 5EO1B 4X99B 5E8DH 4LASL 5DT1L 1A4JB 5A2LH 1UZ8A 1EEZB 1E4XI 1OLLA 1S8DA 2F53E 3KPSB 1PZ5B 1LO0H 1X4ZA 1P9MA 2Q6WB 3RIAK 1CF8L 1JRHL 4X8JA 1LO2L 2XWTA 3TJEH 3IXAB 4P2RD 4D0BB 2XKNB 4JN1H 4PS4H 2DD8L 3FQUA 1W2KT 2G75A 5B8CC 3S4SA 1IM9B 1ZE3C 4JKPH 3U46A 5EOTA 5I18H 3C60A 1EGJA 4JFXA 3UJJH 4OZIE 1ZVSA 3HAEH 3LQZB 2L7UA 3DNKA 4A2LA 3BXNB 4XBPB 1ZGLA 4PD4J 4ORZC 1L7TL 1I7ZA 4H0GA 5BS0B 2DYPA 3G5ZA 1DQTA 1KIPB 3VA2C 4PJGA 4P3CH 4F9LA 3QIUA 5GRUL 2ED7A 1FGNL 3BH8B 4HUWB 4N0FB 4QO1A 4XPBL 1MIMH 1KLUB 2FJFB 3PDOB 5HI3D 3IDYC 2BNQD 3FL7A 1D5XB 1NDGB 1J8HE 4HIJA 5IVZA 2X1OA 1P9MC 4JO4H 4HULB 1NCUA 3QUYA 2DS4A 3RWJB 5D6CB 4EUPH 3FN3A 3W0WB 5ADOL 4JFFD 4FP8L 5C0FA 2NYYD 4HFWB 5CSZB 4Z78B 3FZUC 4CMMB 5GJSH 4NN6B 1A7QL 5SV4A 1U58B 2XZQL 3FOMB 1OQXA 3OAYH 1AI1L 5K9QI 3Q5OA 3QNXA 1UJ3A 1IAIH 2COQA 2AJZA 3L3KA 4LLQB 4R7DB 5I15L 4NQSA 1GGCL 2BZDA 1UXWB 5HVHC 3NVQA 1EO7A 1QLRA 3VWKB 1PKOA 1Q72H 3GJEB 2H2PC 4M7KH 2HT2C 5FYJD 4GUPB 1J0JA 1G7QB 4UOW1 3CU1A 1T1YA 5HPMA 1BVKB 5TPWL 5F88B 4X5XB 2IWGA 4RBPH 1FFPB 12E8L 2DM3A 4IDJH 3DVIA 4GKOA 1NAMA 3TV3H 2D3VA 1MFBH 5I8CA 3QFJA 5ESVA 3STZA 5F1OB 1Q1JL 3G6JB 5FHAL 2BHZA 3GJFB 3EO0A 5HGHB 3O9WD 3OKNB 4M7ZC 5DFWH 3CLFL 3CXHJ 4HBCH 4YX2H 1U8QB 3WO3B 1KBGH 3D9AH 4BSVB 4M48H 1LVEA 1MPAH 4DEPB 1I7RA 1CFSB 3FZUD 3WFCH 2OI9C 1TTGA 5JIPA 5FM8A 4HAGA 4PJ9B 3KPSD 4ONHA 1KCUH 4G7VH 5D7SH 3H3PH 4UZGA 1KB5H 43C9A 3WXWH 2NTFA 4H1LA 4F80A 4J4PD 2ZP0T 3UTSA 2BK8A 5IB5A 1CXLA 2WINA 3QUZA 3LKRA 2ZKHL 1TNNA 4GG8B 1NKOA 4LLDB 3WIIH 2DQIL 1II4E 2APVA 2DJSA 35C8H 4ALAL 4D9QE 1FO0B 3HRZB 2P5EB 4X80H 3IFLH 4TOYH 4H25B 2EE6A 3ILPB 4FFVC 1EAPA 5IB3A 1A3QA 2ZG1A 2J2ZA 1N5AA 2SEBB 3CLEH 3ZL4H 5D96B 3H9HA 3G04A 3HLAB 1M6OB 4KAQH 1G84A 2AEIT 3V7AE 1F58L 1JZ6A 4ODVH 5EULV 4KZDL 1TQBB 1A3RH 1FNHA 1F5WA 2CKBH 1WBYB 2DQUH 4IOFD 5KW9H 3PIQB 4PJBF 1FNGA 4CVWA 1UVQB 5AZEL 1CIDA 4JRYD 4YWGH 4NO0D 3TBSA 1JZ4A 4JRYE 3ARFA 5MERA 4G8FA 5AD0B 1K9TA 3CCHA 1UXSA 4AL8H 3CC5A 1KCRL 3BKJL 3L3GB 2YN5A 2EYRA 3OAUH 4NHUA 4PV8A 1Y18A 2J8OA 1OT2A 1ZT4B 3BHBB 1ZLUK 3VXUA 3DTXA 4DZ8A 1YYML 4EDWL 1ZA3A 2XN9D 4OM1H 3WIFB 3QHZH 4GKSB 2BVYA 3NA9L 3P0YH 4GMTL 4R4NC 1R6VA 1JGUL 3PWNB 3U9PL 3ZDXE 4NQDB 1JGVH 1MVUB 3L5XH 4JZJA 5IKCB 5FV2A 3K8KA 2W9LA 1P7KB 1YY8A 1QD0A 4D3CL 5ANMB 4K8RH 3WO4C 2BVEA 2JK5A 4MXVE 3BISA 4OCYH 3FB5B 4MQ7B 4QRRD 2BNRE 1ULVA 3D39D 3VWKC 1HWGB 5ACMA 1XR9A 5DDHA 2VLJA 3T0BA 3O3DA 5F7WC 4QRTA 5JQ6H 3ARBD 4XCNB 5I1IL 3W81A 2W9EH 2K9UA 5L88H 3IDYB 4I0CC 2EIBA 3BPNC 4MA3B 2K3TA 5ILTL 1CGUA 1IAII 3CDFA 3MBEC 5JW3H 2OTUA 3RWFA 1PFCA 4WW1B 3OB0H 4OZGB 3L3HB 4PJGE 4FMFA 4UNTA 1G7JB 2Q7YA 4K23L 2DOCA 4TUKL 5I6XB 4MNGA 4AMKL 3HZMB 3NCJH 5K9JL 1G7LA 4JFED 5MP6L 1NBQA 2X89D 4ONGH 5IK3A 5FUCC 3ZDXF 4Q9BA 1A21A 3HNSL 3R8QA 4ZUWB 2H8PB 3MXWL 4HKJA 4UUJA 4TULH 5E5RB 4NOFA 1HKLL 3D39B 3C5JA 1TPXB 3GMMA 4PJHF 4JFEA 5GGRA 1NLDL 2ZUXA 5DJ6B 2VZOA 5JW4N 3DWTA 2WQ8A 3BKCL 4DOHE 4ZFZB 3QO1A 2CKBA 2F53A 1U3JA 3LQAL 5E1AB 2J8UF 3VXUD 3KPPB 3HG1D 5IMOB 3NZHL 4KH2A 5IW1A 3QH3A 4M6AA 4ZTPH 3FHQA 3KPOB 4OLVL 1MCWM 1ZLVH 1J9CT 5HHMD 1CGSH 4NUJB 4OCRL 3TYGH 5EA0H 4PRHE 1V8HA 1VGEH 4WUKH 3TZVC 3RUGA 3BE1H 1A4JA 4FQXC 5D7IB 1S8DB 1CD0A 3RL2B 4M8QA 1C5DA 1FCCA 1N0XL 3EYFB 3UMTA 4D0BA 2OM5A 1Q72L 2BY3A 3KGRA 3VJ6A 3LQAC 5HHOD 4HXBH 3NN8A 2L7JA 3HG1E 5MHSD 3SOBH 1IQWL 2ED8A 4PB0H 4ESKA 3KPNA 3QHZL 4GAFB 2ED9A 2IPUK 3GMQA 4M3JA 4HHAA 4WENB 4DKFH 4WI3A 1I7ZB 4Z9KB 5BS0A 1KB5A 4LRIC 4I1NB 4CAGA 3JVGC 4UU9A 3BH8A 3AXLA 4RMWA 4JFPA 2IC2A 4N0FA 5DRNB 1A1MB 3MZTA 4QTHA 1E0OB 3CLFH 5J1SC 2JF1A 2VL5B 3VDCA 5SWSA 1U91B 2NXYD 1H5BA 4W6XB 3DXAB 4J6RL 1MCSA 3ZE0E 1YEHH 1MJ7L 3LMJL 1WBXA 3PWUB 4Z0BL 5BVPH 2CKBL 3ZE0F 1FL5B 1K4CA 5CSZA 4YEFA 1YEDB 3TPUA 2XTLA 4PGDA 3WXVL 1JJUA 4ISVA 5H37G 3PGDB 3ELAT 4L4TE 4XBGB 3SQOL 1E4WL 1JWMB 3RZCC 4NNPH 4WFFD 3P77B 5I1JH 4JEGB 3I02A 3MLTA 3S37X 2DICA 1J7VR 2NY0B 4G9FA 2F74B 5HVFB 3L3KB 4R7DA 4XP4H 1DJSA 4FMKA 4FQQB 4C56A 5AWNL 4N5UA 2OL3L 4OGYH 3SKOB 5IVOA 1LO3L 2HT3C 3SDXF 1DE4A 3P9WB 2OJZL 5J3HD 3MV8E 4Y4HB 4EDWH 4P57A 1CDIA 1QVOB 4LOUC 4GUPA 1G7QA 3OWEA 3PHOB 4JJ5B 1T1YB 2AK4A 4IRJC 2GI7A 4FQHB 2ATPB 1CG9A 5I6XC 4M7JH 1LEGA 4ZPTB 2VXQL 2NYYC 5D1QB 2Y5TA 1FH5H 3FQWB 1QLEL 4JM2A 4TN9A 4TUJA 4LCWE 1IAKA 5E9DE 3STZB 1D5IH 2B1AH 2CLZA 3OF6A 1IT9H 1L0YA 1FG2B 3ARGA 3EO9H 1T83A 2RGSA 3O81A 1UKQA 4X6DB 5D5ME 5KBNC 1UKTA 2QBWA 4WFGE 1S7QA 4YBQC 3LH2L 2DI9A 2PR4L 4Y4HD 4P5MA 3FT3B 1OAZH 3MOAH 3OQ3B 4GKNA 1S9XB 1FLTX 2W9EL 4JB9H 3MLYH 2GSGA 3QDGA 3FRUB 3VFOB 4U0QB 5KANI 1GAFL 2C4FT 2YOCA 2C1OA 43C9B 5DD0H 2WANA 3RVTC 4QTIH 4YDJA 3UTSB 4EQ2A 1NBZA 3GM0A 4YFLI 3QYCA 2ZOLA 2W0LA 4K7FB 3VFGH 5B8CB 1D9KC 5DD3L 2R39A 4Z0XB 1S9VB 3GGWB 1FO0H 5DRZA 5DSCA 4OCXL 1YPZA 1P1ZA 5AG8A 1QG3A 3UBXG 3OV6A 1I7UB 4OLVH 3VE0B 2A6JB 4Z77B 4HKXA 3VI3F 5H94A 2NX5E 1CE6A 4X9GA 4OIIL 3MLWL 4M93B 4MA7H 4WJ5B 3TBWA 3TO2B 4Y5VC 2XTJB 1IM9D 2VXSL 3N1PC 1MHCA 4YHYB 3HZKB 3PE9A 1B9ZA 1ONQA 1SJHA 1A6VL 3QPXL 3SCMC 4LEOA 3CCHB 5C9JA 5HYEA 1D5BA 2VAJA 2ADJA 2FO4B 4FA8A 2DYPD 5GGTH 3UTQA 4PV8B 2C4FU 3PABA 4U6HA 4AY0A 1JHTA 1VPOH 4KTEL 2X9YA 4PBXA 4QRSB 4NJAH 3BGFB 3GJFH 4R4FH 2WWKO 4PG2A 4NQDA 2OL3A 4GSDL 1X44A 4KHTL 1KB9J 3PWLB 1NGPL 1AQDB 4XAKE 3EYVB 4F8QA 3VCLA 5J1TC 1YY8B 2VERN 5ANMA 1WITA 2ATKB 2ZUSA 1LE5B 1XF4B 1KCLA 5KVDH 4OLEA 3FB5A 3GI9L 1JF1A 1I3RB 1P6FA 4POUB 1R0AH 4KK5C 4Q7DA 5DJ2A 4CBPA 1IAMA 4P46C 1B6DA 3H42H 4I3SH 5GISH 4V2BA 1CXIA 2HT3D 5CZXD 4CADA 4NRYA 3QDJB 1AO7D 2D7TL 4YR6B 4BFGA 1AO7E 1IEBA 1F42A 4NO2A 3S35L 5L2JA 1R5IB 1T0NB 1WZMA 3LV3B 4PTTA 1HE7A 3GSXB 3MREA 4OLYL 4UAOB 1GPOH 5DRXB 3RBGA 1BEYL 2YRZA 3S4SG 5KN5B 3G5VA 1H0DB 1EEUA 5KTEL 3L1OH 2NY0C 5F3BA 1BD2A 2KDGA 3KYNB 2V6HA 3NFNB 2FO1A 1V7NH 1AXTL 2CIIB 4L4VE 3T0XA 1UH3A 4HQQH 2R0WH 1EHLH 3RNQA 3KPPA 5IMOA 4LKXB 3QEQD 3FRPG 3HAEB 2X7LA 5AUMB 5LAXA 1TETH 4PLJD 5EPMB 3LN5A 2WP3T 4W68A 3S36H 1NGYA 4XC1H 2WBJC 1VKXA 1FZOB 4BKLA 3RA7H 2AP2A 2VUYA 4M3KB 2WIIA 3FQUB 2IFFL 4M8QB 3MCKA 3NBNA 3WN5B 4FNLL 3T65A 2CQVA 4XNUH 2FX7L 4JFXB 3EYFA 5TFSL 4JHWH 5T3XE 5EG6C 5ACLA 5IFAH 1IGTA 2AEQH 2X4PA 3U48A 4ORGA 3D69B 4ZQKA 1EDQA 2DYPB 4G6KH 3RIAF 4S1QH 1FIGH 2YD9A 2FBOJ 4ZXBC 4OGAC 3RWIA 1WLHA 4KKBD 1DBBL 5LXGH 3PDOA 3QRGL 1C12B 4NKOB 3UJTH 3FQNA 3FB7B 1R0AL 1UYWH 1LO5B 4RWYL 1NC2D 4WV1B 4X4XA 4MD0B 5T3ZL 1D6EB 5EZLB 2OQJA 2D0GA 3SY0A 1F4XL 5KVDL 3BPLB 4DKFL 5SWSB 1G7MB 1A2YA 2R2EA 4KY1H 4LMQI 3DI2B 4OBSA 1TPXC 1AGDA 2HJKB 5FYLH 2OP4L 4ELKA 3BEWB 1NC2B 4Y89A 2ITDB 2BRQA 3F5WA 4GRMB 3VFMA 2VLME 1R3JA 1UB6A 1UJ3B 5FOJA 2CRMA 2ZPKH 5INCA 5CILH 5L8KB 4GRWF 3GZKA 5ESQB 3GMLA 3ZKXC 3ZTJG 4U6XA 1DLFL 1WWWX 3RWEB 3P4NB 5E8DL 3TM6A 3UJIL 3F7PC 4MD4B 5D1XC 4FQQA 4C56B 2XWJB 3VXRB 1JPSH 5EUOB 3SKOA 1WIPA 1JYXA 3BOVA 4FRWA 4LNRA 3QUKA 5KVMC 3SCMB 5E4EB 5FYJU 1D9KD 4HUMB 3SN6N 1IBGL 4P5TD 2HKFL 1K3IA 4JJ5A 4U7MA 3SO3C 1L7IL 5TF1L 4JZNA 3ROOB 3QFJB 4OZHF 1HSBB 1UC6A 2RFXA 1CG9B 2HTKD 4PRIB 3K80A 4ZPTA 3OKNA 3TN0A 4M61B 5B3JE 2H26A 4NCDA 1RHHB 3MJ9A 4TUJB 1WWCA 1BX2B 2EC8A 2HLAA 4G5ZH 5C6WH 2ZUUA 1BBJB 3RZCD 4OLUL 4TULL 4XPHH 4MXVF 2X4NA 4LSPL 4Q2ZA 4X6DA 1CLYH 4J7RA 5HXMA 1E27B 4BSJA 3BEVA 3AM8A 2PTUA 4F3FA 1BQHA 5DD1H 3SE9H 3V6ZB 1AQKH 1KOAA 3HI1A 3LKOA 1MCNA 5HY9A 4JHWL 1YECH 3QDGB 4LKCA 2WINB 3BVNB 3QUZB 5DD5L 3LKRB 3D0VB 2Q8BH 4N5EC 3MFFA 4YUEL 4OKVB 1IGCL 2Q8AL 5C92A 1JNHB 3VW3H 4H25A 4JPVH 4IRZL 4Z8FH 4F7MA 4JY4B 4KK8D 5IB3B 2EDBA 4JGMA 3MLXH 3O45B 2AV1B 3IU3B 3H9HB 1TNMA 4X98B 4WUUB 4ZS6C 2Z31C 4HMEA 1BJ1J 3LZFH 4PRBB 3LHPH 1IEHA 1HHIB 2MMXA 3THMH 1P1ZB 5JZ7C 1I7UA 4Y4HC 2A6JA 4HKXB 4OF7A 4UBDD 3T2NH 3TP4A 4PRPA 5JOPE 1UG9A 2ZUQB 1WFNA 4PIRF 5HHOE 3ARFB 4Y88A 2F58H 3MPCA 1T5WA 2N56A 3EO1B 3QULA 3LEXA 4JZJC 5IBUB 2PYED 1AR2A 1TZGH 3BHBA 5HHPB 4B50A 2WBJB 3VFVB 4XXDB 1X5YA 3PWNA 3RDTD 4TVSa 1CYGA 2DKUA 2X89A 4DAGL 5CCKL 4XBEH 4NJ9H 4N5ED 2PTTB 5F89B 2AEQL 1P5VA 3RVWC 5D72H 5HYFA 4NKIL 3HZVB 5GGQL 3T0EE 1PKQA 2FGWH 4P5TB 2IJ0C 1YNTB 4D0CB 5CHNA 3I85A 3FOLA 2UY7A 3CXDH 1JGVL 5A16B 3U9UA 5IW3A 2DKMA 2YRPA 2WBJD 3KJ6L 3B9AA 3OSKA 1U93B 4X6FB 4WEMB 1S78C 4NKDB 1J0YA 3GIVB 3RWFB 2E3VA 1X5KA 4PJ5E 4L8SB 4DVRL 5J11C 2QHRH 5I8OH 3WFEL 4O9HL 5A2KH 4IMLB 4ONOA 4P3WA 2N1KA 4NRYB 4XTRD 5DD1L 4JDTL 5HBBA 1I8IB 1K8DB 2CK0H 2OR9H 4FQPA 3RU8H 1IEBB 3GDBA 3QXWA 4NO2B 4KJPD 1NFDA 3TT3H 3PDGA 4UUJB 4LDEB 4RIRA 1WWAX 4OZIF 3GMMB 3SGKC 3T2PA 5DJ6A 4HFUL 3N50A 3VMOA 4KKBC 3T0DA 1CGYA 1MQ8A 5DURD 1EBPA 4BJLA 1BZQK 5BO1L 1OAXH 3D25B 3DVGA 1MI5B 3V0WH 3KPOA 4EOWH 4U49A 4ZMAT 1GC1C 2IALA 1EJOL 35C8L 4WY7L 1NCCH 4GW5B 4E42A 1V3LA 1EX0A 4OD2A 2I25N 1FBIL 3DMMC 1T2JA 3NZHH 3V2AR 2FYYB 1QSVA 3BGFC 4LQFL 3HAEA 1FAIH 4RFEB 5FK9B 1W72A 4YH6A 5LAXB 1YDPA 2OX5A 2WUCH 4KI5E 1LMKA 5FYJH 3LN5B 1HHKA