3BQUD

Crystal structure of the 2f5 fab'-3h6 fab complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
222
structure length
217
Chain Sequence
b'GVQLQQSGPELVKPGASVKMSCKASGYSFTDYFMHWVKQSHGKSLDWIGYINCYTGATNYSQKFKGKATFTVDTSSNTAYMQFNSLTSEDSAVYYCARTSIGYGSSPPFPYWGQGTLVTVSAAKTTPPSVYPLAPGSSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2F5 Fab' light chain
publication title Crystal structure of the complex between the F(ab)' fragment of the cross-neutralizing anti-HIV-1 antibody 2F5 and the F(ab) fragment of its anti-idiotypic antibody 3H6.
pubmed doi rcsb
molecule tags Immune system
total genus 39
structure length 217
sequence length 222
ec nomenclature
pdb deposition date 2007-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bquD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bquD02
2YEZB 4QRUB 5SWZB 1NFIA 4JFEE 3SE3C 4NC1C 2YN3A 5DC9B 4W81A 5BOZG 1KIRB 4L4VE 3OKDA 3CVHA 2XI9A 1AD9A 1UXSB 4OKDA 3ZL4L 4ODSH 4PJBB 5E5UB 3RTQD 4Y8DC 5HYSG 1CGYA 2AJVH 3VXNA 1FNGB 1FZKA 3MV8B 4X6BA 2GKIA 3DJ9A 3NAAH 1AI1H 2IQ9L 2P8PA 4M6AA 4GMTH 3EYUL 4C56E 1B6UA 3E1F1 3BP4B 1FAIH 4NPYB 5DT1H 1SYVB 3DHMA 5K9QI 4Y4KD 2X40A 4YBQC 1HNGA 1EZVX 4Q2ZB 5CKAA 3MO1B 4DW2H 4LGSB 4R3SB 2NZIA 1GHFH 4K8RD 4KMLB 3MLWH 1DSFH 3V7MA 5DEFA 2EKJA 4QRRE 2W07A 3MLYH 4JO2L 2WQRA 4Z8FH 4AMKH 4M6MH 1CK0H 2HJFB 3KPSA 3P3YA 4J3XA 3BIKA 1WIPA 4XP5L 3H3PH 4Y4FD 5C92A 5C71A 2IAMD 1HQ4B 3BPOB 3H7BB 1FFPA 4RGOH 4U2ZA 3FN9A 1A3LL 2D7TL 4O4YH 4CU6A 2MQ3A 3U83A 3W2DL 1KJ2L 3WSQH 1YY9D 3MLXH 3GMPB 3VXOB 2FEDD 1KNOB 3TNMA 1T2XA 5IFAH 5M95B 1OLZA 4PJCF 5CP3A 4NP4H 3VXRD 2GK2A 3DXAD 3RNQB 1CE6B 2DD8L 3M17B 1XH3B 2A77H 4X7EC 5A1AA 1HKLL 1AFVH 2A38A 2L7UA 1U36A 2GSIB 5IBTH 4HLJA 5LQBH 4QXGL 4Y7MA 5MERB 2ESVA 5J0BA 1ZLSL 3ZYIA 3MRBB 4HWZA 2EO9A 4W70A 3WL9A 3QEUA 1ZHBB 3ARQA 3BISA 1MIEH 1INDH 1SYSA 5D7KD 2YHGA 1W72H 4ISVA 4YHLL 5DVNA 4NO0A 1PFCA 1KGCE 2DJUA 3CDYA 1IARB 1X5JA 3NACH 1LO3L 1AP2B 3M07A 2HFGL 5D96B 3QUKB 2ARJA 4A6YA 1J0YA 1ZHNB 2MCPH 1D5BB 5IF0B 4FQXB 5CJBA 1U8PA 3BGMB 1FNSH 1GC1L 3PGFL 2VXTL 4AJ0A 4BZ1L 1LGVA 2QSCH 4HX1B 5D96C 1TNNA 2X1WL 3C8DA 3TJHD 1DQJA 2P5WA 2GJ6D 2R69L 3T0EE 4KMQA 2J1KA 3EYVA 3F7YB 4HDIB 1UC6A 3ROLA 4HBCH 5J8OA 4LSQH 4DFHA 1G9ML 3TESA 3STZA 4LF3B 5GSVA 2C4FT 4M7LL 4Y4KA 4DKDC 2ZUWA 3B3IB 1TTUA 5FM5M 5IMLA 1GIGL 1WBXA 5DMGD 2QTEA 5SWSE 5C70A 4LLDB 4ELKA 1EPFA 1JGLH 1RURL 3KYNB 1NKRA 1R3LB 3ZHLA 3D18B 1A47A 4CU8A 1QYGH 1VFAA 4JQVC 4P46A 4OF8A 2X4RB 4KJPC 1I3RA 4BUHA 3B5HA 5FAAA 4DEPB 4MMZC 1XGTB 2E9JA 4KFZC 2P46B 4AYFA 2X4QA 2WBJD 4Q6YA 2ICWJ 4HAGA 3TV3L 4WCYH 1WISA 1IBGH 1NEZA 5ISZE 4N8CH 4CVUA 3T4YA 4DEPC 5E08L 4PJHA 4I13B 4NFBA 5IQ7L 1YEJL 5KVFL 3QRGH 1UG9A 3HCVA 4Z95H 3CXHJ 1U3HD 1JPTL 1TVHB 3BW9A 3EJZC 3VU2A 4YHZL 2XN9A 5FGBC 1LEIA 3FT2A 3QNZA 3UTTE 5ENWA 4ZUSA 2E7CA 3GGWA 1MCPL 1CD9B 5FGRA 4EUPG 1FLRL 3PP4L 5D7IE 3ARZA 4KKAC 4N8PA 3DYPA 5IEKA 1AGBA 1MAML 3EYQC 2AV7B 1MCWW 2FHCA 5CZVH 3VA6A 4FHBD 3VI4F 5K59F 4ZUTB 3PIQB 3G6AA 4Z7WB 1CICA 1F90H 1ACZA 3ZKXC 5I18L 2DB8A 1HCVA 5DGQA 1T03H 5H35A 5JIIA 1NGPL 2R9HC 1VFBA 2AABL 1YNLL 4JFPB 1NAKH 3Q1SL 3AU1A 3S4SA 4K9EH 2DAVA 5C0DA 2IPKA 4CMMB 1FPTL 4GXVL 3QHFL 1LO2H 5GPRA 3Q6GH 1A6VH 3QFJA 4JPIA 5DJ8B 1A3RH 5LGKA 4HFUL 4BQ6A 1LILA 4PJ5E 1ODAA 3IAGC 4WV1A 5SX5K 4U6XA 4OFVA 3BUTA 4JDZA 1AXIB 3B9AA 4EI5B 4U0QB 4AEIH 4JRYA 2EDTA 2VE6B 4GAYB 3MRPB 4RRPA 5L7XH 4ZUVB 3I50H 5HGDB 3RDTA 1AIFA 2XZQL 5F6HJ 4MJIE 3V0WL 1CIDA 4I2XB 1JF1B 1GVIA 3KYAA 5EO9B 5KW9L 1XGPB 1OP9A 2I5YL 4EI5C 1UWXK 1ED3A 3U2SA 4NJAL 5HHOB 2J7LA 4XX1E 1EHLL 2V9TA 2X7LB 5GRWA 1HXMB 1M7DB 1XGRA 2FJHB 5DD3L 5I30L 3HR5B 3JXAA 3AUVA 5EBWA 3BD3A 2E5EA 5JMOC 3MBEB 4JM2D 2DQCL 4MD4B 3TEUA 3N9GH 1J05A 4K3JH 2GSGA 1JPFA 3EOYG 3C8KA 4IRZH 3ARRA 4YDIH 2V2TA 1RJLB 1X6LA 3F58H 3HMWL 4QEGA 1DQQB 5IQ9A 2HJLA 3BP5A 5D6DC 1J0HA 5EU4A 4NNPL 1CFTB 2FX9H 4GW1A 5E8NA 3MBEC 3VXMA 1IMHC 4N0RA 2G9HB 1BX2B 1QPPA 4NKOA 5HDLA 4GQ9H 3L3JB 1TZIB 5I1DB 5TE4H 1AD0B 4JKLA 4G6MH 3MXVH 5I75B 2AXGB 1WAAA 4BJLA 3BEVB 2X10A 4U1IA 4YEEA 2GJZB 3GMQB 4LPWA 4PGBB 4XTRC 1K2DB 3QWQB 1OOAA 4JM2F 5TPWH 4PJGE 5DRZB 3GI9L 4XPGL 4Z7UB 1WZ1H 1LO4L 3DARA 4KK5C 3B8SA 1B0GA 3IETB 2YUZA 3O4LD 3OKOB 1U92A 3T2NL 5FYJH 2AQ1A 4LMQI 1U8KB 5BRZD 3DO7B 3WFHA 4X6DB 4CVXB 3OB8A 2AJXH 3L3KA 5HD8D 5KS9B 4M43L 4AIZA 2VDOH 2K9UA 2K1MA 5HHME 1U8LB 4ZPVB 1B4JL 4LCCB 3LEXA 3RUGE 4BH7B 1BQHA 5HVGB 3B6SB 5D8JL 1OTUD 2L0DA 1P84K 3K2UL 1OAKH 1CG9A 4P57B 4DN4L 2R0KH 1A5FH 1KCRH 1VHPA 4PJFB 5DMJB 3ISWA 1KSRA 1WZLA 1TPXC 4LCCC 4OLUL 3GRWL 4F57L 2VZUA 4DGVH 4EQ2A 3MRJA 3PWLA 5JPNB 3OAUH 3UJJH 5J1AA 1A7RL 4XXCA 2A73B 3ARXA 3MLUH 3CSPA 5F3HA 5INDB 1X5IA 4LOUC 4WHYH 3CXDH 2CR6A 1KBGL 4RMQA 3ZDYF 1CR9L 3TO4C 3NA9L 4U1MB 5LVEA 1SJHA 5DEGB 3I85A 3D3VB 4TUOA 4GMSL 4EXKA 4O9HH 2AEPL 1FNHA 1DL7H 3QHZH 4LAJH 3BN3B 2XWJA 4Z77B 1PLGL 3RZCB 2ITCA 3R06A 3MGOA 5ID1A 1R0AL 1JJUA 3QIBA 4E0RA 3OKLA 4I9WE 4OI7A 5FB8B 3BZFB 4KI5D 4YZFE 3S34H 4R4FH 3NN8B 1TZHA 3U9PL 4LLVA 1A7NL 2VL5A 2X1XR 1GSMA 3F8UB 5FA3A 1EBPA 4XB7A 4PB9L 3RGVA 3VCLB 2BNRE 4A2LA 4OLZL 5ADPL 4WFFD 3IXAA 3MJ8A 1DLFH 1DN0A 3OF6A 4GAGL 2FIRT 5C0BE 1AR1C 3ESUF 2IADB 1ZE3C 4ZDHB 5IVZB 3ZE2E 2WLYA 3WJJA 2E9IA 3LVEA 1EAPA 3OBAA 4ZXBD 4MQSB 3V0VB 2YUXA 4M7KL 3O11A 4JANA 4KI5F 5F71A 1J5OL 5C2BH 1AGEB 4HXAH 2EDRA 3DYMA 3O6ML 5FYKE 1M6OA 3PNWB 4ZSOA 4X99A 5C08A 3DX8A 4S0TD 1DQMH 4NNYA 3HE6B 4LLQB 4PUBH 1FJ1A 2PN5A 3QA3A 1MNUL 3GSNA 3WNMA 5INCB 5JW4M 4Z7OE 2NY6B 2ZUYA 5ID0B 1IC4L 3FTGA 2IPUK 2VZTA 4QRQA 5FYKL 5D1QB 2Y9RT 2DLEA 4JR9L 4J6RL 5I71B 1P1ZB 2EDWA 1M05A 2P44B 3BZEA 5J6HA 3HE6C 1FQ9C 1NGYA 2GTWB 1HHIB 3TBYB 2X70A 1OPGH 1FG2A 5BMFL 1T04B 1NBZB 4GBXD 4U0RB 2NY6C 3CSBA 4QHKJ 2K3TA 5EO0A 3V7AG 1TQCB 2LQRA 3WFDH 5FIEA 4Y4HA 2A9MH 5D1QC 5C09B 1IAIM 2F58H 1NC2B 5I71C 1Y6KR 2ZCLL 3C6LA 2NX5D 5FHAL 4M6OL 1QFUL 2HT2D 3LN4B 5T1DH 3ZTJH 5K9OA 4R8WH 2ZG1A 4C83A 2HG5B 1T0MA 1TQCC 2R1XA 4D9QE 2WM0A 4D0BB 2J8HA 4M7LT 2WP3T 4ORGA 4BZ2H 4E5XA 4TVPL 2H8PB 5DK2B 5ESAB 3CFKA 3CVHL 3W39A 4XXDB 4G80A 2GHWB 3P9WB 4JJ5B 3ZT5A 1EUUA 3HPLB 1P4BH 1T4KB 1A6TA 5HYSA 3U79A 1FORL 1MCRA 3S3PA 2EZ0C 2AXJA 3B9KD 1N2RA 2BVOA 3BN9C 1V3MA 3DGGA 1EAJA 2UYLA 4JPVH 3U46B 5DQ9B 3V4UH 1R3KB 4HPYH 3C9NB 4MNGB 1HHJA 4Z7NF 5BXFA 3VFMA 2F5BL 1CLYL 2DWEA 3KPSE 3DVGB 4K23L 1ZLUH 2DBLL 2BVUA 2OXHA 1LDPL 4I3SL 2EEDA 4ZO9A 1HH9A 1WV7T 1RUPH 2FL5B 1YUHA 5FV2A 1CLOL 2NY7L 4M1CC 2VR4A 3EYOB 4MCYA 4QY8A 3KPQA 3DWTA 1DBBL 1M1SA 4G3YH 3QUZC 1BECA 1LQSR 5D5MF 1WBYA 2FGZA 5D70L 2NYYD 3TBTA 3LQZA 1D5MB 2DI8A 3MJ7A 5TJWK 5CJXC 4JO3L 3N1QC 2BVQA 5FKAB 3WFBL 3SJVB 5IMOB 5B38G 3FQTB 5LBSL 2ZCHL 2ESVE 2W91A 1JHTA 3EJYD 3S36L 5T3ZD 3BKJL 4UU9B 3GSRA 4IOFC 5D7LA 3C6SA 4HUWA 3KNBA 4FQPA 3UBXA 3RRQA 2XQYK 5CZKA 4WFHD 4LFHG 4APQD 1A4JB 4OGAC 4UNVA 3GB7A 3RWHA 5I1KH 2P24A 3EFDL 3NTCH 1FH5L 3R8QA 5JIHA 1MHHB 3D69B 3O9WC 4S1SL 2PTTA 4EBQL 2WANA 2WUCL 4NQSA 4Y16D 1XFPA 1WGOA 4WY7H 1MIMH 3DX6B 3QCUL 1UA6H 1OARL 4QTIH 1OAXL 2BXYA 3LEYL 3BZDA 1C5BL 3K2MC 4A6YL 4KJWC 5F7KC 1VGEH 3QRFM 1OAZH 2JLLA 3WN5A 2P5WE 1GH7A 2BSED 3JWDH 4P4RA 3INUL 3THML 3TT1H 4QXUH 3EZJB 2A1WH 5GS1C 2BRRL 1T7ZA 5D93B 4U7SA 1G7JB 1PYWB 2EH8H 4YUEL 5KSUB 3BH8B 4BK4A 4XT1C 5D6CB 2RQ8A 3W0WB 1PW3A 5FGCB 1X5AA 3F65A 5GS0D 2BSTA 3HAEG 1EEUA 1KPUB 1QLEL 4B7IA 5KVEH 2CK0H 2WWKO 2CR3A 4NWUL 2WWMD 4J3UA 3FONA 5DRXA 5KTEL 5MENB 1TJGL 2NZ9C 4PRPB 2I07B 3ROOB 2DJSA 1U95B 4K8RL 2A6DB 4MA8H 4PJDF 1X5LA 2VZ3A 3UBXI 1EMTH 1YQVL 1IJ9A 1GGTA 1TIUA 2NY2B 4HJ0D 3PHOB 2J8UF 3VFNB 5AAWA 1IL1A 3VXSB 3LEVL 4XMKH 4PJHE 1YN6B 2VDQH 2RIKA 5DR5H 5ACLA 5IWLA 1RUKH 1RZGA 3LH2L 2F74B 4YPGB 1MRFH 2BY2A 1BZQK 4DZBB 4Y8AA 2HRPH 2XN9E 1J0KA 4WW1B 5CJ5A 3H0TA 2CLRA 2HLAA 1A4KA 3ZSSA 2KQNA 5C8JA 2LU4A 4YO0B 4HKJB 2VDML 4DUXA 4XNYH 4OUUA 2NY3C 1KTKE 1ZT1A 3T77A 2VLRB 1AKJD 2EDNA 2XZAH 3UAJD 3BEWA 4WU5B 3DVFA 3M8OH 5DJ0B 5J13B 4Z7QE 4PG2C 5CLWA 2MTPA 3MMEB 4FOMA 3GHBL 2E6PA 3NZ8B 3QG7H 4WJ5A 4EUPA 3WD5H 1UEMA 2AJSH 2A83B 3HUJF 1E4KC 2Q1EA 3ULUE 5BV7L 1P69B 3QDGA 4XP6H 5J13C 4PP1D 4GO6B 3PUCA 4OLVH 3C5ZD 1NBQA 3OJVC 2N7AA 1S7SB 1IGTB 1L7TH 1DQDH 2H32A 1DVFB 4IMKC 4D2NA 4PBWD 4TUJA 3QFJE 1PVHA 3ULUL 4P23A 3QEQD 2XACC 2X4UB 3WO4C 1BOYA 4M5ZH 1S7QB 4PJDA 1U8JA 4NKDB 5E2TL 1DVFC 2VIRB 3K8LA 3FN0L 4JRYE 4LMQE 1CBVL 1J1PL 4BQBA 4OCWH 5JW5B 3FQWB 3ARWA 5FEBA 4QRRB 4IRSA 3MRFA 2XKSA 1YECH 1JYVA 5DFVC 1KJ2B 2BNQA 4TULL 5JZ7C 5GRXG 1KN4H 5D2LA 1ZA3B 4MJ5A 3NCBB 3HPJB 2Z4QB 4NO2B 4Q74A 3NCMA 4QCIA 5HXMA 4CL7A 5DTFB 1IAII 4TSCL 5DDHA 4LPUA 4GRWH 4CVZA 1W8NA 1U0QA 4HWEH 1EO8H 4QF1A 5GRYA 4BFBD 2HKHH 2ZKHL 2VERN 2NNAB 4OQTH 5DXWA 3NMEA 1ETZA 1U8HB 3V2AR 1W0VB 4ZO8A 4BFGA 2LVEA 1IGIH 1GGCL 1EFXB 1WK0A 2V2XA 1UB6A 3TO2B 3VXME 4UV7H 1YN7B 5DO2D 25C8L 1P5VA 4U31A 2C1PB 2CXKA 2Y23A 3VJ6B 2PCPB 4HIXL 2FNBA 4JQIH 1WAAE 1CFNA 5CUSL 5C0AA 2NTSP 1BBDH 1LP9F 2D0HA 5I8OH 2QHRH 1UKQA 4CBPA 1PZUB 1DBJL 3SGKC 3NH7H 4NNXA 4C59B 4XHJC 5E95B 2J3SA 4KAQH 1XF4B 3PG2A 4NZTL 4XP1L 2F8OA 2FR4B 1MAKA 3TNNA 3BO8B 4AL8L 4HFWA 2C1OB 5F89B 1WFNA 2HT4D 4R7DA 5C0JA 3SCMD 2P8MB 4P2QA 1Z3GL 1TCMA 3QNYA 5CIPH 4FFWC 2VZVA 4KJQD 4TTDD 3BKYH 4KK6C 4KUZL 3IFOB 4QHNA 4YXHL 3MV7D 1GC1C 5EU3A 2KL6A 5IHUH 4RGMB 2QADD 4QRPA 5K9KB 1I7UB 3TBVA 3X17A 3C5ZA 4ALAH 3QP3A 2AP2A 4G6JH 4ZFFB 4N0CC 4NHCH 5DJAB 5DVOA 2QQKH 5SV3A 5I1IH 4N8VG 1CE1H 2V17H 3LN5A 4NN5B 4R90H 3KS0J 2BMKB 4ETQB 3MJ9H 3SOBL 5BQ7B 1FGVL 4RGMC 1AQKH 2Z9TA 2CIKB 3O81A 1QO3B 3G5VA 4XWGL 5F9OL 1WF5A 3SBWA 2P43B 1ZGLM 4RMSA 2VXSH 3AFLA 1C5DA 2HMID 4JRXA 3WUWG 4J3WA 3I6GA 5F9JB 5JW4R 5ITFB 5T33H 2IANB 4XMLH 4HKBB 4IS6B 4JZNA 2PR4L 5BS0D 4LPVA 1K5NB 4EI6B 4OB5L 3I9GL 2R29L 5GISH 3WDJA 5EIIB 2HVJA 1KJ3H 3HI1B 1KJVB 3C08H 1NJ9A 1YYLH 3TVMD 3QIUA 5D1ZD 4PS4L 4HK0A 5DJDB 4ZOBA 5JQ6H 1OAQH 2JIXD 3FQNA 3OPZL 3ZTNH 4Q9QH 1CLCA 4XBGA 1H3PL 3GMMA 4L8BB 4PJAF 5F1SA 5ISZB 4JDTH 4MA7H 3KPMA 4UDUA 4Y0GA 2A2QT 4Y5XA 1QG3A 1B3JA 4F33A 5EOQH 5I1HH 2R2HB 3JBG7 5GGRY 4Q9CA 4H26A 3UJTH 4XH2A 1WQVT 4TQEH 4GAJL 4LU5L 1U6AH 2UZXB 3HR6A 3VI3E 5D7IB 1HSAA 1A0QH 1T3FB 5IG7A 1QLFB 4OTXL 2D9QB 2ZJSH 3CDGA 3OHXA 1ORSA 4FFYL 2NXYC 2Y7QA 5EOTB 5F7LB 4UIKL 4D8PA 1NCBL 4KVNL 3ARTA 4I0PD 3O2DA 3QQ4B 5J6GA 1S8DB 2YPVH 4LBEB 1CDJA 3PF2A 1UH4A 1JTOA 4K7PH 5FUOL 4ZSOE 5L6YL 4V1DA 3RNKB 2E7MA 5C08E 4F7MA 3ARDA 4HC1L 2Z31D 3L3OA 2BY1A 2DQHL 1FGNH 5KSBA 5GZOC 5FUZH 1KUMA 4XPFH 2BCKA 3IFNH 2CXGA 4ZFOA 3HNTL 1JUFA 2DICA 4G8FA 1YPZF 2FIKA 3TIEA 3PV6B 1P4IH 5DF0A 5KZCB 4OCSH 5HGHA 3ETBF 1S7XA 4Z5RA 5HDOA 2W9EL 3SDDD 5GSRB 2X41A 5A16B 1Q0XH 3QUMA 4MJIB 3WLWD 3GSQA 5HGAA 1UWGH 2ITDA 2W0LA 1IGJB 2YKLL 3U7YL 5IKCA 5C0RL 1CDGA 1YYML 3N85L 4KQ4L 3QIWA 1QSVA 3EBAA 5TGBB 4I1NB 2DS4A 4B7LA 1MFEH 3GK8H 3BDYL 1FO0H 2A74A 1MCOH 3HZMB 5C0CD 3QDMB 4M7JL 3MNWB 5CBEB 3GJEA 3IDJA 3SKMA 4YFLF 3SQOH 3VG9C 3MUY1 3AM8C 2X44D 1S7RA 3LRSA 1JCKA 2GCYA 1E27B 3FQXB 2XKNA 3HG1D 3WKMH 4PBVC 2PKDA 2EDYA 1WCBA 5CGTA 2DRUA 4WUUA 1OAYL 1I1RA 5GGTH 4CJ0A 3S6CA 3CH1B 1KXTB 3FB6A 3QEHB 1GZPA 1AJ7L 1RZ7L 3V5DB 2DQDH 3WXWH 3BP6A 5DHVB 4LNRB 5M7QA 3UO1L 4F9PA 4PYGA 4HZLB 4MA3A 5T1LB 4TPRH 4JZOB 5IW3A 2AJ3A 1BQLH 2DYPB 2MNUA 1P7QD 1HN1A 5FO9A 3G5XB 1JMXA 3RWJA 3J7HA 5I9QC 3MRGA 1QACA 3EGSB 5F44A 3V4VH 1KULA 4RISH 5TF1H 4PJ9D 4UQ3B 2G5BB 5TF0A 3JV5A 5HVWA 3TBWA 1ZGLA 5I8EB 3EDFA 3REWA 4GKZB 3UPRA 5T1KD 5HY9B 1HSBB 1DN2A 3LAFA 4FQJH 5DYOB 1MY7A 3V8CA 2XWTB 4ZFGL 1CFVL 5FKPA 3L95B 1S9VB 1JRHH 4MS8C 4XWOC 5ICXA 3G6JB 5D7LE 4KPHL 4PY7B 1I7RB 3G5YB 3JUYA 1WT5A 1TITA 3A6BL 1XGUB 3IFPA 1FFNB 5HYEA 4LIQE 3DI2B 4G8EB 1MI5A 5DD6A 1F2XK 1WITA 2MOVA 2Z35B 3DV6A 2IC2A 5B38A 5J7CC 2F19H 2XY2A 2VR9A 1DQLL 3X11A 3DUSA 3CFBB 1BFVH 1C7SA 1DDHB 1I4FB 5CWSA 3T2OA 2X4PB 1BQUA 2XIDA 3SDDA 1HK6A 1OT2A 3MRLB 4G8IA 3UCRA 4HS3B 4EXPX 4RFOL 4ENED 1A6ZA 4D0CA 2FH6A 3S88L 3MUJA 3HC0B 5L2KD 4PRDB 4K3DH 2CDFB 1VPOH 5I1LB 1LD9A 4G43A 2PO6B 4ZPTA 3OJMB 3GSVB 5GGRB 2FBOJ 5JOFA 1UM4L 2VDKL 3GEWB 4PPTA 2X9WA 4S1RH 1NDGB 2P7TA 1U8IA 3LS5H 3PWNB 3PWUA 3VWJB 12E8H 1T22A 2AI0H 4XBPB 1R3JB 4DAGH 1F4WH 4FQLL 2PO6C 3EFFA 2CRYA 3LQAC 5DC4B 1NCAL 3Q6FA 5CEZE 5L8KB 1F2QA 1CZ8L 2Z93A 2PYEB 5HHPA 4WUKH 2VAAB 4XP9H 2R8SL 1RI8A 4Y5YA 5CJQH 4QYOA 1XEDA 1AGCA 1JI1A 2F53B 2IG2L 5KG9B 3WHXB 2M8XA 4FS0A 3O3AB 1IZJA 2FWOA 2R4SH 3HAEA 4WENB 1ZT4A 3H2WA 4JFZL 4P3DB 1H3VA 1FYTD 1NMAL 4Z7VF 4UBDD 4MQ7A 3PWPD 4I8DA 3NIFF 4HZAA 4JY4A 4TRPH 2I9TA 4LLWB 4MAUL 5IJVA 5I6XB 5I17B 2ZSWB 4KC3B 2YD3A 1YDPB 2F54A 1MJUL 2BOBB 3GJFB 4WDIA 5IHZB 4PJIB 2YSSB 1D9KB 5EC2B 9CGTA 3ULVD 5DUPH 1AQDA 3S3SA 3TFKC 3U36B 3OKEA 1N8ZB 3MGTA 2XRAH 4P2OB 5I6XC 4BSWA 5EUOB 3C60A 3GI8L 3HZVB 4YGVB 3B2VL 4WWKA 1P4LA 2WK2A 4E41D 1II4E 4KKNA 1D9KC 5A2JH 4OM1H 5JORB 3WIFA 2I24N 1NFIB 1IAIL 3MRMA 3KS0H 4JFFB 5T3ZL 1H3XA 3TIDB 3RKDD 1ZANL 1CL7I 5L2JB 3PL6B 1WICA 3QDGE 3QAZB 4D0DB 3ULVF 2OR9L 2ORBH 3CFEB 1F97A 1IC5H 1SY6H 2EDHA 1KCSH 1H15B 4PGCA 2R0WH 4YWGL 4P3WA 1Z9SA 5C0GB 4LLUA 3P0VL 5HVHB 2NW3A 3CPLA 4ZODA 5DJZA 3IXTA 2X89D 3OWEA 4S1QL 4U1LB 3MRRA 3IJYA 3PL6C 3QAZC 4WI5A 1EH9A 1RSFA 5IVXF 1B4RA 2VLKD 4PRIE 1JIBA 3D39A 4RAVA 1C16A 3U4BL 1KIPB 1KACB 4XCFH 4LHJB 5KANG 5FECB 4N5ED 4DK6A 1NAMH 4ODUA 1WEJH 1ACYH 1T2JA 3V4PH 4AEHH 3VD7A 3FO2A 4CW1B 3LIZH 4HCRL 5KVGH 1S5HB 4UB0L 4H5SB 2FATL 4CADA 2HH0H 4F80A 2BNQE 4HW6A 4JFYA 3MNZA 2HFFA 1L7IH 2VOTA 5D2LE 4QOKA 1OB1A 3QXDA 1I8LA 4DTGL 3UMTA 3O3BB 4MAYA 2O5YL 4Y2DD 3ZE0E 1A7OL 2CJUL 4R0LA 5GS0L 4JY5H 3ZL4H 3I6LD 5DLML 1KPVB 2HTKD 1DANT 3ES6A 4GKOA 4XBEL 3TNMB 2IALA 4KDVA 1FYTA 2DTML 1IFHL 4IBLT 4DWHA 3VRJA 4HUMB 1T5WB 3FMGL 4EDXB 2V7HA 3EYUH 2VUOA 4NQDD 3L5XL 2IFFL 4WI9A 3RQ3A 1I7ZA 3PXJA 4S1DC 3IKCB 2UY6A 3JZ7A 4CVWA 3BD4A 1OLLA 3QI9B 2WINA 3BPNB 1A2YA 2FEEI 2LVCA 2P48B 5C0AE 2Q6WA 3WL9B 4KGLA 1EV2E 3C87A 1RD6A 3S35X 5BVJB 2XPGA 2HTLC 3RHWK 3QI9C 2H6PB 4OD1L 4XCEB 3CFIC 3L3GA 4NKIL 4XP5H 3BPNC 1IGML 5IVXA 4LASH 4J8RA 1INQB 1AO7B 4HKXA 3RX7A 4P2QE 3D85D 3OKKA 1EGJH 1QR1A 2D7TH 1YEHL 4OV5A 4XAWL 3W2DH 1OW0C 1NFDA 1YNKL 3MCLL 4JKWA 4QRPE 2XWBB 3RTQB 1TTFA 4RWHA 4FZEH 2DD8H 2MPAL 1ZTXL 3CU7A 3DMMD 4OD3L 3RIAK 3ARBD 3EYVB 2B0SL 3WS3A 1ZLSH 3JTSB 5JW3L 2CD0A 5GSVB 4U6YB 5T3XD 3RTQC 4Y4KB 2X2YA 4JRXE 3CJJA 2Q8AL 5L9DL 4PJCB 1J1OL 3JTTA 4ELKB 1RZFL 4FFZL 4N8VA 3GO1H 1JGVL 4HGWB 4P46B 5ALBH 1LE9A 4Y4KC 1R5VA 1CFQB 3U7WH 1Y6NR 3D25B 1WC7B 2WV3A 4Y4FB 2CKBA 3WUWA 1MFBL 2IAMB 4K8RC 4U1HB 4I5BA 2R4RL 1GC1H 2EE3A 3PGFH 4JY6B 3UTSD 3GNML 5B3JF 2X4OA 1N3NA 1X7QA 4P46C 4BZ1H 3MZTA 3NFSL 1NEZB 4O2FA 1JI2A 2VZOA 4TSAL 4Y4FC 2OP4L 5EN2A 4NQXA 4P4KA 5D9SA 4HJGB 3VXRB 3DXAB 2EDOA 1UM5L 5DQDL 3QQ3A 3K1DA 3FT2B 3QNZB 4M7LH 4FG6D 4R2GD 1Q9LA 4ZUSB 5ITBL 3L6FA 1YEFL 1YY9C 3VXUA 2FEDC 2WIIB 1GIGH 3L9RA 4QHMA 3UXFA 1JGUH 2GJJA 3KDMA 5DK3A 3SKNA 1BVZA 3DIFA 3IDIB 1PKQA 3SDXA 1RURH 4NRYA 3KYOB 5BV7B 1EZVY 1NCNA 1BGXL 5H94B 1I8IB 2VLJA 1QSFD 1T1WA 3X12A 1V7NL 4F7CA 5E9DA 1DEDA 5F3BB 5AD0A 3CDCA 1RUML 4UTAH 1CLZL 3U6RA 5GRJH 3GKWL 4ODTL 3UZEA 3ZYZA 5BV7C 3MUHL 4V1DE 3TV3H 1VFBB 4HEPG 2Y5TB 4X5XA 5E08H 1D6VH 5KSBE 5IQ7H 3KXFA 5KVFH 3M1BA 3MRDB 1JPTH 1SJXA 4RX4D 4YHZH 3MRKB 3ULUC 3R4DA 2YEZA 4QRUA 3B83A 1KELL 2GJ6B 5SWZA 4U6XB 1EA9C 3MLZL 1ZAGA 5F9WC 1TZGL 1FLRH 3PP4H 2Y07H 2QEJA 4J12A 1KIRA 3O3DB 1MAMH 4DUVA 3MJ6A 1UXSA 4PJBA 1TJHL 1L9MA 1FNGA 3MV8A 2EYRB 4MD5B 3U2SB 2CDGB 5IW1B 5I18H 4LLMB 3X3GL 3OKNB 2Q8BL 3LMJL 4ELMF 3RDTC 1NGPH 3V7AE 4NPYA 2AABH 5EBWB 1JVKA 1SYVA 3DRQA 1YNLH 4Q2ZA 5CEYB 3WMSA 2WBJB 3MO1A 3BKCH 4N1HB 4R3SA 3KJ6L 1A02N 4M3JA 2GSGB 1AE6L 4GXVH 3QHFH 2QJDA 1OSPL 3LKRB 2ZUQB 4I3RL 5EU4B 1BVLB 4WUUE 3UYRL 3L3DB 1P5UA 5E8NB 2CO7B 2RJMA 1U3HB 2HJFA 3UPAA 2WBJC 5CCKL 2J6EL 1RVFL 5HPOA 3MGAA 5DMYA 4P3CL 2Q86B 1HQ4A 5ICYB 3MRCB 2ZUQC 2QSQA 4LDOB 1IM3B 3V0WH 4R4ND 3GMPA 3VXOA 1KNOA 4LVEA 1NCCL 1WFUA 4EIZC 5I2IB 1JYWA 3AS1A 1XGYL 4XB8A 4RWYL 1CE6A 3M17A 1XH3A 2VISB 5DD3H 5I30H 4M61B 2C3GA 1FHGA 2GSIA 4LCWD 2ILLA 2DQCH 3V6BR 1ZA6B 5MERA 3U0PB 1PD6A 1Q72H 3MRBA 3L3KB 1RHHB 4FNLL 1XCTB 4KZEH 3HMWH 4KTEL 3HB3D 3TA3D 1H9VA 3UEZA 1ZHBA 2QLVB 5DRNB 1HOCA 1ZLWK 4RA0C 5TQ2H 2I60L 2EICA 1X5XA 3O41B 3L3IA 4CU7A 4JO4L 4KU1A 1AP2A 2AV1B 4D9RD 1MI5E 3QUKA 2ATPB 2R1YB 4ETYA 2I25N 1SQ2N 3QG6B 1ZHNA 1D5BA 5FM8A 3FFCD 4HG4K 5IF0A 4FQXA 4M6NH 3BGMA 3MRJB 5ACMA 3PWLB 1IE5A 1R3HB 1A3QA 2WBKA 2KZWA 1MLBB 4OCNC 3TC9A 4MHHG 3MNVB 4HX1A 1LO4H 1P9MA 5MI0B 1I7TB 5AZ2H 5F3HB 3IYLW 3VDBA 2EDBA 1A1MB 1TETL 3F7YA 4HDIA 4P5MB 4YE4L 1UCBH 2ID5A 4LF3A 1ZEAL 4OGXH 3NBNA 3C2AL 4POUB 4JQVA 2YOCA 1CCZA 3RAJL 1FP5A 2DQTL 4LRNH 3B3IA 4JM2B 5MI0C 4M43H 5EBMA 2NPLX 3FRPG 1B4JH 3MGOB 2H45A 4LLDA 4HJJH 3KLHD 4ONFL 4JG0H 3U4AA 1BJMA 1R3LA 2D0FA 1EXUB 3D18A 4OSUL 4YHKL 4TSBL 4LLVB 4P2YA 4K94L 2X4RA 2VL5B 4JM2C 4YHNB 5F7NC 4NQUA 4Y19D 1XGTA 3GRWH 1YEEL 2XOTA 1IEBB 3IXAB 5GRVK 1TCRB 4F57H 1MRCL 4I0CC 5EDXA 1ADQA 1CL7L 3KR3L 4OKVB 4OZIF 4O58L 1PQZB 1NQBA 2D9CA 4EDWH 3RGVC 5I16B 2RFXB 2Y06H 1KBGH 2GQHA 1CR9H 1MJJB 5LCVL 5TFSL 1TVHA 4CN6A 1CTNA 4GMSH 2AEPH 2K7QA 5J3HD 2Q87A 1XGQB 5LKNA 3QXVA 3HLAB 3O4LB 3F5WB 2F54E 4LCWA 3JV6A 4FA8A 4JKPL 2EXYD 4P59L 5BRZB 3WJJC 1PLGH 4K3EL 1GYAA 4LSVH 1JBJA 5CD5D 4JGUA 1RIHL 3U9PH 2AV7A 4OAWB 3FCTB 3DPBA 1A7NH 1I9IH 3LQAH 3PIQA 4LRIC 4WFEE 1FRGL 1T1ZB 4Z7WA 3V0AC 2XV6B 2D4FA 4OQTA 4I77L 4FP8L 4XVTH 2ICEA 1U3ZA 4JGMA 1CGSH 5HD8C 3FZUD 3MBXH 2X70B 2OZ4A 3K4ZA 5IVNA 4GAGH 4GT7A 4JFQB 4PRBA 4JFPA 3D0VA 4G5ZH 4NRXB 1OTUC 4PLJC 4CMMA 4XC3L 1KLUA 2AXHA 3RBSA 1FCCA 5DJ8A 3GMRB 1WFOA 4C83B 2R1XB 4N90D 4EOWL 1MCKA 2HJKB 1ZHKB 3AMLA 4ZS7H 4Y4HC 5GRUL 2O5XL 4EN3D 3PDGA 2Q76B 4KRMB 4EI5A 3C6LC 2FEEL 4U6HB 4G80B 3D39E 5B21A 2VE6A 4XCCL 1YY8B 3MRPA 4RGNE 2DLFL 2ZPKH 4ZUVA 1EO7A 2X5PA 4ZUWB 3EOTH 4I2XA 1FIEA 1JF1A 5ADOL 3HNVL 3ME0A 5FYKH 3NIGF 2VAJA 1XGPA 5B39B 5DD0L 1N6UA 5HHOA 2X7LA 2DM7A 1HXMA 1YEGH 2ZOKB 2FJGB 1K85A 1F4YH 2FJHA 5D6DA 1FBIL 3HR5A 5BMFH 4QOKE 3D9AH 3F12B 3TT3L 1JTPA 4YIQB 1LE5B 1Z0MA 2JTDA 3MBEA 5DJYB 5HDBF 4MLIA 1VB9A 1JNLH 4MD4A 1HH6B 4H20L 4KI5C 2ZCLH 5EU7E 1YUHB 1RJLA 4M6OH 1QFUH 1DQQA 1MCIA 4LVHB 3D2UD 3KPRD 4HH9B 2BX5A 1FYTE 4L4JA 1QUNA 1B0RB 2F8VA 2G9HA 1BX2A 1SVCP 4G6AC 3L3JA 1TZIA 5I1DA 3CVHH 1FSKB 1AD0A 1UB5B 1C1EL 5FHBL 2AXGA 2EECA 4L4TD 4OIAA 1V05A 3AVEA 4MVBD 4LVHC 3JV0A 2GJZA 4PGBA 3AS2A 5FYLE 4RZCB 3TZVD 4F7TB 1FFRA 1WWCA 2CUIA 1K2DA 1H3TA 3KJ4B 3HHRB 4PY8I 2EE2A 1OT1A 3I6KB 2VZSA 3T65B 5DRZA 4F7EB 1FSKC 3MLSL 3MREB 4MD0B 4PREA 3UBXB 4NWTL 4F15C 4NM8L 2CKNA 3IETA 5GS3A 2F5BH 1CLYH 1MHEB 1A1NB 2EDLA 3B2UD 2DBLH 2VXVL 3ULVL 1KF9B 1CT8A 2XFXB 1LDPH 4B50A 1OGAD 3MRIB 5ALCL 3DO7A 2WIMA 2E3VA 5HJ3B 4CVXA 4GBXB 1IKFL 4FQIL 1U2HA 5KS9A 1CLOH 4B5EA 1NFDE 1U8LA 4O51B 4ZPVA 1E0OB 3QXAB 4LCCA 4BH7A 1DBBH 2NX5B 1X6NA 5D70H 4GBXC 3MACL 1HDMA 4PJFA 3WFBH 2ZCHH 5AUMA 3QWRA 5FO7B 2EIBA 5AG9A 5CP3H 5E99H 1FFOB 4OFPA 5JPNA 4YXKH 2VLME 2HT2C 1CD0A 4YHPA 2A73A 3OG4B 5D5MB 3B9KB 5INDA 3MA7A 2ERJB 3L5HA 4X5WB 1RZKL 3EFDH 1FH5H 5DEGA 3D3VA 3ZE1F 1TJIL 2WUCH 5DRXB 2B5IC 4BSVB 4RBPH 1VFOA 3QCUH 2VKWA 4NUGL 2ERJC 4OZGF 3RZCA 2GUOB 1VA9A 1R24B 4KXZI 1OAXH 3LD8B 3LEYH 1C5BH 5FB8A 3BZFA 1N5AB 3NN8A 4A6YH 3NGBB 1NUFA 3OKYA 1MJ7L 3P11L 3VCLA 3P77B 5E8DH 4LAQH 1HE7A 3LD8C 5EWIL 4YUEH 1JNHB 2CLRB 1A4KB 3RIFK 5GS2H 2B20A 2CH8A 4L4TA 3VXUE 3BD5A 1MCCA 3NGBC 1SMOA 2IADA 1F58L 1PKQE 4ZDHA 5IVZA 3SDXE 4XNMB 4NRZB 2P5EA 4HLZG 1NGWB 3V0VA 3U4EB 5AZEL 4PLNC 3MOBL 3Q5TA 2VLJE 3DBXB 5E8OB 1TJGH 1AGEA 4NJ9H 5E9DE 3LRHA 3PNWA 3WLBB 4KROD 4P48A 1FL5A 4Y5VB 3HE6A 3SKUD 3MOAL 4MQXD 1YQVH 3T09A 4Y16B 4YHOL 2O93L 5INCA 5C86A 1OP5K 2IH1B 3LEVH 5ID0A 3MRNB 1BEYH 3KWWB 5D1QA 3KXFE 4AENB 3LH2H 4ZG1A 3DGCR 4Y5VC 4JREB 2GTWA 4TNWK 1HHIA 3IU4L 4JZJB 4Y16C 3TBYA 5SWZE 1T04A 2BDNL 4PJDB 4C4KO 5TDNB 1NUNB 5C09A 4KV5F 3MYZA 1QRND 4YDVA 1EVUA 3AAZB 5KN5A 3G6DL 3MTRA 1B9ZA 4JREC 4PJBE 4O2CB 4JB9L 4JZJC 3LN4A 3MV8E 2FO1A 1UKTA 3MLVH 2X1QA 2HG5A 5D2LB 1KT2B 2UWEF 4D0BA 4K3GA 5T3XL 5ESAA 3BI9X 4HMEA 2Q20A 2FCBA 3NABL 5BV7H 3ARGD 5DUMH 4JJ5A 5GS0C 4MJ2A 4IRSC 5JORA 2OK0L 3EDEA 3HPLA 3P4NB 5IT2L 4G42B 1FZJB 1T4KA 2GFBA 5LGHL 5LXGL 3CVIH 2VTFA 3BAEL 4UIMB 1KTDA 2WWMC 2VRAA 4U6VL 4UOW0 3WIHL 4ERSL 3U46A 4W68A 5DQ9A 3ULUH 3QJHB 5JXED 2BVEA 3C9NA 4MNGA 2JB5L 1OSZA 3IF1A 3K4AA 3HUJB 3DVGA 3GIZL 1QP1A 4OGYL 5E2TH 1BIIB 2MQ0A 4RDQG 4F8QA 2HA1A 1MREH 2BXZA 3FN0H 1CBVH 1I85A 1RU9L 5I76B 1JGEB 3GSUB 2FL5A 1KB5L 4F37F 5CJXA 3JWNC 4OLWH 1TMCB 5TH2B 3GHEH 1F00I 4MNQA 5T5FL 2VNCA 4NNXB 1AKJB 3EYOA 4TULH 3CDFA 1X5ZA 1LWRA 1XZ0B 2VN7A 4X7CC 1D5MA 4HHAB 4NN6B 4TSCH 1BFTA 3QNYB 3UYPA 1DQTA 5FKAA 1A9EB 3SJVA 3FQTA 3UAJC 2ZKHH 4FZ8L 5GJTL 2FH8A 2AJYH 1YNTB 5I66B 2C5DC 1IAKA 1QSEA 1GGCH 4J3SA 5IB4B 3C5ZB 5JA8B 4IOSD 1A7QL 2EDXA 4NN6C 2OCFD 4P2RD 3MROB 3FT3B 3OZ9L 1A4JA 2OQJA 4ONGL 25C8H 1KEGL 4YDJA 2DQFB 1OQOA 5IK3B 2UVFA 5DJCB 3U9UA 1MHHA 4XMPL 3QEQB 2I9LB 3G5VB 4UQ2B 3C5ZC 43C9B 3SDCD 3T3ME 3I6GB 5T1MB 5IW6B 1CDHA 1DBJH 4G6KL 5DHYB 1KCVL 4NZTH 4XP1H 2F8XC 4AL8H 4ODBD 4KH2A 1CD8A 2B1HL 1T21B 1Z3GH 2MSPA 1J0JA 2ADFL 5GHWH 1G7JA 1PYWA 3BUYB 1MF2H 4UAOB 1LP9B 1G9EA 1MJ8L 5KSUA 4CKVX 1P2CB 5D6CA 3QEGL 3EUUA 3W0WA 3GMMB 3IAPA 2OR8A 5K9QG 4K7FB 1KPUA 3BPLB 1CDCA 3BDXA 4UAOC 2JCCF 3SOBH 4MDIB 4XH2B 1YEKL 5MENA 4PRPA 3MPCA 2I07A 3DNKA 5SX4I 1U95A 3FRPA 5J9PB 4NZUL 3BPLC 2A6DA 4Y5XC 1HSAB 3U0WL 4O00A 1DR9A 2PR4H 3PHOA 4L5FL 3VFNA 3I9GH 3VXSA 1QQDA 2B8OT 1YN6A 4LL9A 3D48R 4OLXL 3O6FD 4H88L 2F74A 4YPGA 3WNNA 4DZBA 2RHEA 2V5SA 4WW1A 1RIUH 3SCMB 4P9HH 4LCWE 2DTSA 4OF0A 3OPZH 5E6ID 2ZWLT 4F7MB 3KGRA 2VDLH 1H3PH 1Z9OA 4HKJA 4GRLD 3MV7B 1LNUB 1NMBL 4G7VH 4ZTPH 1NLBH 2VLRA 4WU5A 1JV5B 2QADB 3U1SL 3WO3B 2BCKB 5I1CH 1DBKL 3HI6L 5MEQB 4KJQC 3OR7B 1LEKB 3MMEA 4TTDC 4Z7WE 5KSVB 5ESVB 5JO5B 3NZ8A 4GAJH 2Z91B 3H9YA 4M02A 1IZKA 2X4NB 4WTXA 5FYJD 4IMKA 1WFTA 1C12B 5HGHB 3VFUB 2A83A 1T89C 3NFNA 4GW4B 4PGDB 3BIAX 4PJAB 3NA4A 4PBXA 4FFYH 4DZ8B 3QCVL 4PP2B 1S7SA 1IGTA 1NCBH 3STLA 5BS0B 3VXPB 4D3CH 3KPLB 1JNNL 5ILTL 1F6LL 3QH3B 4UT6H 3H9SD 3PXHA 3UJIH 2HMIC 3S35L 4PTTB 2X4UA 1PBYA 4F7PB 2ED8A 3TVMB 3MRHA 4BSJA 1S7QA 5D1ZB 3SKMB 1IRAY 4NKDA 3GSWB 4J4PD 4JDVA 3BIBX 2BC4B 2DQHH 3BGFC 2VIRA 3F7PC 2XQYG 1EERB 4LSSL 2JIXB 4QNPF 5JW5A 3FQWA 2IMMA 3RY5A 2X1PA 2PUQT 1CDIA 2HP4A 4I2XE 4PFEA 5IOPB 3ZDZE 1KJ2A 5D1ZC 1TENA 5HHOE 1S3KL 1ZA3A 3FB6B 3V79C 4W6XB 4DN3H 1GZPB 4I4WB 3G08B 2NY4D 3HPJA 1L9NA 2Z4QA 4NO2A 1DP0A 3WEXB 3SKOB 4LLAA 5DTFA 2FZ3B 2MWCA 5HGBB 2NNAA 3QJFA 1U8HA 3U7YH 1MRDH 4P0DA 4WEUD 5I15L 1YYMH 4KQ4H 1EFXA 1YPZB 1GGUA 5FO9B 5SWQB 2YZ1A 4OT1H 3TO2A 1SBBA 1FAKT 1YN7A 3REVB 1XMWA 3BDYH 3O6FA 3SGKA 4HIJB 4I0PB 2C1PA 2BY0A 2XTJD 3VJ6A 4ZFZB 2PCPA 1U8NB 2W1NA 3SE8L 3REWB 2C7UB 2Z31B 3N1PC 3OKMB 4JGJA 3T1FB 1OAYH 4U3XA 4I0PC 5ICXB 3AGVA 3T0XA 1XF4A 4FXLA 2FR4A 1DE4A 1I8MB 1N0XH 1YA5A 3BO8A 2C1OA 5HHVL 1NKOA 5F89A 2P8MA 3HNSL 2Z31C 3DV6B 1J8HD 5K9JL 4EEEA 3X11B 3VGHA 3X14B 3IFOA 5I1GL 5IESL 4F3FB 4ZD3L 1WT5C 5KS9E 3K4DA 3SDDB 1I7UA 3S7GA 1RK0B 2JB6B 4BQCA 5ICZB 3GBLA 1QNZL 4HWNA 5DJAA 1K6QL 3VGBA 3MV11 2R0ZL 5IFJB 1MCHA 2BMKA 4ETQA 4JVPA 4BH8A 5BQ7A 3IDXH 4HGKC 2CIKA 4PJFE 3SDDC 1QO3A 3T4AB 5I73C 2A6KB 5F96L 3G04A 4L3CB 3WLWC 4ZO6A 4ZFGH 5H37G 1CFVH 4IIQA 1UJ3B 5F9JA 3W5MA 1N7ML 3CUPB 2DKSA 4XPAL 4BFIB 2P7TB 5E7BA 3HG1B 2OJZH 1U8IB 2IANA 4IS6A 4XNUH 4KQ3L 4Z0BL 1RZJL 2DL2A 3A6BH 4JEGB 2NXZC 4EI6A 1NEZG 4GG6F 4LKXB 1X4ZA 1K3IA 4NQED 1MWAL 4K94C 4J2XA 3HI1A 4JLRB 1KJVA 1UJ3C 3FO1B 1AXTL 4YQXH 1VGKA 2OJEA 3D3VE 1DQLH 4JAMB 3RX5A 1CXKA 1G7LB 5DJDA 3VFPB 4NUJB 4LIQH 4L8BA 5BOPA 3H7LA 4KRPC 2DLHA 4NBZB 1LK3L 4UT7L 3UZVB 1I1FB 1J12A 1P7QB 3S88H 1UH3A 1QA9B 2R2HA 3DSNA 4PJ7F 1KN2L 3RPIB 5F9AC 2EEBA 4FQ1L 1YMMD 4PJ9B 3JWOL 2YMXL 2VDKH 5C2UB 4HS6B 2WUBL 5ECJE 2R2BB 4BK5A 1MFDL 4JFOA 1AQDB 1VDGA 1G7PB 3ZDXF 1T3FA 1QLFA 3OKEB 5IV2B 1DUYB 5T1KB 3T3PE 3IDNB 2LABA 3C60B 4FQLH 4PJ9C 2VL4A 2P5EE 1UH2A 3VDCA 1NCAH 3CX5K 3E6FB 1CVSC 1DFBH 3QQ4A 1S8DA 4LBEA 3RWFA 4Y2OA 5D7SH 5DZNA 3RVXC 1KYOK 3O6LL 4Y1AD 1QVOB 5C0IB 3RNKA 3C60C 2VXUH 3ZLQC 2VDPH 1K8DB 1QKZL 3KYMA 1JGDB 3GMNA 1L0YA 4M9PA 5CEZH 4JFZH 1NMAH 1V7ML 3CFDB 4RRPG 2C4XA 1HINL 2W65B 5D71H 2AK1L 1VKXB 1BZ9B 1RJZB 4ZOEA 4JPKL 3CPLB 5E2UH 3HC4L 3PV6A 1MJUH 3IFLL 5L2KB 4FTVD 4G9FD 1WWAX 1G9NC 4LK4A 2GITA 1P7HL 4NN7B 5E5MB 2IBZX 5C09E 5GSRA 1LO0L 5A16A 3GI8H 4X7SL 1HXYB 2FLBT 3BKML 3B2VH 1Q9KB 4PJXF 3AM8A 2DQJL 3NCCB 1G7HB 2OS7A 4OZFB 4NC0B 2YK1H 4S10A 5C7XL 3ALPA 3LKOA 4QHLB 3H9ZA 3P4OB 4JFYB 4NN7C 5TGBA 1Y6MR 4GUPA 2F15A 5T3ZH 3HZMA 3QDMA 3Q3GB 3MNWA 5CBEA 2P42B 1UACH 2VQ1B 4L29B 1JWMB 3MCKB 3FQXA 4R0LB 1U3JA 3RWDB 2OR9H 4BKLA 2A9NL 4MZ2A 5IB2B 3LHPL 1B0WA 3OB0H 4EUPH 1FYTB 2KQMA 3P0VH 4GMTL 3VRJB 1LK2B 1Q38A 3PWPB 3CH1A 3VG0H 5CEXB 4MAYC 4S1QH 3PGDB 3QEHA 1FAIL 1Z6JT 4R0LC 4MNGE 1S9KC 1PG7W 3V5DA 5EU7C 2C3VB 4DW2L 5DHVA 1T66D 2H32H 3MLWL 4IRJD 1DSFL 4HZLA 5GGVL 3RY4A 5IUSA 5T1LA 5IB5B 3E0GA 3OXRB 1BD2A 4JZOA 4NCDA 4K7PX 3MLYL 3QCTL 4HCRH 2DYPA 2FD6H 4AMKL 2FATH 4MNQE 5J11B 1RFDL 1UZ6E 1AGFB 3H3PL 4DK3A 2HT3D 3KG5A 3L3GB 1S9WB 3BP7B 2ZUSA 4E41B 2YUWA 5IVXB 4P5TD 3ULVC 4UQ3A 4R7NB 2P49B 2DF3A 2VQTA 4HKXB 2O5YH 1ZGLP 3OKKB 3SN6N 5I8EA 1ZK9A 1QFHA 3WSQL 3MLXL 3SJVE 5GS0H 2HLFD 5JHDD 2DIJA 4GKZA 5DLMH 5HY9A 1HSBA 2EIZB 4PJXA 5IFAL 3BZ4A 5DUBB 1NFDB 4XBEH 2XZCL 4NP4L 1S9VA 3BQUD 3G6JA 4URTB 1QSEE 2A77L 4PY7A 1I7RA 1JWSB 1IT9L 3G5YA 3FMGH 4C57C 1XGUA 1FFNA 3W9DA 4KJPD 5DD5H 1JHKL 4G8EA 5LQBL 4LEOB 2HWZL 5FV1L 2Z35A 3RP1A 3RKDC 4WU7B 2QSVA 5DURD 3UTPD 3QUXD 3QSKB 3P9LB 4BQ9A 2O26U 3CFBA 1CVRA 1D5IH 3TP4A 2VLKB 1MIEL 1INDL 1DDHA 1I4FA 5AEAA 2X4PA 1F6FB 2ICWI 2WP3O 3O2VL 4U2YA 1W72L 4Z76B 1ITBB 3MRLA 1MCLA 1DBAH 2YD5A 1N26A 2WMPA 5C07D 2FO4B 4NKIH 4X9HA 4HS3A 1IGMH 1RZKC 3WHE0 4R4BB 2MCPL 3BYYA 4PRDA 4ODVH 3CX2A 1GXEA 2IGFL 2W60B 1IEHA 1FNSL 4QTHB 3GSVA 3QXWA 4XAWH 2EKSB 4Y2DB 2ADGB 4B53A 2QSCL 3FO0H 5B8CB 2J5LB 1NDGA 3W0WE 3MX0A 4NHUB 4UV4H 5FGCE 3PWNA 3TWCL 4XVJL 2EDFA 3VWJA 1R3JA 3L7EB 1F8TL 1N64L 4ZO7A 4OD3H 4ZAKD 3BPCB 2AGJH 4LKCA 1ONQB 2B0SH 5KJRL 4U6TA 2PYEA 4G7YL 3SDAD 5JW3H 4NQDB 2J5LC 2H26B 2E9BA 5MENE 4PRPE 2HTKC 2F53A 5KG9A 3WHXA 5L9DH 2Q8AH 3O3AA 4HUUA 1JGLL 5E00B 1PKQB 4FFZH 4XP4L 4P3DA 4L8SB 2V7NB 4NQVB 3VXSE 2W0FB 4G8GD 1N5YH 3MV9D 4LLWA 1K4CB 1I3UA 3X12B 5I17A 4JKKA 1ZV5A 2ZSWA 1YDPA 4P5TA 5I74B 3GJFA 1MFBH 3LB6C 4UZGA 2R4RH 4PJIA 5EIVA 5IHZA 2YSSA 5EC2A 3D85B 4L8SC 4WCYL 3GNMH 5JHDA 5IJKC 3U36A 4P2OA 3NFSH 4GRWF 5F6HI 1U3YA 5EUOA 5DFTA 4DKEH 1MVUA 2VLRE 3NCYP 2OP4H 3HZVA 4YGVA 5EZJB 4X6CF 3O8XD 5I74C 4LEXL 3E2HC 1UM5H 3PABB 1FIGH 4JHZA 3DMMB 2HVKB 5ITBH 1E4WH 1RUQL 1YEFH 2XQBH 2EIDA 5MHSD 1XIWD 4JFFA 2EC9T 3TIDA 1I1AD 2YRPA 2G2RB 5E7FA 5L2JA 3PL6A 3MLRL 4D0DA 5H2BB 5CZVL 3RPKA 4OFYD 3PHQB 4KVCL 4XGZB 3CFEA 4Q9RH 4DGYH 1H15A 4AQ1B 4WFGE 4NO3B 1V7NH 2HYMA 1GAFL 2EYSB 2Z8VC 5B39G 5C0GA 5TE6L 1T03L 4H1LB 3E8UL 5BZDB 1KPRB 3EO9H 4U1LA 1RUMH 1YJDC 1MCFA 1CLZH 8FABB 4ODTH 5MEPB 1NAKL 3OQ3B 1T5XB 3O2WL 3GMLA 3DRQB 2Q7NA 1KIPA 2YRLA 5FECA 3F7QA 1LO2L 3O2DH 3Q6GL 1FV1B 3UTSB 4CW1A 4TOYL 2AJZB 1S5HA 2DMCA 3FB5A 4H5SA 4KK5D 1EO5A 1KB5B 1KELH 1GJIA 3O6KH 5FCUL 4ZAKA 3NFPB 3MLZH 4UNUA 2EDEA 1BFOA 4XPTH 5J1SC 1ZVSB 3O3BA 5HGGS 5L7XL 4XPHL 2V6HA 4R2GB 2GAZB 4PLKD 4PD4J 4GJTB 1TJHH 1KPVA 4ZNEA 3MLTB 5DD1L 4JPWH 4OJFH 2PW1B 1BMGA 3ARED 3X3GH 4DCQB 3BPOC 3UBXG 1IQDB 2Q8BH 1T5WA 4R2GC 4EDXA 5DK0B 2O5ZH 1QSFB 4MMXC 3WXVH 3DX7B 3QUMH 3IKCA 1CN4A 4JHAL 2RCSL 3QI9A 3LV3B 3RX8A 4N0UB 4YDIL 3CNKA 3F58L 3PGCA 3KJ6H 1KENH 3NPSB 4Z7UF 1OSPH 2FX9L 1HOCB 1FNFA 4I3RH 3UYRH 5BVJA 4LOUD 5HYJD 1OW0A 3L3IB 5EB9A 2H6PA 4XI5D 1C5CL 4XCEA 5TE4L 3TO4D 4ELMB 3QO1B 3PQYD 5CCKH 2J6EH 1FC1A 2APVA 2KUTA 3V6OC 3BDBA 1INQA 1AO7A 4X6DF 3NPSC 4IMLB 2YD1A 4M8VA 4HK3J 1E6OH 5TPWL 4QGYA 4YNYB 1JZ4A 1FDLH 1S9XA 1WZ1L 2VSDA 2XWBA 1NCCH 1NCWL 3IS1X 3MSPA 3RTQA 1FN4B 3FFDB 4LCUB 4YFDB 4MB5A 3PWVB 3BRFA 3I02B 1MHPH 4FQXC 4GSDH 3ZMRA 1NBVH 5C9JA 5IB1B 2AJXL 1CXIA 1S78D 2MMXA 2FGWH 3JTSA 3HZKA 3OL2A 3ARVA 1ZT7B 4PG9B 1QBLL 4U6YA 3V52H 5JOEA 4HWBL 1P9MC 2JF1A 5CJOL 5EBMB 4PJCA 3AB0B 3VFOB 4FN0A 3CD4A 1OAKL 1QBBA 2I60H 2IANE 2E7HA 3KYKL 4JO4H 4HGWA 4QGTA 1CFQA 3MXWL 3WV0A 2OLDA 4GKSA 1J10A 1WC7A 1KC5L 3D25A 4MXWL 4Y4FA 3OAUL 3AB0C 1CXFA 1FZOA 1VACA 2IAMA 1EHNA 4U1HA 4M1GH 4L3ED 3UJJL 4JY6A 1MFCH 4MXVE 5C0EB 2YPKB 3CXDL 3CAFA 3ZHDA 1HZHL 5C6WH 4XCYB 4U1SB 4S2SB 3HRPA 2CMRH 3P40A 4HJGA 2UZIH 2KKQA 3VXRA 2D7MA 3DXAA 4O9HL 1T2QL 3T0WA 4E9LA 4YE4H 1NGQL 3IS0X 5JOPE 1DL7L 8CGTA 2X09A 3FL7A 3C2AH 15C8H 3RAJH 1LO5B 4LCWB 3JV6B 1UM6H 2VUYA 3LN9A 2WIIA 5EU6D 1A6AB 4PRHD 3IDIA 3S34L 3RWGB 3TA3B 1IM9D 4NZDA 3KYOA 4OSUH 2BHYA 4YHKH 1G0DA 4K94H 5H94A 1I8IA 4OZHF 5L88L 2DOCA 4X7FC 1NC2D 4Y89A 3VWKD 4HUKB 1DLFL 2BJMH 3MFFB 5F3BA 2ICEB 1YEEH 2G75B 2FJFB 1MRCH 1OAUL 2B4CH 1X5FA 3HB3C 4OQ1A 3KR3H 4QRSB 3TA3C 4OCRL 4ZYKA 2ENSA 4FXGB 2K7PA 4O58H 4PRBB 2Y5TA 3FFCB 3D0VB 1J7VR 1AR2A 5KVMC 1TDQA 4JG1H 4QHUB 3V8OA 3P4MA 1XF5B 1KLUB 1BWMA 3MRDA 5TFSH 2AAVA 5HI3C 3MRKA 2JKXA 2JJSC 2UZYB 2GJ6A 1WBZB 3HAEH 1DQML 4JKPH 5C0FB 1EHAA 5EZIH 4OZIB 1MFAH 3O3DA 1U42A 2FHFA 2VWEE 2AK4D 3FAWA 1VFUA 2OBGA 3QISA 4JO1L 1RIHH 3SO3B 1KCLA 1PY4A 4FABH 1NC4D 4P9MH 3N06B 2EYRA 3DTXB 3QUZD 4QT5A 4MD5A 1S9YB 2CDGA 3L1OL 4I77H 5IW1A 4FP8H 4LLMA 3OAYH 3OKNA 1R5WB 2HFEB 5AYUH 4Z6AT 3BMVA 5HYFA 1U93B 1PSKL 4OLEA 3QDJD 5JQHC 2A9ML 3QDME 2F58L 3SO3C 4Y19B 4LCIL 5JHLH 4I18B 3VE0B 3KLHC 3MOQA 5DMKB 4K07A 5CEYA 2WBJA 4M8QB 2OSLA 3TH3T 4IOFD 2Q3AA 2M2DA 5JTWA 3ELAT 3LKRA 5DVMA 1BVLA 4WW2F 3L3DA 4J3VA 2DLTA 2PXYD 1HWGB 4I18C 2R39A 5GRUH 3NIDE 4HUVA 3C5SB 1IGYB 1U3HA 1HI6B 3O9WD 3EOBB 4LHQB 2Q86A 5FYJU 1G9NH 5ICYA 1P4BL 3MRCA 4XCCH 1V3KA 2DQUL 5GGVY 1D5XB 4Q7DA 3GUTB 1IM3A 4KJYB 3V5KB 3HNVH 1ZLVK 1BD2E 3WNKA 3ARYA 4JPVL 5DD0H 3V4UL 4HPYL 2UY7A 4PREB 5I2IA 4KJWD 2EH7H 5I75C 3TCLB 2YPLD 1QFPA 4M1DH 2VISA 1QTYT 1FBIH 4IOIB 3TYGL 1NSNL 3TT3H 4FMKA 2EXYC 4HIEB 1B90A 4M61A 4DVBB 4R26H 1NANH 4M00A 1CT8B 4LSUL 3RU8L 5CD5C 2YD8A 1ZA6A 1DBML 1RUPL 4PJEF 3U0PA 2H3NA 3IDUA 4OZFH 1RHHA 1XCTA 1ORQB 4XAKE 4X4YB 3QPQC 2W9DH 5DRNA 3DETD 4HH8A 3H3KA 3CXHK 1NDMB 1ZLUK 3G6JE 3O41A 3HE7D 2AQ2A 3KPPB 5HI4D 2AV1A 3FN3A 1JF5A 4D9LH 5GGSB 1HDMB 5I1JL 1C1EH 2NZ9D 5FHBH 1DEEB 2ATPA 2R1YA 3QG6A 1MWAB 3FHQA 4EN3B 1Q0YL 5AUMB 1Q8MA 1BIHA 1R3HA 3A67L 3CCHB 2WAHA 4OFKA 1MLBA 3VFSA 3MLSH 1RZJC 3H9HB 3MNVA 4NWTH 4YHPB 4PV9B 5I1KL 1VEPA 1I7TA 5DA4A 4TN9A 3MA7B 3NTCL 1EVTC 1A1MA 5FYLH 3F6IA 5IHBA 3ULVH 1I9RL 4P5MA 5ALCH 4PRNB 2UVEA 5D1XD 3O3EB 1IKFH 2E8YA 1MIML 1UA6L 4WO4D 4JM2A 1MCWM 4QTIL 5J12B 2NY3D 1SBSH 4MLSA 1JTTA 1FE8H 1PX3A 4YHMH 4K71B 4YGAB 4NGHL 4M7ZB 1NCUA 1EXUA 3D2UB 3JWDL 3KPRB 5CD3B 3TT1L 3MACH 5A2FA 4F58L 4QXUL 2A1WL 2HN7A 3MZGB 4MXQC 2EH8L 3P73B 3ARPA 5J12C 1XF3B 5EU5B 4YHNA 3JWOC 1MY5A 4WI2A 3RZCC 2PYEE 4LDLB 1F5WA 1IEBA 1TCRA 1FL3B 4M7ZC 4OI9A 1MLCB 4L4TB 4OKVA 2F53E 3IDMB 1XT5A 3TZVB 1PQZA 5KVEL 4N9GA 4JFED 1ZVHA 4HC1A 5I16A 2RFXA 1G6VK 3VXTB 2P5EB 4CDGC 1VSCA 3LS4L 1RZKH 2VQUA 4L4VD 1MJJA 2C3HA 2VITB 3UZQA 1Y18B 2X9XA 1G0YR 4MVBC 3HN3A 4PY8J 3TZVC 1XGQA 2JJVA 3HLAA 3O4LA 3F5WA 4NO5B 5HYQB 4LRIA 3UROR 1OGAB 4PJIE 1EMTL 1FL5B 4NUGH 5BRZA 3QYCA 5B3NA 4TYUA 5CJ8A 4Q6IB 4WHCA 4XMKL 4C56D 3S97C 5EUOE 1RUKL 4OAWA 1T7VA 3FCTA 4M4PA 5JPMB 2CKBH 2HRPL 5CZXD 1T1ZA 4ZNCD 1HYSD 1AXSB 4XNQB 3NCJL 4MWFB 5IMKB 1T83C 4KK9D 4Q6IC 2EDJA 3OSKA 4XNYL 1NH6A 4QRRD 1REIA 4RMUA 4JFFE 4OZGB 2H9GB 3GFUA 4JFQA 2XZAL 1J18A 4NRXA 7FABL 1BM3L 4TVPE 4YDVB 4AT6B 5KN5B 4XVUD 3CIQA 2R2EB 3LZFL 2BY3A 5AZEH 5IBUG 3X13B 4X9IA 2ZG2A 4RIRB 4U0RC 1AHWB 3T0BA 3GMRA 1VFMA 1CF8L 2AJSL 3TGXA 3KPNB 2HJKA 1VADB 1ZHKA 1ZLVH 5D4QA 3S5LB 3FB8A 5GGUB 2Q76A 4XP6L 5B4MD 3MOAH 4OLVL 4U6HA 1YY8A 2BNUB 4HKZB 4OZ4B 4W6YB 1AHWC 1BBJB 1L7TL 2GFBB 4ZUWA 1DQDL 5J57B 4LVOB 4YJZL 2Z0BA 1KTDB 1F3DJ 5B39A 5EBGA 2AEIT 5F7FA 1FVCB 3IU4H 2ZOKA 2FJGA 3VRLE 3IF1B 1OSZB 3UTQA 3F12A 4YIQA 5E56A 1LE5A 4LVOC 5DJYA 1U58B 4OCWL 1KGCD 3CMOL 1HH6A 3WHE1 1G1YA 1GGIL 1RK1A 4JB9H 4ZNEE 1YECL 3ULSB 5E2WL 4MNQB 1FZMB 4AM0A 4HH9A 1OM3L 5IP4A 1X4YA 3Q2CA 3ZZ1A 3F7RA 4NCC2 3N0PB 4ZXBA 1B0RA 1U2CA 5T3XH 1I85C 1Q9WB 2DDQH 3B9DA 1YJDH 3P30H 1UB5A 1R3IL 1EO8L 2XTLA 1A7BA 2OK0H 5DSCB 5IT2H 4KROB 5LXGH 4F7TA 4RZCA 2HRLA 2DQIH 3T0ED 5AAMA 1IGIL 4QWWD 3I6KA 3RJQB 5CSBA 4U6VH 3T65A 4F7EA 1IAKB 1QSEB 3MREA 4MD0A 5IR1B 4ERSH 3I2CH 2UWEB 5IROC 1W72B 2DKMA 2JB5H 2OQJB 4KROC 4YDJB 3RWEB 1RZ8B 4KKBC 1MHEA 1A1NA 5SWSD 4OGYH 4HV8B 4HPOH 3U9UB 1WCQA 2XFXA 3JVGA 1AO7E 3MRIA 1BBDL 1IAMA 5HJ3A 35C8L 3EHBD 5FM5O 4GBXA 1RU9H 2QHRL 4I48B 2ZUVA 1KB5H 4UILH 5EUKB 1NLDL 3VFVB 4KAQL 4O51A 3QXAA 1QRNB 3K81A 4OCXH 5IB3B 2ZUXA 2ATKB 2NX5A 3TBSB 3L7FB 3PDOB 2W0KA 5MP6H 3C09B 3HS0A 1H8OA 1J11A 3WE6B 3BKYL 1BVKA 1BJ8A 1BHGA 5EA0L 2BZDA 1IEAB 5FO7A 5IHUL 2YR3A 1FFOA 3ARGB 1UVQB 1W0WA 4IDLA 2D03L 4G6JL 3C09C 5CP7B 2SEBB 2QQKL 5I1IL 1A7QH 4PJCE 2NXYD 3UTTD 2V17L 2OXGA 4ONGH 4R90L 3VMNA 5D5MA 3B9KA 5D93C 1A14L 5C0ND 4X5WA 4JHWH 1UWEH 4HMDA 1MQKL 1QHPA 3T0AA 3ARGC 2OMNA 3IJSB 1YEDB 1CQYA 5FXCH 3GBNL 2DLIA 3BSZL 4GKNB 4BSVA 4MA1B 4LSDA 5T33L 4N0FA 4XMLL 4MB4A 1SJEB 2GUOA 5JR1L 32C2B 4EJ1C 1R24A 4G6KH 1H3WM 5JXEC 5GISL 1N5AA 3DYOA 3C08L 1QQDB 1OP3H 2GK0B 1K8IA 3EJJX 2B1HH 1QRKA 4MA1C 1E4XH 4XC1L 3GZKA 3VXRE 3DXAE 4XCNA 2YC1B 3P77A 2ADFH 5D7IF 1H3UA 2YUVA 4Q9QL 2NY2C 1JNHA 3BESR 2D3VA 3QEGH 2N4IA 5IVOA 4PJ5D 3RVWD 4X4XB 5FOJA 5I1HL 3RHWF 4XNMA 3UJTL 5CINH 4NRZA 1NGWA 1WWBX 3QZWB 4BUGA 3U4EA 4KUCD 5D7KE 4TQEL 4P2RB 4POZC 1D6EB 3DBXA 4OCYL 4APQA 5E8OA 1QZ1A 5KVDL 1BREA 4ONOA 3EO1B 2LFGA 5SWSA 4HXBL 3WLBA 1A0QL 1IC7H 1ZXQA 1KB9J 4NFCA 4L8DB 1F4XH 4NZUH 3NFNB 3QUYD 5E5RB 4Y5VA 3U0WH 2NTFB 2ZJSL 3DV4B 4JM4L 3SDCB 4Y16A 4L5FH 5DS8B 2IH1A 3VD3A 3MRNA 3KWWA 3GSXB 1HHGB 3RIAF 1ZSDB 3V6ZB 2JCCB 2YPVL 3UTZB 2EEAA 2QQLL 3STLB 4AENA 1I9EA 4H88H 4YBLB 4OZFG 5FA4B 3SQBA 4K7PL 1ADQH 4GH7B 4HCRA 1RAMA 3DVIA 3SDCC 4JZJA 4GOSA 2GJ6E 4KUCF 4M93B 4X4ZA 4ZUUB 4PB0L 3MRHB 1BAFL 3GSOB 4JDVB 5TDNA 1MCNA 4FMFA 4PJ8D 4XPFL 2J8UA 4YBLC 1OL0A 1EEZB 3IFNL 5ETUB 5TE7L 3U1SH 3AAZA 4CNIB 3K0WA 4O2CA 1DBKH 2XKUA 4M93C 4AY0A 1P4IL 4X0KB 4OD2B 4NBYB 1KT2A 2D31A 1KXVC 3KPTA 1JFQH 2O61B 4NYLA 2FSEB 3R1GL 2OR7A 1F02I 2P8LA 1UWGL 3P4NA 4G42A 1FZJA 5SV4A 3GMOB 3ILQD 4XWOD 3QJFB 4UIMA 1I9JH 1IILE 1KOAA 4W4OC 1XR9B 4RQQB 3VI4E 5K59E 1KTLB 2OZ4H 3L5JA 5ILTH 1FO0L 1C08B 1JMZA 1MCOL 3QJHA 3S37H 3IJHB 3LKSB 3WS6C 3UDWC 3S35H 5GRZA 3O6FB 1QFWM 5HHMD 3HUJA 1MH5B 4UOJA 4Y88A 1BIIA 2APFA 3VGFA 4LSSH 2PETA 3VFGH 3F6LA 4PJGF 5E6IB 5I76A 1JGEA 3GSUA 3HC3H 4GRLB 1PAMA 5TH2A 3O6FC 2VZ1A 2FB4L 3V6FB 1AKJA 3UPCA 1FNLA 1LDSA 1S3KH 1DE4B 3OV6A 1XZ0A 3WXWL 1CWVA 1RY7B 3GM8A 4R96B 5E6IC 4HHAA 1L4IA 4KMTL 4FQHB 5CAYB 4GRLC 1A9EA 5CHNB 5JNYB 3E3QC 4TPRL 4PRAB 1Z5LB 5HI5D 2EDQA 1KXQE 1S7VA 1YNTA 3RUGF 5I66A 4AZ8A 5FK9B 5IB4A 5IFHL 1JZ5A 2Z8SA 1NCTA 2YA2A 3V4VL 3MROA 3FT3A 4RISL 5TF1L 2DQFA 5IK3A 5DJCA 1CFSB 2DWDB 3H9SB 1EX0A 1G9MC 5FUCC 4BH8B 3QEQA 2ZSVB 2BHUA 2I9LA 3S8WA 4UQ2A 3SE8H 43C9A 3KLDA 3G04B 3MLPA 2ADJB 4NOBA 1OTSD 3HFML 1QLRB 3GDBA 1X9QA 1KG0B 5T1MA 4IIQB 5IW6A 4X98B 2CGRH 2BNRD 4NN5C 3S9DB 2FDBP 4KKCC 5DHYA 3OXSB 4UT9H 4ODHH 5HHVH 2J4WL 4HSQA 1F3DH 1T21A 1CGUA 3HNSH 4J4PC 5C0BD 4LSPL 3STBA 4IIQC 1BFVL 3IDGB 1VGKB 2OJEB 2YD6A 5BO1L 2NY4B 5I1GH 5E70A 3BUYA 2N56A 1LP9A 3MA9L 3LKQB 4ZD3H 3TFKD 4KXZH 1P2CA 4HF5L 3TN0D 1PZ5B 1J86A 4YZFF 3T1WA 1GZQB 5FYKD 4C55A 2ADIB 4K7FA 2R1WB 2NY4C 4K3DL 5F9DC 2R0ZH 3TM6A 2PW2B 2V5MA 4M48L 3RVTD 4MDIA 1R6VA 4WI8A 1NGXA 3H42H 2XTJB 4X80H 3TYFB 1GGBL 5J9PA 5KSAD 3ZE2F 4XPAH 4JFOB 1SEQL 4RNRB 4HIHB 5DC0A 1TXKA 1ZMYA 4DAGL 4Z0BH 1F4WL 1RZJH 3LKNB 4DVRH 2I27N 1BPVA 1PG7H 4WIQA 1H3GA 1GOHA 1I3GH 1NCDL 4UTBL 1I1YB 1TVBA 2XTJC 4XP9L 1AXTH 3K3QA 4U3HA 1KTRL 3WIIH 4QXTA 4CRPA 3RWFB 4WI4A 4GLRI 2NLJA 3ZKND 4CJ1A 3SCMA 2DI7A 3LDBB 4X6EB 3O4LE 1J8HB 4RAUB 4Z7OF 5BRZE 3ZKMD 4D9QD 3KYMB 2Q7YA 3GMNB 3MV7A 2VJXA 1LNUA 4OV6F 1LK3H 4UT7H 4J7RA 4X5LA 1T89A 4GG6B 1JV5A 2V2WB 4XRCB 4JFXB 3ZDYE 3LDBC 4Q0XH 4YEFA 4HAFA 1KN2H 5MEQA 3OR7A 1LEKA 5KSVA 5CMAB 1X44A 5ESVA 4FQ1H 5JO5A 4AIOA 2Z91A 4H1LG 3KHOA 2X4NA 4NC2B 4WHTB 1C12A 1H8SA 3VFUA 1MFDH 4PGDA 4GW4A 3T8XB 1Q1JH 2AEQH 4PJAA 2GITB 3AXLB 3SPVB 4DZ8A 3KPSD 4PP2A 3DOSA 1RMFH 3TH4T 1PY9A 3CC5B 3MODL 4PJ7B 5BS0A 3SE9L 3VXPA 5CFHA 1E28B 3KPLA 2PNDA 2VWEC 3LKOB 3QH3A 4NQEB 3FO9A 3O6LH 4GUPB 4PTTA 4F7PA 3TVMA 5GGQH 5D1ZA 4TVSa 2QQNL 3GSWA 1QKZH 2BC4A 5BW7C 2EYTB 2J6EA 3GIVB 5EOCL 1R5IB 1IC5L 1SY6L 1V7MH 2CPCA 3DECA 1KCSL 2JIXA 2R0WL 3EYSH 4O2EB 3QFDB 2BOCA 4BKLB 2H41A 1HINH 2ICWB 4L9DA 3SHSA 4F9LA 5IOPA 2ESVD 2MKLC 4JPKH 2IEPA 4KI5E 2Y25A 4JVWA 5F7DB 4I4WA 5I1AB 3G08A 3WEXA 3SKOA 1B2WH 2N7BA 1OD7A 2R56H 5DJXB 1YMMB 2X05A 5LWYH 4WFFE 2FZ3A 2J12B 3V4PL 4NO0D 4AEHL 3N1GC 3ALXA 5KSAA 3LIZL 5HGBA 5KVGL 3MYJB 1BD2B 2LAGB 2DQJH 2CIIB 4LHUD 3ARFD 4YBHA 5C7XH 1X4XA 1L7IL 1YPZA 5SWQA 3EO0B 1MEXL 5EH1A 2Q3ZA 3REVA 1S7UB 4FFVC 4PYHA 1ES0B 1YC8A 4HIJA 3ECBB 4I0PA 3KLAB 1DLHB 5E1AB 3WFEH 4ZFZA 1U8NA 1WTGT 4JY5L 5GS2D 4FQCL 3SGEH 4Y1AB 3ZT7A 3B9VA 2C7UA 3A6CL 2A9NH 2AXFB 2Z31A 2P5WD 3BZ4B 4IHOA 4PJXB 3LQMA 5C3LD 3OKMA 4RA3A 3T1FA 3LHPH 3VD5A 2YA1A 4PIRF 3UTOA 1QFWI 2R23B 3W9DB 1I8MA 2IPTL 3P0YH 4ORZC 3BT2H 1KJMB 2E7LA 3TPUB 2GT9B 4U33A 1A6UH 3R0MA 4GRMB 1JHLL 3X14A 4FTVB 5GGVH 4G9FB 1UYWH 4F3FA 4P46D 3QCTH 2EE9A 5F88B 3MRQB 3HMXL 3S96A 1RK0A 1RFDH 2JB6A 5ICZA 3I75B 3W11D 2NX5E 4LASL 4NDMA 4Z7NE 4MJ4A 1P7KB 5IFJA 3DURB 1EGJL 1QOKA 2YBRA 43CAB 3T4AA 2Y4SA 5GQBA 2A6KA 5C0CA 4L3CA 1HILA 1AY1H 4CMHB 1UJ3A 2XZCH 3CUPA 4BFIA 3AMKA 2NQCA 3HG1A 4FZEL 5DJ2B 2XN9D 5A3ID 3CLFH 1IT9H 3DX9B 3VGGA 2E27H 3JWDC 4X8JB 1JHKH 4LKXA 3I84A 4GG8B 4NQCD 5D5ME 2HWZH 4JLRA 4LKCB 4CMHC 1MCEA 1T1YB 3FO1A 3BOVA 4KHTL 5SX4H 4JAMA 1D5ZB 1CDBA 2GY5A 1G7LA 3CLEH 3VWJC 2VH5H 3VFPA 1G6RA 1UFUA 3O2VH 4NUJA 4NKMB 2NY0D 4HUUB 3GO1L 1CICD 4IRJB 3SE4A 2H1PL 4PJHF 2IBZY 4LHUA 5T5NF 5ALBL 3ARFA 4DQOH 1I1FA 1P7QA 3U7WL 2G60L 1ZS8B 4YFLI 1QA9A 3ULUD 4J23A 1G7IB 1JZ2A 3RPIA 1T66C 2IGFH 1F11B 4P5TB 4IRJC 4PJ9A 4KZDL 3O0RH 4WI6A 2OYPA 4HS6A 1E6JL 2R2BA 1A1OA 1Q9OB 5JHDB 1G7PA 1HQRB 3QFJD 4AEEA 2BVPB 3TWCH 5IV2A 4XVJH 1DUYA 1IGFH 5T1KA 4P49A 3IDNA 5D2NB 5T3ZE 2HT3C 4L1HA 4Z7QF 1MVUB 1F8TH 5HDQH 2RGSA 1N64H 3BQUB 4P5TC 2W9LA 1JZ6A 3E6FA 4JRYD 5KJRH 4G7YH 1HEZB 4WFHE 5HPMA 3RDTD 2HLFC 5I8CB 2B1AL 3QXTA 1JGUL 3ULUF 4P2OC 1H0DB 1J87A 5D2NC 1QVOA 5C0IA 4KKLD 5DURB 3QUXB 1K8DA 3BQUC 3VXQB 1JGDA 4XP4H 1V5JA 1KFAH 3CFDA 3B4NA 5C6PB 2NY5L 1Z9LA 4LQFH 3ZHKA 1XCQB 5D72H 2DIBA 1QBML 4ZTOH 1C8PA 2W65A 5C07B 3IAQA 1IGCL 4K7PY 1VKXA 2KZ1B 1BZ9A 3QUXC 1RJZA 4C54A 4UTAL 5EBLB 5GRJL 5DMIL 5L2KA 5F97E 2WZPD 2BSSA 2P47B 3GMLB 4PJDE 4M5YL 1RULH 5E5MA 2D0GA 1YZZA 4UUJB 3I3DA 3VXMD 1D6VL 1PJ9A 4Z7VA 4H8WL 2J8UE 4ONHB 5HVHC 1HXYA 4HUNB 5TDPB 3WJLC 4N0YH 1Q9KA 5IMMB 1EIBA 4LEXH 1G7HA 4OZFA 1P84J 3QPXH 3FB5B 2WBWB 2QHLA 3I3EA 4NQCA 4QHLA 3P4OA 4ZAKB 1RUQH 2Y07L 3ZKXB 3Q3GA 1BFOB 1YEIL 3SDAB 1OQXA 1F6AB 3RBGA 2VQ1A 4L29A 1JWMA 1NBYB 3RKPA 3MCKA 3MLRH 4GRWB 4PGEB 4DGIL 3RWDA 4KVCH 5EPMB 1G7QB 4X6CB 4DOHB 3VFWA 1MELA 5IB2A 4W6WB 4ZAKC 3RL2A 2XNAB 1KLFA 3NCFB 5TE6H 1GAFH 2IFGA 3SDAC 4XNXL 1LK2A 2ED9A 2IQ9H 3PWPA 3E8UH 5CEXA 5JLZA 4CN1A 4G8GB 3PGDA 3MV9B 2XA3A 4LQ1A 3RIFF 1ND0B 3O2WH 2C3VA 1WAAF 2VXQL 3RJDA 3HUJE 1NUGA 1NUDA 3BKCL 2A6JB 2J88L 5DFWH 4LSRL 1G0XA 2VN4A 3PGCB 2Z92B 3T2QA 5IB5A 3OXRA 4TOYH 4LVNB 5DHXB 4MQTB 1RUAL 1NEUA 4JO2H 1MCQA 5HBBA 5FCUH 1AGFA 1K9TA 3IKKA 3O8XB 3IVKB 1S9WA 2J8OA 3BP7A 4E41A 1PDKA 4R7NA 4Z0XA 4XPHH 5FF6B 4P5KB 4LVNC 4RFNB 3WDHA 5CIPB 1A3LH 1XIWB 4OF6A 3BHBB 2EIZA 1KJ2H 5DUBA 1I1AB 3O8XC 5JXAL 1JZ7A 3QHTC 5CSZB 1S9XB 5DD1H 2AKRA 5J06A 4ODWB 1JWSA 2BERA 4RFNC 4TNWF 5TDOB 3K8MA 1XIWC 3WFCL 3WFZA 1HKLH 4N5UA 4LEOA 3OR6A 1JL8A 3ILPB 1I1AC 5C9JB 1Q72L 4JHAH 2X89A 4WU7A 2RCSH 4QXGH 1G7MB 3QIBD 3P9LA 4KZEL 3QEQE 3HZKB 1EEYB 3AROA 2VLKA 4WTWA 4UINL 4CUCA 1W2KT 4OI8A 5TQ2L 5ABDE 3QWOA 4Z76A 3RGVD 2LAAA 4YDKL 4YHLH 2FO4A 1C5CH 1S7WB 1LO3H 3AY4C 3OF6D 4R4BA 5GIRB 2HFGH 4GKSB 4M6NL 2W60A 4QTHA 4LSTL 4F8TA 3QO0B 4BM7A 2OTPA 1FZOB 1VACB 3RL1B 2ZNXA 1LP9E 1A6WL 1TQBB 2EKSA 3BYTA 4Y2DA 2ADGA 3DROB 2VXTH 5B8CA 5ACZB 5AZ2L 4NHUA 1NCWH 2XYCA 4HD9A 2R2CA 3L7EA 1FLTX 4U1KB 5C08D 3RVVD 5E8PA 5LAXB 3ZSTA 3X3FL 1AC0A 2R69H 3BPCA 5EO1B 1M71A 1RJYB 1UCBL 1ZWIB 2IAMC 3AREB 3HZYB 4OGXL 1TQBC 1ONQA 1L6ZA 1JF6A 1G9MH 5J4MA 4LRNL 4NQDA 4PLKC 1LEGA 2H26A 3VI3F 1QBLH 3G5ZA 4HWBH 1TPXB 5CJOH 4HJJL 1EUTA 4JG0L 4PLJD 4JE4B 2B7DT 1SHMA 5E00A 3AREC 5BVPL 3KYKH 4IM8A 6FABL 1T20B 4L8SA 2V7NA 4NQVA 5IJKA 2W0FA 2X4SA 1VEMA 5EZLB 5HYJB 4M62L 1K4CA 3PHSA 3MXWH 4RFEB 4Y4HD 3TO4B 1KC5H 4KGJA 3B9EA 4MXWH 3PQYB 3RY6A 3C6LD 2MCG1 1Z0NA 3D85A 4ZYKB 5JDSB 4OBRA 4EDWL 1ZHLB 3VGEA 4MCZB 2Y06L 3MV7E 3VRIB 2OL3L 3VFRB 4XI5C 1HZHH 3P4MB 5EZJA 1UZ8B 4JKMA 1YEJH 3TF7C 1UT9A 1T2QH 3ZYJA 1NGQH 3PABA 2MKWA 2V5RA 3D1MC 3O45A 3DMMA 1N59B 2HVKA 1MCPH 3ARBA 4LSVL 5HHXL 3S5LG 5IEHA 3BXNB 3FQUB 2G2RA 4PJAE 5H2BA 2BSRB