3BQVA

Crystal structure of the double mutant d44a d45a plastocyanin from phormidium laminosum
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
105
structure length
105
Chain Sequence
ETFTVKMGADSGLLQFEPANVTVHPGDTVKWVNNKLPPHNILFAAKQVPGASKELADKLSHSQLMFSPGESYEITFSSDFPAGTYTYYCAPHRGAGMVGKITVEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High resolution structures of plastocyanin from Phormidium laminosum and D44A, D45A double mutant
rcsb
source organism Phormidium laminosum
molecule tags Electron transport
molecule keywords Plastocyanin
total genus 22
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2007-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3bqvA00
4N4YB 2J55A 1NDTA 1OF0A 3NP3A 4UF7C 2XXGA 1ASOA 2JKWA 3EH4B 2VW4A 3FU9A 2FQFA 1IBZA 1M56B 2DYSB 2VM4A 3EF4A 3KW8A 1PZCA 3TASA 2PP8A 5I6NA 4F2FA 5I5MA 2FQEA 5B1AB 4DP0X 1PLCA 1JZIA 1BXVA 2XX0A 3BQVA 1FWXA 3TU6A 1ILSA 5AKRA 4HALA 3H56A 3T6XA 1E65A 4YSDA 5I6OA 4HZ1A 1NZRA 1SF5A 1AAJA 1V54B 1KDJA 2QPEB 2W88A 3MBWB 3OMNB 2NRDA 4W1TA 1XMEB 2QDVA 4YSAA 1CUOA 2Y69B 4GY4A 1PNDA 2BZ7A 4PCYA 1R1CA 2PPDA 3PLYA 2R7EA 1QNIA 5A7EA 3WIAA 1ASQA 2A3TA 1AQ8A 3FU7A 4HIPA 4NAJA 1NIEA 1A4AA 1KCBA 1PLAA 4UAHA 1AS8A 5PAZA 1EHKB 3PAZA 4A68A 4DP5X 4DP9X 2IDTA 1NPJA 3OMIB 1TKWA 1XB8A 4DP6X 1WAEA 2XWZA 1DZ0A 3UAEA 3QJVB 4YSSA 4L0PB 1SNRA 3T6ZA 3C75A 4GYBA 1OV8A 1PZBA 2PCYA 4DP4X 1PAZA 2HLEB 2HX8A 1TEGA 1QHQA 1CC3A 4P5SA 1BXAA 2QT6A 3N55A 1ZDQA 2BWIA 3QJTB 2GHZA 3CVBA 5ANHA 2BW4A 1AZNA 1PZAA 2P80D 2PCFA 1EZLA 1ILUA 3FSWA 2MRYA 1E30A 1IBYA 2EIKB 1XB3A 3AZUA 4WKXA 3UADA 2XX1A 1IC0A 1GY1A 1X9RA 1VLXA 1PCSA 2ZONA 1AIZA 4BDVA 3AW5A 4YSEA 4E9VA 2YAFA 2ZWNA 2EINB 3QJQB 4KNUA 3FT0A 3FQ1A 4HAKA 2DY2A 2CALA 2FT8A 5E9NA 1KBWA 1E5YA 1PMYA 2IWFA 1ET7A 1JXFA 4AKQA 4YSUA 4F2EA 4A2HA 3NJHA 2YXWA 2YAPA 4DPAX 3V9EA 4Q8BA 2IDUA 4DP2X 3ASNB 5B1BB 3FQ2A 5I6MA 1WS7A 1AZBA 1JXGA 1NPNA 4BWWA 3DTUB 1J5CA 6PAZA 1J9RA 3AG1B 3FSVA 2FQDA 2RACA 4QKTA 2IH9A 4DP7X 3X1FA 2BP0B 1JVLA 4HHWA 4CSPA 3NSDA 1UATA 3AG3B 1RKRA 4TXVB 1ET5A 1SJMA 4AKPA 1NIAA 2XV2A 3CZUB 1JOIA 3ZX1A 2QPDB 5AZUA 1T5KA 1MZZA 2YXVA 3S3DB 2IDSA 3S3BB 1AANA 2BHFA 3WG7B 2VW6A 1N68A 4DP1X 2EILB 2I85A 4DPBX 2WO3B 1KDIA 1HAUA 1AG6A 3NJFA 5PCYA 4E9RA 1JERA 2BZCA 3RYMA 1JXDA 3WI9A 5F7AA 6PCYA 3FU8A 2AVFA 2N0MA 2BW5A 3EH5B 1FFTB 3X2QB 4G7RB 4EF3A 1KGYE 3FU7B 3UACA 4DPCX 2IWKA 2GC7C 4KNTA 2UXTA 1JZHA 3NJMA 1GY2A 4PAZA 3S3CB 1BYOA 3WKPA 1URIA 2AZUA 3OQRA 2PPEA 5LDUA 3QQXA 3ZBMA 1SF3A 1OE3A 1GYCA 2VW7A 2YQBA 1ZIBA 2VN3A 4BWTA 4YSRA 2YAEA 1OE2A 2PP7A 1E5ZA 4DP8X 4HHGA 1WA2X 4AKOA 1NWPA 1BQ5A 1J5DA 1M57B 1BEXA 1WA1X 1SHWA 3FPXA 4FA7B 2FJSA 2H5UA 1W8EA 3DKHA 1RCYA 2YAQA 2VM3A 1JZGA 1JZJA 2Y1AA 3CVDA 2GB2A 3X1GA 2CJ3A 2YAHA 4MFHA 3ABMB 1GR7A 1SFDA 3IN0A 2E86A 2XXFA 3T71A 1BQKA 4YSCA 1OCOB 4JKNA 3WNIA 1PNCA 5D4HA 1GW0A 2W8CA 1L9TA 2B3IA 2IH8A 4G70B 4BXSV 2EIMB 7PAZA 1W6WA 3CG8A 2GIMA 4GP8B 1JVOA 3G5WA 1L9RA 2FNWA 4JHUA 1F56A 2VSKB 1YLBB 2UX7A 1BYPA 4KO6A 2GI0A 3CVCA 3ASOB 2DWSA 1QLEB 1V10A 2UXGA 5FC9A 3IEAA 2VMJA 3NJLA 5D4IA 1OE1A 2WSDA 1AG0A 1MZYA 2IWEA 2LLNA 2YAMA 1L9QA 1BAWA 1ID2A 2IDQA 2UX6A 2DYRB 3WKQA 2BWDA 3EHBB 1ADWA 3SBRA 4KOCA 2AFNA 2FQGA 1KCWA 5EHFA 2Q9OA 1HAWA 1KBVA 1M9WA 5B1KA 1MG3C 2P80A 2DV6A 3FSAA 5I6KA 3H4FA 2TSAA 2HZHA 3X1BA 4G7QB 1CURA 1NIDA 3HB3B 2I7OA 3V9CA 4GXFA 4F7KA 2VSMB 5F7BA 2XVBA 1JZEA 1W6LA 2H47C 3QJRB 2BP0A 3T6WA 2ZXWB 4A66A 2B08A 2FT7A 1PY0A 3SBQA 3FS9A 1NIBA 2PPAA 1RZPA 1NWOA 4KO9A 3HEIB 3TBCA 1J9SA 3AG2B 2IDFA 3QJUB 1I53A 3QJSB 1OCZB 4M3HA 1GSKA 3WNJA 2OCCB 4KNSA 1DYZA 2XV0A 1XB6A 1HFUA 1PLBA 4HCFA 3SQRA 3OD3A 5B3SB 2CBPA 2AANA 4E9TA 2BP8A 1OOWA 3BVDB 5AFAA 1L9OA 2HX7A 3FYIB 4NERA 3TA4D 3PPSA 3NJNA 4A2DA 1AACA 4UANA 5I5IA 3ABGA 4KOBA 1L9SA 3NSFA 3ZDWA 2GSMB 3UAAA 2J56A 4A67A 3L45A 2XYBA 2UXVA 5I5JA 4YVNA 4YVUA 2PLTA 1ZDSA 3SBPA 2HRGA 3H4HA 5B7MA 4Q89A 1MG2C 3QPKA 4A2FA 1RZQA 2PP9A 4E9XA 3TBBA 4BXVA 2BP8B 1WS8A 1NTDA 3NJJA 3N2JA 2J57A 3EH3B 2XLLA 1J9TA 3AG4B 1A4CA 2XV3A 4E9YA 2CAKA 3X1EA 4G71B 1V55B 3OMAB 1PF3A 1WA0X 1GS8A 4BDVB 1SDDB 2CUAA 2WO2B 7PCYA 4A2GA 3NP4A 1MDAA 8PAZA 2J5WA 4YSOA 3S8FB 1SFHA 4NB7A 1AS6A 2R7EB 2YAOA 1AS7A 4G7SB 4YSQA 1AR1B 1AZCA 1OCRB 4ZK8A 1CYXA 3U25A 4A2EA 4BWUA 3PXLA 5TK2A 3FSZA 1JZFA 3X1NA 3FYEB 2XUWA 4YSTA 1NICA 3CDZB 3IN2A 3ZIYA 4FAAB 3GDCA 2I7SA 5IY5B 3GXUB 1E67A 2YARA 2OJ1A 4KO7A 4M4RB 1AZUA 1L9PA 2PPCA 1GS6X 1A8ZA 2DWTA 1BXUA 4AX3A 1B3IA 3PCYA 4K9JA 3PAVA 3ABLB 2ZOOA 4QLWA 4AI7A 3T9WA 1IKOP 2OV0A 3FPYA 5D4JA 3NSCA 4E9WA 4W9ZA 2Q5BA 3D12B 2FTAA 1TEFA 4ENZA 1A3ZA 3NJIA 3T6VA 4GP5B 4HCGA 3UABA 4GP4B 2X88A 3KW7A 3FQYA 1KYAA 3CDZA 1NINA 1ZIAA 1OCCB 2H3XC 2JXMA 4E9QA 1FA4A 3AY2A 3PAUA 3IBOA 3JTBA 3OM3B 5B1JC 1TU2A 1ASPA 2GC4C 1SDDA 5B1JA 4KO5A 2FT6A 1A65A 2PPFA 2X87A 1ZPUA 3ABKB 1BQRA 2FWLB 2JFCA 2UXFA 3NJGA 3NT0A 4E9SA 1ET8A 9PCYA 5I26A 1GS7A 2IAAC 3JT2A 1A4BA 2HRHA 2TSBA 4JHVA 4HCIA 4G72B 1IUZA 1J9QA 1AZRA 3S8GB 3NJKA 1ZV2A 2EIJB 3GYRA 1CYWA 1X9UA 4BK5C 5B7FA 3MX0B 4CSZA 1N70A 2HXAA 4AZUA 5TK4A 1SHXA 4X4KA 5B7EA 4N8UA 3UGEA 4RH4A 1AOZA 3NYKA 3ERXA 4YL4A 4P5RA 2QDWA 2XU9A 3DIVA 5I6LA 1ETJA 5I28A 1NIFA 2HX9A 2CCWA 3NSYA 2MTAA 4YSPA 2AZAA 2GBAA 3IE9A 1KV7A 2BO0A 4WTQA 5I6PA
chains in the Genus database with same CATH superfamily
4N4YB 3IFLH 1R3LB 2G9HB 1ZLSH 5DO2D 2XG5B 2FQFA 3POCA 4G6AC 4NYLA 4FEMA 4OLYH 1C08A 3ARUA 1V7ML 1F11A 3SDXF 4L8CA 1IKNA 2A74B 1KJMB 2H6UA 2JVUA 2OR9L 3S5ZA 1OIOA 3VRLE 4XC3L 3WEAA 4XN8A 2F58H 1LL1A 4MGXA 1BXVA 2NX5A 3VXSD 1UOWA 3I2CH 2FJHA 3TESA 5JA9A 3BD4A 4HBCL 4NNXB 2E76C 2CDFB 5F70A 5FOBB 4G3YL 4HF5L 2WCGA 1QWUA 3AXHA 2CDGA 4M9PA 1Z5LB 4HZ1A 4F7MB 2DQJH 1D9KD 5E8EB 5HYJD 4WU7B 4YHPA 1MWAH 3LSOA 5HP5A 1KBGL 5C09E 4ZW6A 1FORH 1MCOL 1M3IA 1NUGA 1MQ8A 1P7QD 3FTUA 4DOHE 4KITB 3HS8A 2N56A 2BZ7A 4Q6IC 4NO5A 1CICB 4GUCA 1MFEL 4KK9D 3P77B 2GHWB 4LARL 4NN5C 5AW8B 1WLHA 4W9DC 1I4FA 4JN1L 3BAXA 2EDBA 2BSBA 1ASQA 4KKPA 4LP8A 4X8CA 5EEYA 4OUOA 5TH2B 3BH4A 1PEZA 4Q4IA 4Z7AA 4HIPA 4NAJA 3G6AB 2BJML 4L4TA 5DD1L 1FBIL 1FFQA 3QC6X 3V6OA 5LXVA 1DQDL 1UJ3B 5PAZA 1IL1A 3HLAA 3LB6C 5DD5L 4DP5X 4HS3B 4ZXBD 3UAEA 3EIFA 3A4AA 3L4UA 5E7FA 5B1CA 1WCQA 2VLKB 3NIGF 2XC8A 5A3IC 4WU5B 3S3SA 3VVWA 1NL0H 2JH2A 2EDRA 4QHMB 1AQHA 1MJUL 3NIFF 3PABA 1BXAA 1UXMA 1Q9OB 2Z92B 3Q1EA 4KY1L 4PJAA 5KVDH 1QBBA 4IU2B 1U9KA 4WJ5A 5DTFB 4J5VA 1B4TA 3EFDH 4MAYD 1C16B 1ZXQA 1HQRA 3M8OL 4ECNA 3S5LG 5EORL 5EB9A 1KENL 1KIUB 5GJSL 4CVZB 3WUZA 1XIWA 2G0LA 3T0EA 4Y9EA 3BZFA 3QDME 1RHFA 5KYWA 1PCSA 3MLXL 1AIZA 1CT8A 1W8OA 1A6PA 4NZTL 2IBZY 3MGAA 4C56D 1NC4B 3CQPA 5LWYL 1U6AL 3HNSH 2QZ5A 1G7HA 4A6YB 2CALA 2X4QB 4YN3A 1JGLL 5ESQA 4NO0B 4LF3B 1AHWC 2MCPL 2ZX5A 1CXIA 4H88L 4YEFA 4KJPD 5ABAA 1DBBH 1JDAA 5DJCB 1ZHBB 5KSVA 1A1MA 2H0JA 3LCYA 1JV5A 4V1DB 1VAHA 1IEBB 1UWGL 2X6MA 3IFLL 3K2MC 3QE5A 4Q8BA 5IP4A 2BSSA 2CIIA 4EVNB 2BY3A 4JO3H 4TPRH 5DZJA 2NX5D 4TS6A 1QYGH 3X1FA 2Q7NA 2YPLD 3PFQA 4KI5C 2IIJA 4IKKA 3ZTEA 1FVDB 1TQCC 4HISA 1WHPA 2HCZX 2WBJA 4LASH 4TXVB 1GTNA 2YRZA 4X4ZA 1DJIA 5FUZH 2ESVD 3WD5L 1FNEA 1VZGA 1DN2A 4Y1SA 2AABH 2Y7SA 4JHAL 4PH8A 4UOW0 4AYFB 4L4TE 3F85A 4XZUB 1JJUA 1COBA 1MCOH 3IGKA 1LK2A 3B1UA 4E9RA 3D0VA 1OHQA 3V6ZA 5C2BH 5HYSG 1HHJB 4FCAA 3KYMB 1F1GA 3IWUA 3CHPA 2QVTA 3BSZH 1I7TB 2N0MA 2WNGA 3VFMB 5T3XE 5CEZD 2NTSP 1FFTB 4XN4A 5TDNA 1ZHKB 1KGYE 4L3EA 5HYQA 1FG9C 5GSRA 2UXTA 3T0EB 1JPSL 3GSXB 3GMNA 3NJMA 1KJVA 2R2EA 2BJMH 3CLEH 1QSFD 2ATKA 4JPWL 3M1BA 4U1JA 3LIZL 2BP5M 4XB3A 5LAXB 1UM5L 1JPFA 2B15A 4UILL 3FB5B 2AEQH 2X89D 3N5AA 5KVFL 3DJ9A 4JZJB 1FAIL 3K1DA 3BJLA 3O3AA 5GZOC 1EAOA 3K71A 1A7BA 3FOMA 2BRRL 5A6MA 5DYFA 4I88A 1W0VA 1NWPA 3CZKA 2JQZA 1R5VB 3EYQC 3FPXA 4YHPB 4FQCH 1IEBA 2HFGH 5C0FB 3TFKC 5ECJE 5I6XC 4PYHA 5E8OB 5F6HJ 5E8DL 1WZ1L 2FIRT 1WK0A 2Y1AA 4Z7WB 1U8NA 3UPRB 4Z3GA 4HS3A 3HA0A 1UZ8B 4BRJA 3UTSD 4X4XA 1OB0A 4FNPA 5BZDB 4CU6A 2XFXA 1JP5A 4L8SB 2FUTA 1CLZL 5CN2A 1IU1A 4M62H 2DI9A 4MD0A 5DHEA 5I5RA 1OT4A 1YN6B 2GK2A 4NZTH 4N8PA 2Z65C 4FFWD 4ZX6A 2MOQA 4IGBB 2IXQA 1J87A 1I3RB 1KCKA 1U6AH 3F7PC 3HNSL 5CUSL 3WHE1 2HMIC 1E4HA 2APWA 2KZ1B 3ARGC 1MRCH 4LFHG 4LSTH 5K9QI 4PJHF 1FZKA 3KJ6H 4PY7A 2GK0B 2N4IA 5JPMB 2O4EA 1RK1A 3RWDB 3OGCB 4P2AA 5F1NA 1OAQH 1QATA 3CK0H 4DVRH 3F00A 5DUBB 5FB8A 3RWJB 2Y6SC 3R0MA 4RGNB 3T3PF 3VFRB 4N2FA 2IPTH 1AG0A 4S1DC 2FGZA 2H2SC 4J3UA 4XXCA 3KBPA 1FGVH 3Q3GA 4PEEA 3VXNB 1MVUB 2C9SA 3G5YB 1BFOB 2FGWH 3QIUB 1A6VH 2XXMB 1LP9A 2NMSA 2GIYA 4JEGB 4F7PB 3L9RB 1J0YA 2TRHA 3MO1B 5KBLA 3AGVA 2R27A 5FUZL 1T7WA 4JM2C 1T1WB 4KVPA 2XACC 1ZK5A 3UZQA 4XNYH 3P77A 4UV4L 3C5ZD 1YQ2A 2V37A 4UAOB 4NKIH 4ELDA 1N18A 1YAZA 2A9NH 3FF7A 4K9EC 4XRCB 3V52L 4AZ8A 2BP0A 3BKMH 5K69A 2ZUTA 3RI5F 4YFDB 3CFBA 2WVSA 5E6IC 1AO7A 4A66A 4X9BA 3U36A 2CLVB 4LHUA 3IU3A 2NUTB 1NWOA 3LHPL 5F2FA 1KJ3H 3A22A 4OCXL 4POUB 3MUGB 5C0AE 2A99A 1V3MA 2DN7A 5CAYB 1JPEA 4BA8A 1KUMA 2ENYA 4LAQH 4MJ6B 4PJAE 3NA4A 1QW8A 2P5ED 4J4PC 5FM4A 3RL2B 3C6EA 2HT3C 5ADOH 5BRPA 1TSHA 3APCA 4AL8L 2JCCA 5D93B 3WMPA 1OL0A 1K6QL 3L1FA 4J3OD 4MCNA 1IM3D 4L1BA 4P46B 12E8L 4RDQG 5CJBA 3RAJH 3DRQA 3I50L 2K6ZA 4XR8C 1ZT7B 3O4LA 2G3ZA 4MA1B 4N85A 2BLFA 5KAQF 2XWCA 1WBYA 4XO5A 1VENA 2WXLA 2PR9A 1N19A 4CW1A 3RDJA 3G5XB 3TYFB 3UTSA 3KGRA 2I07B 4YE4H 4H1LB 3HG1B 3F6LA 3OC5A 4S2SB 1QX1A 1TLKA 1WE5A 5I5JA 3BIAX 5AKTA 2IMNA 3Q9PA 4M5YH 3GXTA 3VFPA 2HJLA 2W0PA 1X5ZA 5HI4C 2ROYA 4JZNA 1BBJA 2YOCA 5IROA 5B7MA 2J2ZA 3CD4A 5D1QC 5CLWA 2D73A 1CCZA 5HJGA 1WS8A 4ABVA 3NCXA 1NTDA 4R7VA 4BHUA 4Z3IA 4ODUA 5F88B 4HDIB 5D7LA 4CN4A 4AE1A 1HOCB 5IVXA 4Z7OB 2A9DA 4Y5XC 5HHQA 1XL6A 4B41A 1EHXA 3U79A 4LSPL 4J3XA 2HWZL 4OF7A 3TT1L 5TE7H 1GVIA 1BEYL 1HYSC 4JJHA 3MLSL 2WLZA 4JFZH 1AR1B 4OLWH 3WDJA 4ONGL 1KB5B 2JB5H 1ONQB 2X10A 4NQVA 4FQLL 2JTDA 1RUQH 2ADIA 2MFNA 3UJIH 3UYPA 4HEPG 3L13A 3X1NA 4MQTB 4FXKC 1A5FH 3O4LD 4UMGA 1KJ2B 2ZOTA 4ZDHA 4CMMA 1F6LL 2JKXA 4XZ4A 3VXRD 4OCSL 3F3HA 3QP3A 4JFEE 2GJ6E 4MJIB 5LXGH 2HJKB 2OULB 1O6SA 3DIDA 3QQDA 3TN0D 4KZEL 4IBQA 2J8UE 4UV4H 3MNDA 1A8ZA 4UQ3B 1OARL 2A0LD 3T0EC 2A1WL 2ICCA 2KLSA 1ZJAA 1F1DA 4U49A 5EA0H 3VE0B 3ARGD 2HPTA 2X4RB 1PEWA 1Z9LA 3F6IA 4LNVA 1QRNA 3IXAA 1JGDB 2W80C 2E59A 3BX7C 2WOBA 2X6CA 4GXUM 2FJGA 4IU3A 3VDAA 4IRSC 4KRLB 4JE4B 1TG8A 3TZVC 1LE9B 2LTQC 1I1RA 1YEIH 3NJIA 5JW4R 1QPKA 1QLFA 1KYAA 3KPTA 4TSAH 4B50A 1UB5B 2D03H 1YG9A 2WZAA 1J10A 2JXMA 2Z8SA 1JGUL 4WHCA 1DLHA 3BDYL 4FHBD 2X2HA 2NY5L 2ZUQB 5A2AA 3ZW3A 4ZD3L 2DB8A 2P8PB 5DT1L 3GUTA 12E8H 3QUGA 4MD5A 3MRMA 2BZDA 4Y2DB 2Y06H 1WICA 2R1XA 1TCRB 3HNVL 1G0YR 4KQ4L 3QZWB 4UB0H 4Q9QH 4WFHE 4FLRA 4C55A 2AQSA 4TUJB 4G6KH 1BMZA 5SX4I 3S8GB 1HCFX 1L7TH 1BX2A 5JIHA 3GGWA 1EXUA 3LZFH 1R3LA 3DO4A 5B7EA 3K72B 1BQHA 2QV2A 2XKSA 1BLNA 4JQIA 1BZDA 3SE6A 4C4UA 5BXFB 1KJ2A 1QABA 4PCTA 5F3HA 5AYQA 4RGMC 2ISDA 1D9KC 2YMOA 4AMWA 2HX9A 4L5FE 5C97A 2LV4A 3FC8A 1PG7W 1EA9C 4PJBB 4ELME 3ZL1A 2Y7QA 3GZPA 5ESAB 2JKWA 5ISZD 4LCIH 2J1WA 4K3DH 3B9KD 1IBZA 4PJ7B 2JJUA 2PP8A 4V2BA 2ZXBA 1ZHNB 2X3AA 4JFZL 1N8ZA 2F54D 4MXQC 1TYEB 2MOGA 3RWIB 4BFGA 5KOMC 3EBGA 3L3OB 1TQBB 2QMJA 4LSSH 1GJUA 4LLUA 35C8H 3WY2A 4PLJD 1OSPL 5AKRA 4HHAA 4K8RL 4C59B 2ICEC 4UWQB 2MCAA 4ZUWA 1UJ3C 4HJUA 4HPOH 3VJ6B 3MRIA 1E50A 1FVCB 1TU2B 5LN8A 4KZEH 3BZ4A 2B4CH 4XNXH 1OGAB 3T0AA 1G6RL 1TUPA 2ENSA 5F96H 5GHWL 4PJCF 4HSCX 4XPAL 3VI4F 3VWKA 5HHXL 2AJXL 3BVNA 4GO8A 2WXJA 3WFBH 2Z91B 3VWKC 4YPJA 3ZQWA 5FIEA 3PLYA 4XXWA 3US0A 2JKTM 2BSDA 2F1BA 4J3BA 1CGWA 4HWBA 1C5DA 3TN0B 1FO0B 3OBAA 1UXWB 1AQ8A 1EBPA 5I1DB 5AOMA 1OGSA 3QHTC 4HW6A 4OGYL 3ARTA 1JNJA 4ZJ9A 1ODUA 4IK7A 3FO2A 3F01A 1XB8A 2EDXA 4HIJB 4NUPA 3U9PH 4DPRA 4XPFH 2WUBL 3GMOA 3QJVB 4YSSA 1YQVH 2NNXA 2DWXA 4ONHB 5D1ZC 5HJDA 1EANA 5IW3A 2ATAA 3QZNA 1IZJA 3QEGL 3MLRH 1S9VA 2KLTA 3S88L 2ADJB 5I75B 4D0DA 1EHAA 1OM9A 4RESB 1YPZE 4P5SA 5CZXD 5T3XD 2EDFA 1ZDQA 2VMDA 4Q9QL 5E6IB 5F1NB 2UZPA 4L4VE 4JZOA 1AD0B 1HHGB 2WN2A 3FUEA 3E1F1 4G6KL 1IT9H 2HLAB 3FT9A 4WHTB 5M95B 3CN1A 2E6QA 5DQJB 3HUJB 4RDBA 1W72B 1TQWA 2AQ1A 4ZNEA 1KXQA 2RMNA 3UZEC 4KBPA 1D2PA 3PHSA 3SKUD 4F7CB 25C8L 4NT6A 1E8XA 5FGRA 1MFBH 6TAAA 4YDMA 5EU4B 2CHDA 3OZ9H 4MX7A 3HG3A 2X4UB 1L9NA 3APFA 3IFPB 3HE7D 4FQJH 5CEYA 5I8CB 5DCCA 1GC1L 4KJYB 3RKDD 1EO7A 1J9CT 4F2EA 3WLWD 5FM5M 3CPLB 1DFXA 4L1TA 1MJ7H 3T2NL 2ZPKL 4Z7WA 1S7QB 3G3LA 5B1BB 1K8IB 1M6UA 1IFGA 1CDHA 4TNEA 2YOAA 3GMLA 4WJKB 2P1YA 3HFML 4XCNA 1X5YA 2BNQE 1A6AA 1U3NA 3STBA 4ETQB 3T77B 4S1DD 3UP1A 8CGTA 2V9QA 3OVUB 3QEQA 1RZJC 3QPQD 1KWGA 5JHDD 2PABA 4LBEA 4OGQC 5DJXB 3KWUA 3N04A 3VB8A 1UEMA 4HUVA 35C8L 4AXWB 2Q2EB 3E9UA 3TV3H 5A2JH 3ZDXB 3WLBA 3FMGL 1XHHA 5AW7B 2V3DA 3B2PA 2G2RA 3HOGA 4E9LA 4IIQC 1NGQH 3L3DB 4JO4L 5J12B 2VN4A 4OJFL 3L7FA 4HK3N 4ONFL 2I85A 4UQEA 4NZDA 2Z34A 5TQ2L 4DQOL 1CLYH 1HHIB 1JN6B 1G6RH 3A4FA 4ONHA 3LXAA 1ZV5A 2GI7A 4KVNH 2V8LA 1U91A 3AGWA 3RHWK 5JHLL 2NXYB 5GS0L 3GDBA 1AO7D 3P3UA 2VWEE 4PVLA 1ED3A 3F5WA 3KBHE 4J39A 2IWKA 3V4LA 1CS6A 5JDJA 4NCC1 1IGYA 1YMMB 2R2BB 3TO4C 1HHGA 4OZFB 5IWLC 2NYZA 2XVGA 4J6RL 4NENB 3V5DA 5JW4Q 2ZAHA 3VU1A 2XTLA 3FU6A 3S97C 3VSUA 1RMFH 2GW5A 1ZS2A 3TCLB 2MNWA 4M6NH 3MLRL 5CCKH 3O3BB 2GUOA 3D18B 4XXWC 4JFQA 4DGYL 1JZ5A 3F7LA 2YPLA 3BT0A 1T22A 2F74A 2HB0A 3N0PB 4QIRA 3ECBA 1DBKL 3N9GH 3ZL4H 3IDIA 2H41A 4HIHB 2WVVA 2CJ3A 5DZNA 1XV8A 3L2NA 4L5FL 1GR7A 1WBXB 3HC3H 2Z0BA 5EU7E 4FTVB 4I3RL 5C6PB 3T4AA 1RJZA 4JMNA 4XPHH 4S1RH 5JZ7D 1FFNB 1KFGA 2FECL 1JN6A 4AUUA 4HXAH 4JNXA 1HH9A 25C8H 4Z7UB 2XY1A 3GMPA 4QRTB 3TO2B 5ID0B 1T21B 1QI3A 3SYPA 2Z9TA 1S5IL 4FZEH 2WXKA 3MREB 1MIML 1UKQA 2CXGA 3G5WA 3HE7A 2WBXA 3PGFL 4PGCA 3NCYP 5KSUB 4GI6A 4JHUA 4WHDA 1SMOA 1F56A 2ZZUT 4XB7A 1HXYA 5DJXA 4PVBA 1I1YB 1R33A 2VJ0A 2CHZA 1GCYA 3SGJC 2AJYH 2DWSA 2UXGA 4PJEF 5F0PB 1JYVA 4RQQB 3KXFA 1CIUA 3N3EA 5CKAA 3CQFA 2EDOA 4M29A 1PYWB 4YLQT 5IF0A 1BD2B 3QEQD 4HZLB 2VR3A 2Y22A 4GRLA 4GAYA 1A7QL 4HKXB 1JV5B 1IBFA 4NO3A 4QJ5B 3L7EB 3NDZE 5SWSA 2D31B 3KWXA 5I17A 2BERA 4J4PA 1MN4A 1S5HA 1P84K 3BRFA 3MLTB 1FGNL 4PGEB 3W57A 2N01B 4JG9A 1GGCH 3PWLB 3QFDA 5E1QA 2XPGB 3D09A 3DX8A 4QTIH 5DMKA 4XBEH 1B4JH 5E7BA 1CLYL 1DLHB 2ZKYA 3N1GC 1RUKL 2YWZA 3OG6B 3UJTL 1S7WA 3QUMA 5DJ2A 2R0WH 5E2UH 2JXMB 5KSBA 4GSDL 5KS9E 4HUVB 5CLTA 5MENA 3OR6A 5FGCE 3RI5K 3LV3B 3HR6A 1CGSH 4NQVB 3FW6A 5C0GA 4UOJA 4NQSA 2AQRA 4WY7H 2EVHA 3T1FB 4PJFF 3L5XH 2IAMB 1I53A 1NBVL 1OCZB 5B8CC 2R29A 4ZPTB 4GW1A 3WNJA 4P59L 5K9OA 1OK0A 4PJ8A 4OJDH 2IALA 1JNNL 1I7RA 1OTUD 2BP8A 3UTPD 1L9OA 3CZGA 3MV9A 4AC2A 4A7GF 2D3NA 3GMQB 1CR9H 3WO4B 2YUZA 4F7TB 3WTVA 3H9HA 3SDYH 4MA1C 3KYNA 3EGSB 2DYPA 5K1VA 4N8CL 4QPEA 4MBRA 5I1HL 5A2IH 2WINA 4FQXD 5D93C 2APVA 4R7NB 4XPHL 2RFXB 5T1LB 4UUJA 2N7AA 1X5AA 1A6WL 3VRIB 2B14A 4M7ZB 2CRMA 1WP6A 1RZQA 2IANB 4YGVB 3NABL 1ML0A 3CMOH 1NEPA 1OGTB 4OCNC 1QNZH 4L3ED 4KGLA 2J57A 2DWEA 4CJ0A 5C08B 1OAZH 3EH3B 4JKPH 2OCJA 2GAZB 1TKWB 2IADA 3IDNA 4G8EA 5FYJL 3RIFK 3CFQA 3VFVA 3B9KA 1JWSA 4BSVA 2H32A 2WO2B 1WWAX 3HPLA 3NP4A 1AP2A 1Z9NA 2R56H 4DKAA 4JFYA 2YAOA 1U36A 4WW1A 3ZRFC 1NC2B 1N26A 3BJ91 1F3JA 1RJCA 1OP3H 2ADGA 4JFDB 3NIDE 1USQA 3U1QA 4EZMA 4Z7UE 1Z1WA 3FYEB 5CP3H 3I6GB 4DH2A 5JXEA 3TEWA 5K9KA 3FN0H 4Y9CA 2VZ3A 3HB3C 5E24E 4PJAF 2E7LA 3QORB 1OM3L 3PS6A 2QLYA 4S1QL 5FO7A 1IM9D 2Q76A 3H9YA 3KS0H 2KDYA 3FQNB 1CFTA 4JG1L 2JCCB 1BVNP 2K6YA 4MNHA 3WFZA 4HPYL 3UJTH 5FYKL 1MQKL 2OW6A 3BKYH 5EH1A 3OKEA 4NFDA 3V4PB 3HRZB 5DHDA 5D7JD 3UTTB 3EO0B 1C9SA 1MCIA 2EIDA 2VJ8A 3MUUA 2OV0A 5FS5A 3MXWL 4NRYB 3Q1SL 2APTA 3PGDA 4GRWH 2DICA 3JWDC 1W16A 4D0CA 4P2OA 3RWHA 2QFRA 1NSNL 3U0WL 4ILDA 1FBIH 4NQXA 2X88A 1VFUA 1WH0A 3ET9F 4FQHA 1RZJH 4HS6B 5F89A 3DX7B 3BMVA 3Q9QA 2DQTL 1NINA 1XDTT 4U6HA 5DHYA 3BP5B 1OGAE 3K0YA 4NI6A 1AP2B 1LM8V 3O4OC 2FHFA 4KAQH 3ZO0A 5LDSA 2B77A 2EIZA 3FCBA 1H15A 1A65A 1SLWA 2BNRB 3NGBC 4MD4A 5HXMA 2WQVA 3K46A 1ZVSA 3C8KB 2ESVB 2WLLB 4F15C 5K5YA 4WI7A 1TJGH 1BFTA 1KXHA 1CLVA 3FULA 4P3CL 3OMZA 1T2QH 3S37X 2CZNA 4P2RA 2VLJD 2X4OA 5T8IA 1AGDB 1XF4A 4FQIH 1Z0NA 5IB3B 3QQ4A 1BD2E 4K5NA 1KENH 5FA4A 3V4VH 3V6BR 3FN3A 3ZDZE 1EEUA 3BVUA 2DRUA 2X4NB 3NVQA 3ZKQD 3FRPA 3QJFB 4FADA 3Q7JA 1KTBA 4RH4A 4X8JA 3KLQA 1BECA 4OLXL 4LPWA 3EGSA 1O5DT 3VFUB 1JVKA 3Q43A 3HKZA 4A7UA 2ADIB 3UYPB 5AZEH 4X6CE 2VDMB 4F57H 3QBTB 3T3PB 2VZUA 3WUWA 1JI1A 2XWTA 4G9FD 5E2JA 3V0JA 1B0WA 4CGTA 3C8HA 3BEVA 1S7VB 3DI3B 3VW3L 4TPRL 2D4FA 4W9IC 2D31A 1DBAL 1EUUA 2DLTA 2DQMA 3CVHH 3SGKA 1U42A 3UZVA 4ZTOL 2FQEA 5B1AB 3NFNB 3UYOD 1RERA 4M1CD 1E8WA 1BJ1H 3FHEA 4GRLB 5CEZL 1Y18B 3ULUH 3C6LC 3TU6A 1ILSA 3A4EA 5IHUL 4HALA 3T4YB 1EHLH 4AGOA 3S2AA 3KPQB 3U2SA 3LN4A 3SDCD 1KJ2H 2HH0L 5KAQG 5IEKA 2IGLA 1RFDH 1N64L 1GGTA 3K5RA 1KB9K 2P8MA 1QPPA 1L0QA 4W1TA 4LNRA 2YFOA 3NA9H 5FW8A 2FLMA 3FOMB 4JFXB 1HL5A 1MELA 5D7JA 1PNDA 5H2BB 4KZCA 2QSQA 3BT2H 4PCYA 2DQFA 3EOAB 4NXKA 5AUMB 2EVFA 1ZWIA 2VDQH 4HU8A 3ILPB 3BSZL 5J11B 4K94C 4NUQA 5F9JA 4PBXA 2HPOA 4WTZG 4WI3A 5E8PA 4M61A 2N0KA 4X4MA 3UP6A 1IFHL 2BIHA 4ZFZB 3D5OF 3U0WH 3TA3D 4NWUL 2BC4B 4UAHA 1Z9OA 4F8OA 1Z7JA 3CBKB 3MV7D 3MJ9L 3NCJL 1WAEA 3SYAA 3BGFC 1A14H 2D9CA 5E8NB 4M7KL 4I7ZC 1IVLA 2ZCKL 2BVOB 15C8H 2X0WA 3K6NA 4P9MH 2BRRH 1I8KA 1IC7H 4GRLC 3IKCB 4KROD 2CJUH 3IE4A 4PRPD 5LGJA 1AD9A 2Y1YA 1PZBA 5GRJL 4AC4A 4JRXA 4R2GB 4AMXA 5FXCH 2I27N 1CC3A 3CE1A 2GJ6D 1R9FA 2GITB 4MJ5B 4X50A 1DJWA 1CZ8H 2Z31D 4P3CH 2GJJA 4NENA 4K2UL 3V5DB 4XTRD 4K3JL 4PRHB 1D7CA 2MRYA 1E30A 3TV8A 2A6IB 5EUOE 5GSRB 1U8MB 4OCWL 1PTZA 4RMVA 1E42A 4LCWD 2NY3C 1KBPA 2F19L 5CP3A 3DOSB 4O51B 1PMYA 2DBJA 2NSMA 4PJXF 3AAZB 1S6NA 3KJ6L 1Q94A 4UIMA 1QZ1A 3PWNA 4IBSA 4MJ2A 3F6JA 2YAPA 1A6UL 2QQNH 4Y1AE 1ZLSL 3ZMNA 4AGMA 2NY7L 1A3QA 1Y1DA 1ERNA 5D5MA 1ZGLM 1J5CA 4RFOH 3BFWA 1QR1B 3SJVD 2WZ6A 1UC6A 3KPRE 1AO7B 4N1CA 5I76B 5F9JB 5E2TH 1RK1B 1XTLA 3HKFA 5CSBA 4Z76A 3VRLF 2PUQT 4GQ9H 4PJEB 3ORJA 4TN9A 4DZ8A 1A9BA 3QIBB 3UBXB 5D7JB 4IRZH 3GJFH 2YMXH 4JFEB 1CICC 4MJIE 4Z23A 1JOIA 4BZ2H 4DK6A 32C2B 3MRRB 5E2WH 4MQ7A 1F6AB 1WAAE 1WBZA 2ICWI 4X5PA 2FH6A 1U8PA 3P73B 4YBQD 3LKPB 5BS0B 1D5BA 1CU4L 2K8MA 2R4SL 1AG6A 4Z5RB 2R23A 1JERA 1P4BL 3QI9B 1MCPL 2UVFA 5B8CB 1BAFH 3MV8D 2ZAGA 4NM8L 5F7AA 5IB4B 1GTFA 4NC1E 3WNNA 4BA0A 4LPYA 2A5UA 1KLUB 3RUGE 5C0CB 4S0HA 2CBQA 4QWWD 4F7EB 3SBWA 4J3OG 3WFEL 4LT7A 1LEKB 1T20A 2IV9A 5KUKA 3KWVA 4LB8A 4A7VA 4NQDB 5JQ6H 2H2PC 3GXMA 4PM1A 1OTUC 5ISZA 2G5BA 3IDYC 4HLJA 1KB9J 1GYCA 2GG1A 2RGSA 5KBDA 1A64A 4MRBA 4NO0D 4WK2B 1WA2X 1HXMB 3F7YB 4KX7A 3RNKB 3BKCH 1M57B 3VGDA 5E6ZA 2C3HA 5I76A 3RVUC 5D2NA 3VQLA 3V0DA 3DJRA 4O5LH 3N06B 1LWJA 1SN5A 1A7RH 3HVNA 1YMHB 4JK0D 4AOFA 1QSFE 4PJ9B 4JPSA 4IDJH 3RRQA 3FO2B 2CKBH 4QOKB 4N9OB 2A6JB 1NFKA 4Q9CA 5C0AD 2ZOLB 3DHUA 4YAQB 4M5YL 5I1DA 4PB9L 2HTKD 3JWDH 1UA6H 2HG5B 2HYMA 2CCLA 5CP7A 3MLXH 7CGTA 1JDDA 3ZE1F 2G9HA 2RCSH 2VC2L 3QEQE 4HUXB 4EI5C 2MSPA 5C07B 1MI5D 3WY4A 4O4YL 4QHUB 2VL4A 4YUEH 1S9WB 2C3VA 4DZ8B 2PYEA 5CD3A 1KTDA 1BYNA 4U1MA 3GJEA 4Z76B 1SRDA 4UT6A 2UX7A 3CIQA 1HU8A 5FYLE 3WBDA 2QSCL 4BH8B 1NFDE 4LPUA 1JFHA 1BEYH 2ICWB 3RQ3A 5HGHA 1J0IA 1RULH 2KC0A 3MBEC 4J12A 5DLMH 3H7BB 2NQCA 1V5JA 1L9QA 1BAWA 3D2UA 2CCVA 4N0CD 3MR9B 4E5XB 1LE5B 2DYRB 3MKGA 2WNWA 2AFNA 4ZMPA 2CBTA 3BPOB 4O51A 2X4QA 1I8AA 5I1JL 2PTUA 2WBKA 5MI0C 3MRLA 4ANWA 4OAWB 1A47A 2F8VA 2K3HA 5GGRB 1JNHB 1KFAH 3BHBA 5I6KA 2IOIA 2LAGB 5IQ9A 1U33A 1X6NA 1XZ0A 1PCXA 4Z7VF 4GIOA 4Y9GA 5EA0L 2K7QA 1B9ZA 4G82A 4JANB 1MRFL 5C2UB 1Z5HA 4MMZB 2D7MA 4G8IB 3MROB 4ORGA 5GRYA 3T6WA 4DO5A 3H6JA 3MRBA 1KLFA 2XKNB 3E2HB 5A43C 2Q20A 4KVCH 4WLCA 1YNLH 5IJCC 4YXLH 4IHOA 2WZ0A 1XD1A 3UROR 3MCLH 1XH2A 1UM5H 1O9VA 1QSFA 5E4IA 2AEWA 2OCCB 5KTEL 4NZFA 3RU8H 5C70A 4H8HA 4GIAA 5D7IB 1P2CB 4G43B 4GQRA 3STLB 5ITFB 1UM4L 3W11D 5IB2A 4AYFA 2J72A 3ZVVA 3BDYH 4H26B 2WAHA 3FCTA 3WMSA 4N0CC 5IV2A 5SWSE 1IQWH 3EUDA 4YWGL 4ZD3H 4TQ8A 5D2LE 3WSQH 3FTGA 1ID5I 3TA4D 3TVMD 3U2JA 5IT2L 5HHOA 2ZX7A 2Y06L 4UANA 1UXSB 1H3VA 3ATFA 4MMXC 4ZTEA 3AY4C 4X4YB 5JHMA 4KOBA 2V7HA 3NSFA 2YBGA 2Y36H 2NY2B 2WINB 2GSMB 1AGFB 1D9KA 3D87B 1ZA6B 2XYBA 5DQ9B 4GXUN 2DPKA 3S6CA 3IB4A 4JRFA 1RZ8B 3KPRB 2PTTB 1MHPL 5D7IF 4ACPA 1EO8L 3OB0H 1FL3B 1UA6L 2VXUL 3L3KB 4PP1D 4QHLA 5F7LB 5GRXG 5D4QA 3TCTA 2RCSL 2VC2H 2EEFA 1J8RA 4GW5A 2I26N 3LS4H 4ODWA 3D69B 4YHIB 2OMTA 2H2PD 1R34A 4IRZA 1QFWL 3SJVB 4HOZA 3KLAB 1VGKB 3M07A 4PTUA 4Y5XA 4F2MA 3SO5A 3QZWA 3N40P 4LAJH 4BFIA 3ABZA 2WCPA 1P5UC 1MFCH 1J0HA 2G2PA 2Y6TE 1AE6H 5FDWB 5LBVA 2NNCA 2CGZA 4MJIA 3L3IA 1E4XL 3QNYB 5T5FL 3RWCB 3TLRA 3CFIC 4N0FB 4UAOC 1RULL 5DLML 2IPTL 2PCFB 1HCVA 3RY6C 1YEFH 2HN7B 3PL6B 4S1SL 3MRBB 1NGPH 4JY4A 3BAWA 1FHGA 1G7PB 3WXWL 2NDGA 2JJTC 1FSKC 4YSTA 4QHMA 3QUYD 2X9YA 3O45B 4IU3B 3EOTL 4QT5B 3HG1E 4L37A 5IY5B 4M6MH 4N5UA 3S3JA 2LU3A 3K4AA 1HZKA 3MBXH 3KD4A 3OLGA 5DK0B 1BXUA 1J1PH 4AX3A 4D0BA 3J27A 5IFHL 4NKIL 1A4KA 3JWOH 4CN1A 2UWEF 3NFSL 4QLWA 5C1MB 5DJ8B 4PSPA 3CFJA 1JGEA 1J0JA 1CQYA 1BXXA 4X6EA 2ZYHA 2CRIA 1AZZC 1PAMA 2EDJA 4RAHA 3VGFA 4E5XA 1LE5A 4HKZA 3HN5A 4QY8A 5I71C 4LVEA 5AYUH 4GFTB 2Q8BH 1XBDA 1YN7A 4KDVA 3IJ7A 4NEHB 5D70L 3DTXA 4N1EA 3LPPA 1MNUL 1VERA 2P7TB 3BWUC 5EC1B 1F58L 1TZGL 4ZODA 3FQYA 3KXFD 3FDWA 4NO5B 3CDZA 5DRWA 2WP3T 1JG9A 2FWOB 4HLEA 1A25A 1UKSA 3C6SB 2JKJA 1NAKL 3OX8A 1X7QB 4GRLD 3WFHB 4E41D 1E9OB 3DX2A 5BOZG 2BFGA 3QG6A 2K7PA 4XCCL 2X87A 4PJGA 1YEDB 5ANME 1BQRA 1YSOA 5ENWA 3CDCA 3TBWA 1XF4B 2Y36L 3IJSA 4U1IB 1A7OH 1IUZA 4RBPH 3GBMH 3SGDH 2XKUA 3ARWA 5CJXA 4GUPA 1J1XL 1T1ZB 2EIJB 4BK5C 5BRZB 3VFSA 4PS4L 1B2WH 1Q0YH 2A77H 3QAZC 1GGBH 1NMBH 4TRPH 5KEZA 1A2YA 4UTAL 1JK9B 2P24A 4PJBE 2PO6A 2BMKA 3NYKA 3OKNA 3GJEB 2AQNA 5IEHB 2V7NB 1HZLA 5JORA 2V2WA 4JGUA 4K7PH 1A3LH 1DJYA 1UXSA 3BQUB 5LNDA 2NW2B 2E27L 3S5LB 3IE9A 4X6FB 2D2CC 1AE6L 4WTQA 5T5NG 5C0NC 1UM6L 1AZVA 4TVPD 3UPCA 1ASOA 5C0BA 2R29H 3EH4B 3C08H 2DYSB 3VM5A 3HFMH 3PGDB 3QULA 3SOTA 1QAWA 3N6YA 5I75C 3WTWA 2QQLH 4JM2A 5F7UA 1EZSA 3MRGA 2XX0A 4I4WA 1RUQL 3BQVA 1FWXA 2NSQA 5CZKA 3AJ7A 4AYDC 1A8JH 2XN2A 1P5VA 3I6KA 3ZYIA 3UTQB 2XJLA 4PG2A 1UQSB 5ILTL 5T1KD 3EOTH 2WMPB 1TQCB 4FNRA 1XGRB 1OGTA 3IRZA 4LEXL 4YPGB 4YIQB 5FR3A 2XYCA 2XZZA 3CV5A 2QPEB 1S7RA 1VJSA 3VTTA 3T0ED 1HXMA 3F7YA 5T33L 5DF0A 3QXTA 1EJFA 1X44A 1A9BB 1DVUA 1HNGA 2WXQA 1PY4A 3ARGA 1PS3A 1YY8A 2CNZA 2DQHH 4LL9A 2I9LB 3LDBB 3FF8A 3DPDA 3MA9H 3TEUA 3ZE1E 4X42A 1O7DE 3U4KA 1CBVH 1IAIL 3DROA 3GO1H 2XDHA 2PXYB 1FV1B 2EXWC 4N0FA 3GQFA 4ALAC 1BW8A 3FU7A 2NCMA 1L6PA 1CK0H 4YAQA 1U3ZA 4HT1L 2EZ0D 4J2QA 2W60A 3FB7B 4TSAL 4GEIA 2IDTA 4X6BA 2IWGA 1D5XB 1LNUB 2ZKHH 3B1TA 2Z1PA 1N6UA 1E5UI 3FQUA 4JFWA 4WFED 1U30A 4LCCB 3KPPB 1KACB 2HRLA 2P46B 2YKLH 3L1OL 2MH4A 1RIUL 4R96A 3CFNA 2IAMC 1KIPB 4G42A 5IUCA 5C0RH 5INCA 1MLBA 1R0AH 1TEGA 4RZCB 3LPOA 4OIBA 1I9IL 4U1MB 1I85C 4XCFL 1JHKH 1T66C 3SE9L 1OXYA 3O6LH 2YA0A 2GHZA 1ZLWH 3P0YH 1R3JA 4XOCA 5HYFA 4PGDA 3QUZB 4RMSA 3AS0A 1X3DA 1ILUA 4GMTL 5JIQA 5AVRB 3OR7B 1J1XH 3FUFA 4LCCC 2O6FA 3C5ZA 5EEUA 4K5OA 1G9HA 1SY6H 1VLXA 2W65A 4KRPD 3HBQA 1TNMA 3LZFL 1OKEA 4DUVA 1RIHH 3WS3B 3MLYH 1KY7A 2WTRB 2XCMC 5EBMB 3CFDA 3D0AA 3RGBA 3D39D 4W6WB 4UIMB 5BV7L 1E5YA 1U4FA 1INDL 3F64A 4NOFA 4XCEB 5HYJE 2D0GA 4ZUVB 5B39A 4YSUA 4Z0XA 3VXQA 1TMCB 2N1KA 4TYUA 4ZFFB 5C0FA 4HC1A 2YXWA 1SYVA 5C71A 4G2AA 3L3JB 5D96C 5AVWB 1FNEB 32C2A 1Z66A 3RIAF 3OSVA 3Q5OA 1XGYH 1EFXB 3VU2A 4MXQD 1YPZA 4ZPVA 2UWEE 4Z77A 4AEEA 5AAPA 5C3IA 1JF1A 1WD8A 3INOA 4K71B 2VR9A 2CHXA 4JG0L 4AVIA 1IM3A 3Q01A 1RKRA 2H8PA 1ET5A 5B4MD 1KGJA 1B9KA 5IVZB 2R15A 4JR9L 4MXVF 5LKNA 4KROC 1ZA3A 5CKGA 1P1VA 5I8KL 3DUSB 3LQAH 4OV6F 4QCIA 3SDDC 4HFWB 4U1GB 4DPBX 2ZIDA 3IJYA 3BUYA 4HD9A 4NS0A 1HAUA 4J3SA 4ZO8A 4KTEH 2OL3B 5GHWH 1XGZA 3QNZB 1TMQA 4MAZA 5E4EC 3OHXC 4AVKA 5HVFB 4HHAB 2BHZA 2DQHL 5AVZB 3VWKD 3DPBA 3FL7A 4P4KA 3OJDA 3MA9L 3EH5B 5HGAB 2EEAA 3H9SB 4PJHA 2E9BA 2Z8VC 5AVUB 4NQCE 1ES0A 4JRYA 5ESVA 3ZXAC 1DQJB 5J9PA 4EAEA 4NJAL 3UFIA 2Q8AL 3KLLA 1MF2H 3SDAB 2IH1B 1YEHH 3ZHKA 4HT1H 4GKNA 3V0IA 4OQTL 3QYNA 4MMZA 5I0WA 1I31A 4P59H 5DSCA 3ZSSA 5E1HB 1F4YH 1G7JA 1PLGH 2YD0A 4XH2A 2NXZB 5EOCJ 3TM6A 3LS5L 4LNRB 1BQ5A 2IAND 4FQ2L 4ZS7H 1CDUA 3MAWA 4IKNA 4FA7B 3UBXG 1SYVB 2VN7A 2I60L 3OHMB 5H37H 2EADA 5FYLL 4HH9A 3VGHA 5BMFH 4LSVL 1RCYA 2HMID 3GMLB 4LVHB 5L2JA 1JZJA 4R9HA 2VR6A 4L8DB 3NZUA 1RPKA 3T8XB 2Y7LA 4YGAB 3Q2LA 3C60A 1KZYA 3CFDB 3RGVC 1WDAA 3FQWA 5TDOB 1OY3B 1IJNA 1F45A 4CJ1A 5DS1A 1LDPH 1A6WH 3REWB 3DXAB 4X6DA 3LAFA 5GRUL 4F93B 4BUQA 4OB5H 4ZW8A 1ITCA 3V0VA 2C3VB 5IQLA 4Z18A 4G8GE 1INDH 2YC1B 1P84J 4OZFG 1M1XB 4GBXC 5L4FA 2QZQA 2AJVL 2WVUA 3UERA 3G6DL 3L2MA 4G42B 4KO6A 3LKSB 3F05A 2QVMA 1R3IL 4L8SC 1IC5H 3FFCB 1MEXL 5KYYB 1D2OA 2VMJA 5FDYA 1TQSA 3BKJH 3LN4B 1K8IA 4P2OB 3RWHB 3OAUH 4XOAA 1HL8A 4OZ4A 1VHPA 4PJCE 4HUUA 4NRYA 2PWFA 4M5ZH 4BQ8A 1JCVA 1D6EB 4H25A 4KXCA 4BSWB 3PHOB 3SBRA 5E1IA 2YEVB 2XN1A 4M8RA 5AZ2H 2XWJA 1QQDB 1UVQB 3LKNB 2PCXA 4JR9H 4NKQB 4TQHA 3V7AG 2CIKB 4UTBA 5I8KH 2J88H 5DA4A 1DTUA 2CUHA 1KCSH 4XO3A 3AREA 1QWNA 1WFJA 4DQOH 1UXWA 3V0WH 1QFWI 1CURA 4KHXL 3UAFA 5JHLH 5J1TC 2DJUA 1DEEA 2KYIA 2O6PA 1NCCL 3M88A 4HIEB 2VDMH 4ZXBB 3TC9A 2ARJA 5E5LA 5HDOA 1YJDH 4Y16B 1EAQA 2Q7AA 4OGXL 3TNNA 1YHPA 4BZYA 1QRNE 1T6WA 2W9LA 3QRGL 3UJJL 3IJEA 2ED7A 5GZOA 3DETC 1S7QA 3BIKA 1IFRA 3ZE0E 2I9TB 3CXDH 4D0DB 1M7IA 2HJFB 4O00A 1YEHL 3O3UN 2AK4A 5EOTB 5D1XD 1AIFA 1R5WB 1DN0A 2OSWA 2AXGA 4WV1B 5CILH 3PJSA 5D1QE 1I1AA 4ZFOB 1JTOA 3ZMEA 1RUMH 4LSQL 3LN5A 3OXSA 2XNAA 3P9MA 3QUZD 4GI9A 4BE5A 3N1FC 4CC4A 2C26A 3G5ZB 4TNFA 1H3PL 5AFAA 4FXTA 3TWYA 3VI3E 1JPTL 2D4DA 1FL5B 2JKNA 4MNQD 4X80H 4BINA 2HJLB 4ZBJA 4L3AA 3TA3C 3VXME 5E94A 5C0BB 1L9SA 4OLVL 3OKOA 1T7YA 3O2DH 3BH9A 1S4IA 3TO4A 4ELMA 1ACYL 2VZTA 4HOWA 2YQ2A 4XBGB 5AKSA 3TNMB 4PJ5D 3AS3A 1Y0LB 2AJUH 2J6EH 2GUYA 4FE9A 4EUPH 4WI0B 3H4HA 3FOLA 1P4LB 4IBVA 3NCCB 1AGDA 4LLYA 1CDGA 2ZNWA 4GG6E 2X1OA 1LMIA 3BWZA 3SKMB 3WKML 1DSFH 3MNZB 2ZX8A 1DL7H 3C5XA 2PW1A 1F4XL 3BCDA 3CVIL 5KZCB 3MODH 5J3HD 3KR3L 4B53A 3SPHA 1Q90A 1MCCA 2DTMH 4KH9A 5ALCL 3ZTCC 1CFSA 1XGPB 1FJ1A 4KZDH 1H15B 5E99H 5E9DB 2EE0A 5BZXA 3RGVA 3O3EA 1QI4A 3W5NA 4AYSA 4BBWA 2CUAA 4G11A 2FB4L 1VADB 2YGPA 1QD0A 3SDXE 4XAKD 4DK3A 7FABL 2NYKA 3MACL 3OKMA 1ACCA 4YQXH 1YCSA 1MCFA 4JO1L 1OB1A 2ETWA 3K8LA 1S3KH 1INQB 4YFLF 1JWMA 1REIA 1QTYT 5AZ2L 4HF5H 4HKJA 2AXHA 1U8OB 4JLRA 4UQ9A 1EMTL 4FG2A 3H85A 4KK9C 1DUYA 2DLFL 2OYMA 1I7ZA 3GXUB 4HQQH 1AD9B 2F8OA 1C1EH 3OKDA 4UV7L 5DFWH 3JBG7 3LKRB 4DO6A 2DWTA 1RUKH 2VABA 1FORL 1B3IA 3LN5B 1FH5H 3VO0A 5EO0B 3DV6B 3UTPE 3A5VA 1UEYA 2V33A 4LLUB 5JPNC 1MFAL 1UWEL 3T9WA 2H26A 4ZOEA 1CGSL 1L6ZA 1JXJA 1JD9A 1F97A 3B4NA 1AKJD 2CH8A 1YJDL 3GEWB 1LHZA 3MLWH 3VM7A 5DQDH 4AVJA 1S7VA 3PDOB 4W9ZA 4O58H 4JRLA 2FL5A 2FTAA 2MKWA 4PI0A 5FA3B 4L4VA 4N3UA 2OM5A 2NTFB 4KRNA 5CGTA 4OD3H 2L04A 1WEJH 4N8VB 2M26A 5C08D 4UNUA 4YC2B 1EQWA 3OM3B 2BVUA 4R90H 2P49B 5GRJH 3S9DB 1JZ2A 5FCUH 3PP4L 2LU4A 1AXTH 3PRZA 1TVBA 1HH9B 3MV9D 5ID0A 3PIQB 2YN3A 3NJGA 4OZIB 3F7RA 5KVDL 2BX5A 1ET8A 3SDYL 3BW9B 4AMKH 3GS4A 2IAAC 5EF2A 5E9DA 3SPCA 3GXNA 4GXVH 4ZAKA 1MH5A 4Z7VE 5EORH 1RV6X 5KVFE 1DSWA 2ESVE 4OD1H 1ZV2A 3QRBA 3GTVA 3VE0A 2DWYA 4TVPE 3T1FA 5ICZA 3B2UC 3VFOB 3K4DA 4PYGA 4X6CB 4LCYA 4OZHA 1QBAA 1GL4B 3NABH 2WNXA 1AGFA 1BFVL 4R7XA 4GJTB 5KVEH 1U8OA 2X12A 3SQBA 1ETJA 2WQ8A 3MOAL 1Q9WA 2AK4D 3QIUD 3ULUC 3FTGB 1INQA 3HG1A 5CZRA 2E56A 2CUIA 4Q58C 4U1KA 2L3BA 5DJZB 2AS5M 2H1LM 3CFKB 2IALB 2J8HA 1SN2A 2BOBB 2J71A 3MJ7B 7FABH 4HZAA 3SY0B 3QIBA 5IJVB 4JO3L 1R46A 3BWAB 1RP8A 1HH6B 3U0TA 4L9LB 4P3DA 3TONA 4DP0X 4FLQA 1HTYA 2ITFA 4WIQA 4KKAC 1WCBB 2RQEA 4GG8B 3B7UX 3PJNA 3M7FB 5EO0A 3H56A 1XGTB 5GGVL 3GXPA 4BZ2L 1J1OH 1FPTH 2BIIA 3C2SA 1CXFA 3GSOA 4GKSA 1OSEA 3PF2A 1T1YA 2ED8A 2WYHA 1LEIA 5C2BL 3O8XD 4MXWL 3KAAA 1LYQA 3A24A 3FUIA 1S7TB 1R1CA 2NT0A 1NGYA 4G9FB 5DHVA 1BG9A 1JF6A 3F83A 1OAYL 4DHLA 3BUPA 1F4WL 1ZGLB 4MJID 5JPNB 2EABA 4R7DA 2FO4B 5IBTL 4B9FA 4OD3L 3D0LA 4EUPA 4TULH 5FO9A 1SEQH 1XR8B 3GHBH 3NN8B 4ANUA 1DN0B 3QXAB 4HJ0D 2RA1A 1UB6A 1JRHI 3Q6GH 5EZJA 4GG6B 2VDKH 4PS8A 3ARZA 3ILQC 3DC0A 1HXYB 4NT6B 2Y9RT 1JTTA 1KTDB 3RWJA 2QT6A 5E8DH 3IDXL 2ICWA 4RBPK 5IB1A 4P49A 3SE8H 5JYLA 1EDQA 1AY1L 2Y7OA 1LO5B 3BO8A 4HIXL 1FG2B 4WWNA 1JK8B 3PU7A 1DQLH 3WFCL 1T83A 4WI6A 1WTGT 1FSKB 1P7QA 2RQ8A 1G6RA 3L9EA 3NPZB 2MWCA 4NPYB 4P5KA 3W0WB 1HYRC 5FK9A 2EINB 5EWIL 2O5NA 3PL6C 1NH6A 2W92A 3IDGB 4Y1AB 5E1GA 1EPFA 1WAAA 1X5HA 4YLBA 4YHOH 3X3GH 1X4XA 3AQZA 4MXVE 3SDDD 4Z7UF 1E9PB 3LX9A 3RB7A 4OQTA 5CSZA 4OCRL 4Y2LA 1KXVC 3PDDA 4RGNC 4JX0A 5HHNA 1AZBA 1KC5H 2I25N 4F80A 3GI8H 4KKLD 1FA4A 4CDHA 1NFIB 1SVZA 3FTYA 3D50A 2PXYA 1XR9B 1DBAH 1RHHA 4U7SA 4ZTOH 3QDMB 3TVMB 4DTGL 2GSGB 3G9VA 2FYVA 3TA3B 1IGTB 1UASA 4DP7X 4CSPA 4G1MB 5GGRY 1G7LA 3ARGB 1UD8A 3H2QA 2YC1A 4PWEA 1OAJA 5ACLA 5GGVH 3SDCC 3SCMA 3HG4A 5KJ4A 2BHYA 2YQ3A 1BM3H 3KNBB 1A4JA 1T0NA 3LY6A 4HJGA 3S3BB 3P4NB 2ATKB 2VW6A 3N1PC 3QDHA 3OXSB 3P9MB 5IB4A 2XZCL 4QRRE 3LRHA 4U6XB 5CJOL 4F7MA 2VT0A 5EZJB 4BFOA 3CHXA 5KS9F 4LARH 4AIXA 1Q72L 4WRLA 4FULA 3HS0C 3MRHB 1A66A 4AT6A 3WGVB 1BPLB 3VFRA 2GC7C 4Y4KC 1F8TL 1RK0A 1S9XA 3LRSA 1DVQA 1T7VA 5F3FA 4MWFA 1FG2A 5DVPA 2FJUB 4RAVA 5IVXF 2CO7B 3RFZA 4YHKL 4DW2L 3GRGA 3V5KB 5IBTH 5C0CE 2KZKA 3D05A 4N0YL 1IE4A 1J8HA 2IFFL 1PPIA 4QKXB 2HUHA 2EXSA 3ULVC 5I8EA 2EEXA 1WFNA 2VNCA 1OGAA 2AITA 2CJUL 4QJ3B 1GYAA 3DJZA 4FERA 2V2XB 3F8UB 1IGFH 1XMWA 3CC5B 2FX7H 4WNJA 4YWGH 2H5UA 3V4PL 4D7PA 3VQMA 3REWA 2NZ9C 1W8EA 3U6RB 1MCHA 1O6VA 2JJSA 5F72S 1YC8A 5CBAA 3X1GA 3KHOA 3DVGB 2R1YA 3GBNL 1AY1H 3NGBB 2XXFA 5JPNA 2OFQA 1U8KA 3MOQA 4WI5A 2DIJA 2XZAL 4U0RC 4LVNC 5JHDE 4HFUH 1EO8H 5EBWB 5EN3A 4XZUA 4N5EC 3I02A 2GT9A 5D1QD 2UWEA 2VDPB 3LVEA 1RIVL 3LMJH 2F19H 2GIMA 3TBVB 1L9RA 3RVUD 1M1XA 5EU3A 2NUPA 3RX7A 2P5WB 3OAWA 5BO0D 4H88H 1CGUA 2Z7ZA 1VFMA 3AVEA 3EYUH 4Y2NA 1Q0EA 3DX3A 1A6UH 2GI0A 5DURD 1XBRA 1KTCA 1ICTA 5F1IB 4PJ9D 3H3BC 1NUFA 1P7HL 1YN7B 5JXAH 1PZUB 4XNQB 1E3FA 4G6FD 3VCLB 4ODTL 1PY9A 4QRAA 4S1SH 1ID2A 2IDQA 1K85A 2JB5L 2NCEA 2VRAA 1I1FA 1HWWA 1N7ML 3UJIL 3UTOA 2D0HA 2FQGA 3I75B 4NQCA 4YX2H 4Z3HA 1A5FL 3BZ5A 3HRZC 3I9PA 3L2LA 3WIFB 3DDFA 4PJGF 4HVBA 2DKMA 3ARBA 1TFPA 3MJ8B 1MHHB 3W81A 4Y0GA 1NANH 4JHAH 1MHCA 4YBQC 1S7TA 4XHJC 1MFVA 4OZHE 3VFTA 1FV1A 1SN0A 2ZX9A 1DVYA 2QGDA 3WJLC 3ZY7A 1MCPH 1O7DC 5DVMA 1JF1B 4H2CA 4OCYL 4Q0XL 2B2XL 1G1YA 1MPAL 4MCZA 1S3RA 4WNSA 3WHE0 4HGWA 3Q13A 3CLFH 4ETQA 2IO5A 1XCTB 3P3YA 5F7WC 4LSDA 3HHSB 1PSKH 1Q9OA 2Z92A 3GIZH 3OB8A 5C86A 2C3GA 3TWCH 2YJQA 4F5CA 2ZOWA 3PPEA 2X38A 1EGJH 1K2DA 5ANMA 2XTJC 4A7QA 3G08A 4YHKH 1VDGA 4Q97A 5I0XA 2XV0A 3HE6C 5HD8D 3BGMA 3QNZA 3MRQB 2IFFH 1KGIA 1PLBA 1A4KB 4A6YA 5J7CC 3RVXD 2DQDL 1KIQB 1NC4A 4E9TA 4KKCC 1TENA 3U6XA 5K39B 3D07A 2P43B 1C12B 4GW5B 4YHIA 3QULB 3ZKMC 5F6HI 4Z7VB 3NEOA 2DQEL 3ABGA 3QPXL 4JKWA 1L5GB 3DOIA 3QA3B 2AJ3B 4BZ1A 4P23B 1YYLL 2OZ4A 4EZKA 1XT5A 4UM9B 5KVDE 4PJ7F 1KTLB 1FLRH 5E9DD 6FABH 2Y1VA 1GIGH 3D85B 4JFPA 1HZHH 3GBML 1JZ3A 4LLDA 4KUCD 4ZNEE 4J2XA 4JFDE 2B59A 3JWDL 4BKLA 1SUHA 4M62L 1ADQA 4U0RB 3QUML 3K4ZA 1D5ZA 1MAML 4F9PA 5KSBF 1U58A 3LMJL 3TBBA 4M1DH 1HHKB 3BFQG 1IRAY 2LQRA 4P2RB 5IBLC 1B6DA 3VH8G 2YA1A 4YUEL 4XP5H 5GS1C 3WJMA 1TEYA 4XNZC 1ETZB 1UCBH 1A3LL 1BVLB 4Y88A 1IAIM 3BAIA 3D9AH 3QQ4B 5EZOL 2AAVA 2CAKA 3QARA 4NUMA 1UJ3A 2VXQH 1J0KA 1ZVSB 3J2PA 3MA7A 3NQIA 5F9DC 3FBQA 2ICEA 1NCWL 2HJKA 2CKNA 3H7LA 2H0EA 2VN6A 4LCIL 4NPJA 1LO3L 1RQ5A 3Q8BA 1NBCA 2C1OB 8PAZA 4RWHA 2J5WA 1UT1A 3EJZD 1TYJA 3AROA 3O6KH 1OCRB 1XF5A 4JQXA 4ODVL 4JMXA 3ZR5A 1PFCA 2ZAIA 1CYXA 2WO4A 3GSVA 3NZSA 5EEWA 3SQOL 1ETB1 2G30A 4DEUA 1A6VL 2I07A 5F9WB 3AMLA 3MLUH 3IVKB 2E5EA 2EDTA 1QSZA 2M2DA 5ILTH 1E9QA 4OJCA 5E4OA 3IN2A 4APQA 4NQXB 2ZXEB 1A22B 2CR6A 2X2YA 1UB6B 3FN9A 2K3TA 4WWKB 3I6KB 5FO9B 2J8UA 2J4WH 3JTSA 4QY8B 4XPTL 1J7VR 1V8HA 2UY6A 3B3IA 2LT9A 3RWIA 3AWGA 2J2ZB 3D2UB 2JIXD 3T8VA 1JGIA 4D94A 1PSKL 3PY9A 4KVCL 5HGHB 4NQQA 5KG9B 1KBBA 1TEFA 3A6CH 3I3DA 3T6VA 3LOWA 2KL6A 2XN0A 3HW7A 4FHKA 4ZXBA 4UDUB 3MROA 4ORGB 3TVMC 2V9TA 3UAJC 2WIIB 1DEEB 5DZAA 3FCUB 1IAII 2ADFL 4XMVA 3PAUA 4LLQA 1YQVL 1Z5YD 1NMAH 2RR3A 3MLPA 2ADGB 1RIUH 4JFDA 4QXGL 3ZZQA 4JW3A 1W72L 1FC2D 2IXQB 3K72A 1K6QH 2R2HB 1XF5B 4OSUH 2PPFA 4X0KA 2R69A 2CO3A 1E2WA 1R0AL 1CFSB 1XGPA 4JFYB 4LU5L 1J48A 4HK3J 4GSXA 2UXFA 3L9YA 3SGEH 3OAZK 3HMWH 2DYPD 1QEWA 4QDGA 2XFXB 1GS7A 2X70B 3M1OA 3RL2A 1PKOA 3O4LE 2OJZH 3CSYB 3KXFE 3EH1A 1NGXB 4XGZB 4Z0BL 1N8ZB 3Q3GB 2QGCA 4K23L 1YDPA 1BOGB 4UI2A 3DMMB 4P5TA 1MHPH 3GYRA 3FB6A 4XWOD 4YDJB 4HOXA 1IGIL 5F9OL 4Y5VB 4CBPA 2NPLX 1H8NA 4ABWA 4RISL 3Q6FB 3MLYL 3KYOA 1FIGL 4APQB 2LOEA 4DVBA 2W0LA 1MNNA 3TYFA 4NP4L 3UTSB 2IBBA 4AIOA 2J12B 4UUJB 5IK3B 3DV4B 5I6LA 2XVLA 1WBYB 2WXOA 1GW6A 1UA7A 2MTAA 2EC9T 3CZFA 3FH5A 3DA0A 3MJ9A 2OPCA 1HT6A 1DANU 3KYNB 1SXAA 1XGUA 1OAUH 3FQ4A 3CFCL 1BF8A 4OH2A 3HI5L 3RWCA 4C4KO 4R4BB 4IM8A 1FYTB 3O0RL 4F7PA 4PRBA 2ADYA 3QUXC 4JHBA 1D7FA 2EYSB 3JWNG 4GKLA 4I87A 2BSTA 4DGVL 4ZPTA 4U2ZA 2E47A 4JG0H 2XFGB 1LXMA 1WQVT 3QH3B 1CGTA 4QF1A 4YSDA 5I6OA 4U1HA 4XP9L 4NQSB 3D7PA 2KH2B 4LOFA 1V54B 3O9WB 3D69A 1G7IB 4M6ML 3WS6A 3HBZA 3NIDB 4D9RD 4LESA 3FTVA 4B5EA 4PJ5A 3CWGA 1ZKAA 4IHOB 4B9JA 2XPZA 3MRRA 4NBXB 4A6YH 3FO0L 1M7DB 3JWOL 4AQOA 2FIKA 1SHMA 3W39B 4G5AA 4HYTB 4IGBD 3WEOA 1EHNA 2XPYA 4XPTH 1P0SE 2WQXA 4R3SA 4EI6A 3C5JA 5K9JH 1QVOA 1QASA 4FXGA 5D8JH 5FLUA 3WIAA 3IMUA 3KPLB 2W07B 1MFUA 5SX4H 4BZ1H 1MF2L 3NDYE 5EU6E 2OL3H 2XHNA 4K4KA 3EO9H 1A4AA 5DJ8A 3ZDZF 4TVPH 4XMUA 2MHAB 3CZNA 1I7UB 2BINA 4NKDA 5GSVA 4M6OH 3MNWB 4AW7A 4NNYA 3ARXA 3MRQA 4GS7C 4LF3A 1I3VA 2X3CA 2WY3B 4BFBD 3T6ZA 5D71H 3LKPA 3OGOE 5BS0A 5B3JE 4EE2A 2WBWB 2HX8A 3L3KA 4QHLB 3VXSA 5BMFL 2IDCA 4K15A 2WLKA 2ZUYA 3DJTA 3WEXB 4I9XA 2OP4H 4PHZA 1NANI 5J3HC 3QWRD 2BNRE 3AACA 3QJHB 2DL9A 4EKJA 1MWAA 4P2RD 1M7XA 1J5HA 1PZAA 4QRUB 5CFHA 4GQQA 3FO9A 4PV8B 4IQHA 4DKEL 1O5PA 5I74C 1U8HB 1XGQA 4EN3C 3UADA 4YO0B 2QGBA 3OJVC 3SDAC 4YDVB 1F02I 1AKJA 1F90L 3HCVA 1FJ1B 1N67A 5BQDA 3S34H 2JIXA 1H3XA 3QG7H 3UG5A 4P48A 1MIMH 3ARFA 1BPVA 5LG1A 5KYXA 2P44B 2VUKA 5E9NA 1MIEL 4NQCB 2WXRA 5EU7C 4IBLT 2VN5A 2ZOLA 3EDKA 1G1OA 3S37H 3PV7A 2C9AA 3CX2A 5C0JA 1HI6A 3QW9A 1YEEH 4IKJA 5CBAB 3E8UH 2ITDA 1R3IH 2Y72A 1IC5L 4PJ9A 4U1GC 3ECBB 4P07A 4HWEL 4XNZB 1FVEB 1A7NL 2WW8A 3H9ZA 4KK6C 4Y5YC 1LD9B 3T3PE 2H8PB 2VDRB 1J9RA 3AG1B 3NK3A 1QVOB 2QQLL 2IH9A 4J8RA 1HQRB 4NWTL 4QRRB 4MMXB 3FCSA 5AB0A 3IXTA 4N6RB 4NUJB 1NA8A 2BIMA 4PJDE 3W39A 1AGBA 2EUZA 5EV7A 3GM8A 3QWOB 3X3FL 5JOEA 3TBVA 4Z9KB 5C07A 1U41A 1M42A 3E1ZA 3X14B 1EERB 4L3FA 4N2IA 4QTIL 5JOPD 1NEUA 5DD3L 3ULVD 1KDIA 4XPGL 3V0WL 4A6YL 2OJEA 3B8YA 1HHJA 3ISWA 5F96L 4B97A 5LQBL 2RIKA 5IROC 3SHSA 1YEJL 4HS8H 2JJSC 3Q2NA 5HHXH 2BNQB 5HHPB 4JFUA 1JAEA 2MTPA 5E6RB 5CLYA 1O75A 4D9QD 5HYJB 3GO1L 4KKBD 43CAB 1HQ4A 1IO4C 4BZ1L 2OZ4L 1KPUB 5HYSA 1H5BB 4OFQA 2OL3L 4XN1A 3W3BA 2MNUA 4POZD 1CXEA 3JXAA 4N2CA 3TJHD 4AZ8B 2X6BA 1MWAB 2BIPA 3QEQB 3GBEA 4YDNA 4UOZA 8FABB 4N5ED 5CGMA 2F53E 2YQGA 3OSKA 3TJEH 1BMGA 4LSQH 2K6WA 5IQ9B 3EYOA 1BEXA 4PRPA 3BRGC 2X44D 1CFMA 2KUTA 3QJFA 4LHQB 3SY6A 4MD0B 4CVUA 4PJXE 5JHDB 3HAEA 5FHAH 2Z31A 4MMYB 2SEBA 5FEBA 5KSAB 5L7XH 4LEEA 2R8SL 1JZGA 1T6BX 4NZUH 3PAYA 4OJYA 1UJTA 4FFZL 3U30C 5IB3A 1KYFA 3VXNA 2GBUA 3ZQXA 1MW2A 1PKQB 4MNGA 1BWWA 3GMMB 4YBLB 4BFEA 1XSKA 3LXCA 1IX2A 4B7LA 4CILA 3EZ8A 5H94B 2FHBA 3BEVB 5K59F 3P73A 2CRZA 3COOA 1RSFA 2AK1H 3QEUB 3PXJA 3ARFD 4NQEB 3X14A 3L6FA 3CZFB 2VDPH 3FT3A 1MUJA 1OAZL 2A6IA 3AUWB 2L7UA 4FQJL 2YA2A 3IXTB 4N6RA 4NUJA 5IJBC 5JNYB 4OJAA 1I3UA 3SKJH 3RB5A 5BVJA 1WWCA 2Q6WB 2J1XA 2YEZB 4FFYA 1WFUA 4RMRA 1MJ7L 3T2NH 5JXEC 4KKNA 2PW2A 2YGOA 3DJSA 3E8UL 4R96B 5G55A 1DANT 1WC7A 2O5YL 3E3QC 1R3KB 1A7NH 2WQUA 3OF6A 1LO4L 4N2BA 4WV1C 2L7JA 4TLSA 4NM4H 1DFBH 1DJGA 1P6AB 2OSLA 3WKQA 3IGAA 2BNQA 2BWDA 2IF7A 3MCKB 1R5IA 4DCQA 4Z95L 4PLKC 1BVKA 5IW6A 1CFVH 4PUBH 4LVNB 2ZG1A 1TETL 5TH2A 4JUSA 1KIRB 5ITBL 1EMTH 5IVXE 3UPAA 4JO4H 4NHUA 1WD9A 1MVYA 4HQQL 2OK0H 3IDMB 2BNRA 1UG9A 3QORA 1U93A 2QR0A 3BVNB 1VZHA 4NPYA 1SJHA 3QIWC 5D2LB 1N4XH 1MCDA 3QXWA 3FO1A 4FTVD 3BKYL 1QLEH 2VMCA 3AFLA 3J8F7 4MMXA 1RZ7H 1YNTF 4ZQKA 4XAKE 1YY9D 5E6YA 2VH5L 1NC2A 4IOFC 3Q1SH 1WWBX 3QDJE 1GKOA 4GH7B 4V2CB 1KV3A 2ZUWA 4KO9A 2BS9A 4FNLH 3O6MH 4JRYB 3P30L 1XFPA 1F00I 4D0CB 3IAQA 2PWHA 1RXLA 3B83A 1SYSA 4U33A 5CR1A 4HBQA 2MQ0A 1WEJL 3D0VB 3TPKA 1W91A 3OKEB 4NO0A 4WI4A 4AV0A 4U4BA 2OJEB 4CUCA 2DQIH 4F58L 5CD5D 2EC9U 3MRDA 1SBSL 4JFDD 2P5PA 2FZ3A 5JDSB 1HJCA 4QMEA 2F1AA 3L3OA 3CXHJ 3AS2A 4FZ8H 4JN2B 3MFFA 2IANA 5JA8B 2EJ1A 4UT9L 4NERA 1EUTA 2BOLA 2AEPL 1HH6A 2QL1A 3F7VB 1RURL 3NJNA 4IS6A 3OX8B 4DGIL 5A2CA 4Y7OC 2XT1B 5L7XL 1TJGL 5FYLD 4FFZH 2WC7A 4PJGE 1GZQB 3WL9B 4O2EA 1OSZA 5AB1A 4KUCF 1UFGA 2UXVA 1YA5A 2E9IA 1LILA 2OQJB 4UQAA 3B6SA 3RTQD 1IB5A 5KSAD 3AMKA 2CBOA 2APBA 4OB5L 3FRPB 1N10A 1S5IH 1IGCL 3G04A 1ZVYA 2NLJA 1KGXA 4AV4A 4G83A 4IIZA 4RGNE 2DM7A 2ZUVA 3MRMB 1VESA 3HG2A 4F57L 1BF2A 3FT1A 5TDPA 4MNQB 3GSRB 3PIQA 1MDAA 5F7KC 4OLYL 4CVZA 2WPGA 3K2UL 2ZXDA 2ENJA 3CU7A 4A2LA 4A63A 3DSFL 4PRNB 4PFEA 3MN8A 2JQAA 2OX5A 2Y5EA 4F1SA 1KGCE 2DYPB 4QO1A 4PRPE 2VLLB 5TK2A 3TYGL 4TQEH 2F8IA 4KMLB 2C9XA 2OMXB 4RAUB 2OMZA 4ELKB 4MSWB 4ZMAT 4HS6A 3MRPA 5F89B 2YPVL 5L6YL 2X6VA 5L8KB 2HTLC 5LNEA 4GAGL 1KIQA 4PLJC 1F2QA 3DGGB 3ARED 5FOBA 3BQUD 4M9OA 2AKRB 2DJSA 1JUFA 5SWSB 2ATPB 1NPUA 4C8XA 1I1FB 5KBKA 1J8KA 1AQKL 2VM9A 4XE0A 2VDLL 2E6PA 2EDKA 2GCYB 4K7PX 4KTYA 4XNQA 4XI5C 4XVTL 4WY7L 1JE6A 2R1WB 3T6QC 1OF2A 3WOVA 3U82B 3N43F 1NFAA 4PJXA 3DOHA 3GXFA 4GP4B 1DQDH 4CVXB 2GTQA 1RSYA 3WL9A 3WNMA 4WW2F 4XNMB 1E0OB 5F7DA 1M7DA 2AQ2A 2DQIL 1VSCA 3NSXA 4AQEB 1KCVH 1MY5A 1X5GA 2K8QA 4X5XA 1I1AD 4QXTB 5KSUA 2VDKL 3BDXA 3SPJA 4PJDA 1K5NA 3EKCA 2FT6A 2YJLA 3O2WL 4IIQA 3QWQB 2COQA 3SJVE 1DVFB 2FDBP 4Y5VA 4QRTA 5TF0A 1M71B 5GZND 5I15L 5B22A 2ZCLL 1BZQK 2EECA 2JFCA 2L8AA 4GRWF 4M5TA 4PGZA 5IB2B 3HRPA 1CE6B 3KLHC 3ARBD 4LRIA 3V6OE 4ZAKC 4F8NA 4WW2C 1NFDA 3CDFA 4CMHC 1M2VA 3IDJB 4H13C 4HCIA 4UYPA 3MR9A 3HRZA 5BRQA 3NJKA 4GEJA 3B5TA 3PJLA 1HKFA 4NC1C 1BD2A 5IMKB 2OMNA 2VB5A 3CZJA 4AGQA 5FW6A 4OCWH 4GBXD 9CGTA 2JE8A 2YD3A 1U8QB 3TTSA 5A6LA 1RLBA 2ZKWA 2ZUSA 1D9KB 1PG7H 2WM0A 1SJXA 3VD9A 2WD0A 3L9BA 3DHPA 4KUZH 4UTCA 4CW1B 4X4YA 3RJDA 3ZKNC 2WVTA 2NXZC 3VGAB 5ALCH 5CD5C 4AM0Q 2OBGA 2VLJB 2V5SA 5FYJH 4LOVA 2J55A 3NP3A 1OF0A 4UF7C 1IZKA 5CLZA 1JNHA 4XCYA 5GJTL 3ILEA 2J20A 2R83A 2VAJA 5JQHC 1U92A 4ODXB 1EZVX 5HYEA 5DEZA 2RJMA 3MRHA 4APQC 1IEAB 1S3KL 3MA7B 3UTZA 3OXRA 2YHGA 3FQRB 1BVLA 2MMXA 4FG6C 4LASL 3IDIB 1G5AA 4UCFA 1DE4A 3DMMC 4P57B 2ESVA 1BZEA 5K9OB 4KMTH 3FBKA 4YHZH 4MJ6A 3EYSL 5AW3B 2QMKA 1BM3L 1GGIL 2DLFH 3QFJE 4QXUH 4MAYC 2JB6B 4LKCB 5INDB 4JG1H 1XMEB 2DDQH 4JANA 1TTGA 3ZT6A 2D0FA 5FYKH 1KN4L 4Y2DC 5D2LA 4A39A 1WIUA 3WLBB 1MFAH 4L3EE 2L4OA 1CN4A 2CGYA 5A6IA 2OMVA 5F9AC 2C9VA 3CHRA 3E3QE 4HUNB 43C9B 5D6CB 1T2XA 3CCHA 5JIIA 1QNIA 3AQXA 3BAYA 1DVZA 5DQDL 4F7TA 2VZVA 4LKXA 5CU9A 4FFZA 3WFEH 1JYXA 3VWJA 1JPSH 4F7EA 1CFQB 3ARPA 3IBEA 1NIEA 3SYOA 1U8KB 4WUUD 1KCBA 3EUUA 4LGPB 1PLAA 3US1A 2HP4A 2VXQA 3LPWA 4DW2H 1NPJA 4EN2A 2DF3A 3QI9A 5KJRL 4OLUH 4OF6A 1F13A 3NESA 2J1KA 5KYUA 1ZY9A 1LP9B 2G3MA 4P06A 4L0PB 3D30A 1HHIA 3RE0A 1E4KA 5MHSE 3GSWA 1VFBB 3IWVA 4N25A 3FFDB 4V1DD 4MCYA 2HLEB 1YEGH 5FK9B 4F1ZA 5EO1A 5BVJB 1A7RL 2IC2A 4AYID 5F0JB 1G6RB 1CLCA 1F1AA 3P9LA 4XP1L 8FABA 5HI4D 5AAMA 2CKBL 3HUJA 1X5FA 3IAPA 4B27A 1RZIB 3FSWA 3QAZB 2AAAA 3F7KA 4HXBL 2AXJA 4HFUL 1JTPA 3L3IB 4E2OA 3KLKA 4BSVB 5KVMC 3W82A 2JI1A 4E9VA 1SVBA 5EZPA 4PJCA 4KNUA 3FFCD 3ARBB 1PG7L 3RJQB 4PMFA 4QOKA 3JV5A 4CMHB 5CSZB 3AM8A 4KUZL 2E3VA 2YPLE 1MRCL 4LSRL 3WXVL 2EO7A 3ARDC 3TBYB 4O2FA 1IC4L 1RJZB 3MOAH 5TDOA 4W9FC 3TZVA 4A2HA 1D5BB 5AZEL 1MCQA 4NCDA 3OKLB 1I85A 4R7LA 5HHME 3TBSA 4BWWA 3SE3C 1AMYA 3SCMB 3DX0A 3HHSA 5IMOA 3GSNL 4LKXB 4PG2C 2DMCA 2GEEA 5EUOB 1T04B 1M05A 4ODTH 5D5ME 1VKXA 3T2OA 4QRRA 1JVLA 3ZDZB 1CDIA 1AGEB 2OMVB 4NQEE 4JPQA 1UATA 3ZZLA 4HBCH 3H9HB 4OIAA 4LXFA 1SMAA 1ZCRA 4PTTA 4DK5A 1K8DB 1KJ2L 2HH0H 3GF8A 2WYZA 3FB5A 4JY5H 1T5KA 4ZS6C 3WAKA 2V3EA 1FPTL 3S3DB 2BHFA 4GKNB 1TJIL 3PWUA 4X7FC 2UWEB 4Y16D 4I0KA 4IMLB 2IGFH 2IH1A 2V17L 1T5WB 3O6FB 3UMTA 1KN4H 1HCYA 3L7EA 2BZCA 4PRHD 3V52H 3LRMA 5IW1A 2AI0L 4DAGH 4Q0XH 3GRWL 3Q44A 4PBVC 3FH8A 4HKXA 4AQ1A 1XEUA 2FECI 4YHNA 3STZB 1WVZA 2ITEA 1KOAA 4LLMA 4F37K 1GJWA 4IRJA 4Q7DA 4DPCX 5L2JB 4N28A 1T1XB 1UT2A 5GGSA 5GIRA 4Y4KA 3I9GH 4FFYL 1KGUA 3VFNA 4EDWL 2V2XA 3A67L 4NWUH 2YWYA 3HPJB 1LMKA 4WEEA 4XN2A 5C0AB 3OR6B 2A9CA 4LAQL 3ZBMA 3EOAA 2WKLA 2VXTH 3JTTB 5DJYA 1S7WB 3QUMB 4F9LA 5ADOL 4C56E 4XMLL 2PP7A 3K6SA 4RFNC 1JS4A 3ILDA 4PJFB 2APXA 4G8GB 4EXKA 3BHBB 2CU9A 1UA3A 1SHWA 3EFOA 2FJSA 5F93C 1EAJA 3KBEA 5IT2H 4TUKL 3I6SA 1I8KB 5EBWA 4K8RD 3M1CA 4OU3A 2VM3A 4FG0A 5MEQB 3MNWA 3QDJD 1YYLH 5I24A 3S35X 4UNIA 4K3JH 3AABA 2V9RA 3D06A 3NZHH 1M2VB 4YSCA 1ZGLA 3QXDA 2EYRB 5IF0B 2BVEA 3VYNA 1ORSB 2WOYA 3RTQC 3O6FA 3WHXA 2B3IA 1XIWB 1SJVA 3L8QA 4P2QD 1Z2KA 4G70B 4AJVA 4PRHA 3CFKA 2EIMB 1MAMH 3MV8A 4PJBA 4JFHD 2NY2C 2XTJD 4D7BA 5DDHB 2DI7A 1RZKC 4Q2ZA 3VSVA 3C5ZB 3X12A 4FL4C 4QHKJ 2Y2TA