3BQVA

Crystal structure of the double mutant d44a d45a plastocyanin from phormidium laminosum
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
105
structure length
105
Chain Sequence
ETFTVKMGADSGLLQFEPANVTVHPGDTVKWVNNKLPPHNILFAAKQVPGASKELADKLSHSQLMFSPGESYEITFSSDFPAGTYTYYCAPHRGAGMVGKITVEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plastocyanin
publication title High resolution structures of plastocyanin from Phormidium laminosum and D44A, D45A double mutant
rcsb
source organism Phormidium laminosum
molecule tags Electron transport
total genus 22
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2007-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3bqvA00
2E86A 1PLAA 1QLEB 3QJRB 7PAZA 1J9TA 1BXAA 1FFTB 2GC4C 2HRHA 2Y1AA 3NJGA 2VMJA 1A4AA 1ET7A 3C75A 3IE9A 3L45A 1PLCA 1XB8A 2FT8A 2XU9A 4HIPA 5I6PA 2OCCB 5B1BB 3ZX1A 4YSOA 1KBWA 1NICA 1JOIA 1GS6X 1OOWA 4ZK8A 5B7EA 1IC0A 2FJSA 2FQEA 1EZLA 1SDDB 2PPFA 3OD3A 5B3SB 1JZFA 3UAEA 6PCYA 4DP6X 2ZXWB 4AKQA 1JZGA 1ZPUA 2DY2A 2YQBA 1TKWA 3FS9A 2Q9OA 3OMIB 3PAUA 1GYCA 1ET5A 2YAFA 4A67A 3G5WA 4YSTA 1L9SA 4GYBA 3SQRA 4AI7A 4E9XA 4YSQA 2R7EB 4QKTA 3EH5B 3H4HA 4P5SA 3AY2A 3IN0A 3WIAA 1RZPA 1V10A 2CCWA 5I26A 3PLYA 2DWSA 4BXVA 1HAWA 2XV3A 3PPSA 5ANHA 3QJVB 3NYKA 3TA4D 2PP9A 5E9NA 1CURA 2YAHA 3CVBA 3QJTB 2FQFA 1M57B 1I53A 3TBBA 1AANA 2XV0A 2DV6A 3S3BB 2UXGA 3FPXA 4UAHA 4DP5X 3IBOA 4A2GA 3QPKA 2W88A 5FC9A 5TK2A 3HEIB 1PNDA 3CG8A 1J9SA 2XX0A 1OCZB 1OV8A 2VSMB 2A3TA 3X1GA 4W9ZA 3NJNA 1ET8A 4DP0X 1E30A 5F7AA 2BW5A 1J5DA 1DZ0A 2IDUA 1ASQA 1OCCB 3ASNB 3NJKA 5PCYA 2IAAC 2P80D 2QT6A 2FQDA 3FU8A 4NB7A 4BDVB 3NSCA 3NJLA 2J5WA 1CYXA 4G72B 4A2DA 1CC3A 1NPJA 1SHWA 2VW4A 5D4HA 1E5YA 3FU7A 2AVFA 2DYRB 2I7OA 1WS8A 4A2EA 1PAZA 5I6OA 3MBWB 2J56A 2PLTA 1AACA 4X4KA 1TEGA 2TSAA 3JTBA 4DP7X 5B7FA 2OV0A 4KNTA 5AFAA 3CDZB 2PP7A 3CVDA 3ZBMA 2YAOA 4QLWA 3X1BA 2LLNA 1ZDQA 2IDSA 2UXVA 2GC7C 3SBQA 2I7SA 2PPDA 2XXFA 1JZIA 4AZUA 3UADA 1DYZA 3WG7B 4HHGA 1A3ZA 4JHUA 3QJSB 1WS7A 1ILUA 2FQGA 4GP5B 4RH4A 5LDUA 3D12B 1PMYA 2J55A 1V55B 2NRDA 4N4YB 2PPAA 4YSPA 1YLBB 1GY2A 1CYWA 3ABMB 1WAEA 2VW7A 3KW7A 5B7MA 3FSAA 1SHXA 2WO3B 1AZRA 1EHKB 2HXAA 5PAZA 4A2FA 4AX3A 1AZCA 3NJHA 3DKHA 3UABA 4YL4A 4UANA 1IBYA 1AZNA 5D4JA 2HX7A 3NT0A 1TU2A 3FYEB 3PCYA 4M4RB 5F7BA 1GR7A 3S3CB 4GP4B 4HALA 1KYAA 3FU9A 3CVCA 3WKQA 2MRYA 1XMEB 4KOBA 2YXWA 2BP8B 4NAJA 1PLBA 1JZHA 3QJUB 2QPDB 1A4CA 3JT2A 1SF3A 1SDDA 3FSWA 3X1FA 2JXMA 1RKRA 4EF3A 3WI9A 4DPBX 3NJJA 2EILB 1IKOP 4E9VA 4WTQA 3UGEA 2W8CA 1GW0A 1NZRA 2GIMA 4WKXA 3AW5A 3IEAA 2TSBA 1BXUA 1T5KA 4DP9X 4NERA 2R7EA 3AG3B 4DP1X 1M9WA 4KNUA 3BQVA 4CSPA 3FT0A 3PAVA 3TU6A 2VSKB 3S3DB 3IN2A 4G70B 4E9WA 1J9QA 4BWTA 4G7RB 2ZOOA 1AIZA 2YXVA 3NSYA 2CAKA 2EIMB 1PY0A 3KW8A 2VM3A 1AR1B 3AG1B 1J9RA 1ILSA 3OMAB 1ADWA 2VM4A 5AKRA 2UX7A 3FYIB 1RZQA 2XXGA 3WNIA 2CBPA 1GS8A 1L9OA 2WSDA 2IH9A 2BZ7A 1BXVA 2FWLB 3FSVA 1AZBA 4YSAA 4L0PB 3WNJA 3OQRA 1SNRA 1E5ZA 2PPEA 2IDTA 3DTUB 3S8GB 1OF0A 3NJFA 5I28A 4ENZA 1FWXA 1W6LA 2GI0A 5I5IA 1MG3C 3OMNB 4HAKA 1ZIAA 4F2EA 2BZCA 1NTDA 2IH8A 2YAQA 4CSZA 1QNIA 2FTAA 2FT7A 2IWKA 3RYMA 3X2QB 2P80A 1JERA 4HCFA 1PF3A 1PZBA 3NSDA 5B1JC 4FAAB 2J57A 7PCYA 1NIEA 4E9TA 1OE3A 3EH3B 3EHBB 2CALA 2BP0B 3TBCA 1BEXA 3FU7B 1M56B 2GBAA 4KO5A 1B3IA 4UF7C 4KO7A 1PCSA 4F2FA 1UATA 3FPYA 1WA1X 2HZHA 3UACA 3GYRA 2EIKB 4BWWA 4G71B 1WA0X 2QDWA 3CDZA 1NINA 2QDVA 1MZYA 2GHZA 2PP8A 4YVUA 2AZAA 2HLEB 1AOZA 2IWFA 1ZDSA 2XWZA 1ASOA 2X87A 2B3IA 1OE2A 2HRGA 1AG6A 1OCRB 1SJMA 2HX9A 4YVNA 2PCYA 3S8FB 5I6KA 2YAMA 4BWUA 5A7EA 1JZEA 2UXTA 4HZ1A 2DWTA 1PNCA 2B08A 3PAZA 1A4BA 2BWDA 5I6MA 1W8EA 3NP4A 4PCYA 1FA4A 2Q5BA 1NWOA 3TASA 3H4FA 1NPNA 3DIVA 1VLXA 1QHQA 3MX0B 2PPCA 3FQYA 4W1TA 1X9RA 1TEFA 3ABGA 1HFUA 4HCGA 4Q89A 4DP8X 1ZV2A 1AS6A 4KO9A 5I6NA 3T6VA 2BWIA 3QQXA 4G7QB 3GXUB 1A8ZA 1L9TA 4N8UA 2X88A 3T71A 1L9QA 3AG4B 4P5RA 4M3HA 3AG2B 3FQ2A 1JXDA 1IUZA 1JXGA 1NIBA 2BP8A 2Y69B 1CUOA 1BQRA 3ZIYA 1AAJA 4JKNA 4A2HA 1BQKA 3BVDB 2JKWA 4KOCA 2IDQA 2DYSB 2XLLA 4G7SB 4PAZA 1AS7A 2XVBA 3ABKB 3SBPA 2BW4A 8PAZA 3T9WA 3FQ1A 6PAZA 1KDIA 3UAAA 5EHFA 1NIAA 2HX8A 2FNWA 4YSRA 2VN3A 3NP3A 4JHVA 3T6WA 2UXFA 3NSFA 2EIJB 3FSZA 2AZUA 1OE1A 1R1CA 1JVOA 4E9SA 4BK5C 3AZUA 4YSEA 1KDJA 3EF4A 4KNSA 1L9PA 2JFCA 4HHWA 4DP4X 2XX1A 3V9EA 1AQ8A 4Q8BA 3X1EA 2XUWA 1ETJA 2MTAA 1AG0A 4YSUA 1ID2A 2OJ1A 1F56A 2CJ3A 4YSSA 1E65A 5B1AB 3SBRA 4AKOA 3ZDWA 1AZUA 1MDAA 5D4IA 4F7KA 4GXFA 2IDFA 1GY1A 1J5CA 3N2JA 2YAPA 9PCYA 2RACA 4E9YA 1KCWA 4K9JA 1WA2X 3V9CA 1A65A 1BYOA 4BDVA 1NWPA 1JVLA 2BO0A 5TK4A 2UX6A 2FT6A 1JXFA 1KCBA 4E9QA 3OM3B 4DPAX 1GS7A 2ZONA 4E9RA 2YAEA 4YSCA 1KV7A 1BYPA 3NJIA 4BXSV 2WO2B 3H56A 5B1JA 1MZZA 2BHFA 3ABLB 5I6LA 2AFNA 1PZAA 2H5UA 1ZIBA 2XV2A 1URIA 3GDCA 3PXLA 1SFHA 1N68A 3U25A 1V54B 1PZCA 4DP2X 2BP0A 4AKPA 1MG2C 4KO6A 3EH4B 1IBZA 3WKPA 4GY4A 5B1KA 1HAUA 2QPEB 1X9UA 2EINB 1E67A 1GSKA 5I5MA 2GB2A 1BAWA 1L9RA 2YARA 2IWEA 3QJQB 1W6WA 3T6XA 4FA7B 2I85A 2H3XC 1KBVA 1XB3A 4A68A 2GSMB 4HCIA 1BQ5A 3ASOB 3T6ZA 2N0MA 1SF5A 5AZUA 1ASPA 1JZJA 5I5JA 4A66A 2PCFA 2H47C 2VW6A 1SFDA 4MFHA 1AS8A 4TXVB 1NIDA 3CZUB 4GP8B 1KGYE 3X1NA 1XB6A 3N55A 1RCYA 2XYBA 3NJMA 1NIFA 1OCOB 4YSDA 1NDTA 2ZWNA 5IY5B 2CUAA 4DPCX 2AANA 3ERXA 1N70A 3HB3B
chains in the Genus database with same CATH superfamily
1WBXB 4ZS6D 2XTJC 2DKUA 2GAZB 1Z9LA 3Q8AA 3IRCA 4NRZA 1AGFB 4NWTH 2N7BA 3HE6A 2F58L 3KXFD 1D9KC 3FTGA 4AQAA 2AQ2A 2EDQA 5I6PA 1NC4D 3NFPA 4BBWA 1G94A 5JNYA 2APBA 4XMLL 4KTYA 4PGCA 2B4CL 1MOEA 3V6ZA 3INUL 4G9FE 1A6UH 1EO8L 5FUZH 3HG0A 1G9EA 5EU6D 3CX5K 3QI9C 4NPKA 3HS8A 1JPGB 5LBSH 4EKJA 1FO0H 1W0VB 1L6ZA 3BAEL 2DWDA 1MIEL 2JELL 2YAFA 2MKWA 3SQRA 5BPPA 2EDMA 4XO5A 3EFFA 3TVMB 3QWRA 5DC4B 3VXQB 2R7EB 1UXSB 2VDPH 1YG9A 3DARA 3DV4A 3I6SA 2ICEC 5CWSA 1GH7A 3VWJC 2YRLA 1E3ZA 3QUZA 4TUUA 1FZOB 2UUDH 3BVXA 1KJ2B 2NSXA 1NC2A 4WUUA 5F3HA 3GMNB 1LK2A 3QARA 2F8IA 1RMFH 3CXHK 1COBA 1QBLH 4Z78A 4M93C 3RWCA 1FAIH 1BQHG 4GG6B 2UZYA 2X1PA 5FYLE 3ROOA 3SD5A 5IF0B 4MNQD 3BKCL 5CS7A 2F8XC 2VWEE 2BOBB 4XC1H 2G3ZA 3JWOL 3L1OL 4Y1SA 5JHDD 4Z0XA 1O6SA 2KQMA 4PY7A 4Z0BL 5EIIB 4IK7A 2XX0A 1QWHA 3MOBH 4LKXA 5CF3A 1KY6A 1UA7A 3UPRA 1PEWA 5C0FB 4QWWD 4Q9RL 4RGNC 4Z5RB 2EC9T 3E9UA 4S1QL 2BP3A 4B9PA 2F61A 3TJHD 3O3BB 4H7VA 5L2JA 5F3BB 2ERJB 2MOVA 3VNYA 4QAMB 2Y0SA 2C4FU 2QT6A 3RKPA 1JS4A 5E8EA 2FBOJ 3T0ED 1MNUH 5L88L 1EHNA 4Q58C 4NGHL 3V5DA 4U2YA 1WBYA 1YSOA 1HXMB 4LLAA 4HS8L 3S34H 4JQXC 3MU3A 3MYJA 2VW4A 1V3LA 1N8OE 5DZAA 3ZT6A 2DYRB 4PJDB 1WS8A 4R7DA 2BDNL 4D0BA 3O4LA 1ZXQA 3TM6A 3VGBA 5J1TC 2BRRL 4OLVL 2IALA 1DN0B 4R2GB 5JMRA 2Q7YA 4TUOA 5KVDH 5B7FA 2OMXA 1JN6B 1G7MA 4ZSOE 5C70A 5FXCH 2A38A 1NGYA 1CFTB 2ZKHH 3WELA 4PVMA 2EDKA 1F41A 4XN5A 3IS0X 4AEFA 2VSDA 5ILTL 3UG3A 5L9DL 4JFFA 3D0AA 4YDIH 25C8H 5I18H 4OZIB 4LEBA 2UWEE 3VMOA 2PPDA 3NCYP 6FABL 2DQEH 1M3JA 1PKQB 1DYZA 3OZLA 2OMBA 2ZOLB 3FT3B 2Q8BL 3NFNB 4LSUL 5BV7L 1T7ZA 5DK2A 3HBGA 1HL8A 1E7VA 1ZHNB 4AG4L 4NNXA 4UT7H 4HC1L 3CLFL 3MXVH 4UYQA 4GFXA 3DWTA 4AQ1A 3TA3A 1H3WM 1JYNA 5IIEA 1AZRA 1WIUA 4J4PC 4U7KA 3BGMA 5C6PB 1O7SA 3HJ0A 1UKQA 3HMXH 3DKHA 5I1CL 3CUPB 1SJHB 1YO4A 5FK9B 4KNQA 5DZNA 3ATFA 4MBRA 1EAPA 4PSRA 4PJ8C 1A6TA 3WO4C 1F6LL 1Q8MA 3EADA 4WJ5B 4OH2A 1GR7A 4YHLH 5F1IB 5A3ID 5HYIA 3SDCA 1ZTMA 1PZ5A 2VR6A 5AVYB 1VB9A 5K1NA 2EE9A 3F3HA 5SV4A 3F7VB 2BC4A 3C2AL 4J3OC 4S2SA 1NBZB 4FQHB 1ZK9A 2VERA 2OL3A 3H1ZA 2BP8B 2Y3NA 3H85A 1P84K 4R97B 1CLOL 2FBJH 2J4WL 5FHAH 4A7SA 5B38A 3NZUA 4O2FB 1XD1A 1IBHA 1U8JA 3MA7A 2R56H 3MRMB 4Y8AA 5FUCC 1OGTB 4R4NC 4KXCA 3WI9A 3T0BA 3WN5C 1S78C 4FXKB 3DVIA 2VLKA 3V52L 4M8RA 3AW5A 1FNEB 4KQ4L 2VLMD 1BECA 3TNMB 1SMAA 1EWHA 3OWRA 1MEXL 2IPKA 4X0KB 5C07A 2P5WE 3TU6A 5KBMA 1CD9B 1WH0A 1X5MA 3AQZA 3HVNA 4WO4C 3LNDA 3ZZSA 1PW3A 3WUZA 4XPBH 1ZT1A 3EOAB 3QRLA 1PY0A 2VDOH 2IH3B 2XBDA 3IJ7A 3RWGA 4KH2A 2Z8SA 2WLLB 3CIQA 3L3JB 1QFPA 5ID1B 4UTBA 2MNJB 4ZUWA 4ELKA 5KVGL 4UDTB 4M6NH 3F7LA 1F11A 3SDAD 5JQ6H 3E1ZA 3GZKA 3GSRA 2NY2D 1IBGL 2K1MA 1B90A 4ZO8A 4ZUVA 4Z3EA 1YY8B 1LTXA 3DTUB 2VDPB 2KYIA 4B50A 4B53A 2F53E 4NM4H 3E2HB 2NX5D 1DEDA 1JWUA 3F6LA 3RL2A 1AE6H 2H8PB 5ACLA 5C08A 5D55A 2FT7A 1H9DA 1J86A 2CJTA 5JPNB 1CWVA 5IJCC 3IB4A 2J3SA 2M26A 4JKLA 4XRCB 4P2RA 2MNWA 3RPBA 1IX2A 3RVTD 3X2QB 2VE6A 1BZ9B 2GFBA 4ADIA 2DPKA 5ICUA 1R19A 1OF2A 3QQNA 4PLJC 2Y1VA 1CTMA 3VFRA 2J1KA 1L7IH 1PX3A 4JREC 3ULVC 3L3KB 2OMTB 2LR4A 1G7LA 4IRZL 2AAVA 4FFZL 2DYPD 4XMLH 4DWHA 4DGYL 4F8TA 1H3XA 1IM9D 3BN9C 1OP5H 2V2TB 4M5ZL 5EOQL 5DUMH 5ICXA 4RMTA 3O6LH 1EZSA 4MMZA 1MFCL 4PV9B 4YBLC 5IHUL 4Y5YC 1A66A 3AXHA 2HFEB 2J12B 4X9IA 4I2XB 4W81A 5L7XH 3NOIA 1BZEA 2PP8A 2W1NA 4K3GA 3DPBB 4M61B 3X3FL 3BSZA 2X4QA 4J12A 4LEEA 4BZ2A 1Z7JA 1LQSR 2JI2A 3CXHJ 4FF9A 4ONHA 2HFFA 4OI7A 1MCQA 3VFNB 3HRZC 2OL3H 5FA3B 3IGFA 3O9WA 3MLZH 4MCYB 1I8KB 1E8XA 4ATTA 3MN8A 4ZFFB 3GSUB 2MNUA 3FO2B 3D08A 3O6FC 3W57A 2UXTA 4FYRA 2B08A 1UCBL 1E3FA 3MRKB 1M05B 4KTDL 3U0PB 1N6QH 4Z7VB 1C9SA 4P2OD 1E43A 3L1GA 4ZXBC 5AVQB 4X9YA 4WDIB 2PPCA 1JVKA 3NCJL 1IKNC 4CA4A 2BVEA 4DQOL 5D71H 4QOKD 2M83A 4AQAB 2BSSA 4XXCC 5EFIA 1OARL 2BWIA 4NDMA 5CEXB 2QQKH 3NFPB 3QQXA 4HWNA 4B5ZA 1OD7A 2QZQA 5JNYB 4ZFQA 3P0YL 4ZS6C 3WJMB 1OOAA 4KWUA 5GRXG 1BJ1J 5ID0B 4N1HB 1ZK5A 1EX0A 4LASH 2NQ3A 4PRID 5IB2A 3DJTA 1CLVA 3G6AA 4JDVA 3FB8A 4KOCA 4MJID 1HE7A 2ZPKH 3CZKA 2DWDB 4WI9A 5C0RL 1AS7A 1LO3L 4BH8A 5J11C 3EFFB 3SKMA 2FSDA 4NUQA 1FYTD 4TQIA 1U33A 4PJAA 1BLNA 3WKML 1YNLH 4HIJA 3GO1L 3HZKA 4FXGC 4U6XB 1KIRA 4OLVH 5CWSB 3WGVB 4PBVC 5EOTA 4NSKA 3RWDB 3S96A 1NBYA 2W5PA 1NC2B 1NAMH 1LDPL 5F3HB 2NY5H 3ESNA 3PXHA 1ED3B 3SQBA 4IHBA 4Z78B 5FLVA 2ROXA 5IOPA 2WWKO 3O3EA 2A1WH 4F93B 1XBDA 4FE9A 4QHNA 2XX1A 4PY8J 3HC4L 4L18A 3ROOB 4TF4A 4UQ3A 3NIGB 3P40A 4B97A 3UTSE 3T04D 2OJ1A 2P45B 4Z0XB 3TEUA 4HHAB 4N8PA 1DQJA 5DD3H 4B9YA 3QZNA 4XOCA 5TDNB 3F7YB 3LRGA 1AZUA 1DUYA 2MQCA 2E3VA 3KWWB 1L5GA 2CQVA 3QUYB 3W0WE 5F7HA 1E5CA 1S9YA 3UG4A 5GJSL 1SHSA 4G2AA 1JGIA 4FI7A 4PRPD 9PCYA 1GGCL 1VFBA 5FYKU 3QCUH 1T6VN 2NTFA 4O9HH 3AB0C 4XZUA 5F6HJ 5L2JB 1BGXH 2OPCA 3DVNA 3QDJA 3QNZA 3QPQD 3SY0A 4QWWC 3X11B 5DJDA 4JQXA 2Y5EA 2VDOB 2YAEA 32C2A 1WBYB 2GCYA 4OFYA 5I8OL 4WO0A 3TJHC 3MYJB 1Y7VA 4NN7B 2H5UA 3LDBC 4R7DB 1P84J 3O4LB 4ZMZA 2IFFL 1MCPL 2FGWL 2HWZL 3EO9L 3T0EC 3TIDA 2IALB 2GJZA 2OULB 5T3XE 1DQLL 1E4WH 4RVBA 4AMKH 1HJBC 2Q7YB 2BP0A 3UTTE 3SE9H 1KCVH 5IM7A 4R7XA 1G7MB 4GPVA 5B1KA 5CEZL 1J8HE 1ZLVH 4X5WB 2I07B 4KK6D 3VSQA 4JFFB 3AACA 3UCRA 2YD0A 2J8UB 2A6IB 3AT0A 2VITB 4NQDE 3FRPG 4UM8B 3D3VE 5BZWA 1UM4H 3V52H 4A6YH 3V10A 1BD2D 2Q8AL 2O72A 4CSSA 2DRUA 4JDEB 3PWJA 2VZTA 1FGNL 1KBVA 1MCEA 1TZGL 3RL1B 1LEKB 4ODUB 2EVGA 1YEIL 2D2OA 5D1ZI 1PX8A 2H47C 2R0WH 1GC1L 3GPEA 3I6LD 3JYCA 1ZEAH 5FYJD 4YUEL 3OKKA 3PGCB 1MXGA 4M5SA 2W9DH 3QEHA 3MODH 1VEOA 3D39B 3GQFA 2O5YH 1OP3H 3O45A 1TVDA 4PJ8A 4PJGE 2CUAA 3ZJAA 4H0LC 1U8KA 3C87A 3CFEA 5SWSD 4H8WH 1EAPB 2WVVB 1QSVA 4TVSa 4PJ5A 5HGHA 2ADJA 3SDCB 1PZ5B 4U33A 3IJ8A 5JUEL 4N2NA 4TQPA 4ZOCA 1NM9A 2YMTA 1R9FA 1PYWA 2A6DA 4S2SB 2EDHA 3OF6D 1WC7B 2OL3B 5E6ID 5I1GL 5B38B 2V5TA 4ZK8A 5B7EA 4HH8A 5A3IC 4GMTL 3MA7B 4RMBA 3WN5A 1B4JL 3A4EA 4KJQD 4QRPD 3MFFA 5TDOA 2RD0A 4EUPG 3Q5OA 3VU1A 3LH2H 1ZSDA 2VLKB 4P59L 2CHXA 3LKPA 3MLXH 2Y7OA 1ML0A 4M3KB 4ODVH 1CFMA 1AH1A 5MERB 5F7EL 1F3DJ 3UYPA 1QMUA 2IPKB 3KCPA 1X44A 2CCWA 3GEFA 5ADPH 4WO4A 4GI9A 1U2YA 1SY6A 4S11A 1HAWA 3ARGD 3P4NB 4NX0A 2P5EE 4PCKA 1ZT1B 4M7LT 4N68A 1UWGL 3FU3A 4N90E 1MF2L 1OT1A 1P4UA 3QULA 3SHSA 3BZ4A 4MJ4A 1EJOL 4ELKB 4PJEE 3EJPA 4CNIA 4KQ3H 1F11B 3BP4B 4R9HA 4PWGA 3GSRB 4I3SH 4ZUVB 3SE4A 1CTNA 4GBXD 3IMWA 4HXBH 1MW1A 2B9BA 5F7YC 1T0MA 2P48B 4LHUD 3I50H 2OZ4L 4GKNA 1IGIL 4NPYB 3LXCA 1Q1JH 5DHYB 5IFJA 3OKOA 2BW5A 3RTQA 1HI6A 3SDAC 3TBVB 3GZPA 1UB6A 1NAMB 4Y9BA 1FBIL 2NY2C 2G9HA 5C08B 4C58B 2DAVA 4MMXC 1TPXC 3FTYA 1QSFB 1CFVH 2WLZA 4P2RB 4PRBB 4HAFA 3JVGC 2K3TA 4LL1A 4DQOH 1T7XA 4GAYA 1HNFA 1PAMA 2G2PA 3ATEA 5GISH 1OF2B 5MHSD 3G6DH 5C0CE 3MLPA 2R0LL 5DUPL 1OPGL 1KULA 1BPVA 5IQOA 2ZP8A 3BEWA 3HNTL 3OHXC 3WY2A 2VSCA 4JPVH 5F7KC 3RVTC 5EZIH 5ICXB 2AITA 4Y5YA 5KUMA 2HRPH 5HHPB 4MMZB 4DP7X 3IAPA 4PP2B 4LB8A 5D70L 2A5UA 4XO3A 3QQ9D 4YX2L 2LGNA 5E1GA 4RFNC 4Q4IA 1D7BA 1PBYA 1R24A 4X8XA 1CMOA 5EH1A 4ZT1A 4F58L 4PJGF 5ABAA 3DUSA 2XZCL 3HRZA 2HFFB 3TZVD 4IRJD 5EG6C 3GXMA 3VDBA 1NPUA 3DSNA 4HHGA 5E8NB 1PY9A 1UD3A 3OR7A 1AR2A 3QJSB 3O3DA 4J3TA 1MCFA 4RH4A 4TVPD 2IH1A 5I71B 2AJVL 1FIEA 2X5PA 1ZXKA 2OYLA 2Z64C 4ECNA 2B1HL 1IKNA 1YPZF 5LN8A 2O6EA 5KZCB 5DDHA 2NY7H 5CHNB 5MP6L 4LCUA 2Y5QA 4NQCE 3UABA 4UANA 4XXCA 5JQIB 1BLIA 1U8IA 3CZSA 4A6YB 5DQ9A 4LHQB 1SY6H 3JVFC 1D5ZA 2KI6A 4P2OC 4NDMB 4YZFF 1JDCA 5BJTA 2V3FA 4ADGA 5FOBB 1A14L 5I1DB 4OI9A 2MCMA 3KXFA 4QXUH 5CIPA 5JHMA 2A4EA 3RIAF 1R46A 1RSYA 3WUWA 4PYGA 1JK8A 4CMHC 3LXAA 5IB2B 1UKTA 3QR0A 2ENPA 3FB8B 4JDVB 4W9DC 1SF3A 5I8OH 3U6XS 3CDGB 3AQDA 3ZL2A 1E8WA 1TOXA 4EF3A 4X6CB 3VI3E 3SKMB 5EU6A 1R6VA 5T3ZD 5KSVA 1BM3L 2OMYB 4PJEF 2WBWB 1CFSB 4LQFL 3FUNA 4HIJB 3UL4A 1KIRB 3RFZC 1BXUA 5EOTB 3DIDA 4NSKB 3S96B 1IC7H 4UT9H 1G9NH 4X4YA 1ZANH 1NBYB 1BZQK 3KL5A 4M93B 3IJHA 4TTDD 1ODUA 3S5LA 2Z9TA 1W8NA 5GRJH 1NOAA 3JV0A 5IOPB 4Q6YA 3GLEA 3ZHFA 4QHNB 3UZVA 4CU7A 1IAIM 3LS4H 1PJ9A 1QFWL 4AUJA 2AP2A 4RBPH 5A6IA 3EDKA 1QFHA 3KYMA 1OTUD 3PP4L 2EVIA 5EPMB 1FGNH 1DQJB 3QXTA 4AL8C 2NMSA 4I9WD 1ADQA 2F19L 1BXVA 5IW6A 4ENED 4ORGB 3TT1L 1CF8H 1CCZA 1DUYB 4I77L 1OAXL 1O75A 2ENQA 1YEIH 4AV5A 3OKDB 2NY4B 1KYOK 4FERA 1IRAY 3QNFA 1S9YB 2ZCKL 1DVZA 4CBZA 1CLZH 3SIKA 1G43A 1TVBA 2RTTA 1VFBB 3LPGA 4XZUB 5F9WC 5LNGA 3HE7A 1W6LA 1SRDA 4OR1A 3QDJB 1NAKL 3MV7D 3QNZB 1B2WH 4IQHA 4MB1A 5G2NA 4G6JH 3SY0B 2YAQA 5DJDB 1BMZA 1UENA 4F5CE 5A6MA 5DD6B 1QD0A 4OZGA 1DUZB 3FFCD 1EH9A 1DVSA 3T0EA 1X3DA 4QKXB 5JW4Q 2J57A 3COOA 5HPMA 3ARVA 2AXGA 3QPQC 5LNDA 4W9GC 5IFHL 2Y6TE 3SKOA 2GJZB 1O0VA 1CDBA 4B0MB 4M00A 4XP9H 1UH4A 1JNHA 2BP0B 4XC3L 5GGVH 3VXRE 3ARTA 2L8AA 5IM7B 4YEEA 1U8CA 3WIHA 2IANE 3OMZA 1AQKH 2BSTB 2FHBA 4CC4C 3B9AA 3LKSA 1FGVH 3VQ1C 1D6EB 2G2RA 3ARPA 4QPEA 4PB9L 2Z91A 4EZKA 2EUXA 1WA1X 1B4JH 2DQIH 3GYRA 2WQXA 2BINA 1QASA 2KZWA 5JHLL 3JTSA 2FWOA 2GPZA 2JKIS 5H8DA 4F7EA 3NFSH 5BZWB 1ZD6A 1RZGB 2F5BH 3FAWA 4YVUA 1OANA 3APDA 4BK8A 4KK6C 4KXZH 5DLMH 4UIMB 2IQAA 5HGDA 1TLKA 4JKWA 4W9LC 3P3UA 4PR5A 1F8TL 2XN1A 3NBNA 1ACXA 4JM2D 4XVSH 1Y18A 5IMKB 4EZJA 4R5XA 4DGWC 5IG7A 3QEHB 1MDTA 12E8L 4RGMC 4HJ1A 5DXWA 2P44B 3GMMA 2R0KL 3O45B 2ARJQ 3QPXH 2IAMD 3DTXB 1AO7B 1SYVA 1OD9A 4XP1L 3CFEB 5F89B 1IFHL 4W1TA 4XE5B 3VI3F 1OGSA 4J3UA 2C1OB 1FLRH 1X9RA 3CV5A 4PJ5B 1DN2A 2ADJB 3APMA 1J1OH 5HI4D 3KYAA 2E0PA 1PYWB 3GMLA 3OLEA 4FI8A 4HK3N 3SGKC 1J0KA 1N2RA 2AEQL 3U2IA 2P49B 4JO1H 1F90L 1FBIH 2YA0A 4WHDA 4G7YH 4J6RH 3VMPA 2F0CA 2OMWA 4TNVK 1JPSL 4LARL 4NQTA 5TDOB 5IHHA 4FNQA 1GZHC 2CM6A 4TUKL 5J12B 1INQA 1Z32X 2VLLB 5E6IC 1ZSDB 3SDDB 1ES0B 3U4BL 4KY2A 5DUPH 1OPGH 1KTRL 2JLPA 5LAXA 4NQQA 3T9WA 4U1LA 1R3HA 2ICWA 4P9HL 1C1EL 3MV8D 4X7DC 1W72A 3KGSA 3OGCA 2BSBA 5TTRA 2XACC 3GSVB 3KCPB 3I6GB 2FNWA 1LWRA 1XHHA 1ID5I 4YHPA 3ZOAA 1QLEL 2ROYA 2ADIA 2X4RB 2ZUTA 1CXHA 4Z3GA 4MB4A 3LIZL 4HJEA 5KVFL 5D5MA 2GQHA 2CNYA 4L9LC 5LGHL 3BZ4B 2JFCA 5AG8A 3GKWL 3A22A 3ARGC 1YUHA 4HUXB 1FVEA 2NLJA 4WFGE 1I8IB 2XG4B 2F7OA 5TD4A 4CNIB 3DNKA 4YFEA 3SE8L 4BFGA 2ZOWA 1JFHA 1IVTA 3WV0A 1TFPA 4WSKA 3A21A 4OCNC 1T0MB 3FO1A 1JTPA 1U36A 1HL4A 3N40F 2WWOA 4TULL 5JIKA 5IFJB 3RTQB 5SWZA 2CLRA 3RIFF 1T2XA 2YAPA 4RMVA 1GAFL 1OSYA 2G9HB 4MMXA 4GBXC 1LM8V 3JVGA 2NX5A 4OIBA 4OCYH 3U1PA 3TF7C 5KN5A 2E7BA 4G8EA 4Q7DA 3OM3B 4U0QB 5MI0B 3O6KH 4FZ8H 4GAYB 2N1KA 1KB5L 1QI4A 1KJMB 5K33A 2FZ3A 1Z5YD 4PJXB 2WO2B 3OHXA 1MZZA 2UZIH 4HEPG 5EUOB 5AVRB 4WW1B 3BEWB 3SZ6A 3D30A 1WJ3A 5DMKB 4UI2A 2CA3A 3FAXA 4BZ1A 2B20A 1OGAE 4JGMA 2X9WA 1IBZA 3L5XH 2DYPA 3D2UD 3ZSTA 3A6BL 4O2EA 1PIGA 4QO1A 4Q4EA 3VXUD 2BY3A 2ZXBA 3D25A 4Q74A 4ODBD 4AM0Q 2XQYG 4N28A 3L7EB 4DETA 3T6XA 1DE4B 5DD1L 3TWCL 3DUSB 3HI5L 3CSGA 4M6OH 5AVVB 4X9GA 1G7JA 3FCSA 1BF8A 3A23A 1DQQA 1YECH 1MLBB 3QQ9C 4A68A 2GSMB 3DSNB 2DI9A 5AZUA 1MFEL 3O3DB 3GIVA 3FF7A 3ROLB 1VZGA 1Z6JT 2IH1B 1YYMH 1OSPL 2IC2A 5EMYA 4F7MA 3TZVC 4DKEH 1XB6A 4HD5A 2Q7AA 5I17B 4IRJC 3EGDA 3VW3H 1DBKH 1KLUA 3LEVL 1AGDA 5ES4B 5DDHB 1AHMA 1NDMA 2CGRH 4LCUB 2IMNA 4QY8B 2D7PA 1KYOJ 3EOBB 3DX6B 1GTFA 3F7PC 1WZ1H 2G3NA 4JAMA 2XI9A 4OV5B 4I77H 3MBXH 2VNCA 4UT6A 5DQ9B 4XNMB 1D5ZB 2OTWA 3NPZB 3DHMA 5BJTB 1H9VA 1UQSA 1G9MH 2AEWA 1FFTB 2DF3A 1F3DH 1F6AB 4QOKA 4G80A 5I19L 3PWVA 3CN4A 3K8MA 5CIPB 2FH6A 2C9QA 1EO7A 1H6EA 3JBG7 3KPMA 3BVUA 3FQWA 1NAKH 4A04A 3RZWA 1F97A 1NICA 1IGJA 4OCXL 2P7TA 4XP5H 5J11B 1H8LA 4NFBA 4OQ1A 3V4PH 5DMGC 5B3JF 4FOMA 2RALA 3LZRA 3RWHB 4UTAH 2A83B 3UAEA 4PRIA 6PCYA 5L8KB 4AGOA 2ZXWB 1YVLA 3LKOA 2ZD0A 1WICA 3RFZA 1HSBA 5KSVB 2DICA 4JN1L 4X7CC 3S0PA 3WAJA 2D0FA 4Y19D 4A67A 3G5WA 3UFIA 1WBZA 3FULA 3ISRA 3ULUL 1OAKH 1OCWH 4J3BA 4NI6A 1MW0A 3AY2A 1NFDE 3CFQA 3IJHB 3MUJA 4HJTA 3H0TA 2JB5H 2C3VA 4FFWD 3I6KB 2D3NA 5E9NA 2CRYA 2OZNA 4XNZB 5JHLH 4H13C 3L8QA 1JK9A 3Q2LA 4I3GA 1F4WH 2VXQH 2EC8A 4TTDC 4NQUA 3KYMB 3MJ9L 5C0DB 4LQ1A 3VA6A 1TTUA 1ACZA 4I87A 4LCWA 1DJIA 3HCVA 1UA6H 5HHNB 4BZ1H 1QTPA 4B95C 3DV6A 5ACZB 1OIOA 5AB2A 1DSWA 1LL1A 1K8DA 3PQYE 1KLFB 1OTUC 5FKAA 2HN7A 1N5AA 4A1RA 1B0RB 3U48A 1J8SA 2R2BA 3HE7B 4ENEC 3TURA 1KTKE 2X6BA 1J5DA 3KPRD 12E8H 3OC5A 5IESH 3WFDL 1BBDL 5J89A 4PRPA 4L3EE 1WK0A 1Q9KA 4HH9A 2DIBA 2DZEA 4WFED 3SYPA 4YHKH 1CDHA 3WFHA 1FNGB 4MS8D 1H8SA 4OZGB 2MCPL 4PI0A 3T8VA 5DC9B 1TYJA 4AJ0A 1HZKA 4S1SL 5HPMB 2AXGB 5AOKA 1MFMA 8CGTA 1OXYA 1WSST 3SKOB 5D7JD 1B0GA 2AW2A 3T4AC 1OALA 3PJLA 4CC4A 3C5JB 3VE0A 4KTEL 4Y9FA 5TE7H 3O41A 1C12B 4J2QA 1ZSHA 1K6QH 4X6DE 2WUCH 3LKSB 1NGZA 4XPHH 1IT9H 3JTBA 4QHUB 2Z91B 2AQRA 4KI5D 3TYGL 4QCIB 3R7RA 4PMEA 2GEQA 3X12B 1OAQH 2PP7A 1BEYH 2FWOB 1S7SA 4FQJL 4TUKH 4EXKA 1HYSD 3WDIA 2ISDA 1A5FH 1NDGA 3U4BH 4JPWL 3WIIH 5GS0L 5DQDH 3LSOA 1CE6A 4LEOA 1AIFB 2IQAB 5HGDB 1BD2A 1HSAA 4OLYH 1BWMA 5JDSA 4PR5B 1S7XB 1QR1A 3WS6C 5JOPD 3KJ6H 1X4XA 5C09B 1WS7A 2B4CC 3UC0H 1Y18B 4HJSA 3EFOA 2NRDA 4ETQA 1FL3A 4R7NB 3IXTA 2YPLB 4N86A 3GMMB 2Z0BA 1QPXA 4OZIE 4QRBA 1RSFA 2NYZA 4P3WA 5JIDA 1VAHA 2W9EH 4JM2C 4PPTA 3UTPD 5IHLB 4KX9A 1CL7L 1LO0H 3SE8H 4FMVA 3UTOA 1PKQE 2XNAB 3B1TA 5DZJA 3SKNB 1GPOH 1S9VA 2WNGA 3FOLB 3MQIA 3PHQA 2VLRE 4N0YH 2OYMA 2YZ8A 2EH7H 1CXKA 1O9VA 2HX7A 5T1LD 3SGKA 3U4KA 3U9UB 2IAMC 1AGBA 3GMLB 1N26A 1NFDF 3IDYB 5I75B 2X1OA 2RB8A 1XDTT 1XMEB 2B0SL 1GZHA 5HI4C 5A40E 1YEHL 5E6IA 4IBUA 4RRPA 3UBXI 2QKIC 4GKSA 3N04A 5ESVA 4PJFA 1INQB 3NRFA 2Y06H 5E5LA 3JWOC 4C55A 4AMWA 5CJQH 3B2DC 3L4VA 3N43B 3QG7L 4QRPA 2ICWB 3UGEA 3CVHL 2VL4A 3OGCB 5GGQL 1TKWB 1ACCA 2DQJL 4RAVA 3OBAA 4YHPB 1P4BH 4L8CA 4KUCD 5FWQA 4L9LA 1RZ7L 3A6BH 3HPJB 5CJOL 5D5MB 1T0PB 4I3RH 2X12A 4XWOD 4HFWA 1FVEB 1AR1B 3AG1B 2NY1D 4A7QA 1DHKA 3PU7A 5IEKA 3OMAB 3V4PB 1IAKA 5AKRA 1IC5L 3B6SB 3FYIB 4J3WA 2YSSA 3ZUCA 4R83A 3R8BB 5CEZD 2PYFA 1L9OA 2KHAA 4V2BA 2F7PA 2E47A 1FG2B 2J1YA 1X4YA 5CR8A 5FIEA 2ZUUA 3FO1B 2VGLM 3WNJA 4JO4L 1WISA 2NY2B 1SNRA 2ITDA 4GBXA 4GRWH 2CLRB 3AY4C 3P1VA 1IJ9A 4LP8A 5SWZB 5HYJE 3CSFA 4X6DF 4MMXB 3MR9B 2QQLL 4LNVA 2B1OA 5EULV 2NX5B 1LNUB 1QNZL 7FABH 1FL5A 4G8EB 2D73A 3K4ZA 4U1KA 1NTDA 3SDXB 2OP4H 1A7RL 3NRPA 3RYMA 1E0OB 2HSIA 1WFNA 4BQ6A 4HIQA 3DUUA 5EEYA 3WJJC 1BQHB 5J1AA 4FAAB 4WFHD 5I5RA 1NIEA 1PFCA 5FCUL 3N91A 1UM5L 1TVHA 4TSCL 5BV7C 4B96A 1IGTA 4OCWH 2D3JA 2E46A 1CVRA 5KOVC 1BVZA 3KLSA 2UV3A 4PRHB 4F7PB 1SXNA 3W81A 4O2EB 5ADOL 4FYQA 5KTEH 2AQPA 3ARFD 4KAQH 2CE6A 5JPMB 1U95A 1KC5L 3VDAA 4G6KH 4JN1H 5MEQB 4XGZA 5JO5A 4M1DL 4QAWA 1UOKA 4OLXL 5B22A 4A2MA 1AMXA 3IU3B 3FCSB 4IBQA 5FYKL 2WXHA 2VR5A 4HBCH 2ZWKA 4JUTA 4OM0H 4GAGL 2BSRA 1DJXA 3N85L 1YHPA 2P28B 3GIVB 3BKYL 1TUPA 2D8KA 4GB9A 4IRJA 1I3GH 1RZJL 1HVXA 4F7MB 5CZXD 1MW3A 4M8QA 1KIUA 1HINH 5EZOL 4B6ZA 2YAMA 3QZMA 1BF2A 1ZGLB 3IPFA 3L3OB 4EBQL 1YEFL 2HVJA 3J27A 3PAZA 2QSVA 1FZJA 4O58L 4MAYD 4W4OC 5I6MA 1OP9A 3F2LA 4JFED 5DHVA 1TNNA 4OSUL 1E4JA 1WTLA 1XCQA 4JAMB 1N7MH 3QISA 1N8ZA 2AJ3B 3PNRB 4ZMVA 2DQCH 1TTFA 1G5AA 3LXUX 4WGVB 1I8LC 1UQSB 3VRJA 3LKQA 4Y4KD 4QOKB 4G80B 2LTQB 4AVIA 3L3IA 4NOBA 5I1LA 1JBJA 3PV7A 2ZWZA 1JNLL 3KPMB 5DFAA 2EACA 1RUKL 1UWYA 4K8RH 4NKQB 1OT2A 3LHPH 3KZ8A 1BBDH 3AG4B 1HYRC 1FL6A 2P7TB 1MWAL 3DOHA 1YYLH 1JXGA 1XGUA 1QSZA 3LKOB 3FTWA 4K7PL 1HSBB 1XGQA 4S1SH 4QT5A 2Z31D 3VI4A 5KS9A 3QXDA 4ONGL 3TO2A 3RILA 1WBZB 5EC2A 1MW2A 2K6WA 2APVA 8PAZA 2VMDA 4E42B 5CFHA 2F1EA 5BVJB 3HN8A 4ZMLA 2WGNB 3GSNA 5DLLA 2UXFA 2C3VB 2F8VA 2BJMH 3BJLA 2NW3A 3WCYA 4FQCL 4D3CH 3QIUB 1JK9B 1RUMH 5AZ2L 3T2LA 1I3RB 4QRRD 1JNNH 2CR0A 1KDJA 4FHBD 3G5ZB 2AK4D 5BQ7A 2EAEA 4Q8BA 5KBDA 4JGUA 4ZAKA 3BOVA 4FFWC 3LZOA 2XKUA 4W9IC 4HEME 2OLDA 1FFNB 3B43A 4LCWB 3QSKB 1A3QA 3CFBB 4LNRB 3NIFF 1D5RA 4ZZFA 3LN5B 1NJ9A 3F65A 1D5XA 3DV6B 2I24N 4X80L 2V5YA 4Z7UA 3KYNA 3VFSA 4WUUE 4IU2A 1XVSA 2GJJA 3DYOA 1TTAA 3MSPA 4RGOL 3ESVF 4QJ4B 2A9ML 5DJ0A 3P54A 4K23H 5KSBA 4L1LA 2X6CA 2VERN 2IJ0C 4GRMA 1TQUA 2E9JA 1LWJA 2JKJA 3HZ3A 4LSVH 1REIA 2YK1L 3CQQA 4PJBB 1U3ZA 1JXFA 4XE0A 3RI5K 5GJTL 3MV7A 2HLFD 2FJHA 2KH2B 2VDRL 3UO1H 4E9RA 1YQVH 5B3NA 3EHBD 2PCPA 3T4AA 1D2PA 3KPNA 2WXFA 3V0AC 3TF4A 4IRSD 3K0YA 4GUOA 1B0GB 1HWWA 3FONA 3U82B 3FFCA 2JJTC 4QXGL 2VO5A 2XV2A 5LBGA 2G0KA 3VE0B 2EIBA 1NUDA 4MS8C 2XJLA 3O41B 1GW6A 4FABL 2A99A 3P2BA 1NGZB 1Q0EA 3VRLE 2KLRA 4CVWA 3CSPA 4NM8L 3B9DA 4GRWB 4BELD 3LNIA 2O4EA 5D7JC 1YMMA 5TH2B 4CU8A 3MJ6A 2W0FB 1S7SB 4LFHD 3ZE2B 2Q76B 4C59B 3MROA 3X17A 1NDGB 3G04A 5MEOA 1AXSB 2VLJE 3MRIA 5I5MA 2E75C 1CZ8L 5BVPL 3EUDA 3FTVA 3SY6A 3P9WB 3QHTC 4KI5C 1UH3A 1CE6B 5GGQH 4HFUL 4LEOB 3EBAA 3WS6A 4XN8A 3IKKA 1HYSC 3H3PL 3KGRA 3G5XA 1PEZA 1TTGA 5DYOB 5HHQA 1QR1B 4P5TD 1BJMA 3GJFK 5FFLA 1JZJA 2CNZA 2AQ1A 3GTNA 1SFDA 2H6PA 3TT3H 1G1OA 5KUKA 4ETQB 2XFGB 4TLUA 1T1XA 1KGYE 3IXTB 4G6MH 5E8DH 5SX5K 1KG0B 4X9FA 1EO5A 1G6RL 1OCOB 3OL2A 1A6PA 5AB0A 3AU1A 4O00A 1R3IL 4ZOEA 1KSRA 3IFNH 2CBOA 4G1MA 4OQTH 5AQ0A 4X0NA 5L8LB 3CNKA 1UACL 3P2TA 1A6WL 3VG0L 4JGNA 1M6UA 1T89C 4ZG1A 2Y1AA 5AOJA 5HGBA 2WVTA 3HI6H 2QKIA 2FT8A 3HW7A 4BV1A 4GXUM 1Q1PA 3B2PA 5FDWB 1TJXA 1E27A 5BUGA 1XR8B 1N0XL 3JV6A 4GKSB 4L4VA 3UJJH 2YJQA 3NGBB 3HN5A 4RFEA 1GZPA 1S3RA 4PJFB 5EA0H 5ESVB 4D8PA 3K4DA 1WAAE 3STZA 5T33H 4F37K 4DP6X 2UZXB 4DGVH 3FK3A 1F1GA 1ORSB 3ARBA 2G9KA 4I4WA 4EUPH 2D3LA 1MQKL 2F2HA 4TSCH 2IBBA 4RAVB 2WQ8A 3BPNC 3KE0A 5FM5O 4P46D 2GK2A 2VXSH 2R2EA 2X4NA 4GJTB 2DWSA 2ITCB 5DWUH 1Y6MR 1JE6A 2GSGB 3FCTB 1I9IL 1B4TA 5LBVA 4HFWB 3CBRA 4KMTL 3U30C 3MGOA 4GXUN 4XAWH 4OBRA 2ICES 5H94B 1M42A 1NSNL 5AB9A 4LKCA 2A9NL 4M1DH 4OLXH 4LRNL 5C2UB 1K4DA 2V3DA 3LMJH 4LSTL 4DW2H 2WC7A 4JO2H 1MUJA 3VFMA 2MIZA 4XWOC 4UAHA 4WQOA 4U0RC 5C07E 2Y7SA 5IR1A 3LY6A 2FIKA 3N85H 1NBVL 2NY1C 1FLTX 2YN5A 3BKYH 3CG8A 5D1ZD 4WEMB 4KZDH 2J6EL 2GJRA 2ITDB 1LO4H 5CMAA 1FIGL 4EI6B 4KK8D 3I9IA 2FJGB 4CDHA 3CH1A 2YHGA 4U1GC 1SYSB 4W9FC 1WIOA 3VRLF 5KW9H 5EBLA 2F7RA 4DP0X 5F7AA 1XGYL 5C9JB 2Q3XA 2AV1A 3MRRA 1AQDA 1DVFD 4L3CA 4OZHB 5ESAA 4U1KB 4Y5VB 4QTIH 4JFQA 1ZWIB 3OKNA 1UJ3C 5J7CC 1TJMA 4BDVB 3QH3B 3NSCA 2UY7A 3Q8CA 5J1AB 2ESVA 4G72B 1QFUL 1KGIA 1N59A 4HXAL 1MPAL 2BVOA 3BT0A 3QC5X 5FM8A 4JZNA 4A2DA 1ZHKA 4P2AA 1TVHB 2RBLA 2WLJA 5CLZA 3E6HB 4WU5A 4OFDA 1IGTB 3FU7A 1PY4A 1T20A 3HUJB 4HC1A 1GC1C 3P9MB 1HIMH 2CPUA 1HOEA 4ZDHA 4P9ML 4JDZB 3T2NH 5JIIA 1YNTF 2XVGA 3NSXA 4KU1A 3B5HA 1CB4A 1EANA 1S7TA 3QDGE 3R0NA 4Q56A 3D2UA 5FA4A 4K7PH 4CGTA 3VXUA 4KX7A 2BS8A 3TV3L 1U8QA 4U6YB 1I85A 2EYRA 2C9UA 2LLNA 3T8XA 4AOFA 1JRHI 3ARFC 3QNXA 2F5AL 4Z7OB 2BSRB 4U7MA 2AQNA 5DD5L 3UADA 2E6JA 4GI8A 1D5BA 4WV1C 3G6JA 1I9RL 4FHJA 4M8QB 5C0ND 2A6KA 4ANUA 1ILUA 2FQGA 3BZFB 4FTVD 1PMYA 4B60A 2HVJB 4OB5H 1EGJL 1FZJB 1G7QA 2FWSA 1GGTA 1T22A 1EXHA 3KW7A 1WAAF 3HG1D 1S4IA 1HHGB 1WE5A 1MCDA 1I8LA 5CZXC 5DZ9A 1N8ZB 4O02H 3FNKA 2P46B 1Z2KA 4PBWD 2VZ1A 5AYUL 3VDCA 3EOTL 1DLHA 4MAYC 5IEHA 4OCSH 1J0HA 3L3IB 3FRPB 3FYEB 3OPZH 4JJOA 4P3CH 3CFDA 3WD5L 4AC2A 4Z77A 1BJ8A 5GZOD 1UWXK 2VAAB 1SJEA 2EUVA 1W91A 2ED6A 3VXTB 4JFDD 4PRAB 4X4XA 2M2DA 4G8GA 4G5ZH 3STLB 2PTTB 4O2CA 1FL6B 4L1DA 2FDBP 4F57H 5M94B 1Q90A 2XTJE 1U41A 2ZUXA 5ECJE 4Y4KC 1C5CL 1XGUB 1L0YA 1CFBA 4ZFOA 5AVZB 3KBHE 1IGML 4QT5B 2A74C 2VUOA 4FZEL 5KS9B 3QXDB 5EEVA 4HPOH 3O3AA 2ZXGA 4KDTC 5KYNA 2QGEA 2O61B 3DIFA 1AGCA 1BMWA 2H9GB 4NUGH 4Y19A 4DSYA 3BUBA 4BZYA 3DPDA 2Z31C 4FFVD 5F0MB 2CRMA 1N18A 3RBGA 4TNWK 2NW3B 5BUPA 3DJRA 2E5EA 4FNLL 2C3WA 3QEGL 1F4XL 4KNUA 2CLZA 2WANA 4H1LG 4JO5A 4CSPA 3VXPA 2YD8A 1WDAA 4N8VG 1DJSA 4YHOL 3RGVD 1J9QA 5D93C 4A63A 3RX5A 5IK3B 3WKYA 3WAKA 5BQ7B 1VKXA 3NPSB 4R8WH 3MLTA 3B7YA 4PJAE 3PRZA 1RIVH 4ZAKB 4IRZA 3BH8B 4FFZA 4CJ0A 1NJ9B 2CBPA 1D5XB 4JG1H 4XMVA 5E9DA 4Z7UB 1EVUA 3LKRA 3INOA 4Y2DD 3OAZK 4EUPB 1QWNA 4YSAA 5HHMD 4JRXD 1WP6A 5DJ0B 4ZFGL 1MFVA 2YEZA 3M7FB 4WJKB 2H3KA 4JPKL 5FO9A 5BRZA 3II3A 3QXVA 2RQ8A 5LCVL 5BOJA 3DJSA 2AJZA 2V2XB 2MQ3A 2Y7NA 3MV7B 4HAKA 1R3IH 4CSZA 1NKRA 3MNWA 4NHCL 2P1YA 2PCPB 2H32H 1UVQA 4RGNE 3VG0H 2F6AA 4KDVA 3FFCB 4D9LH 3T2QA 5F0PB 4BKTC 3GUTA 4OAWB 2HLFC 4M02A 3EH3B 4P04A 5D7JA 2QHLA 3EHBC 3F84A 2IGTA 3IWUA 1ETZA 4IRSC 3QDJE 4KO5A 1YMMB 4NUPA 2ALWA 2XQBL 4RISL 5IKCB 1PCSA 4F2FA 2NR6D 1UATA 2YWYA 3BDYH 2DQFA 1JUFA 4ODWA 2ZCLL 1DO6A 3G04B 4H2CA 3MRIB 1PLGL 1CIDA 1S9XB 3EJSA 2LQRA 2GK0A 2P8LA 3MXWH 5HVWA 2DQHL 2FYYA 3N9GL 4KRNA 4GSDH 1GZQA 1MQKH 4H25A 3G5XB 1CK0L 4TUJA 3OJ2C 4KKQA 3FUFA 2MOGA 2YJLA 1OLLA 4K3JL 2AC0A 5T5FL 1BFSA 2OBGA 4FLOA 4XXDA 3D7PA 2OCJA 2Z8WC 4HEPA 1VHPA 5I1HH 1DTUA 3ULUD 1JTOA 3KBPA 2C4FT 4NBXB 4P5TC 3UIZA 5BUAA 4OZ4A 1QBML 2MPVA 3AU1B 3JV5A 3N5AA 2WKGA 5ISZD 5I6XB 1L7TL 2EUZA 2Q5BA 4DO4A 2X89D 2B2XH 1T89A 3FO0L 3QR1A 4RAUA 4ALAL 1YDPA 2XN9E 5E2WL 3Q5TA 3IJ9A 4ORZC 3HC0B 1INDL 1Q0XL 1MJJA 2COVD 4KO9A 5T1LA 1SJVA 1TQCB 4DGIL 3L1FA 5A2IH 1CICB 3M45A 3CDFA 3QQDA 5IFAL 5J0BA 1CD8A 1E9PA 3DRQB 4QYOA 4FQ2H 4L4VB 3JV6B 3FQUB 5H2BA 3IVKA 4DVBA 4D8PB 1GZPB 4M3HA 4NZUL 4P2CG 3STZB 1G0DA 5DQJB 1KFAL 2BNRE 1QFUH 4PJAF 3X14A 2E7LC 2BK8A 4HXAH 4OM1H 3ARBB 3BWAA 3O2DL 3DVGB 4O02B 4Y4HD 2DM3A 3U4EA 5GS2D 1BF5A 5HDBB 4PTTA 1TG8A 5ALBH 2X4NB 4WU7B 5CUSH 2EYSA 2QSCL 3MMEB 5FUCE 3U6RB 1LE5A 2VT0A 3MRPB 1NGQL 3LQZA 4ELMA 1LO2L 3DROA 2X9ZA 2MEJB 3A6CH 3RLSA 2C9SA 3C9NB 4P46C 5CN3A 1AJ7H 5D1XD 2JIXA 4LKCB 2O26U 1RVFH 5MENA 1L9PA 3DOSA 2HKFH 1FAKT 4BQCA 2ZSWB 2QHRL 3J07A 3VFMB 5KSUA 2IIJA 4WSGA 3OG4B 3HFMH 5DEJA 1N3NA 4ZW7A 1FZMA 2FGZA 3WEMA 5B1AB 2VABA 4JEGB 1H19A 1DVXA 2WXOA 4BSJA 3PDDA 4AKOA 5GXBB 2V5SA 3SPJA 4DKAA 3ALXA 1C5BH 5GS0D 4XBGB 2OI9B 1F2QA 5ESAB 2AV1B 3D48R 3MRRB 1E6JH 1CD1B 1UJ3A 1JPTL 3F58L 1KCWA 1I7RA 4JFQB 3OKNB 1SEBA 1WEJH 4OLWL 1R47A 4KK8C 5E2UH 2J88H 3MC0A 1NBCA 3CX2A 1KCBA 4TOYL 2ZX8A 2VN7A 1K72A 4K94L 2ESVB 1N59B 4N5ED 2BVOB 1KN4L 3P11H 3NCYS 1DVFC 4JZNB 5SX4I 2XTLA 2PUQT 4UV7H 2C34A 5I6LA 3AUVA 4OF0A 3DMMD 1DJWA 1KV3A 4KUZH 3ATDA 1XCTB 2AABH 4FL4C 4PB0H 1FDLH 2APFA 2Y07H 3KPQA 5F2FA 4ZDHB 3WLBA 1FNSL 2D7TH 4K3DL 1OTSD 4HGWA 1N19A 2ZUVA 4RLDA 4WFFD 1Z5HA 3D2UB 5FA4B 5CJXC 3ULVE 5L6YL 4FZEH 1BQLH 1RJCA 2FX7H 2YSTA 4GINA 1F6FB 3ARFA 4O51A 3G5YA 1U8QB 1SLWA 2EYRB 4W9JC 3T8XB 5C7XH 2H1PH 1FQ9C 2H32B 2I85A 5AAPA 1D7CA 3B1UA 3MBEB 1TENA 4UQBA 4MAUL 1T1WB 3MJ7B 3G6JB 1FP5A 4LSQL 4R96A 1NCWL 5EWIL 1KTCA 1URZA 5AAWC 4HKZB 4KGLA 4ZS7H 3MO1B 3X1NA 1G7QB 5CXPA 3AUWB 1T22B 4MD0A 4MD5A 4NCC1 2JVUA 3H3KA 1TIUA 2QKSA 3EJTA 1KCRL 4NO5A 4CW1A 4NO2B 4YSDA 4G6FB 1IBBA 4MAYA 4PVBA 1AI1L 4J3OF 2E8YA 1MJ7L 4P9HC 3MKGA 3FN0L 4UQCA 3VSVA 1ZVNA 4JFEA 1DLHB 1FFPA 5IEHB 1P7QD 4FXLA 3F00A 3CFDB 3GSXA 2JI3A 4JR9L 4XCFH 4ZFGH 4XVJL 4RFOH 5H4YA 1EAJA 4JHWL 4X4XB 4G8GB 4QTHA 4Y4KA 3P73A 3IE9A 4L1BA 4O2CB 1K5NB 3L45A 1PLCA 1XB8A 1RPKA 3RU8H 2XWJA 5KSAD 5F71A 4YSOA 4HSAC 4ZFOB 5GZOC 2PCXA 5LGJB 1GS6X 2AGJL 4R4FL 1P53A 2FJSA 2FQEA 4K2UH 4XP4L 1QUNA 1NGPL 2FB4H 4RZCA 3O3UN 4DTGL 1JZFA 3O3AB 1ZKAA 1YRKA 4HIIA 1ZPUA 4JFHD 3DIFB 4G42A 2OZ4A 3N42B 4ERSH 2Z31A 3KXFE 2X9XA 4YSTA 2ZCZA 3T0XA 2WW8A 4B9CA 4HOXA 5FW7A 3ILEA 3CTTA 2B8OT 4H40A 5IHZA 2CLZB 1ACYL 3X13B 2RGSA 3BDXA 2WNXA 5TFSH 2ED8A 2DBLH 3ZKXB 5CO1A 1D3CA 4G7VL 4U6VH 3PABA 5EU6E 2NY6D 4ZO7A 2DM7A 4FFVC 3RIKA 3BQUD 1AANA 3CZLA 2YEVB 3RGVC 4OV6F 5E9DB 3VX1A 1DQDH 2FEDD 4OUOA 4BRVA 4NBYB 4YDLC 1T3FB 1FRGL 3NESA 1Z3GH 5E1AA 4MZRA 2ZUQB 3H9ZA 3UBXG 2K8QA 2YEZB 1OV8A 5FO9B 3JWDH 5BRZB 1ET8A 5FYKD 5TPWH 1J5HA 1E8YA 3QFJD 2WLNA 1QZ1A 1V5JA 5FDYA 1MHCA 2AJZB 1PG7X 5CSGA 4FQQA 3TV8A 4ZMQA 4URTB 2EADA 4BKLA 3MNWB 3ULVF 4MNQE 3LCYA 3F5WA 4PM1A 2IAAC 3DECA 5JHDE 4ALAH 3SO3B 1F13A 1MKFA 1YJDH 4FDWA 1HWHB 3BESR 1SHWA 3MLVL 3PIQB 4IRSA 5HDOA 1MREL 3HAEA 1ZRUA 3S8WA 3U1SL 2GVYA 2H2SD 1ETZB 3ZVVA 3V0DA 5EOCH 1MFBL 2VC2L 1W2KT 2WD0A 3GBML 1A7PL 3SPVA 3ZDYB 2DQFB 5FAAA 1JUFB 4ODWB 4Y5XB 4YHYB 5BXFA 1TTCA 4L8SA 3T0EE 2VDQB 3FFOA 2GK0B 2QVIA 4D0CB 1DJHA 3EZ8A 2P8LB 3CGTA 5AW5B 1OGPA 3O2DH 2FYYB 4HV8A 4IKJA 4JKMA 3BD4A 4DK3A 4IDJH 3AS1A 3II1A 3OZKA 2NR6C 1TT6A 4JY5L 3M1CA 4TQ8A 1KOAA 4U1HA 5F9JB 1JGUL 3MUUA 3FCUB 2QSCH 1JZIA 4LVNB 1D2OA 2FL5A 4ZQTA 5IROA 4G8IA 1LO2H 4FC3E 2AQSA 4P5TA 4ZO9A 4KJPD 3L4UA 1TLMA 1VJSA 1A7OL 4XMKL 5IMLA 4YSPA 4XTRD 1CYWA 3MRBA 5IBTH 3ETBF 1OZTG 3H3BC 3HB3D 4L5FE 5B7MA 2VXVH 2D03L 2G0LA 4RAUB 1XF5A 4Y1AD 4LCIH 3GRBA 4Q14A 4EIUA 3AQYA 3ULUC 1YDPB 4P48A 5IOKA 3PWPD 1W0YT 1NLDL 4KHXH 1MJJB 4WI0B 2WQSA 1VIWA 2WSPA 4M29A 5FYLH 1WITA 2GI7A 2KDGA 1E9PB 3B83A 4RNRA 4HALA 1IQWH 4PWEA 5F21B 4NQEB 5H2BB 1T4KA 1ZGLM 3IVKB 2APTA 3CU7A 3F58H 4RMSA 2ZP0T 4OLWH 2YQ3A 3R8QA 2E7LA 1RK1A 2HFTA 4NP4L 2F68X 3WDHA 4L8BA 1YEEL 4NO0A 2EABA 1JHKH 2EXTA 3X14B 1K3ZA 1LLAA 2JJWA 2V7HA 1KN4H 3FH5A 5HJBA 3GJFH 5DMIH 3U4EB 2MJWA 4IHOA 1WFMA 3U9PH 4PTTB 1DBML 1QLFA 2P5WA 3M8OL 3BP6A 3FXIC 2G2NA 2GIMA 3N6YA 4PRDA 1LEIB 4FNUA 1FNSH 1FHNA 1AMYA 4NERA 3I84A 4P4RA 4JZJC 2JE8A 4P46A 1CFNA 5AL0A 5F70A 4Y4HC 2DH2A 3BQVA 3IF1A 2I69A 3MCLH 3BMWA 1MAML 2JIXB 1T03H 3D50A 4E9WA 1RFDH 1ZPLA 3LQAL 5MENB 3DOSB 1UGKA 3SCMA 2EIMB 2QLVB 4U0RB 3V6FA 2JKTM 2OMZA 3PGFL 2CKBL 3A67L 1HQRA 4LVHB 4QRQA 4JHAH 5E6UB 5F96H 1N3NB 3QIBD 5D1XC 2VLME 3NZHH 1A7QH 1F00I 3PG2A 2F53A 4IKKA 3EJQA 1BQUA 2FWLB 3C6SA 3DI3B 5J6GB 3QUXD 2BIHA 3FQTB 5D5ME 2KBGA 4NKIH 1CD0A 5D1ZA 2I60H 2KKQA 3GK8L 1JZ3A 4C4UA 5D2NC 4C57C 3EYOA 4PG2C 4BA0A 2HJFB 1I7RB 5DJAA 1Z5LA 4HQQH 3B9KB 1DVFA 3HR5A 5GS0C 5F88B 1TETL 1W80A 4EDWL 3M1BA 3O11A 1QRNB 5IGXL 4HCFA 3BD3A 5FFOA 4JK0D 5DVKA 4NRXA 4U3SA 1XGPA 3BPCA 1NM4A 4HCRA 4OJYA 4UOW1 5GGTL 5C3IA 3BVNA 2PYED 2XIBA 2CALA 3D51A 4N5EC 1E9OA 2D0HA 2NX5E 2R0ZL 5CJXA 1SHMA 1H8OA 3DMMC 4TKWA 4PV8B 5ALCH 1WHPA 3BSGA 4N0UA 3P0VL 1GXEA 2CO4A 1NINA 5LQBH 1NMCC 4LVOC 3H6AA 1OTSC 5INCA 5F7DA 1MRCL 3F05A 3U7YH 2KDYA 4GQPH 3QJFB 4OU3A 4F1SA 4P5MA 1U8OA 3MLYH 4AWJC 2XWZA 2HA1A 3U2JA 5C0JB 2X87A 2OX5A 4R96B 4LL4A 3S37L 2HLAA 5I0WA 4RSVA 2VDKH 4O5LH 3S8FB 2YXFA 2PW1A 3IDNA 4GIAA 1TCMA 2FECI 2X0WA 4MD5B 4GQRA 2R1WA 4FTVA 4FHKA 1FH5H 4NO5B 4CW1B 2CWRA 1W8EA 4MAYB 4AJWA 3W1ZA 4HLJA 2VXUL 3BPOB 3CC5B 4QLRA 1U3YA 2R2HA 1NPNA 3HG1A 1CDCA 1BXXA 3MX0B 4DFIA 1CR9L 3LIZA 4R0LC 4LK4A 3P73B 5CU5A 4G9FB 3SOBL 1TYEB 1CI3M 4L29B 3K6NA 2XWJB 3QZOA 1A8ZA 3PFQA 4JFDA 4DCQA 2EDTA 1L9QA 5IMOA 3WXWL 4Q9QL 1G7HA 1L6PA 2X4UA 3UMNA 1QUNB 4XPTL 2EXYD 1ZLUH 1NIBA 1BHGA 1KCUL 3QVAA 5JR1L 5DJYA 1XZ0A 5KSAC 4M03A 4QOKE 5IUSA 2W95A 2XVBA 3FSOA 2JJSC 4OCRL 3ESPA 1KDIA 4JFXA 4OT1H 3BUIA 4AEHL 3R1GH 3VWKC 4BFIA 5IHZB 4GAJH 1T04B 2VC2H 3GBMH 3GMRA 4K7PY 4G82A 5KYUA 4AXWA 2H1LM 2IQ9L 5A2AA 2E9IA 2EIJB 3ZL4H 3IKCA 4PRIE 4Y4FD 3MUY1 3W82A 5EU7C 2E9WA 4WIQA 2J8HA 4C4KO 4MJIE 3AZUA 2EH8H 1DO5A 5EN2B 1LJMA 4YHZL 3SODB 4DEUA 4Z7WF 4MSWB 3V0EA 1FYTE 3UMTA 4N2LA 2NY6C 3GJFB 5GSVB 3NUKA 2F7QA 5E1AB 1RUPH 2VKXA 3WE6A 3BQUC 4Y2DA 4IOFD 3FHQA 1MRDL 1CT8A 4C56D 1A7OH 5FO7A 4EIBA 4GXFA 2FEDC 4J1UB 4N2MA 2CR3A 4Y88A 3KBFA 1XH0A 4J27A 4JKPL 5T5NF 1QW9A 4HIXL 4ACTA 1PSKH 4LIQL 2UX6A 1IAII 3ULSA 1A1MB 1BQSA 2DQTH 4KROD 3NTCL 1B4LA 1ZOXA 2O1AA 1CQYA 2GSIA 3IDGB 3IGUA 4UAOB 4ZQKB 5F44A 4AT6B 1V27A 3EDEA 2ZE0A 1PZAA 2VM9A 5ANMA 4GXVH 3ZT5A 2ARJA 1N68A 4UQ2A 3EXJA 1RZJC 3H42H 3TIEA 2EDDA 4DN3H 3HLKA 4OVVA 4PRPE 2DJMA 4HWBL 3MRJA 5BXFB 3EH4B 4UB0H 2L7EA 3I75A 3FTZA 4L8SB 4NQDA 2LFEA 2H2SC 3GMPA 4N8CL 2W07B 2NR6A 3VUAA 4HZLB 4HV8B 1RPQA 4AJYV 4L4TD 1EFQA 1BZ7A 3FQNB 1NLBL 4U1HB 5I76A 2RMNA 4N1EA 5K9KB 3MA9L 5H37G 3LKNA 3KEDA 4TQHA 1HZHL 3L6FA 4APQD 4N0FA 4NQXA 1TQWA 1G7IB 2FL5B 1DCLA 4G8IB 4P5TB 1SF5A 1V7NH 1ASPA 3J7HA 3QEUB 2WIIB 3SE6A 1UM6L 3C5ZD 2H0EA 3QK0A 5GIRA 2D31B 4TXVB 5E00A 2XPGB 5IMLB 1E4HA 2YS4A 3P77A 4HT1H 1QA9A 4GIPD 2DQGH 3MRBB 3UZQA 4UV4L 4KJPC 2AJSH 1BD2E 1N9PA 4UU9A 2GUOB 5BQDA 2NT0A 3KDMA 1MFDL 4CC1A 2P9RA 1HKLL 2X42A 3CDCA 1HCZA 5ISZA 5KYYB 4XTRC 5MEPA 5E1IA 4PEEA 2C8NA 1JGVH 1L0PA 3HB3C 1YN6A 3LD8B 1B0WA 1AXIB 3I6LE 4MHHI 1O6VA 1TF4A 3BXNB 4ZPVA 3ARED 5FYJE 4EN3D 5I66B 4F8NA 3BVWA 1T4KB 3RPIB 1TZHA 1UZGA 1YPZA 1Y1UA 5IWLC 2CRIA 5FWRA 4ZD3H 2YGVA 1X6NA 1DLFL 1PQZA 3MJ9A 3MV01 2VDKB 4I48A 4JX0A 1KIPB 4LAQH 1UFUA 2HT4D 5TGBA 5C8JA 5I1AA 5KVEE 4JG0H 1UWEL 4IU3A 1VEMA 2DJSA 1PTZA 2W65A 4NO0B 5AW8B 3D85D 5JA9A 3GHBH 1I8AA 3MV9D 2YD2A 5SWSE 3MHZA 4WEUD 2OXHA 1MHPH 2W0LA 1J05A 4MTMA 4XN9A 3P3SA 4IHOB 2PXYB 5E2VL 2DY2A 2P5WB 1EQWA 1QLFB 1YEKH 1J1PL 2XV6B 3BP6B 3IE4A 1Z0MA 4LXFA 4XVTL 3RWFB 1Z9SA 4JZJA 1TTBA 4PRDB 3L2MA 4KMQA 4Y4HA 1NCDH 2FNBA 3QAZC 5L4MA 4JBSA 1DFBL 2YKLL 4P4RB 1CFNB 1O5DT 3H4HA 1AY1L 1CLYL 3HS0C 1V10A 4GS7B 4OKVB 5EF2A 4MCZB 4H20H 2NXZB 4N2CA 5ANHA 4PUBH 3TA4D 2WBJA 5FB8B 3P0VH 2IPTL 2PP9A 3SCMB 2VRKA 2YAHA 4HPYH 4QRPE 3V6FB 2DTML 2OMZB 5LGKA 5T3XH 3MRLA 3OJMB 2VXTL 4NNPL 1WPCA 2FVNA 5HYQA 2F53B 4DP5X 3QPKA 1AXTL 1BVKA 4AM0A 5D2NA 5HSFA 3L95A 2OJZH 3VXOA 5D1ZB 3KNBA 3VGHA 1T1YA 3GI9H 3EYOB 2FJFA 2A77H 3QIBC 1IM3A 1DZBA 3HC3H 2WAHA 4P4KA 3ARDD 5DJAB 5IVXA 4GSUA 1P5UC 3B2VL 3FQRA 1UYWL 1OLZA 1Z5LB 3WS3B 3QUXC 4N3TA 3HR5B 5C71A 4M7JH 4N6RB 3O11B 5DR5H 4YDMA 4QHLA 3ZHDA 2BY0A 3T08A 4Z3JA 5F9DC 1U8LA 2G3MA 2LV4A 2W81C 4LPWA 1XGPB 3IFPA 4NRXB 3BPCB 3HHMA 4U3SB 4WGWB 4YDVB 5E0FA 2O5NA 5IMMA 1MFNA 2EUWA 1Q0YL 5GS1B 1P1ZB 3RA7L 4KPHH 3NDYE 3DMMA 3MBWB 1CU4L 2R23B 4LLVB 3H7BA 4QUOA 5FR3A 4HK3J 3WXWH 5DURB 4Q9QH 3PGDB 3MLUH 3NG5A 4JFYA 3RWEB 4N0UB 4R5TA 5B39A 2ZXCA 2X2JA 3MCKB 5AZEH 5INCB 2X41A 2VIRB 1VPOL 3DX7A 3KDPB 5J9PB 5MHSE 1FPTL 1DSFH 4P5MB 1U8OB 3MOQA 1S7WA 4OJFH 4AEHH 2OX5B 3WSQH 1PGRB 2DI7A 2JV6A 4GRLD 1MCRA 2PO6D 2HLAB 5TE4L 4GG8A 4NKOA 1CGSL 3OB0H 4KVNL 1BVNP 3JTTA 1AP2A 2IQ9H 4IBSA 2WQUA 2YBRA 4LLDA 2ATKB 5CILH 1BVNT 2XKNA 4K3HA 4M8UA 2PW1B 4YPJA 2C26A 4GP5B 2NQDA 3ISWA 4IKLA 1AKPA 3D12B 2R1WB 3GIZH 4AYBA 1H6FA 1XSKA 1YLBB 4PREA 3CVHA 2CMRL 1GY2A 4NKDA 2XJKA 5GPRA 2HH0H 3U0TA 5J6HA 4Z7OE 3QNYA 4Y16A 2R2HB 3WNPA 1VCBC 3HNSH 3V4LA 3ZHKA 3U7WL 1P69B 4CVXB 5GHWH 3GLAA 3P30L 1R3KB 1ZTXE 1MRDH 3UTZB 4P49A 1RZFH 4ODTL 3NH7L 4TVPE 5DRWB 1VFOA 2GHWB 4DCQB 4JFDB 3UJIL 3FU9A 3WFEL 3MV11 4JKPH 4BD4A 3V0HA 3LNHA 1A9EA 2X4UB 3HBPA 3BJ91 3NVQA 3VI3A 4X83A 1L9MA 1JZHA 1S9KC 4LLWB 3BP5A 4FP8L 2JJSA 5DJYB 1IEAA 1IC1A 3ZL1A 4OD1H 3IPBA 5C3LD 2WM0A 1M4KA 1KCSH 4JFZL 1A1NB 5GGSA 4OIIH 3OZ9H 2EXYC 4WTQA 4ZBJA 3WU1A 5IJVA 2VR7A 1R17A 4BFIB 1P4IL 3HG5A 2ADFH 1QLRA 3LIUA 3KS0J 1X5LA 4IBTA 4MQTB 4AXWB 4WJG3 5KYUB 3VJ6A 3BMVA 2A9DA 1A22B 5DJXA 1SVBA 2WLIA 1KIQA 3IKCB 1J10A 2NUPB 1EUUA 4KKPA 5TE6L 3UTSB 3UEQA 3ESMA 1UUNA 3HNVH 4N8CH 4H1LH 1IL1A 3VI4E 4ZMTA 2X4OB 4GH7B 2FUTA 3CHOA 1KNOA 3CN1A 3BUPA 2VM3A 5T3ZE 1J9RA 3W0WB 4Y4FC 1M7XA 1ILSA 4HOMA 2B1AL 3GSWA 4EI0A 1A2YB 2OR7A 3BQUA 3QFDB 5IQ9A 1LDSA 1GGIL 4XNUL 4RMQA 2Y36L 5C0GA 4Y2DB 2WZPA 2EO7A 4E68A 1A3LL 1MVUA 3GI8L 1CT8B 1MN4A 5EZPA 1MCOL 2IDTA 5GGUB 5I15L 3K8KA 3ALWA 5H35A 1M71B 3NJFA 4F5CA 2WXNA 2OM5A 1SUJA 4IOFC 3ULSB 4MQ7B 4AZ8A 4O4YH 4F2EA 1MCBA 1JF5A 3AS2A 3MDJA 5E6RB 1MFDH 2HFGL 2WJ7A 4I9WE 2GSIB 3MYZA 3UTTB 2ZT9C 5JLZA 3DX0A 5KSBE 5ANMB 2O6DA 3N3EA 1J8HB 4UQ2B 3FU5A 1VEPA 4B9FA 4KROC 4PTUA 4K71B 3HIZA 3S35H 2ZCHL 2B16A 3TBCA 3MRJB 5EIQA 3V5HA 5FGBA 4QMEA 1Q9WA 1VACB 4NQDB 2ZTBA 3MV7E 4YHMH 3D3VB 3GMPB 5D1QD 1UT2A 1EXGA 1JV5B 1HOCB 3P3YA 4G71B 5I1IH 1KXVC 1FN4B 3FFCE 5I76B 1GSMA 3VACA 1KWGA 3EYQD 4N25A 2O5ZL 4XVTH 1ZS8B 3BW9B 3LKNB 2APWA 4PI2A 5CP3A 1MCWM 3NZ8B 5IGXH 2WOYA 4N0FB 4F2MA 4NQXB 2YKLH 4M9OA 4XMPL 4ZOAA 2MHAB 2HP4A 3BIKA 1MWAA 1WFIA 4Z7QE 1QHPA 2EYTA 2WXPA 4JJ5A 2DMHA 1FFRA 3O2VH 2OR9L 2BNQD 1UOVA 2I9TA 1MAJA 3FFDA 2R69H 1TEYA 4APQC 4PS3A 3P77B 4WCYL 5AYQA 4PJGB 2QBWA 4B7LA 1CO1A 1R3JA 2DTMH 3UZQB 4BWUA 3F6JA 4PH8A 1X6LA 1OAZH 3RHWF 4UU9B 1U30A 3C5ZC 1XCWA 3LZFL 3KDMB 3UBHA 3VG9C 2V17L 5ISZB 3ZYJA 1UD2A 1DVUA 3QG6A 4Y1AA 5GGRY 5E7BA 3TPUB 5CSZA 4ZTPH 3CQFA 1JGLH 1XIWD 4AYSA 1Q72L 1TEFA 1ITCA 1EJ6A 1PZDA 5IWLA 2ADGB 2VQTA 3PWLA 2J73A 1VGKA 1TZHB 1YPZB 2KQNA 4X7SL 4HUVB 3KL3A 4GSRA 3B2VH 4I48B 1G1KA 1XGRA 2EDOA 5AALA 5KYWA 1B3JA 1IILE 3GC3A 4ZW3A 1UWFA 4IU3B 2W65B 3MLWH 1PS3A 4P5RA 5IBUG 4FADA 3VI4F 1ZA3A 2FX9H 3AREC 4EN3C 1AKJA 4NFDA 4HS3A 2OXHB 4MXQD 4WEEA 5LWYL 2QADB 4OD2B 4EAEA 2HT4C 5F9AC 1W0WA 3HS9A 5DEFA 4GQZA 3QUMH 5EBMB 3D0LA 3NA9L 4CKVX 1Q0YH 3HS0A 4Y4HB 5GZND 4XOAA 1DQML 5ETUA 1Y1DA 4LAJH 5F9OL 1T4WA 1TR7A 1IEHA 1YY9D 4JB9H 4WUKL 3T6WA 2Z93A 4UNUA 2VTFA 4FMFA 4KK5D 1SOKA 2WBJB 3VD3A 3B8YA 4PJEB 4I0PB 2AK1L 4ZFZA 8FABA 2NNRA 4HWEL 3MRLB 4YXHL 4ISVA 4X7FC 2DQUL 3WFBL 2DKMA 3ME0B 5D7LD 5HYQB 2PF6A 2XUWA 2ZJSL 4PW9A 3MV8E 4QJ3B 2CGYA 4PCTA 2ZNXA 2ENJA 3UAJA 4KJWD 5D2NB 1F56A 3QRFM 3L95B 1KT2A 5KSBF 3V4UL 5JW4R 3LH8A 1OP5K 1T1YB 1T5WA 1P5UA 3C09B 3FU0A 1IM3B 2ZUWA 4P4KB 5D4IA 3WNNA 3MNDA 2IDFA 3FQRB 2VRAA 3JZYA 2NY0B 1IE5A 3NAAH 3W9DA 5E08L 2BSED 4TRPH 3DVFA 5C0CB 1P6FA 4EOWH 3C6LD 1A65A 3E3QC 1NWPA 4H1LB 1Z9NA 5CP3H 2LE9A 5TK4A 5E4EC 4GW4A 3RY6A 2R2CA 3GBNH 4N8VB 1KJ2L 1R0AH 3ARDC 1KYDA 3W2DH 4F80A 5KJ4A 4WHTB 2FE0A 4JM4H 3FHEA 3IYLW 4RWHA 5IMMB 5B1JA 4AW4A 1PCXA 3AITA 3NK3A 4AYID 1DDHA 4Z7QF 3H7BB 1V7MH 3U25A 3UJIH 1G6RA 3ATAA 2MPAL 5I0XA 4OLUL 2WNWA 3QXUA 4JFYB 5DC0A 1OW0C 5L8JB 4OLZL 5C0IB 3ZGHA 3OX8A 1DBJL 3RB7A 3DX7B 5D6CA 3WHE1 3BWUC 4LSSL 1T83C 3PV6A 4JGJA 3CZGA 5T1KA 2WWKT 3B37A 1U92A 3QCVL 1IAOA 2EIZA 4TTGA 5DWPA 3V4VA 4GG8B 4NKOB 1E28B 3Q6FB 2LU5A 2GTWA 4J3OG 3JTTB 3TCTA 1AP2B 4HU8A 5I1KL 1SBSL 4LLDB 4XNXL 4JM2F 2XKNB 5B4MD 2MFNA 3EYVB 4NZJA 2VW6A 2Z1KA 3KPSD 1OB0A 1MVYA 3CSYB 3VXUE 4NQCB 2PO6C 4PREB 3VH8G 3IJYA 4KKLD 2D9QB 4KZ0A 4OLEA 4M5YL 5CEYA 4Y16B 1P6AB 5IT2L 5CBEB 2FIRT 4L0ZA 1TJHH 1MJUH 1TMQA 2X10A 2AXJA 5K1JA 1FZKB 1XTLA 3P4OB 2H0FA 3ZR5A 2Y36H 4JQIA 2QGCA 2R29L 3MNZB 1FNFA 2WUBL 4WTZA 1T5XB 4FG4A 3FT2A 1MCOH 4IOIA 2GITA 2X3CA 1PG7H 4U1SA 2FX8L 2VDNH 3S2AA 4QYAA 4HIPA 1BFVH 3BHBB 1MCWW 1M2VB 2C5DC 3JZ7A 2R1XB 3VI3B 5C0AD 3WL9A 3PWUA 2V3EA 1FSKB 1KBWA 4JJHA 2BFVH 1XO8A 3TFKD 2G75A 2HJKA 5E23A 1IBFA 2A4CA 4YXKH 2HFGH 1IEAB 1Q9LA 3LNFA 1IKFH 4JPIA 4BUQA 4MWFA 5GGSB 1NFDA 3IGAA 4MA8L 3BKJH 2YQ2A 3VNZA 2K70A 2NZ1A 3CQPA 2C7UA 4XNQB 3V0VA 5ITBH 1RZKH 4J39A 5KVGE 1ZE3C 2NXYB 4WWNA 2VWEC 5I26A 3L4TA 4PS7A 5DD0H 1IL1B 2X1QA 4YE0A 1KZQA 1R4XA 4L2YA 3K2MC 4Y4FA 1KNOB 3C08L 4QRTB 3EFDH 4K94C 3U0WL 3GMQA 3RVVD 1D5IL 2W80C 4YGVA 4Y19E 3LYRA 4XVOA 3KVDD 4H5SB 4I1RA 5EORH 5CNHA 5IQ9B 3K80A 4PGJA 1XAKA 4A2GA 3WO3B 5TK2A 3DUHA 3QUMB 1MVUB 4XBEH 5E94A 1JYXA 2I25N 3M88A 4MCMA 3K8LA 5H35B 5T1MA 3QORD 3NN8A 3RWJB 3D06A 3IDJA 1CQKA 3QO0A 1Z3RA 4KJYB 4YZWA 1GGBH 1O6TA 4NWTL 3GB7A 4JUSA 1VGEH 3CMOH 3WTWA 4XCEA 4FTDA 3QEQD 1FC1A 2WKOF 5FV2A 2IANB 5JLZB 1CYXA 3BAYA 5KEZA 5FGRA 2EDBA 4PRNA 4AGMA 1NFKA 1LMKA 2YD7A 4PTUB 1A6UL 5D8JH 2OXGB 4BGDA 2K0RA 5FUZL 5EV7A 1Z9PA 2AVFA 4RSYA 2OTUB 1G0XA 1J0JA 5LBSL 5J13C 3KPRE 3S5ZA 5HY9A 1KXVA 1P7KA 1OP3K 4WFEE 2OV0A 4KNTA 1T1ZA 2YWZA 3O2WH 2VDPL 2HJLA 3VX0A 3K6IA 3D33A 5HI3D 4BFNA 3JUYA 4MJ5A 5AOLA 1QP1A 1RUQH 4JQIH 4CMMA 2L0DA 4DNLA 4NUJA 1NOLA 2B59B 2ZF9A 4L4TA 3SGJC 3X1BA 4F2MB 4YNYA 1D5MB 5D1QC 1ZDQA 1DQMH 1RMFL 1QBLL 1K9TA 3BIKB 5E4IA 5F7LB 2EYTB 4JJ5B 3KWUA 1FAIL 1MCIA 4M62H 4APQA 4XXWC 1EXUB 5CCHE 3EYQC 2Z7WA 2CJSA 2I9TB 3QDMD 2HMID 3FFDB 4KI5E 4PWKA 4EMZA 4JMXA 4WHYG 4XC1L 1A1OB 1R3JB 1YN7A 4IJ3B 3WUWG 1XF1A 4HWEH 2PPAA 2NYYD 3MOBL 3CFJB 3EYUL 3GHEH 5C0BD 1H15A 3NMEA 5CSZB 4AX3A 1AZNA 2AEPH 2XDHA 5JOPE 1SGKA 3PWLB 2CKNA 3NQKA 4HX1A 1MNUL 4M48H 5G55A 2CIKA 1LWHA 4GP4B 4M4PA 3K6SB 3S5LG 3AREA 1KYAA 4LVEA 1XIWC 1P1VA 3WKQA 3SGEI 3ELAT 2DQMA 4HKXB 4E0RA 3PFUA 3UTPE 3FT4B 1AKJB 2HVKB 5LXGH 1L3NA 3TNNA 2DLFH 2XXCB 1W0WB 3D85A 1SOSA 2G3XA 5DEFB 1C08A 1CXIA 3D0LB 3GRWA 3OLIA 5KVDL 4LCCC 1HXYA 4JCLA 1IKOP 3ZZQA 4NN6C 4F8LA 5ETUB 2ZKHL 3RVXD 2Y6SD 4MXQC 2QJDA 3SSGA 3WJLC 2XIDA 2OMVA 1L3WA 3GF8A 1T5KA 3LN4A 1BDYA 3ZDXE 2Z93B 3FUMA 2X6UA 4OLUH 1NANI 4MNGE 4F9PC 2CBTA 4OKDA 3VQ2C 1UD8A 1X7QA 3BZEA 3ARWA 2VDNB 3IU4H 4ZFZB 5FO8A 5GZNC 3L3DB 1DBJH 1QO3A 3H6JA 2DM2A 2DQEL 3US0A 3S98A 2YMXH 4ISVB 1ZA6A 4ODXA 3LJ3A 1YY9C 1QVOA 1MNNA 4KK5C 4YHIB 4Q0XH 4YL9A 2NNAA 4UT7L 3APFA 3ZTNH 4WRLA