3BQVA

Crystal structure of the double mutant d44a d45a plastocyanin from phormidium laminosum
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
105
structure length
105
Chain Sequence
b'ETFTVKMGADSGLLQFEPANVTVHPGDTVKWVNNKLPPHNILFAAKQVPGASKELADKLSHSQLMFSPGESYEITFSSDFPAGTYTYYCAPHRGAGMVGKITVEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plastocyanin
publication title High resolution structures of plastocyanin from Phormidium laminosum and D44A, D45A double mutant
rcsb
source organism Phormidium laminosum
molecule tags Electron transport
total genus 22
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2007-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3bqvA00
2PPAA 1PZCA 3AG1B 2VM3A 4BWWA 5B7MA 3QJUB 2GBAA 1OV8A 2EIMB 2PP7A 2PPFA 4AKQA 3PAZA 4WTQA 2VW4A 3NP3A 4HHWA 5I6PA 1SFDA 2BP0B 2I7OA 3FSZA 4F2EA 3FQYA 1MDAA 3NSYA 3WIAA 9PCYA 4G72B 4AI7A 1L9QA 1QLEB 1HAWA 2GHZA 2NRDA 1CURA 3T6VA 3NSDA 2FT6A 1CC3A 3T6WA 4PCYA 3AZUA 4YSPA 3QJRB 5B1JC 2J55A 2MRYA 7PCYA 5D4JA 1IC0A 3HB3B 2IDQA 2XXGA 3UABA 1AZUA 2FQEA 1FA4A 1JXGA 4KO9A 2XLLA 7PAZA 3QJQB 2EILB 4UAHA 1JXDA 3CVCA 4MFHA 1L9SA 2X88A 2HLEB 2GSMB 5PAZA 1JOIA 2BZCA 1NINA 3OMAB 1QNIA 4Q8BA 1HFUA 1PNDA 1X9UA 1CYWA 4NB7A 2IDFA 2X87A 1MG2C 2Y1AA 3WI9A 2CALA 3KW7A 3H56A 1WA0X 3OQRA 3TBCA 2P80A 3WG7B 3X1BA 4DPBX 3IN2A 5D4HA 4E9WA 3FT0A 1A4BA 4JHUA 1KYAA 4HHGA 4A2DA 4GXFA 1IKOP 1AS6A 2R7EB 3HEIB 4HZ1A 1ASPA 3MX0B 1A3ZA 4DP2X 3UAEA 2EIJB 2YAOA 1OOWA 3S3BB 4AZUA 5B3SB 1GR7A 2E86A 1ZDQA 1AZCA 4X4KA 1JVLA 2QPEB 4DP0X 1JVOA 1BXAA 3EF4A 4K9JA 2I85A 3NJKA 2DYSB 6PAZA 3CVDA 1AZNA 3IN0A 1PF3A 4NAJA 1KCWA 1QHQA 2AANA 3NSFA 1SDDB 2OV0A 1JZHA 3TASA 4DP9X 1N68A 2DWTA 2DYRB 2XV0A 4GP4B 3NJLA 1AZBA 1ZIBA 2HRHA 2JXMA 4Q89A 4L0PB 2B3IA 5I5MA 4KNUA 3TU6A 2OJ1A 3NJMA 2H5UA 1GS8A 2OCCB 2XWZA 3H4HA 5I6LA 1J9QA 2YXVA 3FPXA 1GSKA 3FU7B 4TXVB 1JZFA 2Q9OA 1W6WA 3ASOB 1R1CA 1E5YA 1OCCB 2B08A 3S3CB 1XB8A 4A66A 2JKWA 4F2FA 2FQDA 2JFCA 1WS8A 4AKOA 1I53A 1L9RA 1PLBA 2PPDA 1WAEA 4PAZA 4GP5B 2BP0A 2UXGA 2PCYA 1OCRB 2IWEA 2YAEA 1BQKA 4A68A 3T9WA 3GYRA 1TEFA 2IWKA 3C75A 1A4CA 3DTUB 3SBPA 4AX3A 2A3TA 4BK5C 1N70A 1E65A 1OE3A 1TU2A 3T71A 3V9EA 1BXUA 3TA4D 1BQRA 3AG4B 3ERXA 1RCYA 3NSCA 3PAUA 1KDIA 1NICA 1PZBA 3GDCA 3WKQA 3FS9A 1TKWA 2EINB 2UX7A 1ILSA 2YAFA 4DP7X 3UACA 1M57B 2WO2B 2WO3B 2FT8A 2I7SA 5B1KA 1RZPA 1NIFA 1J5CA 2YAMA 1AANA 5I6MA 3IBOA 4KO5A 5I5IA 2UX6A 1BXVA 1J9RA 4YSTA 4E9SA 3QJTB 3QJVB 3OMNB 4E9YA 1ET8A 1TEGA 4ZK8A 4E9XA 4DP8X 4E9TA 1L9TA 4G7QB 4YSAA 4KNSA 4YSSA 2UXVA 2XYBA 3JT2A 3SBQA 1KBVA 1BYPA 1NTDA 5ANHA 1BAWA 6PCYA 1NWOA 3EH5B 2BP8B 2AFNA 4QLWA 2R7EA 2FNWA 2IH9A 2VSKB 1ZIAA 2J56A 4EF3A 3PXLA 2XV2A 2BWIA 2XX1A 1JZGA 2YXWA 1BQ5A 2N0MA 1KCBA 3ABGA 4A2EA 4BXSV 2XVBA 4YSOA 4E9QA 1AS7A 1NWPA 4DP6X 3TBBA 3FYIB 1AAJA 2UXFA 2IH8A 3BQVA 2VMJA 1T5KA 3V9CA 1SF3A 1E30A 1SDDA 2QDVA 2PP8A 3CVBA 1ET7A 2TSAA 4YVUA 4UANA 1ET5A 1M56B 2UXTA 3NT0A 3PLYA 3RYMA 4G7RB 1MG3C 2HXAA 1NIEA 3EHBB 1AACA 3EH4B 3AY2A 2J57A 2AZAA 3ZIYA 1NIBA 1WS7A 2EIKB 3UAAA 3FU9A 4GP8B 4BXVA 2GI0A 3AW5A 4DPCX 3FU8A 3FU7A 5B7FA 1FFTB 2ZOOA 2DY2A 2FT7A 1SNRA 2HX8A 4A2HA 3CDZB 2YAPA 4CSZA 1J5DA 1PY0A 2QPDB 2GB2A 1SJMA 2LLNA 4JKNA 2PPEA 1GS6X 4HAKA 3OM3B 1V54B 1AR1B 3DIVA 3QPKA 3X1GA 1NPNA 3IE9A 3FSVA 3ABKB 3NJGA 1AQ8A 4N4YB 4A2GA 1SF5A 2BO0A 2XV3A 8PAZA 1AZRA 1UATA 5F7AA 2GIMA 2XUWA 2HZHA 5E9NA 1PNCA 3SBRA 3NJFA 2PLTA 1FWXA 2XXFA 2XX0A 1BYOA 1A4AA 1NDTA 5AFAA 2H47C 3JTBA 1RZQA 3PCYA 4G7SB 5I28A 4BDVB 5TK2A 4HALA 2BW4A 2W88A 3ASNB 3CG8A 4HCIA 5FC9A 3X1NA 3T6XA 3G5WA 1JZIA 2FTAA 3ABLB 1OCZB 4YL4A 3T6ZA 1PCSA 2CJ3A 1AOZA 2IWFA 1XB6A 3N2JA 4CSPA 2HX9A 3FQ2A 5TK4A 4DPAX 1GY2A 3S8GB 2BZ7A 2YAQA 2CUAA 2ZONA 4NERA 4HIPA 3FYEB 4GYBA 1ETJA 1WA1X 1F56A 1AS8A 2BP8A 1CUOA 1OE2A 3ZDWA 1GS7A 1GY1A 5PCYA 5I6OA 3KW8A 1W6LA 2AVFA 2PCFA 3UADA 1E5ZA 4KO7A 1EZLA 1NZRA 1J9TA 4KOCA 2WSDA 4YVNA 1JERA 4P5RA 3ZBMA 2VSMB 1PLCA 1YLBB 1PZAA 2PP9A 4HCFA 2FQFA 3FSAA 3WNIA 3NJJA 3U25A 2BHFA 3BVDB 1X9RA 3FQ1A 1ASQA 1JZEA 3OMIB 1B3IA 4GY4A 5EHFA 5AZUA 2XU9A 2GC7C 1KGYE 4BWUA 3OD3A 4N8UA 2BW5A 2BWDA 2YAHA 4A67A 3DKHA 2VN3A 2Q5BA 3EH3B 1E67A 1SHWA 4KNTA 3WKPA 1CYXA 4RH4A 3L45A 3X2QB 2GC4C 1A65A 1L9OA 4M3HA 2FWLB 1ASOA 3NYKA 2IDUA 2ZWNA 1OF0A 1EHKB 1PMYA 3NJIA 3CDZA 4YSDA 3CZUB 4G71B 2CBPA 1HAUA 4W9ZA 2MTAA 1ZV2A 4E9VA 2RACA 2Y69B 1OE1A 1IBYA 2IDTA 4BWTA 2P80D 1SHXA 3X1EA 5B1BB 4A2FA 1XMEB 4JHVA 3NP4A 1WA2X 2QDWA 5F7BA 1NPJA 3ZX1A 4KOBA 3D12B 3AG3B 4AKPA 4ENZA 3NJHA 4P5SA 5IY5B 2IAAC 1DYZA 2HX7A 2DWSA 1M9WA 3UGEA 1KV7A 1IBZA 1PAZA 2VW6A 1AG0A 1KDJA 1JZJA 2YQBA 3PAVA 3ABMB 2J5WA 2VW7A 5I6NA 2W8CA 4KO6A 5B1AB 3S8FB 4BDVA 5B1JA 1MZYA 1XB3A 1RKRA 3QJSB 1AIZA 1ZPUA 4YSRA 4FAAB 5B7EA 3WNJA 2QT6A 4G70B 4DP5X 3X1FA 2CCWA 1KBWA 1V55B 1W8EA 4QKTA 1VLXA 2CAKA 1SFHA 2FJSA 4F7KA 2H3XC 2IDSA 1J9SA 2PPCA 1IUZA 3H4FA 4W1TA 2ZXWB 1GW0A 3NJNA 4E9RA 4YSCA 4FA7B 5AKRA 3PPSA 3FSWA 4DP1X 3MBWB 1PLAA 3S3DB 3QQXA 1ID2A 1AG6A 1URIA 2YARA 4HCGA 3N55A 1NIDA 1A8ZA 4DP4X 1OCOB 3IEAA 2HRGA 3AG2B 4WKXA 1MZZA 1JXFA 4YSEA 2AZUA 5I26A 2FQGA 1BEXA 4UF7C 1V10A 5I5JA 3SQRA 5LDUA 4YSQA 1NIAA 5D4IA 4M4RB 1ZDSA 3GXUB 5A7EA 1ILUA 5I6KA 2VM4A 1DZ0A 1L9PA 4YSUA 2DV6A 1ADWA 1GYCA 3FPYA 2TSBA
chains in the Genus database with same CATH superfamily
1KOAA 3S3JA 3BZEB 4R90L 3OLDA 3QJHB 5I8OL 3I9AA 1OV8A 1R3IH 2Q3ZA 4TQPA 5I19H 1MHCB 4Z95L 5MENE 5A2CA 1KCVH 4HHWA 5F1KC 4YPGA 1R3LB 1SFDA 4Y5XA 3UTSE 4HLZG 3FCSA 4JFED 5F9WB 1NCWL 5DHEA 3FO1A 4IRJA 1TCRB 4FQXB 3TYGH 5JNYB 2R27A 4P23D 1ZHBA 5ADPL 2YMOA 1NCCH 3LS5L 1FZMA 4XNYH 4YLBA 4P23A 1DDHA 1DANT 2I9TA 4WNSA 1SEBB 4POUB 3GLAA 2IDQA 1INDH 4TVPD 4F27A 1AFVH 1QSFE 1ZVNA 4B97A 1JXGA 3OPZL 3GZKA 4KI1A 1NGQH 4XXDA 1JXDA 1TYRA 3CVCA 3HNSL 5ISZE 2N01B 4F8NA 1L9SA 3LEXA 5HJGA 1CDGA 2VDMB 2IFGA 3BAXA 4YBQD 3BSHA 3TBSB 4LRIC 3LZLA 3GJEB 2WM0A 5D7IB 3H56A 1XIWD 5BPPA 1RK0A 1T0NB 4JFPB 4M8RA 5D7JB 2H7WA 5AUMA 4HHGA 5M7QA 1XF2B 4AL8C 3WNPA 1SN5A 3EBAA 3V7AG 4A2DA 4XO9A 4Z5RA 1JWUA 5E08H 1GSMA 1DQML 1E3XA 2VH5H 3MV7A 1Q9LA 2OYPA 3S35H 4QRPE 4LPTA 4HJ0D 5LXVA 4LXFA 4RRPA 1HOCA 3IE4A 5I1JL 3DGDA 4NQEA 3L5WA 3D69A 4N2GA 1A14L 6PAZA 3BI9X 2ZSVA 4OJYA 1MEXH 2DQFA 3PXJA 2NNRA 2DMHA 3CIAA 3FQXB 3TASA 3W82A 3I6GA 4HK0B 2FCBA 3L13A 3PWPE 4U1GC 5FDWB 3ULUC 1G9NC 3S34L 5F3FA 3RPBA 3RNQB 1QKZL 1MLCB 1F11B 2KHAA 2VN5A 4G8GB 5AG8A 5J3HD 4BFKA 2GK2A 3CFEB 5D7SL 3LZRA 3Q5TA 4N0CD 4A7TA 5IJKA 2V6HA 5EU6E 1VA9A 2F8IA 2P5EE 2P26A 4XPBL 4LOUD 1O5PA 1EEQA 4Y88A 4J8QA 2IIJA 3B5TA 3D50A 4YMPA 2FJFA 4ZPVB 5KBDA 5KSUB 1GL4B 3AS1A 4F57L 4X9HA 3BQUD 2B08A 2BHYA 2BFVH 5AVRB 3AT8A 3PFUA 1LE9A 2E27L 2W9EL 4MMZB 3BQUA 2ATKB 4ZPTB 3US9A 4JCLA 1C16A 4GAGL 4HJGA 5C3IA 4H88H 1OGAB 3DOIA 1VESA 3HC4H 4B95C 4CN6A 4AYMC 2UYLB 3L17A 4WY7L 4TULH 4KK8C 4HUCA 3VG0L 2YKLH 1P4BH 4KV5F 5DRNB 2X3CA 3SQBB 4Q9QH 4BV1A 3BKJH 2XG4A 3T71A 2EE9A 3JV6A 1ND0A 3FT3A 4KXDA 5DK0B 4K3EH 5BO1H 2OA9A 3KJ6L 1SXZA 4L05A 1YEGL 3RTQD 4F37K 3SZKC 4ADIA 1MRDH 3PAUA 3QI9A 2PW1A 3MCLH 3IU3A 1KBPA 3CFIC 3EOTH 4OV5B 2EINB 3RNKA 2DH3A 4YHPA 1G6RA 5ICZB 4JUSA 3ZKXB 3OJ2C 4KHXH 1GMIA 3VA2C 1U2CA 3OWEA 1RJYB 3R8BB 3X3GL 4FZ8H 5HYFA 1MJJA 5JPNA 1VZGA 4LPVA 4KVCL 4ZFQA 5K93A 3T0AA 3WLWD 1K2DB 4X5WA 3E1F1 4FZEH 4AUUA 2G9HA 1H3GA 3MSPA 1BSIA 1QSVA 4HAGA 2G0LA 4ADJA 4MS8C 3US0A 6PCYA 4PRIE 2YGVA 2DQHH 2CUIA 4DPRA 2VSKB 3NPZB 1QPXA 1QSED 1UT1A 1MCOH 1WEJL 2BWIA 5CBAA 1N0XL 1FPTH 3PAYA 5KYWA 1KN4L 1NGZB 4XE0A 2HFEA 4PGCA 5T3XL 3HE7B 1QSEA 3UG3A 4R5VA 3ZSTA 4BHUI 4E41A 4NBXB 2C3XA 4BXSV 3U1SH 4ELKA 3F00A 4PGDB 3AY4C 3ZDYF 1CBVH 3HG1E 4N90D 4JPWH 4G7YL 3V0WH 2VSCA 1SF3A 3FUFA 5HDBB 4G9FB 5DJCB 2HG0A 3K2KA 5ESQB 3V5DB 5E6SB 2WN3A 4UANA 3V4PA 5BUPA 5JO5A 3V2AR 4ECNA 3GRGA 3QA3A 5HJ3A 4NT6A 4A7GF 3WN5B 2NY0C 4LASL 4DUVA 3LHPH 2R4RH 3EDJA 1X44A 2AAVA 4LEEA 2B59A 2BSTA 3BVNA 2PR9A 2ZF9A 1EVTC 4XCNB 5SV3A 5KYUA 4AG4L 1H15A 3AC0A 5GGTL 5DJ0A 2VL5B 1HZLA 4K5NA 3TLRA 3T4AA 3UJIH 2YJQA 3QE5A 2UWEE 4N8CL 1SNRA 1XVSA 3WO4C 3GMLB 4FOMA 1UZGA 2IH1B 4Z7WE 3OQ3B 5HJDA 2MCMA 4AGNA 5J9PA 3H9HB 3I6SA 4GAJH 3V5KA 4Y16B 4DOHE 4P3DA 5DS1A 5K9JL 3GHBL 2FWOA 2GQHA 3TYFA 3P0VH 1ZTMA 3OAYK 1U8KB 2GUOB 1NDGB 3RP1A 3IFLL 1S7VA 3QUZC 4KJWC 5E00B 2HTLC 3W9DB 4J8RB 4L1HA 5IQOA 4PSPA 4NUMA 3SDAA 1NGPH 4X2UA 2EDMA 2UY6A 3UG4A 4AUJA 1MCBA 3WSQH 4QEGA 5C0IA 2OL3H 4D3CH 3LHAA 3NJFA 4PJGF 5EN2A 4OR1A 4Z0BL 4J7RA 4O58L 5DJ6A 5LG1A 3V4VA 1A7NL 1NDMA 5JW4N 3RGHA 1IGFH 2NY2D 1QVOB 2H6OA 2H47C 3QHZH 3AUVA 5DK2A 1I9JL 4FN0A 4I0KA 1JDCA 3CG8A 3NTCL 1YEKL 1UXLA 3E3QE 2K78A 1RP9A 1IFRA 5D55A 1UXWA 2JJSC 4FI6A 2UY7B 3S36L 2HT4C 4HUWB 2GK0A 2RJMA 4PR5A 2IWFA 4UYQA 3P2DA 4MQTB 2CNZA 2PCPA 5EZIH 1CXLA 4JVPA 4LIQH 4JR9L 5DDHA 4LCWB 1J1XL 5D7KD 1MFDL 3ZYOA 3FT4A 4JFQB 1D9KD 4PJAE 3MRJA 2J7LA 3I6LE 4LBAA 5I23A 2AMUA 1FIGH 1D9KA 2NZ9C 5TDOB 1XT5A 3D05A 1QZNA 1BQLH 1Q9KA 5FF6B 3T3MB 4PM1A 1FH5L 2CLZA 4KK5C 4XGZA 1DVXA 3LQMA 1P1ZA 3ES6A 2L7QA 1V27A 2HVJB 4OGAD 1VADA 3OVUB 2VSMB 5I0WA 1BJ1J 4F7PB 3LRKA 4PP1C 3O41B 2APFA 3L2MA 3LZQA 3UXFA 1UQSA 4KAQL 2ZTBA 3OMIB 1OW0A 3BZDA 3NIGB 4U1IB 1K72A 3KL0A 4ZTEA 3VB9A 3JWDL 1Q94B 4KMTL 3EYUL 4JM2B 5LJYH 3MREB 1DVYA 3D39D 2A9NL 4QCIA 4WIQA 4NGHL 2YAHA 4A67A 4M48H 4OGXL 1T7VA 3EH3B 3RQ3A 3D39A 4F20A 4M7LL 4JPIB 1UA3A 3V7MA 3K8MA 5AKVA 3ZMRA 4GQRA 1A6PA 3D6GA 1ODAA 1E5CA 5IB3A 4QXTA 3DX7B 4WRLA 4P5TC 2YGPA 1EHKB 1PMYA 3LPWA 2DBLL 2XPYA 4FTVD 5I8KL 4NJ9H 3RVUD 5JIKA 3VI3B 4QT5A 2BS8A 4FMFA 4U33A 1AXSA 1HAUA 2FVNA 4Z7NE 3VJ6B 5CLZA 3QYNA 1EIBA 1LO0H 4YZFF 2XKNA 4OLZH 4LLVA 1VERA 3NSXA 4ODVH 2L7UA 3F62A 3V7AE 2E0PA 4TTGA 3UPCA 4QYOB 5BJTA 4TVUA 1EZSA 2EKJA 2ZUQC 4HS6B 5GGVY 5D4QA 3WXVH 3BPOB 5D1XC 3ECQA 4UM8B 1JRHL 4Y5VA 5HHME 5DVLA 5IJVB 5KTEL 4ZMQA 2R0WH 5KBNC 2ZX8A 1XSIA 2Q2LA 2X6MA 2JK5A 1IL1A 2DWSA 4NRYA 3HJEA 5I8CA 2DJ4A 2BIOA 3DPBA 3DX3A 2NY4B 2WC7A 4I48B 3JVGC 1LWRA 4PLKC 4MYPA 1NM9A 4OCLC 2CQVA 5D7LB 3MRFA 1HZHL 1MZYA 2OK0H 3O45B 1RKRA 4IDJH 1YNTF 4ZX5A 1YC7A 5A6LA 1ROWA 3F85A 3ULVD 5D7EA 1AGEA 3GI8L 4NCC2 5EOTB 3UTOA 1L3WA 3MRIA 1W8EA 2JKRM 1TETH 2FJSA 3GUTB 3DBXA 3QIWB 3TPUA 1G9MH 4RISL 3RU8H 3SCMB 3V4UH 4M1DH 4PB0L 1JXJA 3BDBA 3C2AL 1HEZB 3H42H 4CU6A 1F86A 4DKFL 4EOWL 2AV7B 2JSFA 2ZOWA 4BFIA 2YPLD 4P06A 4X5XB 4ANKA 3FKUS 1HNYA 3B1TA 5FPIA 1NIDA 2EDOA 2VDOH 3F5WB 4K15A 3ZQXA 3X11B 4LEXH 2X4OA 1NEZB 2AZUA 4GRWB 2EYRA 5D7IE 3IDGA 1K3IA 1YEIL 5C7XL 1GGIH 1XAUA 5LDUA 3GXNA 2NXYB 1AQDB 2P45B 2PYEE 1BOGB 1COBA 32C2A 3F58H 3EGDA 4KH9A 4B5ZA 4U1LA 2VLRB 4F9PA 3CSYA 4RFEA 1Q9OA 3IBEA 4AGQA 5MEOB 2R69L 1CLVA 2JCCE 2PPAA 1OGTB 4JO3H 1A3QA 4XMZA 3B5HA 2WLLB 1HHKA 2YC1A 5EO1A 3IVKA 1I8UA 3LEYL 4W9KC 3P11L 3PAZA 4WTQA 1LDSA 2RGSA 2E9WA 4JKLA 1PCXA 4UNIA 4F80A 3FSZA 1A6UH 5BUGA 3K6SA 4ORGB 4AI7A 3AAZA 2SEBB 4R7DB 1MNUH 2GHZA 2OZ4L 1CURA 4KRNA 3FUEA 5IOKA 2FX7H 2H1PH 2Z64C 1N7MH 4G8GE 1NFDB 2CUHA 3BVWA 4PRBB 3VW3H 4UZUA 4O4YH 5EBLA 4GI6A 2H0JA 1YDPA 1CD8A 3ZTJH 1JMZA 1HINL 3PGCB 4K2UL 1ZLWK 3GMRA 4L3ED 3KL5A 4Y4FC 2A99A 3TNMB 1IQDA 2KL6A 3G9VA 1A1OA 1PQZA 3SD2A 2OCJA 4OZIA 2EC8A 2FBOJ 4L3EA 4JQIL 5FHAL 4OTXH 2V33A 4H8PA 2X6VA 4O02L 2WUCH 3D4GA 5AENA 5AYQA 2WYIA 4MNHA 4YXHL 1G5AA 1S7UB 2NX5B 2AJYH 4JZJC 3T2OA 4BBWA 1CYWA 4NB7A 1OGAE 3P4LA 1U6AL 2VQUA 4J3OH 2ZKMX 2CALA 5JLZB 5JTWA 1FORH 2BJML 2Y3AA 4UDUB 1T1ZB 5DJAA 3HR6A 4G3YL 1V3LA 2W92A 2E7BA 1NEZG 1ZANH 3CXFA 4BYHA 4QD2E 1GHFH 4M5SA 4YQXL 4JG5A 1RVFL 1WZAA 2CUMA 1DVQA 3KR3L 3MXWL 4FL4B 5JIPA 1A3ZA 2OR9L 4HKJB 3ARXA 5IMKA 2NLJB 4OLYL 1NEUA 4KKLC 1MSPA 3QUXD 3BSZL 3KMDA 3Q3GA 4C83A 1DVTA 3GPEA 3LKQA 4IIQB 1WCBB 1AZVA 1C7SA 5DI8A 1D7CA 3QZMA 4J3TA 3H7BA 1RV6X 4JG1H 4P57B 3U4EB 3N43F 1YEKH 4IU2B 3US1A 2IMMA 3E6FB 2OL3A 2E46A 5D9SB 4GQQA 3IDYB 3KPRD 1JZHA 4JQVA 1P0SE 1UWFA 3K8LA 3BH8B 1M7DB 4NNPL 1ZIBA 1J1XH 4FI8A 4BSJA 4ZQKB 2VQ1A 2VXSH 3D2TA 3MLUL 2EEDA 4HX1B 4ATWA 2Z8SA 3WN6A 2DLIA 2YFOA 4ZW7A 3GJFK 4JREB 4JFDA 4Y4KC 3TU6A 2WQ8A 3RKDC 3DSFL 5LQBH 2H2PC 4AQEB 4NYLB 1MAJA 1N8OE 2X5PA 1GSKA 4LEBA 3UIZA 1BZDA 4G6KH 4HIEA 2Z8WC 4NO2A 4XVUC 5K9QI 3VXNA 4AZ8B 2WOBA 4YHIA 2WNKA 4JB9L 4F5CE 2QMKA 3KBEA 1XB8A 1JPSH 5ETUB 1SOSA 1Q72H 4XCCH 3HG3A 3VU1A 1PLBA 5FM5O 3EYQC 4QHKI 1EO5A 5HHNA 4EN2A 5KJ7E 4Y4HB 1BQSA 3T4YB 2J88H 5HTSA 2QQNL 3VFTB 5HDBE 5EIQA 1A0QL 3NK3A 4G9FE 1S5HB 2A9NH 1E28B 5I1IH 1DQKA 4P46A 2YAEA 5KN5B 4PG2A 4M6OH 4ZMAT 2KI6A 3SBPA 5ACMA 1MI5B 2VMCA 4HCRH 2HWZL 4YHNA 4ZUVB 4F7EB 3S2AA 4PJBB 4DEUA 2V2XB 3AG4B 3CH1A 2EKSA 2C1OA 3NSCA 4NQCD 1QHOA 1CMOA 4Y2DB 2VDNH 3WXWH 2EE2A 4NQCA 2FATL 1USQA 2WO3B 3BZ5A 4ZW8A 3WLBA 4H1LG 1NIFA 3GTNA 3MACH 4K73A 1AANA 3MCYA 4PLJD 5D2NB 3RVWD 4YSTA 4KY1L 3O11B 1NSNH 4JO4L 2IGTA 3L4CA 4PJIE 4Q2ZB 1MVYA 1KELL 3LN5A 2WQXA 2Q8AH 3D4CA 4E9XA 5CAYB 5EU7E 1L9TA 1WHPA 2EO9A 4ALAL 5J6GB 5E1AA 5G4MA 1JPFA 5E2UH 4FQIH 3G6JA 3QYMA 4JMXA 4JLRA 5IW1B 3P2TA 2GT9A 2ARJQ 1QACA 3WJMB 4CU7A 5T1DL 1FYHB 4KFMA 4ABUA 5L6YL 2I69A 4DSYA 2X9YA 3CZFB 3K8KA 3FN9A 1M1XA 3FH5A 5D96B 5BCAA 2ZWLT 2WK2A 2ADGB 3HMXH 5T5NG 4UM9D 5AWNL 1BZ9B 1ZEAL 3FB7B 2XVBA 5T1MA 3NQIA 4M8UA 5IK3B 2E7LA 3B6SB 1CG9B 4PWHA 5KWYC 1OM3L 3BQVA 3MBEC 3EXLA 2P8MA 4LAQH 1SDDA 5C3TA 5D6CB 2AEIT 3C60C 4OQTL 3R06A 1T6WA 3D0VB 3GRWL 4QRBA 1QR1A 4HZLA 3T2QA 4LCWE 3N50A 3L95A 4HWBL 5C0BD 1ES0B 1J0KA 1JJUA 5D1QE 2H0EA 3QIUB 1R0AH 3M1BA 3QQ4A 4K94H 2APBA 3RWCB 1HL4A 4MJ5B 4EXKA 4XVSH 2XKUA 3FU9A 3FQNB 3QEQB 2VC2L 1ZJAA 4F37F 1KYUA 5CJ8A 3T3ME 5E8PA 4IQHA 2DPKA 3QDJB 2ZOOA 1RIHH 4KXZI 5AZ2L 2WXQA 3HJ0A 4I85A 5IWLC 2RA1A 2WKLA 2YEQA 4WW1B 1N5YL 1UXSA 3U0TA 2C9UA 4KKRA 1U4FA 2G3MA 3JVFC 3CLEH 1DSWA 1RZJH 1DSYA 2X4TB 1QI4A 3AGVA 5SWQA 3VQ2C 4ZS7L 3HUJA 3NIGE 3O3BA 3ILDA 1I1YA 1XH0A 2NOYA 4A2GA 4CKQA 1SF5A 3O4OB 2MJWA 1CFBA 2AQRA 4JFHD 5I82A 5D1ZD 3U7WL 3X12A 4RFOL 3ARFD 1RIVH 5FW7A 5HD8D 1PNCA 4RFNC 1OVZA 1C7TA 3ARZA 3F7PC 3PIQA 2R51A 3ROLA 3RY6A 5HI4C 3MRLB 4HPYL 4JANA 1J5OL 5TF1H 3Q2NA 2KC0A 1PU0A 2Y72A 3FOMA 5FO9A 3RJDA 1E4HA 3NCJL 5HGAA 4K3JH 2G60L 4OIIL 4Z3JA 2BW4A 3VI3E 3W0WB 4DTGH 5L2KA 5J12C 2FTAA 3HS0C 2B0SL 3QNYA 4H8QA 4DN3H 1UB5A 1TVHA 3WV0A 1ZOXA 3FDWA 3QDMD 3GSNB 4I77H 4XP6H 1MHPL 4M6NH 5JW3L 5EU3B 3M8OH 1OSPH 1XF5A 3QDMA 4U4IA 5C9KA 1DLHA 1EXGA 1KENH 1OT2A 4XI5D 4AH2B 2VLKA 3N42F 3T0BA 4P5MA 3MJ7B 1JHTA 4J6IA 3IDJB 3W3BA 4XNQB 2BP8A 5BMFL 1PY4A 1UTDA 1OGPA 4G80B 4AVHA 5TFSH 1K5WA 1NBVL 1UYWH 1I1AD 1KYOJ 5L4JA 4Q56A 2HPOA 2LVEA 5GRXG 5C09E 2D7TH 1OTUC 5C07D 4GG8A 1I1AA 1JGLL 3FUHA 4R3SB 2YXMA 4UIKH 4KQ3L 1PEZA 3RZCB 3KH3A 3SB3A 3RL1B 3EJCA 4JCMA 4L2YA 4EBQH 3MRPA 4OKVB 5D7LE 3ARGD 2BIHA 5CEZE 1HCFX 3P73A 5F7MC 5IEHB 2VDKH 1DEEB 2A4EA 3ARGA 1QFPA 3IJSA 1A4JA 3ZRSA 2Z93A 1JNHA 4L8BA 3BEVA 3Q2WA 3VQMA 1N26A 1VFOA 5B4MC 4Z77A 5DD1H 4J3OD 1NKOA 2OLDA 3GTTA 2OTUB 3K4AA 4I89A 3SYAA 1KXVA 2CO7A 1F1DA 4HQQL 1CTMA 1NBQA 1YQVL 1KB5H 4PJCB 4WI4A 4LDLB 2P28B 2WVTA 4FQ2L 1E27A 4QRUA 1INQA 4GT0A 3OHXA 1F4WH 4G6JH 4XAWH 3H3BC 4OT1L 3UX9B 1B9ZA 2JQAA 4LCIH 2LAAA 4NN7C 3EYSL 3CDZA 1I1CA 1FI8C 5IQ9A 4DVBB 4NNPH 1MHEB 4W9ZA 1IT9L 4ONHA 4EI5C 2DICA 1WWWX 1T0PB 5GRWA 4WGKA 3P3SA 2F18A 4GRWE 2R56H 3WOVA 1IC7H 5IKCA 4LVEA 3NOIA 3IDMA 1U3ZA 4RMTA 1O6VA 2DEWX 1SJVA 3FC8A 1A6VH 1MCNA 4ZSOA 4YN3A 3SQOL 5DXWA 1T1XB 3D12B 3OG4B 4LFHG 3P4NA 4DWHA 5EZLB 1OAQL 3S4SG 1IE5A 3QHFL 1CLCA 2AJZA 2ICWB 2NYYC 2F19L 4GT7A 4D9LL 1PAZA 5KAQF 2VW6A 1S7XA 1DFXA 1N12A 4DERA 2FZ3A 5LVEA 3C09C 3HRZC 4J6RL 2J5WA 1HDMB 2X4SA 4WFGE 3HS9A 1CVSC 1XB3A 2Y7QB 4AGMA 3PPEA 1RMFL 1ZPUA 3PS6A 3L5IA 4FQQA 5DCCA 2JKIS 1BQHB 3GEFA 3KYNB 2BC4B 5KW9H 1JHLL 2IGFH 3QVAA 4FDWA 4P4KB 1NFDE 2J1YA 4HDIB 5SWZA 2YBRA 5G4NA 4I88A 2H3XC 5DQDH 1XX9C 5HPMA 2JWYA 4DO6A 3B3IB 1KTRL 1LQBC 4IRJC 2IPTL 4W1TA 1H9DA 3N5AA 5E8OA 4B9FA 1MELA 1QLFB 4FA7B 3KXFD 5AZEH 4LHJB 3I3BA 4JO4H 3W39A 5AL8A 4MB1A 3GBNH 3FTGB 1DVUA 1KELH 4V1DB 1L5GB 3I50L 3FBQA 4TQEH 1OCOB 2CWRA 2OR8A 3IJEA 2WN2A 1ED3B 1LTXA 3GQFA 4R7XA 4ALAH 3KD4A 2VXTL 4I1PA 1JXFA 5J57B 2ZCKL 2E47A 3IGAB 2OXHB 2CLVB 1BEYH 2ZUXA 2FX8L 4PV8A 5DMKA 4LQFL 1J9CT 4AQ8C 2G5UA 1ADQL 2XN2A 3SQRA 3G5ZB 2D4FA 2VAAB 4JRYE 4YH6A 2F74A 1WAAE 5HHQA 5E9DE 1LO3H 1KPRB 2GY7B 4P8QA 2FYVA 3Q06A 2CKBH 5IMLA 3TTYA 2WYHA 5CEXB 2F8VA 3HG5A 4U0QB 5H37A 4DGWC 2TSBA 3MBXL 2GAZA 3CFKB 1LO5A 1E50A 3AG1B 4BWWA 2QVTA 4IKIA 1TJIL 3I6KB 2FLRT 1WE5A 3PREA 1YEJH 3EFDL 2EUVA 1RIUH 2L4OA 3PQYA 5I6PA 1N3NB 4R4NC 3EJZD 4PRPB 4N5EC 4IIZA 2DTMH 2YEZA 4BK8A 3H6AA 5JHDB 3QR2A 4LKCA 5I18L 3HMXA 4NKQB 2W0FB 4P9HL 4YSPA 5EG6C 3U9PL 2ZXEB 2O5YH 2OSYA 2YEVB 3TH3T 2E7MA 5AW7B 3WMQA 1HHHA 2QSTA 1W0WB 5T1KD 1J0HA 3IKCA 4XCFH 5JPMA 4YDVA 1IEHA 3ZYIA 2DN7A 3RA7H 1X5GA 5T1KA 2CHNA 2IBZY 7PAZA 5I1AB 4LPYA 1UACL 4NZTL 4PJGB 4JUTA 5C70A 4HV8B 4LEOA 1KT2B 1TOXA 3VRLE 5DTFA 1U8HB 3PGFH 4XR8C 3QUZB 1BLIA 1PSKL 1NOLA 2WBJB 1MWAL 2AI0L 3HHMA 1FNEB 2HH0L 3GBML 3U4BH 5CGYD 4GI9A 1SBSH 1TZHA 3WI9A 1M42A 2J1WA 2P80A 4LVHC 4DPBX 3IN2A 3R4RA 4CW1A 2BCMA 4E9WA 2OTWB 3AADB 4QI3A 2E6JA 1R5WA 4FTDA 1M9SA 4NLHA 4FLSA 4R7VA 2CBMA 3V0DA 2RMNA 1MI5E 1ASPA 1DO5A 4PJBE 1IV8A 3KPSA 4Y9BA 4YGVB 3O2WH 1JTPA 2VR6A 4GRLB 4XHJD 5AVYB 1NCOA 1JZ7A 4Z3FA 3OKOB 2QPEB 1HI6A 2YK1L 3APMA 3LRSB 3I84A 4HULB 2ZYSA 5LO7A 3MMEB 1G1YA 1AHKA 2JLLA 3ORJA 4RNRA 2QMJA 1E2VA 5D2NE 4ODHL 3HCVB 4KDWA 4NO3A 2V9RA 4K07A 1DBAL 1PDKB 3FQRB 4DP9X 2BMKA 3QI9C 5L2JA 3UCRA 1MRCH 1UWXH 2ENQA 2JXMA 2W38A 4AYFA 5GS0D 3ZHFA 1H5BA 1MFCH 1CD1A 2EJ1A 4MX7B 4TS6A 5I6XB 2XFXA 3KM2A 4C56B 4YHKH 1LLAA 1J9QA 4AIEA 2DQTH 2F5BL 1RULH 4PCTA 3HR5B 1HQ4A 3MJ6A 4YZWA 1E5YA 1Z9NA 1KTDB 2QV2A 3D5OF 3L3HA 3O81A 4DF9A 5KUMA 1IEAB 2PABA 4FGMA 4LO9A 5DR5H 4AKOA 1I53A 3C5JB 1EDQA 3UBXI 4YHLL 4PWJA 1FNFA 1S3KL 1EXUA 4PAZA 1CS6A 2BP0A 4MAUL 4XB7A 2X4PB 2ZCHH 3ARED 2W60A 4JQXA 2AKRB 4EE2A 2ODIA 3Q1SH 2IWEA 2PCXA 4XCYB 3KWVA 4QXUH 4KXAA 1TZOA 1IC4L 1SQMA 3DTUB 3HPJA 1AGCB 2L7JA 3WDHA 1M6UA 3JWOC 5JYMA 1KGCE 4PRHD 4RWYL 3ERXA 3PJNA 4F33A 1RCYA 3WIHL 2YJLA 3V6BR 4DZ8B 3HKFA 3ULVL 3DA0A 3QEQE 1T83C 5FUCC 3ATFA 2R2BB 4G8EB 3UACA 3HI5H 5KVGL 2FT8A 3GSWB 4PB9H 5C6TL 2AQ1A 3L3GB 3RIAF 2FB4H 5K9KB 4GBXD 2R1XB 3FT2B 1L6XA 4N6RA 4R26H 2Q8BL 4OAWA 4X6DA 1BZ8A 1KB5A 5F21B 5D1XB 5EFIB 5KJRH 2XQYK 5LGKA 4GBXA 3D48R 1LE5A 2D2OA 4PGBB 3HAEG 4M6ML 3BKML 2NSQA 5IB1A 4A38A 5F1OB 4KNSA 3BAJA 1A66A 3N3EA 1MJ7H 1FFOB 1U2YA 1D6VH 3OHMB 3I9PA 4PRAA 3RUGA 2QQLH 4OB5L 2X4RB 3D18A 3DGGA 1A2YA 1C12B 1WJ3A 4YAQB 4ZRGA 3T0XA 3E7JA 1KUMA 4LSPL 2EDFA 4HIJA 1YJDL 4D9LH 3VCLA 5DS8B 1DJSA 4UIMA 1EHLL 4ZW6A 1GXEA 4A2EA 1RUAH 2NY5H 1NANI 3SDAC 3A4DA 3UTSD 5MENA 1NWPA 4DP6X 3VQLA 5GIRA 3UP1A 3LZNA 3VI4F 3LX9A 4M5TA 3UTSA 3W0WE 1ZE3C 3I3DA 5BZWA 2NUTB 1WPCA 2XWTB 1UJ3B 4H8VA 4TTDD 5EEUA 4QRFA 1UB6A 1OLZA 3RYMA 3WENA 3BGMA 5IF0A 1T5WA 2Y22A 5JOPD 1I9RH 5I15H 3AY2A 4ELMB 2XTJC 2ZKYA 2AZAA 2IPTH 1QSFD 2W9DL 1FFQA 4EUPB 1GTFA 2JTDA 3S7GA 2W0PA 4ISVB 4GP8B 5ISZD 1QSFA 3NFSL 2VLJA 3DOHA 3F7LA 1KTLA 2G75A 3FU7A 4Y19E 5HDQL 5ISZA 1J8HD 1CI5A 2BIIA 1GZQA 3MJGX 3MUHL 2OMWB 4XMPL 3VSQA 5C3LD 1IBGH 4NHUA 3MFFB 2C4XA 3NAAH 3NCMA 2D3JA 3ENEA 1I7TB 1AC0A 2FRGP 5CMAA 4ZJ9A 1ADQH 4P5KB 1OTTD 1SHSA 4WK4B 3FSVA 2CBTA 1VKXA 3NJGA 3HC0A 4PJHF 3UPRA 4I18B 4WSGA 1VF5C 4JN2B 1XL4A 1NJ9A 3A23A 5L0QB 3MLXL 1G7QB 3F7VB 4OCSL 4FQJH 3CBRA 3BN9D 1GZPA 2WSKA 4QRPD 4OBSA 4IW4C 2D9QB 4PJCE 1RU9H 4R5XA 3EFDH 3FO9A 1T2QH 4RIRB 1X5AA 5GZOD 1ETA1 3D07A 2VJXA 1D5BA 5AFAA 2XPZA 1BJ8A 1FDLH 3I02A 4HPOL 4BZ2H 5D70H 1A6WL 5ACZB 2CKBA 2D31A 5GZOA 4PJXF 3MAWA 4X8JA 3PWPD 2OYLA 4YWGH 3HFML 3DO7A 4W6WB 3BDYL 1EEYA 2VLLB 1TZGL 3L3JA 4R7NB 4KUZH 4CSPA 5EU6D 4W9DC 3TBVA 4NO5B 2ZPKH 4XNDA 1A3RH 2FJGB 1DBML 1SN0A 2BZ7A 4JDVA 3CFQA 5D6DA 4RA3A 4BH7B 2FIKB 4OQTA 5EU6A 1UACH 5F3BB 2KLTA 4BQ6A 1F56A 2P5EA 3BLKA 1CICC 3JTSB 2A74C 3VX0A 4DEPC 4AQZA 2HT3C 1U8JA 1W6LA 3BPLC 2EH7L 4HH9B 2D2CC 2FJHA 3P40A 5FKPA 3PWLA 4P5RA 1TQBC 1RZIB 1TNMA 3FN3A 2G30A 1BREA 3GTVA 3N43B 4TNWK 3PL6D 5JXAH 3GLDA 4H8WL 3GLZA 1SOKA 5FUZH 2HJLA 1IBHA 4K55A 1UM5L 2P47B 4FFVC 4GO8A 1FNSL 4MXWL 5I1CH 3QJFB 1J1OH 1P69B 1AO7B 3PRZA 4LHUA 4Z7IA 3KVQA 4TQ8A 1A6ZA 4O2EA 2MCAA 4QHMA 2VDMH 3BP5A 3K4ZA 4G42A 4XCEA 2ED8A 2YK1H 2BVOB 2E8YA 2J73A 3BESR 4W9HC 2AXHA 3PWUA 4M43H 4B9ZA 1KJVA 2YA0A 4M3HA 5J6HB 4M93C 3Q1EA 3D0LB 4PQXA 2ZP0T 1XCQB 4QOKB 4JW3A 3APNA 5HVHB 3QZOA 4BJLA 2AV1A 5ICXA 1HHJB 3A22A 4V1DE 2QSCH 5HDOA 4FNLH 2JI3A 3MZTA 4ZXBB 5K1JA 1XF3B 4JX0A 4Y7MA 2EDEA 3IDIB 3FCTB 1QPPA 3N44B 3NZSA 4X7TB 5C0ND 3SE4A 1BD2A 3LD8B 3MDJA 3ZGIA 4HFUL 3KPQA 3KS0J 2D9CA 4N2IA 4LSTH 2O4EA 4TRPL 3C5SA 2P8LB 3S5ZA 2EABA 3JWNG 5DD3L 2YWYA 4OZGB 1WZ1H 3OSKA 4S0SD 4PRIA 3V6OE 3GSOA 1TMCB 1IEBA 4U6XA 3TFKC 4QMEA 5BZDB 2VKWA 1DR9A 1BX2A 3R7RA 2PXYD 1SXNA 5J56B 2ICCA 3AWEA 1KV7A 3V8OA 4YHLH 1D6EB 4JJOA 5DJXB 2ODHA 3ZTEA 2PXYA 1OB1B 2HKHL 2ZYRA 3ARYA 3GB7B 3HG1D 4X6BB 3VFPA 2GJRA 3T1FA 1JZJA 2HFGL 2Y5TA 3TN0D 4JHWH 4HJEA 2VAJA 2FD6L 2C4FT 1F6AA 1U8CB 1Z9SB 1RJCA 1ZVYA 2XWBB 3HG1A 1QBAA 2NY7L 2HB0A 3DO4A 3TN0A 4F9PC 2IBGA 4PRPE 5A6IA 4PHZA 3QUKA 5B8CA 4WUUA 1K4DB 5EB9A 2OI9C 5JHDE 1LXMA 3S5YA 1UOLA 1WD9A 3ZDXF 2JLPA 2DIJA 2QT6A 4L8DB 2JKSA 1IM3B 2BCKA 3KGUA 4XMVA 1UM6H 3G04B 4AJ0A 3L9RB 5B22A 3GMPB 4ZFZA 4W6XB 2O6DA 1MN4A 5C97A 1SOQA 2H6UA 1ZHNA 1OF2A 3CZGA 4MNGB 3H54A 5J11C 3WTWA 4JFXB 1BFSA 5C0EA 3FQUA 1U8LA 4PJGE 1C5CL 2CO6B 1M2OA 4X42A 3VFUA 3DX8B 3ZMEA 2UWEA 4LKXB 1NC4D 5M95B 4Z7WA 5CEZL 4ODSH 2WQWA 3IWVA 3KPLA 1WAPA 2BVYA 5CFHA 1T1YA 2MTPA 3BKMH 3ESUF 1WFTA 1SJXA 1IGIL 2K6ZA 3HHSB 1IGMH 3VWKD 4UYPA 3G08A 1KGXA 3IFPB 1U8MB 2QKIB 1HHGA 3FOLA 3VWKA 4M4RB 2F1AA 2PTUA 4GKSA 5GGSA 1RZ8B 2ZX6A 4KRPC 3WE6B 1AR1C 5KVDL 4Z7OE 3QB7C 3L4UA 1AGDB 3SPGA 4YBHA 1ULVA 2LLLA 5AOKA 2QPUA 5BRZB 1F1AA 3GMOB 2X9ZA 3VG9B 2IXQB 1ZLVK 1KIUA 2WXLA 3RX9A 4DW2H 3DJZA 2H2SC 1OO2A 2KUTA 3QIBA 4AYDC 2ZQKA 1WRFA 3ZK0A 4JRWA 2HUHA 4GW4A 3MLVL 4KITB 4OCMC 5HYJB 4KTDH 2WXOA 1B0GA 4TN9A 3JUZA 4M7LT 4GFXA 3DJ9A 3CHQA 3I6LD 3C8HA 3TJEH 3O3UN 5IR1B 5BV7L 1U8PA 4PJAA 1DLFH 3ARTA 4BQCA 3MLPA 1JL8A 2P24B 1I3RA 2EUZA 1AXTL 2Q76B 3DMMD 5E8DH 4A37A 2MPAH 4WUKH 1FA4A 5IVXB 2XBDA 1BBJA 4GKLA 5DD0L 2CMRH 4Z7UF 5DHYA 1U3HA 1Z9LA 5ECJE 4WEBL 4A7UA 5AVZB 4RRPM 1JK8B 2DI8A 4U6YB 4U1SB 3UAJD 5JMOC 4MQXD 3ZKND 5E5UB 4NN6C 3UAJA 3IGFA 4O2FB 5CNHA 5C0JA 4OY9A 1I85A 5FOJA 1X9QA 3OKEA 4RFNB 5JORA 2P7TB 1L6PA 4E5XB 1A4BA 2BNQD 3LKNB 4GAAA 1D5XA 5DA0B 5DEJA 2FH8A 3BAEL 1DVFA 4GXFA 3GS4A 2CK0H 1QRNB 3AQXA 2QADD 3FRPG 3IXAA 3F7YB 3QUYB 5B39G 1LJMA 4GQPH 4WWID 3UAEA 2EIJB 4JEGB 1XZ0B 3KWWB 5CSZA 4AIZA 2K4AA 3U7AA 1OOWA 3LKSA 1MLBA 1ADQA 2VB5A 2WB7A 3QZNA 4I9WE 4K7FA 4L48A 4UQ3B 5J12B 4PYGA 3HS0B 4APXB 4X4KA 2NXZD 3DETC 3MUGA 4R8WH 5DYOB 4P46C 4OLVL 4ZS6D 4PG2C 1TCMA 4KXBA 4PTTB 3CFBA 4L9LA 1UCBH 4J4PA 5IB4A 2OMXB 5F9DC 2GVYA 1WBZB 2E76C 2M83A 1N68A 1TZGH 2K3HA 3QWQB 1J87A 3QJZA 5D1XE 4X8CA 1K85A 3RWGB 5C6PB 4AQ1A 1S7QA 3EJJX 4AENB 2B3IA 3D25A 1TJHH 1N6QH 4E0RB 2BVPB 4BZ2A 4NKMA 4P2OC 3O3DB 2BY0A 5L7XL 2WO4A 3WFDH 5HHMD 4CN1A 4QO1A 3U0PB 1QFWL 5CEYB 5FYJL 4PREA 4PWFA 2UZXA 4QTHA 25C8H 4WI3A 3UBXG 1VJSA 2C9QA 4HPHA 1DANU 2UZIH 2FBJH 1JF5A 1Q1JH 1EUUA 3BZEA 1PYWB 3CBKB 3QJHA 4NZUL 1P6FA 2Y07L 2KLSA 1F4XL 4ANXA 1MHCA 3LRGA 1GGTA 2QFPA 1XR8B 5AW4B 1OP5H 3QS3A 4IKLA 2E56A 4ZUWB 1D3CA 1R3LA 3OG6B 4FQXD 2YPKA 3RWEB 3TBYB 3ZDZB 1TCRA 4FQXA 5JNYA 2HTKD 1TEFA 3WFHB 1EMTL 2X9XA 1IGYB 4E5XG 2L7EA 4OLUL 2IV8A 1CE6B 2Y6SC 4PH8A 4ELME 1AKJB 5I30L 5DO2D 2E7LC 1BQRA 3ECUA 5FCUH 4QF1B 3PDOB 4M8VA 4CAGA 4JBSA 1JHKL 1TO5A 1ZLSH 2MQGA 1GAFL 3SO3C 4EI5B 5FW8A 3TVMC 1UGKA 2VUOA 1RJZB 5EORL 3IMBA 3WD5H 1AP2A 1MJ8H 2EE0A 2WO2B 4P3WA 5CIPB 5HYIA 1FHGA 5DHMC 4TLTA 2EDKA 5KVFL 1YEDB 5EWIL 2V5TA 4E9SA 2WVVB 4KXCA 4N20A 2D0FA 5IBUG 4XPGH 1TEGA 4NC0B 2XRAL 3TBSA 2WCGA 2HRPL 4M29A 4LSDA 3GJEA 3GGWB 1G7JB 5D7IA 3MKKA 2Z34A 5CSBA 4GXVL 4E42B 1IILE 3KS0H 2PYED 1T0NA 4JFPA 3RVVD 5D7JA 1BYPA 4MNQB 4Q9CA 3TEWA 3WFCL 4OH2A 4XTRC 5DFVD 1DJXA 1SM3L 2PYEA 5ENWA 1ZRUA 3WL9B 2C9PA 3RAJL 3C09B 1AD9B 1ZIAA 2WMPB 3BN3B 4IMLB 5CHNB 1CFNB 4RSVA 1H3WM 2CCLA 1NFAA 5DZLA 5LGHH 5C0RH 4XB8A 3J07A 1KXQE 4DKEL 4BK5A 3BP6B 5FGRA 2BRRH 5E4AA 3E8UL 1TVDA 1JZ3A 1E30A 4HXAH 1CLYH 3LH8A 3KEDA 3ZT7A 4AJYV 1FGNH 3FQXA 3RY6C 3QPXL 3O6FB 4G8GD 4D9RE 1MREL 2GG1A 4HK0A 2KDYA 3NT0A 4DFIA 4KI5C 3CX5K 5FDWA 3GF8A 3K6OA 2LU4A 1MG3C 3RNQA 1MLCA 1F11A 4G8GA 2HXAA 4QNPF 7CGTA 3CFEA 1NL0L 3P2BA 2QSQA 5KBLA 1U91B 1P7QB 2HKFL 3GIVB 3UAAA 3A21A 4IU3B 1MH5B 5EF3A 2X6BA 1IAIL 4DPCX 5HYSG 1XR9B 5CEZH 4ZPVA 5KSUA 2XZAH 2QPDB 1PY0A 4FFZL 4GMSH 2BNRE 2CLRB 2HJFB 1NAML 1DUZB 1OGAD 1LYQA 1N10A 1CD9B 4JHAH 4MMZA 4ZPTA 4D8PB 3APFA 1ZTXE 5EU5B 3UO1L 4BZ1L 1OGAA 4PJDB 1BP3B 5I71C 4XNBA 2IDCA 3F04A 4HEPG 4LK4A 3EDFA 1TDQA 3RBSA 1AO7E 5DRNA 3SQBA 2NY1D 2NCEA 3SY0B 1J88A 3KGSA 3GBLA 5FHBH 5DK0A 1OK8A 4B0MB 1L0XA 2DOCA 4XP4H 4R6UA 3UYOD 2YD8A 2ENYA 2XVGA 1F90L 3DVFA 4QHPA 3CHOA 4HF5L 4MA1C 3QNXB 3IMVA 2BERA 4GRWH 4JFUA 4QOKE 3WTSA 4OV5A 4K7PX 4JJHA 5KG9B 1BW8A 2BWQA 3JTBA 4RGOH 4AVKA 5ICZA 4PJFF 3ASNB 3FZUC 3U1PA 2CM5A 1H3VA 1GJUA 1RJYA 4YL4A 2C3HA 1B4JH 1A1NB 1AOZA 4W4OA 4UUJB 5T5FL 4EZMA 4DGIH 1R5IB 2XIIA 3OHXC 1WCQA 5CD5D 1K2DA 4DPAX 4U0RB 1NM4A 4JKPH 3WDJA 5IJDC 1ZY9A 4NZJA 3CC5B 4OZGE 4ZDHB 3MLYL 5KANG 1G7IB 2V9QA 3ZDWA 4WEBH 4OIAA 4HGWB 4KQ4H 4Z9KB 4D94A 1DL7L 4LOEA 5TDPB 1WP6A 2FEEI 3FCBA 3CFDB 4LVHB 5GS0L 1KCSH 2K9UA 1JERA 5EEVA 3GI9H 1NGZA 2DQIL 4F5CA 1FNGB 3GSQB 3K6DA 3HE7A 4YE4H 1LMKA 1RZFH 5GZND 4OD3L 3QWOB 2B9BA 3GSNL 3DYMA 4PGDA 4WK0B 4XWGH 2W81C 2BHFA 4X4ME 5GZNA 1L3NA 5F9JB 3GHEL 2AEPL 4YHYC 1S9XB 2AJUL 5HYQB 2IWGA 4KNQA 4G9FA 5DJCA 5ESQA 3TBTB 3V5DA 3V52L 3OD3A 1GA2A 1HK6A 1MCKA 2OS7A 1A9VA 4DK6A 1OSZB 2CHZA 4LGRB 2BWDA 2K8MA 1BG1A 3WN5A 4NPJA 5FO7B 5I1KL 1E67A 4H0IA 1A3LH 5HDLA 2BOLA 3IYLW 2ILLA 4MNGE 4QXGL 2YN3A 3MODL 4XCNA 4JFFB 2X7LB 3KYOB 4CGTA 2VL5A 5MI0B 2FWLB 2VL4A 5DZ9A 4KROC 5AOZA 4ZMTA 3R18A 3PHAA 1ZHKB 3SPVB 3ZHLA 3II2A 1A9BB 4KY2A 2B1HL 2EXYD 2IH1A 5HHXL 4RRPG 1RURL 2CJUL 2IPUK 3H9HA 2JI1A 4Y16A 1XGYH 2PO6C 5DWUL 3RFRA 3JWDC 4AT6B 1XEUA 1IGTB 4OCWL 3R0NA 1S9VA 1ZVSB 4L23A 1U8KA 2GUOA 1NDGA 4IK6A 3I75B 3L1OL 4HZAA 5BS0B 3RWFB 5E00A 3W9DA 4J8RA 3KYMB 1BWMA 1IC1A 1T20B 1UKSA 4OSUH 2PUQT 1B2WL 4G6AD 2MKWA 1A7RL 1W0YT 4N8PA 4ADGA 4BRJA 4DFHA 4N22A 4OCXL 3QXAB 2P49B 1HHIB 5FYLL 1BDYA 5EIIB 3QP3A 2OW6A 2VDPL 4ZO8A 1F4XH 1NC2B 2X2JA 4TUJB 5LG6A 2D7PA 2J25A 4XODA 2XY2A 5BRZE 1J1PL 4OD1H 4EI6B 3QXVA 1QVOA 3CDYA 1G7MB 2I32A 4MKMA 3MUY1 3EUUA 2YD7A 5L88L 1CL7H 4N25A 2Z1KA 4YSRA 3RWIB 5B7EA 3RVXC 4F9LA 4IHBA 3L7EB 4QAWA 2NY3D 2UY7A 4HUWA 4NCDA 5D1QD 5HYJE 2Y25A 2DS4A 1E9QB 4M61B 4LCWA 5MP6H 2YZ1A 4M7ZB 4JFQA 2MOGA 1KULA 3S97C 4PJ9C 5EORH 4K23L 3KPMB 3GJFB 5TDOA 5IVXE 5FF6A 2J72A 2FX9H 1MF2H 3S88H 4LL4A 3QQXA 3LQAL 1URIA 1DN2A 2YARA 4HCGA 1ZXQA 4KTEH 2HVJA 3MNZB 3LKRB 4RMVA 4RBPH 3ZY7A 1FZJB 4BUQA 3O41A 5ILTH 1S7RB 1DJGA 1Y1UA 5E8EB 3UBGA 4KFZC 5I26A 1Q0EA 3VD9A 2FQGA 4P2QB 1M3IA 1KJ2B 2BVQB 4U1IA 3ZOAA 1OB0A 1F1GA 4YIQB 3LB6C 4JM2A 5A7EA 1HCZA 5DLLA 1GJIA 1QRNE 4B9IA 1ZGLB 1E7VA 1GYCA 2IVFC 3ZR5A 4PI2A 4Q4IA 3D1MC 4R9HA 1KWGA 1WV7T 4JPIA 1IKFH 4KZCA 1KCUL 4G6FB 5HGHA 2EIMB 1S4IA 2A6JB 2BIQA 3DX7A 2A6DB 4X5PA 5C1MB 2W95A 4F2EA 2LHAA 4OCRL 3VI3A 3UZEA 1BZ7A 3VJ6A 3ME0B 1JNNH 3PP3H 3QDHA 5ESAB 3B2UC 3MA9H 5IUSA 2Q3XA 4UTAL 3CH8A 4FFWD 4OFIA 3CWGA 1IX2A 3OGCB 3W11D 3DOSB 1S78C 4MD4B 4QYOA 1NAKH 4GJTB 2UUDH 3OKLB 4HS6A 4CA4A 4I4WB 3NCWA 5HPOA 5DLMH 3QORC 4WQOA 4UM8A 2XLLA 3GIZH 4NZ8A 2WCPA 5C09D 5IJVA 3OL2A 4U1KB 3B7TA 3Q8EA 4S2SA 3TZVC 3ARDC 3T2NL 4HWEH 3QXWA 3FONB 1H5BC 3TEZA 1N59B 1EBAA 5ESVB 1RUMH 2ZNWA 3FO2B 4BZ1H 5D7LD 5LHDA 4I48A 4ZODA 4XBEH 3PP4H 4IGBD 2I25N 4L29B 5D7LA 3TBCA 2EEXA 1MCIA 3ZKMD 5HY9B 3O45A 2ZWYA 1WFJA 1XF4B 4Y5YC 3ZDZE 1FN4B 1NGYB 2C7UB 1TQUA 1GKEA 1RPKA 4WWOA 2IV9A 5EOTA 3BD3A 4UT7H 1JPTH 2R0LL 3CAFA 3MX0B 1AI1H 3GBEA 4MD5B 4ZOEA 4K0OA 3SPIA 1O9VA 3GUTA 1FRGL 2BM3A 3MNWB 3LPOA 1CDHA 2RB8A 3PFQA 3QIWA 4JQXC 4WWPA 1PAMA 5DO8A 3SCMA 4ZFGL 3QEGL 3ILQD 4WSKA 1MNNA 35C8H 3C2SA 5TE7L 3SBWC 1RD6A 1HEZA 1RUKH 2JIXD 3CVDA 2AV7A 5KSBF 1GYVA 5C08B 1KCWA 2AANA 3NSFA 2BSRB 3KNBB 3LNGA 5T5FH 3RURA 4W9GC 1AE6H 5EBMB 1T21B 3F5WA 1CICB 1KNOB 2A74B 2BY3A 2DQUL 3BWUF 3FAWA 4FG6C 4JHBA 3I9GH 4MXVF 3X11A 1NEZA 2HRHA 2H0PA 2NXYD 1FQ9C 1BGXH 3UTTB 2QGEA 5ADOL 4MNQE 3NJMA 1Q8MA 5JW4R 4XVTL 1AQDA 1OAJA 1DL7H 1XTMA 1PKQE 4G1EB 4DAGL 2EDDA 1BOGA 2DLFL 1UFGA 3QEHB 4IS6B 5I75B 3TO4D 1MQKL 2H45A 1WBXA 3PU7A 3TC9A 4I3RH 2AK1H 1T2XA 4B9YA 4EIZC 4OLWL 5MEOA 3SDYH 1HWGB 2Z8VC 1OGTA 1HQRB 1MRFL 2GJ6D 1HKLL 4ZO7A 3G3LA 1OSYA 1OSEA 3GSNH 4A66A 2WLLA 4YLCA 3LPPA 1CLZL 3QCVH 3QR1A 2GSIB 1NPUA 4WFGD 4X4XB 1U93B 4P9ML 1D7DA 4NUGH 4ORGA 2FIRT 3CQQA 3BVXA 4N2NA 2SEBA 2DIAA 4NP9A 4XHQA 3RI5F 3WAJA 4A68A 5EEXA 4Z8FL 4KK9C 2DQEL 4G8FA 3C75A 4AX3A 1N70A 4YPJA 4JMNA 1PZUB 5JUEH 1NFDA 4MZ3A 3IETB 4PRBA 1IM9B 4AL8H 2CD0A 1FC2D 2AERT 3PGCA 1Q0XH 1MIEL 1I4FB 3TNMA 3GDCA 4XE5B 4KKZA 5HHXH 4KKNA 2CJUH 3FFCB 4Z7QF 1EFXD 3APCA 2M8XA 2X70B 5I5IA 1BXVA 4L8CB 1S7UA 1CN4A 3TCLB 4QHNB 2Z3FA 4E9YA 2NX5A 1OM9A 4YEEA 3NABH 3WELA 4PJDE 2X4NA 4JRYD 4JGNA 5JLZA 5E9DD 3ARSA 1IZJA 3GM0A 1URZA 4UDUA 4V11A 1T1ZA 4HBCH 1BOYA 3MOAL 3ZDXB 5EOQL 4JN1L 1G9NH 5E9DA 3UYRL 1A5FL 4MCYB 4NM8H 5AW9B 1NCTA 1S7WB 4X9GA 3EHBD 4RMQA 2VGLM 3VVWA 4HKJA 3JQOB 5D8JH 2NLJA 3UH8A 3V79C 2DQDL 4YC2C 2E4FA 4E68A 1FBIH 1QLEL 5IBTL 4XPTH 5F0PB 2FGWL 4IIQA 2OJZL 1WCBA 5JZ7C 1OCWL 3DV6B 2ITFA 4AMXA 2ARWA 2R0ZH 4P49A 5L88H 1WF5A 3CFCH 2VZSA 4NQEE 2Q7NA 4P57A 3U4EA 3TEYA 4IU2A 2F0CA 5HXMA 1CTOA 4YXLL 1YEFH 3QEUB 3E6FA 4JVWA 4NWUH 1T5KA 2CGRH 5D9SA 4ALAC 3VD2A 2GIXA 1U8NB 2DAVA 1M7UA 1YY9C 5J11B 3BH8A 4UQAA 1M7DA 1M1SA 4XWOC 1CE1H 2C9XA 1QFUH 4HX1A 3K46A 3LIZL 2ZXQA 3OXRB 2EVIA 4XXWA 3QYCA 2APVA 2MKLC 3OF6D 4LPXA 2X09A 3JUYA 3EZJB 5BOZG 1MFUA 4YDKL 4AQEA 4NYLA 3NIDF 4FCHA 1DUYB 4FQ1L 3HI6L 4NQTA 2HX8A 1LO4L 3IM1A 1HIMH 5LAPA 4AZ8A 2YAPA 2ENJA 4FFYH 3ZN6A 5I1EL 5ETUA 3ZE1E 4Y4HD 2Z6FA 3AM8A 3P0YL 4U3CA 1K8IB 1V54B 4ZUSB 1RK1B 1AR1B 4M1GH 4NXKA 3RIFF 4Y4HA 3T4YA 2OMNA 2H32B 5F88B 3VFTA 4ZMPA 1I8MB 4UCFA 1S5HA 1E5UI 2CR3A 1AY1H 1E28A 1MI5D 3HS8A 5KN5A 5MEQB 3O9WC 1UATA 2VKXA 2XWDA 3NGBB 4GNKB 3VXMB 4AOFA 4F2MB 5BW7A 3TONA 2HZHA 1NKRA 2QQKH 1MI5A 4CJ0A 3QO1B 5EH1A 4PS3A 4ZUVA 4F7EA 4PJBA 2V2XA 3B2VH 4Y2DD 5FYKE 4OFYA 4JFFE 3A4FA 2DQGL 3D30A 3QG7L 5KSVB 4Y2DA 1U95B 5DHVB 3ZKQD 5IHUH 1V7ML 5TE4H 3C6LD 4LCUB 4Z7UB 4HKZB 3QPQC 4JO2H 2WWKT 5F7KC 2Z0BA 5D2NA 3C8DA 3C6LA 4WDIB 2G4EA 5F9OH 7FABH 5M94B 1OIOA 4PYHA 4Q6IC 3O11A 4MAYD 3UEQA 4UTAH 3AWFA 4Q2ZA 1BZQK 3D9AH 5FYKU 1PX4A 4LSSH 3LRMA 3EJSA 5J6GA 4HKBB 1KJMB 1MIML 1YYLL 5BS0E 4R4FL 3SDXF 1EBPA 1P7KB 5IW1A 3V0VB 2NNAB 5F7UA 4MGXA 4LCYB 2WXIA 3SO5A 3OAUH 4GYBA 3WJMA 2WXMA 1R33A 1Z3GL 4X80H 4H0LC 4DKTA 2O5ZL 3CZFA 1YEEL 2H8PB 4Z3EA 2Z35B 5IJCC 1RXLA 2ADGA 4AITA 4JY5L 1BZ9A 2GSGB 3FB7A 3VXRD 4FEMA 4OCNC 4UTCA 4WJKB 4XPAL 3V5HB 2ZCLL 3VFRB 1Z32X 5IK3A 1J5IA 1JGDB 3B6SA 1CG9A 1FFPB 1A1MB 3H0TB 3MLWL 4CVXB 5JXEA 2EDNA 3EJQA 2IOMA 5D6CA 1AGBA 5F7FA 4BWUA 3D0VA 5FUCE 3LPFA 4BZ1A 1VPOL 5FWRA 4OZFB 3V6ZB 2E7HA 3VMOA 2ATAA 1ES0A 4L9DA 4G1MB 1LEIB 3QIUA 4FKEA 3VXPB 4JFTA 1HL8A 4RH4A 3DVIA 3RWCA 5JR1L 5TE7H 2QGBA 3QBTB 2LVCA 1TTAA 4NLAA 4OI7A 3KLQA 4EKXA 3DVNB 1OAKL 3FQNA 3L08A 3QEQA 1FLTX 4N8VB 4GAYB 3QDJA 3BIKB 3UJJL 4EDXB 3ZLQC 5DVKA 3C08H 2EVGA 4WW1A 4QJ3B 4WKZB 4P2OB 4NP4H 1J0ZA 2I9LB 2NZIA 5T1JA 4CBZA 5B38B 4ODXB 3C5ZD 4QRAA 2X4TA 4TSCH 3KH4A 4P2QE 2BH0A 2OMUB 1WHOA 5TE6L 4PV9B 4A2FA 5DJZB 4BA8A 1KCRH 3IPBA 4DAGH 4UT9L 2KH2B 1T22A 3S36X 1P2CB 4KOBA 1HH6B 4GKZB 5DFAA 5T5FA 2Y06L 2J6EL 2VR5A 1HKLH 2R29H 2DDQL 3HNVH 4ZO6A 4A7VA 3UGEA 3SHSA 3HN3A 3UO8B 3MRLA 2NYZA 2XVKA 3IAPA 1X5YA 2JELH 1KIQB 4DK5A 2KZBA 4TV3A 1N64H 1JPEA 5GGVL 3MJ9H 4NPYA 2JTYA 4YHZL 3ZE2F 4Z8FH 3RHWF 4LMQE 2WINB 5KOMC 3HN5A 3W0WA 5JW4Q 2QVFB 1PD0A 3K80A 2XFGB 3MQIA 2JKLA 3ATAA 3TVMB 2QKSA 3GSNA 4KK6C 3SKOB 5DVNA 1DE4B 2F15A 2CH8A 3MJ8A 2Q6WB 2C3VB 5EU3A 1KBWA 3UTPE 3FU5A 4ACTA 6FABH 1VCAA 1JDAA 3EYVB 4LFHD 4WEUD 3NEXA 1W16A 1WSST 4AJVA 2IDSA 1A7OL 3QIBC 3K81A 3FTXA 4AH2A 1XGTB 3QW9A 4OZFG 1CGVA 3MJ7A 4ZUUB 5FECB 1S3RA 3IDJA 1MPAL 4Y19D 5F2FA 4XNQA 1OARL 4YSCA 3R4DA 5AKRA 5AL0A 2VABA 4JRFA 3TF7C 4Y19A 2GTQA 4N1HB 1MXGA 2EVHA 2MOQA 4GW5B 4UT6L 12E8H 3O2VH 3LQZB 2ALWA 2WZPD 3O6LL 3VFSB 4PW9A 2P5WB 4R3SA 3PG2A 2VWEC 1LO2L 4F58H 3QZWB 4AEHH 3FBKA 3RZCA 1NLBL 2VT0A 3WY3A 4YSEA 2WZPA 2G3ZA 3RL1A 1E6JL 4WV1C 4OKVA 3ZTNH 5BVPL 3T04D 4DEWA 1U3HC 3MRMB 1A22B 2K1MA 1EEUA 1WC7A 3DK2A 2ZWZA 4WI0B 5B38G 5IEHA 1DEEA 2XNAB 4RGNC 1DZ0A 2FECL 2RBLA 4DGVH 1L9PA 1UHVA 2OTUA 2VERA 4BA0A 4M7KH 5A16B 2WAQA 3P30L 2EE6A 4PJCA 4UAOC 1A9EB 1O9WA 2VXUH 3ULUD 1DDTA 1VAHA 2G2RA 1WUNT 2HG5A 1DVFC 4UU9B 3RDJA 2GCYB 4BKLB 2J43A 4A39A 1T66C 4F7CB 3WYRA 5IROC 3FQYA 1JWSB 5C08E 5IW3A 2NW3A 2VDQH 1MHEA 3POCA 4AE0A 3NN8B 4N2BA 4X5LA 4QRQB 1RUPH 3NSDA 4KUCD 3UTTE 2XETA 3BE1L 5FGCB 4L9LC 5EO9B 7PCYA 1N18A 3HB3B 2WVSA 4J4PC 1E43A 4S1SL 1YNLL 1T1XA 4N0YL 5DVMA 1SHMA 2A0LC 2EDJA 3VUAA 4QTFA 4AQ1C 2CO2A 4KK8D 5EZLA 4AEFA 5KVMC 4UOW0 1I1RA 1KCLA 1WFIA 3P0YH 1X5MA 2ICWA 4M3JA 1N2RB 2XN0A 1W72L 5AYUH 3BRFA 4AYBA 1E4WL 1HDMA 2IDFA 2EO7A 4P9HC 3AABA 3WKML 2YQGA 4EUPH 5CUSL 3X1BA 1YUKB 5FM5M 2Y7QA 1EDYA 1EJ6A 1ONQB 1AYOA 3VSVA 1S7TB 4MA1B 3KYNA 1BQHA 1P4LB 1W91A 5GISL 2BC4A 2EEBA 3HEIB 2WXGA 4P4KA 1H6EA 4HDIA 5L8JB 1N5AB 2Y7MA 4ZUTB 2DQGH 4RZCB 1BFOB 4BQBA 3R1GH 2MWCA 5B3SB 1B88A 4OGYL 4XP9H 1EH9A 3B3IA 4Z7VF 3WS6A 1NFIB 2BHZA 1BXAA 2W1NA 4YFLI 5JHAA 5IB2B 4M7JL 2VDRL 1UOKA 2QBWA 4V1DD 2Y4SA 3FFCE 3G5VB 4NO0B 2QZ5A 4URTB 4MS8D 4NAJA 3ZQWA 1CDIA 5JW4M 4RMBA 4KZDL 3FTGA 2O61B 4V1DA 2YGNA 3PUCA 1L5GA 2R39A 1ITCA 1MWOA 2BXZA 3PABB 4MDIB 5HVWA 1ED3A 5CBEA 3CVHL 1UD5A 2VDLB 4UMGA 3IGAA 2OXHA 2CLVA 3CLFL 3MUJA 5KZCB 3G6DL 3MO1B 3G5ZA 2VAAA 5DK3A 3RY5A 2OCCB 3H4HA 4D0BB 3LVTA 1I75A 3NUKA 1KPRA 3V6OA 5ES4B 3AY4A 4UTAA 4A7GA 1YEEH 4TXVB 3NSJA 4HUUB 5HDRA 1DBBH 5CEXA 3U7YL 3GFUA 4YHYB 4J28A 1ACYL 3FB5B 3CFKA 2WWMC 5AB2A 4WHYG 4Y2NA 5D7JC 3U2SB 5BO0D 2NY0D 1Q0YH 2JFCA 3I6KA 4YFEA 1NBZB 3AU1B 4PRPD 4N24A 4A1RA 1JWMB 4DKAA 5IQ7H 4MAZA 1N3NA 5JHDD 4NZRL 4PRPA 3ZTJG 2F1EA 5FO2A 1LDPH 5JHDA 1SYVB 4P4RB 1GC1L 4LP4A 1Z0NA 1IAMA 2YD6A 3DI2B 3CTTA 3DDGA 1J18A 1ETZB 1MFNA 2W0FA 1NCBL 4BK5C 4KZ0A 1Q4NX 3RLSA 3D3VB 1UWGL 4JM4H 4E9LA 1W0WA 4K3DH 2XZCH 4PP2B 1A7PL 2PO6B 1WWCA 1G0YR 1ZTXH 4ENEC 1SLVA 1E42A 4M9PA 2Z92B 1UH3A 4PJGA 2AF2A 3QUZD 1EZUA 4KJWD 4XN5A 1SMAA 4HV8A 5LWYH 1KT2A 2HTLD 4V2CB 1C08B 1U8HA 2N59A 4KO5A 3QUZA 2L04A 1GIGH 2B2XL 4IBVA 4L4TB 2OP4H 4F7MB 3QJVB 3FH8A 1ACCA 1ZA3B 2WBJA 5H2BB 3SOTA 3QCUH 4ZK8A 2VZTA 1A4KB 5CJXA 5B21A 1F3JB 2YMXH 3TWCH 2B1AH 3OLGA 5CD3B 3FB8B 4N0UB 1LEGB 3QXUA 2P46B 2OTWA 4WGVB 5LBGA 4F2ME 3OC8A 2XJLA 1MJUL 4MMZC 5DZOA 2GTWB 5T33L 4YGVA 4I1RA 3PNRB 2IH3B 1A6TB 2HT4D 2XX1A 4FNRA 4GRLA 5HP5A 5A40E 4CJ1A 2YXWA 4AEIL 5IHBA 2DKSA 1RPUA 5TTRA 4RX4D 1KCBA 3LRSA 3MXVH 2JJSA 4OUUB 2VXVL 2YD3A 5KBKA 3MMEA 1JF1B 1JTTA 4RX4A 5LNGA 1P4IH 1CXHA 1Z5LB 3V9CA 4O9HH 3HCVA 2NZ9D 2XC8A 2HCZX 1WFNA 2ZOUA 2R29A 3BFQG 3QUHA 4GS7B 4PJ9B 3VAEA 4KZEL 1PDKA 2VMEA 1I7UB 3DTXB 3FQRA 5DSCB 5IT2L 4YVUA 4PJEF 1J8RA 2V4LA 4KK5D 4TUKH 5DUMH 1HYSC 1E4XL 1G1OA 2N7AA 1XL6A 4NQDD 4ZAKB 4ZZKA 4M62H 4IRSC 5E2WH 5MERB 1OHZA 4IKKA 1YJDC 1TT6A 4PP1D 3ZKXC 3MJ9A 5CZXC 3WUWB 2CO1A 3C8KB 4C56A 4YUEH 3HR5A 1ROCA 4HXBH 1KTDA 2CZNA 1JGVH 4R7LA 1YYMH 3RGBA 3X13B 4MA7H 1CB4A 1IEAA 2OX5B 1E6JH 4L37B 3C5JA 3DSNB 3NEOA 1CWVA 3ETBJ 3P3UA 5B3JF 3IU4H 3W9EB 1NPNA 4N2CA 4P59L 1UOVA 1JGEA 2X4PA 3VFGH 2AKRA 4LNRB 3WMPA 4HHAB 2KQNA 2K7PA 3BP4B 4P5TD 4XCYA 1G1KA 2LTQB 2AJVL 3CFTA 3HE7C 4K3GA 2AJXH 5E9NA 4I9WD 1E90A 1AGCA 3O6MH 3A4EA 3BAYA 4PY7B 1I7ZB 3JV4B 2R0KL 4FJZA 2AITA 4OCYL 4TNVF 1KBGH 3VX1A 4DZ8A 1L9NA 2XKSA 3CC1A 3TWYA 2MQCA 4FG4A 2R2BA 5H37G 1HXMB 3GSWA 2A6KB 1CFTB 5ALBL 3WN5C 3U0WH 2OSXA 2I60H 3WFBL 4OJEH 3L3GA 5D1XD 5K9KA 5FKAB 2GKIA 2H3KA 2R1XA 5J5EA 3FT2A 4GSRA 2WLZA 2CGZA 4KKBC 3LH2L 5TDNB 2VO5A 3QORB 5D1XA 3TT1L 5FR3A 1BCIA 3ETSA 1YO4A 4PGBA 5T3ZL 5K1NA 3SIKA 2DWEB 1ID5I 2NY6B 1P6AB 2YWZA 1LK3L 4MZRA 3TZVB 3ARDB 5DRXB 2VN4A 3A3YB 1DFBH 1FFOA 3MRKB 5C0CB 3UZVB 1JYWA 3S5LB 4PLKD 2O1AA 4Y16C 2BDNH 1WK0A 1PS3A 2X4RA 4NSKB 5E8NB 1TSRA 1C12A 4YAQA 1IIKA 5ITBL 3WUWG 4ZFFB 5K59E 4OF3A 5DS8A 3A67L 4Y5YB 3QAZC 2AEWA 1AHMA 2Z1PA 1PZAA 2PP9A 5I1GH 5CUSH 2XZQL 1CK0L 5D2LF 3FQ1A 3LDBB 1L7IH 2OM5A 3BKYH 1ASQA 2ZOKB 3K1DA 3LN4B 1JZ6A 1WH0A 4O02B 4B60A 1C1EL 5B3NA 2EYTB 4LGSB 2RH0A 5AZUA 2NUTA 2V2WB 1G7PB 1MVUB 2P44B 2XWTA 1UJ3A 3QC5X 4NQQA 2BW5A 5I1HH 3QFJE 4B9KC 4PI0A 1SQ2N 1G9HA 5TGBB 4OGYH 3CMOL 4ELMA 3LMJH 1CGWA 1IAOB 3CPLB 1P9MC 3MV9D 3OGOE 3GT6A 1JFHA 4MWFB 3TV3L 5ABAA 2B4CL 4DGYL 4EUPA 3ZYJA 4ISVA 4UQ2B 2Y24A 1Z2KA 4AGPA 3E0GA 4FE9A 4F9LC 1O75A 1OF0A 1X4ZA 2KZ1B 2EICA 2PWHA 4H8WC 3P9LB 4S10A 1CJYA 1E40A 1RFDL 3CZUB 2OMWA 4OBRA 1AQKL 2FHCA 4BCZA 4BD4A 1H3TA 4IDLA 5EZPA 2P5WE 1I7TA 5ID0B 4BWTA 1KYDA 4CNIB 4P5KA 1IFHL 3NA9L 4UILL 4FQHB 1KFAH 3X14B 3QZBA 3HUJE 3BPCB 4I18A 4H20L 4UMSA 1AJ7L 4JN2A 4QRRB 4N3TA 1CF1A 1EJOL 1VEPA 1G7QA 3F7VA 3MNMA 3SDDC 4QNPE 2MCPL 5GRUH 3T5WA 3KLAB 2VJ0A 1CBJA 5F7NC 5F0JB 3QK0A 3H3PH 15C8L 2X1XR 2A7BA 4FJ6A 3PWJB 4RIRA 4JDTL 2ZUTA 3UC0H 4JM2C 3DURB 2W8CA 3OAYH 3STZB 3WMSA 5ACZA 3MRBA 5BXFB 3IDXL 4FYSA 4NENB 4Y4FD 5DEFB 4DCQB 4D9RD 3L5JA 4YK4C 5L2KE 4PHXA 2UZYB 4XC1H 5T3XE 4N68A 2O5NA 1JZDC 3LCYA 1OPGH 4DP5X 2Q20A 2RHEA 1O6TA 2VLLA 3L81A 4R4BB 4UQCA 4KC3B 3X1FA 4UNVA 5FB8B 3TF4A 4IBQA 1E8YA 4R7NA 5A2BA 5CGMA 4RVBA 4K71B 4NO5A 2FJGA 3MTRA 2F61A 4BH7A 2FIKA 3UZEC 4MRBA 2PPCA 2WQAA 1CTNA 2ZWSA 3JTSA 5CKAA 1RZ7L 5IMMB 2KQMA 4XP1L 3SE3C 1YMHA 2BNRD 4HH9A 3G6JF 3MLTB 2NQDA 1G87A 1E7UA 5HGBB 1RZIA 3N55A 3UFIA 4XX5A 4K9EL 5KSAB 4OM0L 4KKLD 4ZYKB 4UQ9A 3EGXB 2KBGA 5IREA 4X4ZA 4U7MA 1FFNB 3N85H 1WISA 1AO7D 2ETWA 4M5ZL 4JPVH 4XO4A 2IQAB 5CIPH 3OX8B 4OF7A 1W8OA 3QJFA 1TMQA 3N91A 1AO7A 2VITA 4QTIH 4PVMA 2NY4C 2JF1A 1IJNA 1UURA 1QA9A 3MYJB 2IFFL 4TOYL 4Q0XH 2WOYA 2BVOA 4QOKD 2VXVH 3T3PF 4X7SH 3CFNA 4KX7A 3H55A 1NCHA 4J12A 5J6HA 2BP3A 3NIDB 4OZHF 2PPFA 3D0LA 4QOKA 1XCQA 2ZJSL 4OM1H 4WHCA 5CP3H 1VIWA 1OAZL 4Y4KD 1HJCA 1ZPLA 3OWRA 3RKDD 4JY4B 4K8RL 1HHJA 2H2PD 2BSSB 3WIAA 1KJ2L 3UGUA 4ZXBA 1E4KA 2AGJL 1XF3A 4X0KB 1L9QA 2ZOLB 2DIEA 4XVJL 3FCTA 1HAWA 3QIWC 4X7TA 5E2VL 2YLHA 2NRDA 3SCMC 1P5UB 4XVUD 4RAUB 1YN7B 4G7VH 1H6FA 2ORBL 4EN3C 2C4FU 3ZE0F 2LQRA 4PCYA 2R8SH 4ETQB 5JA9A 4POZC 2DJUA 5IBLC 2MRYA 3BX7C 5J8OA 2J8UE 3QNZB 2XXGA 4FXKC 2P8LA 3EYQD 4I3SL 1AZUA 1CF8H 5E6UB 3RG1C 3DBSA 3UJTH 4OZGA 5DUBA 4ZSOE 1JF6A 4AYID 5JIMA 3ZKSD 1X5IA 1X5ZA 4XN8A 5FGBA 4K4KA 4YHOL 2HLEB 3K5SA 1KGUA 3SE9H 2HPTA 2FEJA 5AVQB 4JFEB 1D6EA 5DJXA 1OB1A 4PD4K 4X6BA 3QWRD 1PNDA 4HG4K 4LLUB 4FYRA 2X87A 2X42A 1U8CA 1Z9SA 4X4MA 1TJGH 3F2LA 2PTTB 3QWRA 4DETA 2X0VA 4UT6A 1DSFL 3SJVB 1K4DA 4IOSD 4M1CC 1CGSL 4S1RH 1I3GL 1CFVH 1IM3A 1WVZA 5I16B 2AEQL 3G04A 3L9RA 3D3VE 3GMPA 3S3BB 3SDXB 2XQBL 1GR7A 1SY6L 4MNGA 4Q6IB 2X3AA 4R0LC 3NFNB 5A2LH 2AQ3A 4JFXA 3IGUA 1ZWIB 3QDAA 3CZNA 1WZKA 2CO6A 4GB9A 4XPHH 3ASWA 3GWJA 5F96H 3DX8A 3TIEB 3EGSB 2WGNB 3VWJC 1KJ3L 1XIWB 4PFEA 3TT1H 2DWYA 2HFTA 2PWEA 4L4TE 2KT6A 1UVQB 3SE8L 1JZ8A 2O93L 1LK3H 3B7UX 4XNXH 3HHSA 5LUMA 5DGQA 2CDFA 1FZKB 1JYXA 4N0UE 3IFPA 1PG7L 1U8MA 4A6YL 2A9BA 3QUML 4HT1H 4M4RA 4QLRA 5F71A 3WIIL 1HJBC 1VHPA 2YXVA 1RZ8A 3MBED 3C6EA 4WI5A 4YE0A 3WE6A 1ZK9A 3GC3A 2R15A 1GYWA 3FT1A 4U3XA 3I2CL 3C60D 3OKNB 4AYSA 3Q2CA 4CVUA 3NZHH 1AGDA 1JNLH 1UWEH 3S3CB 2AJ3B 3QWNA 1QBLH 3CVIH 1L0PA 3C60A 3LNHA 4TPRH 4OF5A 2D03H 2XXCB 3LZFL 2DJSA 5BRZA 2WUBH 4FJYA 3GMOA 3KBPA 1UT9A 1MCJA 2IXQA 3EOAB 3PQYE 4J3OF 1S9YB 3IFNH 5DU7A 1C5BL 1YUHB 2PCYA 4JAMB 3MOBH 5HYJD 3SPJA 2EXWC 3LPGA 3THML 1S8DB 2V5YA 5HYJA 3Q9QA 4N87A 4WO4C 1JGUH 3MHZA 4JRLA 1HYRC 5IR1A 1HN1A 1YPZF 4XH2B 2P24A 3IDYC 5GRJL 4LHUG 2QPFA 2Q76A 2XSKA 4ABQA 5IVXA 2VLME 5MHSE 3CJJA 1DVSA 4LLYB 1D7BA 2W65B 1GW6A 2AJSL 1JK8A 3EDKA 4U6YA 4U1SA 4UOW1 3DRTB 4JREC 5FGSA 4BUHA 5FA4B 2N0KA 1YNKL 4A2LA 1V3KA 1IO4C 5FYKH 5HI4D 4HC1H 2MNWA 4TSBH 4UDTB 4E5XA 4PLNC 4EVNB 5ANHA 4FC3E 3LKNA 1ZLWH 1SEQL 1PLGL 4BM7A 3RTQB 4X98B 1QRNA 2FNWA 2IH9A 3AM8C 1V7NH 2J56A 3F7YA 5AB0A 5AVWB 1EUTA 2NW2B 2LU7A 1XZ0A 3KWWA 3PXLA 3KJ4B 2XV2A 2X12A 2Z31C 3B56A 7TAAA 1FV1B 4UQ3A 3P3TA 1MJJB 5EUOB 3QDGB 43C9B 3MV11 3HS0A 4APXA 1VGEL 5MEPB 4YX2H 5DYOA 3JSSA 1YEWA 3H9SB 5BW7C 4PTTA 1OQXA 2G9HB 1AAJA 1JZ2A 2APWA 5F7EH 4LU5L 1HEHC 2I26N 2J8OA 2DQ6A 2PP8A 3U2JA 2OMXA 4ZMYA 1WBZA 5FCSH 5LNDA 2AS5M 3U9UB 1YAIA 3RWGA 3IRZA 4HOZA 3DLQR 2DLHA 3LEVL 4AENA 1OTUD 1NIEA 5KS9B 1MFBH 3RGVC 3D09A 1NIBA 1QSEB 4E0RA 2BVPA 4GSQA 1T4WA 4L3FA 4U3SB 5GRZA 1WS7A 1KYFA 2NTFB 2X38A 2Y1VA 3O3DA 3QXDB 4XVOA 3DGCR 2J4WL 1JTOA 5ALCH 3JWOH 4FP8H 5CEYA 3U0PA 5B7FA 3KBFA 1LD9B 1NCAH 4YDMA 1UD2A 2DY2A 4RSYA 4WV1B 4LCCC 1L9MA 4A2HA 3FTSA 3D51A 1KC5L