3BQVA

Crystal structure of the double mutant d44a d45a plastocyanin from phormidium laminosum
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
105
structure length
105
Chain Sequence
ETFTVKMGADSGLLQFEPANVTVHPGDTVKWVNNKLPPHNILFAAKQVPGASKELADKLSHSQLMFSPGESYEITFSSDFPAGTYTYYCAPHRGAGMVGKITVEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plastocyanin
publication title High resolution structures of plastocyanin from Phormidium laminosum and D44A, D45A double mutant
rcsb
source organism Phormidium laminosum
molecule tags Electron transport
total genus 22
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2007-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3bqvA00
2VM4A 5I5MA 3TASA 2EIMB 3WI9A 3UACA 4GXFA 2HLEB 5B1KA 1BXVA 1V10A 1WA1X 2IH8A 1CUOA 1GS7A 1JZEA 3ZIYA 3EHBB 1NICA 2HZHA 3T9WA 3OMIB 1E5ZA 1CYWA 2FT6A 3ASNB 3OMAB 3QJQB 2P80D 3NJJA 4HCGA 5I6MA 2IWFA 3AZUA 3AG4B 1AG6A 1IUZA 2FNWA 5B7EA 5IY5B 4KOBA 2DYSB 3X1GA 3T6VA 1UATA 2UX7A 3UAAA 2CUAA 5I28A 4KOCA 1BYPA 1PZBA 2VSMB 2XX1A 3TBCA 1BEXA 3KW7A 1AANA 1URIA 3FYIB 2PPEA 1CURA 2CAKA 2EIJB 5AFAA 1J9SA 2IDQA 4UF7C 3WIAA 3T6WA 3PLYA 1OE2A 3FSWA 1V54B 2VM3A 1AG0A 4PAZA 2E86A 4GYBA 1GS8A 4AZUA 2IDFA 3FT0A 2XX0A 3T71A 2NRDA 3UGEA 2B08A 1E67A 3T6XA 1AIZA 4BWWA 1SNRA 3NJGA 3T6ZA 4AKQA 2N0MA 4E9XA 2HXAA 2YAPA 3FU9A 2BW5A 2OCCB 4YSCA 1AZRA 3UAEA 2EILB 3QJUB 4HCIA 4NB7A 1EZLA 4DP6X 2HX7A 1OV8A 2Y69B 2GSMB 2OV0A 5AZUA 3X1BA 2VN3A 2Y1AA 1N68A 2PP8A 2YAQA 3S3DB 4YSAA 3NSDA 1T5KA 3NYKA 1JVOA 2JXMA 2H47C 5LDUA 1AS7A 2CCWA 2YAHA 5FC9A 1QHQA 1TEFA 2BWIA 1L9TA 2XLLA 3BVDB 5B1JA 3H56A 3S8FB 4YSSA 3IEAA 2JFCA 1YLBB 2IDSA 2GBAA 5TK2A 3SBQA 4GP5B 2GIMA 4DPCX 2QPDB 1IBYA 4GP4B 1SHXA 2CBPA 2PPFA 3PPSA 1ZDQA 4RH4A 1E30A 1QLEB 1PAZA 4Q8BA 1AZBA 1CYXA 3MX0B 2UXFA 1TU2A 1AAJA 3WKPA 1X9UA 1KDJA 3BQVA 5ANHA 5D4JA 1J9RA 1NIAA 2CALA 3CDZA 4HAKA 3X2QB 4DPAX 2UXVA 2AFNA 3H4HA 1NWOA 4QLWA 1GW0A 1SDDB 2VW4A 1JXGA 4YSOA 2HRHA 2YQBA 3HB3B 3PXLA 1HFUA 1JVLA 1KCWA 1ET7A 1N70A 2PPCA 4KO6A 4HCFA 4ZK8A 1BXAA 3ABLB 1WA0X 3PAUA 3AY2A 3U25A 5I6OA 2FQGA 7PCYA 5D4IA 4KO9A 1GSKA 1MG3C 2QT6A 8PAZA 2R7EA 4DPBX 1HAUA 1J9QA 1OF0A 2BP8B 2XUWA 4G72B 4PCYA 2BHFA 3NJNA 1AS6A 1PNCA 3C75A 3QJVB 3NSFA 3ERXA 3FSZA 4K9JA 1TEGA 1XB6A 1JERA 1A4AA 3N55A 3QPKA 2GI0A 4YVNA 4GP8B 2PCFA 4YSPA 1WS8A 1KDIA 2TSBA 1ZIAA 1NZRA 2GC7C 3NT0A 4UAHA 2RACA 2LLNA 2VW7A 4P5SA 4CSPA 2FT8A 2BZ7A 3HEIB 1BQ5A 3FPXA 3SBRA 2EIKB 1NTDA 1FA4A 4E9WA 1OCCB 4A2GA 1OCRB 3H4FA 1PNDA 1GR7A 5B7FA 6PCYA 1AZUA 1B3IA 2IH9A 3CZUB 2DWSA 5I5JA 2UX6A 2ZONA 2FTAA 4YSRA 2XYBA 3GYRA 2P80A 1W8EA 4F2EA 3GXUB 2J56A 2I7SA 2YAFA 3X1EA 1WAEA 3OD3A 4DP1X 1JZJA 2FT7A 4KO7A 4YL4A 1GY1A 4A2HA 3TA4D 1PLAA 2PPAA 5B1BB 2QPEB 1RKRA 1KBVA 1V55B 3FSVA 1AR1B 3FPYA 3FSAA 3S3CB 2BO0A 2AZUA 1OE3A 4HZ1A 1EHKB 3GDCA 2XXGA 2YAOA 3RYMA 2GB2A 4BXVA 1A4CA 1ASOA 7PAZA 2XXFA 3CVBA 1GY2A 1WA2X 1JOIA 1MDAA 1XB3A 2FJSA 4JHUA 1MZZA 5PAZA 3DTUB 3NJMA 4CSZA 1ID2A 4E9RA 2AANA 3WKQA 2HX9A 2PP9A 2W88A 3EH4B 4A67A 1NIFA 2IWKA 2BP0B 3JTBA 1RZQA 1ETJA 1AOZA 3FU8A 4GY4A 2JKWA 3AG1B 1A3ZA 5EHFA 1ZDSA 2YARA 4E9YA 5TK4A 1PLBA 3CG8A 3S8GB 2YXWA 1XMEB 4BXSV 3SQRA 2I7OA 5A7EA 1I53A 3IN2A 4Q89A 4BK5C 4X4KA 4HHWA 3ZX1A 2FQFA 6PAZA 2XWZA 3FQ2A 3X1FA 4DP4X 3NJIA 1CC3A 3FS9A 3IN0A 4WKXA 1A8ZA 1BYOA 3FQYA 1AQ8A 4BDVB 1AACA 4KNUA 3NJLA 1M9WA 1X9RA 2H3XC 4HHGA 4BWTA 4HIPA 2VW6A 1OCZB 5I6LA 1OCOB 3FU7B 2ZXWB 1PZCA 1SDDA 1BQRA 1SJMA 3FQ1A 4G71B 1NWPA 1RCYA 1QNIA 2AZAA 1VLXA 2WO2B 3TBBA 2YXVA 1JZIA 3EF4A 1L9OA 2WO3B 4KNSA 4L0PB 1AS8A 9PCYA 3V9EA 4W9ZA 5F7BA 2BP8A 4DP8X 2W8CA 3SBPA 3NP4A 4M3HA 3WG7B 2OJ1A 2BWDA 2ZOOA 1AZNA 1R1CA 4F2FA 4YSEA 3N2JA 1NIBA 3NP3A 4JHVA 3D12B 1SFDA 4A66A 4E9QA 4DP0X 1BQKA 3OM3B 4AKOA 4N4YB 2FQDA 2XV2A 4G70B 5B1JC 5I6KA 2MRYA 3PAZA 1IBZA 2B3IA 1PMYA 4A2EA 3EH3B 4FAAB 2VSKB 2QDVA 1MZYA 4M4RB 1PF3A 1NIEA 2ZWNA 4KNTA 1E5YA 5D4HA 4TXVB 1NDTA 3OMNB 3QJSB 2DYRB 2FQEA 2J55A 3QJRB 3ABKB 1M57B 2IDUA 5B1AB 4AKPA 1KCBA 1NINA 2BZCA 4YSQA 4A68A 3UADA 3NJFA 1SHWA 1ILUA 1JXDA 3NJHA 2PLTA 1OE1A 2UXTA 3QQXA 1SFHA 5AKRA 2IAAC 2YAMA 4DP7X 2H5UA 1L9SA 3KW8A 1ET5A 3V9CA 1SF3A 4G7RB 4DP9X 1DZ0A 2J5WA 1ZIBA 2X87A 1MG2C 3WNIA 2GC4C 1A4BA 1ASQA 4MFHA 2PP7A 4G7QB 1PCSA 3ZDWA 4AX3A 5B7MA 4ENZA 4YSTA 1ILSA 1PZAA 2HRGA 1F56A 2CJ3A 2I85A 4NAJA 3ABMB 3PCYA 4YSUA 1J5CA 5PCYA 3AG3B 1PLCA 2IWEA 2XVBA 3DKHA 1TKWA 1ZV2A 3L45A 3AW5A 1M56B 1XB8A 3ZBMA 1NIDA 1JXFA 5B3SB 1KBWA 2PPDA 4F7KA 4EF3A 2DWTA 2YAEA 2XV3A 3ABGA 5I6PA 3UABA 3PAVA 3DIVA 2BP0A 3WNJA 2Q5BA 3CVDA 5I26A 2DY2A 3S3BB 1JZHA 3TU6A 1FWXA 4E9VA 3CVCA 1FFTB 4P5RA 1KGYE 1W6LA 4JKNA 2XV0A 4DP2X 3G5WA 1BAWA 1J9TA 1HAWA 3NSYA 4W1TA 5E9NA 1BXUA 4E9TA 2IDTA 4AI7A 2AVFA 1ADWA 3ASOB 2A3TA 3OQRA 1AZCA 1SF5A 2QDWA 2PCYA 3NJKA 2EINB 4A2DA 1GS6X 1L9PA 1WS7A 4G7SB 1NPJA 4BWUA 1IC0A 3EH5B 4UANA 1KV7A 4YVUA 1NPNA 1J5DA 2VMJA 3QJTB 2FWLB 4BDVA 1W6WA 1JZFA 4KO5A 2Q9OA 4N8UA 2WSDA 1JZGA 2UXGA 3FYEB 3FU7A 4FA7B 4QKTA 5I5IA 1GYCA 4DP5X 3AG2B 5I6NA 3CDZB 1E65A 1OOWA 3X1NA 2MTAA 2HX8A 1IKOP 3IBOA 4WTQA 3JT2A 4YSDA 1KYAA 4A2FA 1ZPUA 2XU9A 1PY0A 3NSCA 2J57A 1ASPA 4NERA 4E9SA 1DYZA 2BW4A 2DV6A 1L9QA 2TSAA 4HALA 1RZPA 1A65A 2GHZA 3IE9A 3MBWB 5F7AA 1ET8A 2R7EB 2X88A 1L9RA
chains in the Genus database with same CATH superfamily
4X0NA 1ZGLM 2EIMB 1L4IA 4TNEA 4TVPH 2JIXD 3CNKA 3DV4B 2NUPB 5B1KA 3E2HB 3RNQA 2VZOA 1F58H 1F97A 1KC5H 1OZUA 1FHNA 3HS0B 3UTTD 1G9NL 2X2YA 3MNWA 3QS3A 3JQOB 3VI4E 5K5YA 1E5CA 1A14H 3T9WA 4KY1H 5E4AA 2PCFB 3ASNB 3EDFA 4L18A 4S0SD 4JDEA 4WSGA 1OL0A 3CDGB 5HVGB 2R56L 5EC2A 4L1DA 3AG4B 2WTPA 1DN0B 2FNWA 3DSFL 4KOBA 1RFDH 3I2CH 2QADB 1O75A 4G5AA 5AEAA 3QFJA 2WGNB 3WXVL 3VFNA 4KOCA 5KYXB 1U8JB 1ZPLA 4O9HH 4TVSa 1GAFL 1Z66A 5DJ2B 3MA9L 2BSTA 4RAUA 4L4VD 3GO1H 1KSRA 3UBXA 4MYPA 3SCMB 3U1QA 2E47A 3LMJL 3DVFA 4XC1L 5HGAA 3ZHDA 5JIQA 3RWDB 2A9ML 2IDFA 4KRLB 4PCKA 1GGCL 5I66A 3FTGB 1AY1H 5DUML 4Z76A 4IU2A 2QR0A 4YK4C 5AZ2L 5E08H 2YGNA 3TP4A 1SVCP 4A7VA 3VAEA 2HVKB 4DFIA 1Z1WA 5DK0B 2M26A 3IBEA 1R5IA 1T7YA 3NJGA 5DUBA 3N0AA 3B6SB 1W0WB 1WRFA 2IPUG 5ALCL 1QPPA 2F08A 5DS1A 2LAAA 1SY6H 5E2UH 3FL7A 5D2LA 5C0GA 1BBJB 4NHUB 3KDPB 2AQ1A 5GZNA 1DJSA 3VFVA 3HCVB 5GRZA 1T7WA 3IMVA 2OZNA 3PWVA 2GG1A 1RZKL 4O51A 3DPDA 4FZEH 4Q4IA 3E6FB 3LRHA 5F97E 1AHMA 4RVBA 4PJFF 3V4VA 3GNMH 4HH9B 4IRSC 2XRAL 2X4PA 4NO3A 3LQMA 4J8QA 3KZ8A 1HOCA 3VMOA 3ZMEA 4CW1A 6TAAA 1X7TA 3F58L 2VTFA 3HJEA 1AKJA 4OB5L 2X5PA 3ZMRA 3Q3GB 3GXIA 3U1SH 2COQA 4H2CA 2IDSA 5GGQL 4HIJA 3LZNA 4Y2OA 1F1AA 1X4XA 1JYVA 2KUTA 3P69A 2NY0B 1A47A 1G0DA 1QKZH 4PJIB 5FLVA 4KZDL 4JFSA 1P4IL 1OT1A 4DK3A 1VFAB 1SOQA 2CSPA 5K39B 5KJRL 1DQVA 1DVFC 3FTZA 1KIPB 5I0VA 2ARJQ 1P6FA 4KKAD 2V37A 1NGYB 3K2KA 1D5ZB 4DPAX 4OZHF 5FYJE 1D5XA 2D9QB 1UWGL 3IU3A 4IMLA 4OGQC 1G9MC 1UWYA 3PS6A 5D1QE 4ZFZB 2B9AA 2Q8AH 1FRGL 3FT9A 3KPOB 4R84A 2VLRD 2QVTA 2FD6L 4BE5A 3UTSB 4B96A 2DEWX 2ZNWA 5C71A 2OK0H 2LHAA 4LSUL 4EZJA 4BSWB 2KHAA 1V3JA 1K8DB 3BKCL 3CHQA 2EDKA 3MV8D 3OC8A 3EO0A 3LDBC 1NCOA 2JJSC 4N2LA 1HAUA 3Q2NA 4NBYB 1HC1A 2AJ3B 2DD8H 3RUGF 1UA6L 2ZWZA 3DV4A 4XPHL 1HJBC 4PV9B 2ITEA 4R5VA 3UP1A 5LNDA 3HS0A 1JYWA 2CIKB 4XB7A 1MWAB 2PCFA 2RFXB 1QBBA 4X6CE 4JM4L 3DYPA 3SIKA 1ZIAA 2EDRA 2WLHA 3CDGA 3NT0A 5HI5C 1WBZB 2AKRB 3N43B 1IIKA 1DN0A 2C1PB 2IV8A 4Z5RB 4UUJA 4L0YA 4JO3H 3S88H 3MOAL 4L23A 4X6DA 5IG7B 5E56A 4Z7QE 2V2XB 3AM8A 2MKLC 3O6FC 3IMRA 4HS3A 2FLRT 3OMZA 1M2OA 3QH3A 2GTZA 1DVSA 2P5WE 1WHPA 2UX6A 4LVNB 4OLYH 1KBPA 5LGHH 5DJ2A 4Q58C 4JZNB 1MCHA 5KAQG 4XTRD 3LHPH 3SCMA 3FRPG 4KV5F 3CDFA 1G7HA 2BIOA 4MZRA 4WK4B 4D94A 3SY0A 3QDMD 3IRCA 4LDOB 2MCMA 1F42A 3E9UA 3ZHNA 2QVMA 1XCTB 4M6NL 5KN5B 2QMJA 3QEQD 3BPCA 5DWUH 4FKHA 2CMRL 4AQ1C 1KJ2H 2HVKA 2WBJB 1YHPA 3SE4A 5KZCD 2E6PA 2J1ZA 1V55B 4LL9A 5HVWA 2ZXGA 4IRJA 5F88B 3HC0A 3L3KB 3B6SA 2EYRA 2QVKA 1V7NH 4M5YH 5DS8B 1B4RA 4RBPK 1RJLB 5AKVA 1BQHA 5E9DA 1A4CA 1BBJA 1QD0A 5LBSH 4R0LC 4Q7DA 1WAAA 3UAJC 3FRUB 2FGWH 3HCVA 4JCLA 3CVBA 2BVEA 4QJ3B 5GS1C 2N7AA 4U6XB 2YGOA 3GMQB 1FG2B 1HDMB 1X5FA 4G8IB 1FL5B 3E6FA 4LARL 5CINH 5DC2A 4HUVA 3IFLH 4EPSA 5EZJB 1A6ZB 3NFSH 4R9HA 5D7KE 4ANUA 4DKAA 3I3EA 2H32H 2X4NB 4WI9A 5CSZB 1MJJB 3IAGC 3CXFA 4EZKA 1ZDSA 3T4AB 4OTXL 1EGJA 1XBRA 4JZOB 1AD0B 1O7DE 3SGDH 1NCUA 2NYKA 1ZA3B 3BEVB 5JYLA 3SQRA 3IN2A 3QQ9D 2NY1C 3KYKL 3CZLA 5FDWB 5GGVH 5F7HA 2OJEB 4JGUA 5GRJH 4PJIA 1XD1A 2QKIB 2QSQA 3BRFA 4MZ2A 3RIAF 5CBEB 5K39A 4NJAH 2QQLH 4RSVA 1KIPA 3ARGB 3IN0A 5F1OB 5B1CA 2EEXA 4JEGB 3RWCB 2WTRB 4HGMA 3AMLA 2H3XC 1L9MA 1NGYA 4LU5L 4PJEB 3DVIA 4JK0D 1CI5A 5I6LA 1ZXQA 1QOKA 3PIQA 3P73B 2EUZA 4DGIL 4X7SH 3TN0B 4Z3HA 5IB1A 4WO0A 5I16A 4PB0H 1G6VK 1MFAH 3B2VH 1XAUA 3KPOA 4OT1L 4AIOA 3BW9B 1GC1H 3JUZA 3PL6C 2N56A 1TQUA 3FB8A 3UTSA 3WFEH 4DO6A 2CR3A 4K5NA 3LRMA 2GJRA 3GXMA 2YLKA 4YDJB 4P2QE 3RJOA 3T3PF 1OGAD 2H1PH 3DV6B 5LB1A 1TOXA 2NQDA 2VUOA 4G9DA 2HMID 1IFHH 4NLHA 4OIFA 3U0WH 1YY8B 2AJ3A 4IDJL 4PJ5E 4Y19A 5JA8B 1TMQA 3AU0A 3V0DA 1WIUA 1TQWA 3FO2B 2F7OA 1N5YL 1YCSA 4PV9A 1R4XA 4XE5B 2NSXA 1AZNA 3OX8A 4Y4KD 3DHMA 3US0A 4MNQE 4UILL 2P43B 1URLA 2CIKA 3DETC 2WQVA 3MGAA 5KTEL 4QRSB 5A43C 3GTTA 1MWAA 2GBTA 2RFXA 1R3IL 3OM3B 4GMSH 2HPTA 2EC8A 1C7SA 1XGZA 1I7TB 4X7TB 3B34A 5AOKA 1WBZA 2AKRA 3C60A 3QZWG 2C1PA 4QY8B 1JWUB 4QJ4B 4Z5RA 5KVFL 1GOGA 4MA1C 3D9AH 2IADB 1CTNA 5DD0H 2P49B 4NOBA 1JZDC 2V2XA 5BXFB 2ZWNA 4PCSA 4GXVL 3UJJL 4ADGA 1WE5A 4OF6A 2R0LL 4XNYH 5JHLA 3FUIA 4JZNA 4Y9CA 4HPHA 1F2QA 2K45A 2BRRH 4E5XB 1YPZE 1ZAGA 1EGJL 4MS6A 4FG2A 2WZ0A 3IWVA 3RIFF 5FOBB 5I5RA 4DP7X 3CFBB 2NY4D 3ECUA 5C0CD 5IHUH 3P30L 4Y5YB 2NW3B 1XCTA 1D5IH 4NGHL 4KVCL 1SLWA 2AK1L 2DI9A 2WBJA 1Z9NA 4ZNEA 2MSPA 3IFOA 3VG0L 5DYFA 1ZLVH 2C3GA 4JX0A 4KTDH 1QO3B 4TQHA 2D0FA 3CHXA 5F88A 4AX3A 3L3KA 5DTFB 5ITFB 4MQXC 1U3NA 3WMQA 4YBLB 5C0NC 2QHRL 1RY7B 3HPJB 5DS8A 2H8PB 2EXYC 3PCYA 2XV6B 4XNDA 3L48A 3L45A 2FBJL 3FRUA 1G0XA 5GGUB 2AJVH 4EEEA 4MZIA 4QTIL 3OLEA 4U6XA 3GMQA 1FG2A 1HDMA 2BIHA 2R29H 4G8IA 1FL5A 1ZVYA 3LIZH 3MRLB 1KIUB 4WQOA 3ARXA 5I6PA 3BUQA 1A6ZA 3T77B 4PJ9B 3L3OB 1YEKH 2KBGA 2X4NA 1NGWB 2DY2A 1E4XI 5I75B 5D1ZB 1IGML 1RLBA 4ONGL 3SDCB 1RMFL 2XG5A 4DP2X 4NKOB 2APTA 1AD0A 1V3MA 4H20H 5I73B 5IR1B 2KMWA 3GMPB 1ZA3A 4TNVF 4WI4A 5E0FA 3BEVA 5E95B 5TH2B 2RHEA 1H9VA 1YEIL 1R3KB 2R2EB 1RURH 3REWB 2D7OA 3HLAB 5FDWA 1GPOH 3A6OA 3OQRA 3G6AA 4P23C 4ZFOL 2QKIA 1L9PA 3H3BC 3M8OL 1QA9A 3NA4A 1BFVH 2B1HH 1Z32X 2EICA 1IC0A 1R3JB 4G7SB 5CBEA 3HG1B 1MWAL 4RMSA 4NUQA 2A9BA 3RNKB 1ACCA 1C5BL 3O6ML 3TTYA 4BKLB 5JIHA 3MODL 3FT4A 5ITBL 3RWCA 2WTRA 1I8LA 5JXEA 3IGFA 2X6VA 3L5IA 3RDTC 2YHGA 4PJEA 1QSFE 3S36H 3V0FA 4NM4H 2XWEA 2WSDA 2YPLB 3DPBB 2B7DT 5L8KB 5EMYA 1QI4A 3GS0A 4JFFE 4GH7B 4F7TB 3TN0A 3OG6B 4OU3A 4P2RB 2V3DA 1KJVB 1XIWC 1Z9LA 3BW9A 1OP3K 1YAIA 3DRTB 3QHFL 5I8EA 4S1DC 2JSFA 2WTOA 3CVIL 5E8NB 3O6LH 4YDJA 1KJ2B 5JHLL 1WYJA 4NHCL 4PJHF 3VRIB 3QPXH 3DV6A 1FL3B 5T1DH 3QWNA 1JAEA 2A77H 1MREL 1ASPA 1JTOA 5CLXA 5JHMA 1YY8A 5FFGA 1C08B 5H37G 2P28B 4EDWL 4ZMQA 3ARED 1VGEL 3FO2A 3LN5B 3WY4A 4BYHA 2DLGA 4PWFA 3BQUB 3U30B 2JKNA 2PYFB 4QRSA 4X9IA 4HHAB 5GSVA 2J4WL 4NRXB 5IBTH 2H32B 4YFLF 1I7TA 5AWNH 3BCFA 1RUAL 3L08A 4QY8A 1JWUA 4HBQA 2ZOLB 3OMAB 4PJGF 3B2PA 3MUZ1 4U4IA 1NL0H 1T2QL 1WAPA 2GFBB 4KTEH 1MHHB 1W72B 2IADA 3WTTA 3AZUA 3VGDA 1QATA 4O58L 2LTQC 3QXTA 2XOTA 4JDZB 1KPRB 3A3YB 3X1GA 2HLFC 3QDJB 1F58L 4BK5A 1KC5L 1P6AB 3IRPX 4KRPC 2KZKA 3L7EB 1BYPA 3IXTA 5I2IB 3NIGE 4PRPB 4KY1L 5FOBA 1INDH 1MLBA 1MI5B 3B7RL 1J5HA 4FXGB 3CFBA 4EIGB 3IS0X 5JHDE 1F11B 1PAMA 2W07A 2CUMA 2WPGA 2RB8A 4Q0XH 3UPCA 5F21B 1KTJA 1QZ1A 5AW9B 3BCDA 3GIZH 4WFGD 4L1BA 1RFDL 3I2CL 3RKDC 4ERSH 1QO3A 3CFCH 4WFED 2VLJE 4C54A 5DTFA 4Z8FH 2CPUA 4G6MH 3DMMC 3ESUF 4O9HL 4XVJH 5ITFA 2FDBP 5C0FB 2CIIB 1KYFA 4V1DB 5D93B 3PWNB 3MRHB 2WLLB 2H8PA 3GO1L 2OMWB 3H6JA 3PHQB 5BRZE 2ZYHA 3Q6FB 4LHJB 1RLWA 5HI4D 5GGUA 4LRIC 2OCCB 4Z7WB 1FI8C 3OVUB 4HC1A 4DUXA 3NJVA 3TEWA 3QJUB 1AY1L 3HAEG 3MRLA 1KIUA 3THMH 1WITA 3VX1A 5GS2H 1CF8H 3VGFA 1OSZA 5E08L 1ERNA 2HX7A 2WXGA 3T77A 5IHLB 4PJ9A 3L3OA 4H0IA 5DSCB 2F19H 3SPIA 1N19A 2F58H 1JHKH 4M00A 5D1ZA 3SDCA 3S98A 5TPWH 4YBHA 5IR1A 3GMPA 2FWUA 1T5KA 3NYKA 4TQIA 5TH2A 1AQDB 3WJJC 1SY6L 3H9YA 1R3KA 3EFOA 3REWA 3HLAA 1A4KB 4YEFA 1QHQA 2Z31D 5IP4A 1CL7H 4ZBJA 4B9PA 2YO3A 4ZTOH 3NH7H 3SDAD 2HT2D 1R3JA 2Y5QA 4FZEL 2WC7A 2WBWB 2XN9D 1Z5LB 3HG1A 3NQIA 2ZWSA 3RNKA 4BKLA 1EVTC 1EX0A 1QFHA 1RJZB 4R7NB 5J3HC 2MCAA 3GNML 1MFBH 3VFRB 3QG7H 1OLLA 3ZGHA 3VTAA 4G9FD 3R0NA 2YPLA 3DPBA 2XTJE 3LKQB 3ESNA 4N2KA 4NP4H 4NI6A 3U1SL 4BQ8A 1AHWC 5A2JH 4P2RA 3QXUA 3K5SA 3TEUA 5J56B 1DLHB 2UXVA 3DRTA 4X8XA 4YZWA 2FVNA 5IBUG 2R1WB 3LAFA 1MY7A 5E8NA 3VRIA 1W8NA 1M05B 3GSXB 2I9LB 1FL3A 1NC4A 3POCA 2VIRA 5ISZB 4JQVA 4ADJA 2KLRA 1PD1A 5M94B 3ABLB 4M7LH 3D07A 1RZIB 2X2UA 1OGTB 2PNDA 2QQQA 1C08A 1XCQB 4A6YB 4AQ8C 1C1EL 4AYDC 4DPBX 3OF6D 4S11A 4ATTA 4ZUVB 2PYFA 2Q8AL 3VSQA 2BHFA 1JWSB 4QHMB 3ERXA 4HHAA 3H2PA 1XX9C 3CPLB 4NRXA 4F20A 2OK0L 2H32A 1FYHB 3AUWB 4H8QA 5F71A 2GHWB 1MNNA 1T66D 4O4YH 3VGHA 2ZOLA 4HWUA 2GFBA 2WKOA 1W72A 4L9LB 4KTGA 3VM5A 4HC1L 3G6JE 4F7MB 1VEOA 1N67A 2DD8L 4JDZA 1KLFA 5C0BB 3WLWD 5ICYA 1I85C 2BFVH 4QHUB 1OCRB 3H4FA 3QDJA 5C0JB 2IPTH 5KYUB 4WEMB 4ZTEA 3L7EA 4XXDB 4BCXA 5I2IA 2EDLA 4G7YH 4U6VH 4PRPA 1UD8A 3V7AE 5HJDA 3D1MC 1S2EA 4FXGA 1T1WB 3MV01 4JRYA 1F11A 5GRUH 2HVJB 5HYSB 3TNMB 4CL7A 3VXUB 5TDNB 2W0LA 1KBGH 3X17A 4JO3L 4R3SB 3S88L 1WAEA 3O4OC 3V6OC 2FBRA 3KLHC 3B1TA 5AOMA 1EJFA 3DJRA 2WVSA 1B4JH 4X8GA 1B2WL 5EF0A 3RFZC 1WDAA 5C0FA 2CIIA 5LGHL 2ADFH 4L2LA 4V1DA 4Q52A 1WJ3A 2WLLA 3MRHA 4WFFD 3ZZ1A 2OMWA 3LHPL 3PHQA 1TNMA 2BHYA 3KH4A 3T3MF 4Z7WA 3A0OA 4LLVB 3RYMA 4JRLA 1HHGA 2BNQB 3T8XB 4HEMA 4BXVA 3RPKA 3V8CA 2WJ5A 3FOLB 4R5TA 2APSA 5AVQB 1NM4A 2MFNA 5DWUL 1JDCA 1E27A 1KJ2L 3P4NB 4FZ8H 4OZ4B 3LDBB 4P3CH 3NJMA 5MHSD 2OFQA 1SGKA 2NXYC 2MQGA 4LCIH 5DVNA 3U4BH 1SDAB 2AGJH 3FMGH 3SKNB 1AOZA 1V7NL 4M5YL 2OR9H 1AQDA 3GUFA 5DZVA 4KK8D 2RH0A 1LP9F 2W80C 3E1ZA 5LBSL 4LKXB 1RIVH 4IYKA 3LH9A 2ZX5A 2EADA 3BAKA 4HKXB 2FGWL 2HKFH 5DEGB 3WN6A 2RCSH 2C7FA 5DZNA 1QFWI 4X6BB 2A6DB 3DJ9A 3D50A 3SPHA 5IQOA 3KLAB 1Z5LA 5CINL 1RJZA 3KH3A 4R7NA 3RP1A 4XOEA 1NAMH 3VFPB 1Q0XH 3NFSL 4QOKB 3I3BA 4XB8A 2A83B 2VITB 1XZWA 5C6TH 3FS9A 4EI6B 1MCSA 2YMXL 1UZGA 1BYOA 3LKQA 5FYKU 3QO1B 1LO5B 4O02H 1WBXA 2FZ3B 4W4NA 3UFIA 1FV1B 1QRKA 4FCHA 4G8GD 5GGVL 2OSXA 3H7LA 1H3WM 5FCSH 2R1WA 1O5PA 1CFVH 2GIXA 4IS6B 3BZ4A 1VZIA 1JMXA 2I9LA 3FB7A 3GSXA 5ISZA 5AENA 5JZ7C 2DQTH 4IRZH 4JMNA 2Q2LA 4L48A 3UG3A 1KLGA 3DO4A 1QNIA 4NJAL 2QQLL 4DGYH 5IB5A 1RZIA 2L7JA 1A6VH 1OGTA 2Z0UA 2YXVA 3O8XC 1XCQA 4R8WH 4AQ1B 3NEOA 2ZUSA 2R8SH 4W6XB 4A6YA 1B88A 1UWEH 2Y3AA 3MV7E 1H6UA 3DDGA 4PRID 4X7SL 1WV7T 1J88A 2X6AA 1D9KC 3OQ3B 1MFAL 3B2VL 2WSKA 1JWSA 3RWGB 2VJXA 1HE8A 2R29A 3ZDYB 3R06B 4QHMA 4YSEA 3ILPB 2E7HA 4R0LB 2FHFA 2MOGA 3FTSA 4U31A 2H1PL 3QPQC 5JOFB 1BOYA 5EUOE 5GS1B 3HBQA 4Y89A 2XQYK 3ZTJG 4GKZB 1IFHL 4AKOA 4FTVA 3JUYA 1JF1B 3U0WL 4GQ9L 1FZMB 1S46A 2BOBA 4IRSA 5DURB 3TO4C 4F7MA 3GINA 4WUUB 4I0CC 2XG4B 5C0BA 4GS7C 1OF2A 4QHUA 2QDVA 5KYUA 3EJTA 2AJXH 3SPJA 4XXDA 5IFHH 4LNRB 2VR8A 2F8VA 4LGPB 4AMKH 4Q56A 3TCLB 4GMSL 5J6GA 1J7VR 5B1AB 3B5GA 1AO7B 1E8WA 1T1WA 1MCJA 1O6VA 2HVJA 2ZJSH 4N2IA 5HYSA 5CP7B 1E8XA 4KVPA 1NDGB 3VXUA 4JPWH 1WO2A 3NBNA 2NZ9D 1NMBH 2UWEA 3D9AL 1DVFA 4MAYD 4HQQH 4GSXA 1L9SA 4MCNA 5DD0L 1DZ0A 1ZIBA 1WBYA 4IIZA 1UD5A 2OMVB 3I75B 5HPOA 4QRPD 5KUMA 3G08B 4XNYL 2M83A 3VXRD 3F62A 3TV8A 5K59F 3PABA 2BRRL 3ZJAA 3ISRA 3BISA 3RVWC 1F56A 2YEQA 3FUJA 3PL6B 3VA2C 4LLVA 4XMTA 3T8XA 2BNQA 2AMUA 1J5CA 3GT6A 1E4WH 5IHUL 1JPTH 1PLCA 3FOLA 3F64A 4UOW0 3I50H 3TF4A 3NCYP 4H0GA 1PX8A 3NSXA 1D5IL 3AS0A 1E4KC 1T0MB 3ABZA 1PS3A 2E59A 4GW4A 3P4NA 1QWHA 4YO0B 1YUHB 5B3SB 4M3KB 1CLCA 4NC1E 5SWQB 1QYGH 2JJSA 2PW2B 5LGKA 3D51A 1EXUB 3WAKA 1U8NB 2Q5BA 2XWBB 4JFYA 3SKNA 2X4SB 1CI3M 2X1WL 4WWPA 3LKPB 3QT2A 4A6YL 3CVCA 2YK1H 4LKXA 5E8EB 2V2WA 2AJVL 2JXMB 4E9TA 4X6BA 1NUGA 2H2SD 3QGVA 2WLIB 4ONHA 2JJUA 3HBGA 3KLAA 2QLVB 2R29L 3IM1A 3LIZL 3VFPA 3JTSB 1YEKL 1OHZA 4QOKA 5KANG 4MA1B 5C97A 2R69H 5L2KB 3T0AA 4UANA 3ZR6A 4EI6A 1J5DA 3CU1A 3O6FA 1VA9A 2VMJA 1LO2H 4OLEA 3MRNB 4TNFA 4H20L 1W8OA 1HH6B 3QO1A 3ZQWA 1TXKA 3P9MB 5CIPH 2XJLA 3MUJA 1RURL 1FV1A 1Y1DA 4JKKA 4JM0A 4PBDA 1GPOL 1CR9H 2OA9A 4YDVB 3TT1H 5JIPA 5CSGA 2L0DA 1E5BA 4IS6A 3MRQB 1DJIA 1BFVL 1OTSD 2B1HL 2YPKB 2MTAA 3R7QA 2XVLA 3BOVA 1IKOP 3VA6A 1PW3A 1KXTA 4IBTA 3V6ZA 1GJUA 4UMGA 4AQ1A 3WFCH 2KDGA 3EDDA 3LZFL 3ZKMD 3BUIA 3X3GH 4NM4L 2E6QA 2BW4A 1U8PA 2DKUA 3FONB 4G8EA 4P3DB 2QTEA 4QUOA 4OFDA 3L6FB 4JVUA 4AE0A 1WICA 3W37A 2OMZB 3RWGA 4TLUA 3W0WB 1EHNA 3P3SA 3R06A 4QHLB 3ILPA 1BQLH 4R0LA 5EN3A 3ARBD 5EU3B 3O6LL 3UAJA 2KPNA 4HBCH 4W9EC 1G9ML 5JOFA 1ZV9A 3KPRB 5GS1A 5T1DL 3NZSA 4H88H 2A77L 2DWEB 5ICZB 1J1XH 4YXKH 1JF1A 3C5ZC 1FZMA 4M4PA 2FT6A 1URZA 4WUUA 2XG4A 1SM3H 2WLMA 3PP3H 3ZZSA 2DJ4A 3FT2B 2HFGH 3RUGB 1IUZA 2XICA 3ELQA 2GBVA 4LNRA 4JGNA 2D0HA 1TJHH 3A4EA 3A6BH 3EJSA 2QBWA 4X80H 4P05A 3T6VA 2ADIB 1G7PA 1ITBB 3TCLA 1FGNH 3B3IB 1RUQH 3NVQA 4HDIA 4JN2B 4XPGH 4JY6B 4P23B 1FLTX 2VSMB 5CP3H 5IBTL 3WCYA 3WY2A 5AWNL 1NDGA 1XF3B 4WWKD 4R97C 1NL0L 4KTEL 5MERB 4MMYB 3T6WA 4O02B 4FC3E 2P52A 2XWDA 2XPGB 3RDTB 4C4UA 4HLZH 1I9IH 3I75A 2VABB 2HCZX 1T80A 3G08A 1MXGA 3T71A 3CIQA 3GMLA 5LN8A 2EDQA 2B08A 1E67A 4X4XB 1SOXA 5J9PB 2VQUA 3PUUA 3CQQA 5FYKH 1INDL 1XIWB 3MJ9A 1A4JB 4KKAC 5FHAH 3PL6A 1RH8A 1CN4A 2Z8SA 1J05B 1I3VA 3CXHK 4AKQA 4LLMB 4Q0XL 1HXYB 2J7LA 3FU9A 3P4OB 1T0MA 4NN7C 1H9DA 5HYJB 4OQTH 3GIZL 1L5GB 4DKDC 2Y72A 5C92A 1YUHA 5SWQA 3KWTA 5EEUA 1NBCA 3CFCL 1EXUA 1X44A 4Z8FL 4G6ML 1U8NA 2DWDB 4XVJL 2OV0A 1TJIH 3VXSB 3EBGA 4JGMA 1KGCD 1DQJB 4QHKJ 3F6LA 4YSAA 5E8EA 2OSYA 1JD7A 2IO5A 1RVFH 2CLRA 2JXMA 1TMCB 3DA0A 4Z7NB 2DQGH 3RWHB 2WYIA 4LAQH 2OI9C 4XN2A 2WLIA 2WXJA 3VNZA 3THML 2VR3A 3UZEC 4Y9BA 1MFEH 3UO1H 1IVTA 3WUWG 2X10A 3DUUA 4B5ZA 3INOA 2F58L 1JHKL 4APXB 4PVBA 4MNGE 3HI5H 4ELKB 2LTQB 3M1BB 4PJFA 3N5AA 1I8AA 4S0HA 4PHXA 4HUUB 3QCVH 5TPWL 5TE7H 3W56A 2FYYB 3SJVB 3SYQA 2V5TA 1KT2B 3S8WA 2UXFA 3MXVH 3UCQA 4Z7OE 1VEPA 5LXVA 3QI9C 3QZOA 5E6RB 1CL7L 2EYTA 3MRQA 4ZTOL 3NH7L 3BVXA 4X6EB 3ZR5A 1TDQA 1TO4A 1PZ2A 3MYJA 2VKWA 3CLEL 3FUNA 4P9HC 1NLBL 1ONQB 1EZVY 3L4VA 4G82A 1LEKB 2WOYA 2D7TH 4XTRC 5JW4M 4XVTL 5IT2H 3QG7L 5FDYA 4ZK8A 1AMXA 1BXAA 3APNA 4PJBE 1MOEA 1CDUA 5C0EA 4NQEA 4PBVC 2ZUXA 3FONA 4P3DA 5HYIA 4NP4L 3DMMB 3J8F7 4H0HB 3L6FA 4WLCA 1NCAH 3DX3A 3B9EA 4U3CA 4XPAL 3DURB 1OD7A 3U48A 3W0WA 1BYNA 4QHLA 5AVXB 5KYWA 1EH9A 4G72B 5MP6H 4V2CB 2EE6A 3CZEA 3AS3A 1LILA 3FH7A 4MTMA 3O3AB 1MVFA 2DWEA 3A6CH 3FAXA 3K6IA 4EDXA 1ZA6B 1OB0A 4M9OA 3MJ9L 1MKFA 2DLTA 3LPOA 4LIQH 3RY4A 1BD2D 2D73A 4TNWK 5FW6A 2DLIA 2TSBA 4MB4A 3KG5A 4WGWB 1RZFH 1UADC 3QA3B 5B3JE 3FT2A 3RUGA 2C3XA 5C07B 3KL5A 4NIYE 3MFGB 1FCCA 1OK8A 2ADIA 5HHOB 1X6NA 3VCLA 1KGUA 2FR4A 4P23A 4ANWA 1QRNA 5FO9B 2IOIA 2BX5A 4NKDB 1TQCC 1UWFA 4O4YL 1XF3A 3QC5X 4ALAC 5EEYA 5MERA 3QQ9C 1P4LB 1QSZA 4WGKA 1QQDB 2VO8A 4KHXH 5DRWA 3GXUB 3RDTA 3WUZA 2BFVL 2VABA 2AEPH 1QASA 2IPTL 2QSCH 5IREA 3HMXH 1F6AA 5J8OA 2J73A 1AHWB 4G7YL 2OSLB 1A6UH 3MROA 1RKRA 3ALXA 1XIWA 1A4JA 3FTVA 3ARFD 1NA8A 4LB8A 4LL1A 4U7MA 1Q1JH 1BVLB 2CO7B 5GRUL 1J05A 4GQPH 3H85A 5E23A 1J9CT 3P4OA 2FIKA 1KBGL 3EYOB 3QW9A 5DQJB 1IL1A 1L5GA 3KBPA 3FFDB 2GJ6B 3FFCA 2I26N 1Y6KR 1SRDA 2XXFA 2ZQKA 1B4JL 4Y1AE 3TXAA 4AYBA 2DWDA 4CSZA 4CC0A 2O5NA 1XEDA 3VXSA 2WY3B 4KX9A 2HMIC 3EH4B 4KBPA 5C09B 3JTBA 1UXWA 4HU2A 4KV5E 4KX7A 5TQ2H 1ORQB 4LCUA 4W9DC 3RWHA 2Z7YA 1LEGB 1UD3A 2F5AH 4Y4KC 1OAYH 3Q8CA 1I53A 4FZ8L 4ICXA 4P3CL 5CFHA 1NCWL 4LCIL 2ZXBA 3GWJA 3P3YA 3U4BL 4ELKA 3M1BA 1KYOK 4ZPVB 3VGGA 4PVNA 2DLEA 3FMGL 3V6BR 3VXME 4HUUA 5LG6A 1KELH 2OR9L 1KPVB 2BK8A 3UYRH 1LYQA 5FA4B 3B8YA 4MCYB 1JGLH 3MCKA 1RIVL 1UVQB 3G5VB 3EXLA 2HKFL 4BWTA 1YMME 2RCSL 3F00A 4KKLD 5CM1A 4RA0C 4X6EA 1UM6L 3BH9B 3FHAA 2DF3A 3HR5B 5T3XD 3S6CA 3T0XA 4A7GF 1OWWA 1NAML 1MCRA 1Q0XL 2PUQT 3FH8A 3OXSA 1LK3H 1KXHA 1XF5B 2W59A 1BPLB 4QXVA 4XO4A 4J6RH 5C6TL 2CGRH 2B5IC 2NY4C 4P04A 4L8CB 3MTXA 3DMMA 1L9OA 2EVIA 4O02L 3L17A 3S5LB 3RFZB 3SD2A 3CZNA 1OPGH 2UY7B 3DURA 3AXHA 3BHBB 3V9EA 3P2BA 3DO3A 5F1IB 5HHQB 1CFVL 5T3ZD 4LRIA 1JPFB 2ZOOA 3MVSA 4C56D 1R1CA 2IH1B 2WLJA 3JWNC 3O3AA 2OCFD 4WI2A 5EWIH 3MBEB 4OCYH 4PM1A 4DGYL 1TTUA 2BSEA 4GKOA 4X4ME 4XP4H 4DO4A 1KTRL 4KJPD 1GKEA 1MW2A 4R8WL 1ZS8B 2R8SL 1UWEL 2NXYB 2J43A 4PI0A 3KM2A 3QA3A 1TF4A 1DJZA 2HFFB 2X89A 1IBZA 4B50A 4FA6A 1PMYA 2F8IA 3EH3B 5C07A 3VMNA 3WJJA 5JR1H 5HHOA 2CRZA 5BQDA 2AXFA 4EOWH 3RI5F 5FO9A 2R69A 3QJSB 5GGSA 1FAKT 1WFTA 1J8RA 3KXFB 1MCLA 4HPYH 4JJOA 2MCG1 4MB3A 1P4LA 2IAND 4XNMB 3BDBA 4JFUA 4BH7B 1KB5H 2EIEA 1QBLH 2H5UA 1CFSA 1XR8B 3CSGA 2J71A 3BE1H 2AJXL 4MRBA 1UFGA 1AHWA 5IFHL 5C0AE 1MUJB 2OSLA 4LVOC 1BX2B 4PRNB 4AMKL 4MJIB 4NAQA 5EZPA 4UM9B 4AEEA 2VQ1B 2UVFA 2CO7A 2O61B 2AK4B 2DQMA 3QUYD 3T2QA 1PZAA 2B20A 5AOLA 1NQBA 2A9CA 2VLKD 4JPWL 3MRJA 3EYOA 5HDLA 5DQJA 1NMBL 3FFDA 3FCBA 2GJ6A 4HQQL 2XVBA 4N0UB 1BAFH 5F9JA 4AYID 5H4ZA 1FYTB 3O8XB 4ZG1A 1N18A 5CEZD 3AWGA 4N1CA 3O45A 5FM4A 3GJFA 3TO2B 4AQ8A 4MJ6B 5D2LE 1KZQA 3EIFA 3VXQA 3T0ED 1CFTB 4JL2A 2QSVA 2OXHB 5LO7A 2P5PA 3DIVA 5C09A 3WNJA 1KYOJ 1FSKC 1D9KB 1NFDF 4HS6A 3SOTA 3UX9B 1YNKH 1NOFA 4F2ME 1ORQA 3AREC 3Q8BA 5I1IH 2C4FU 3Q8FA 3WIFA 1E4WL 3LH2H 3ZE0E 1JPTL 4PRHD 3QBTB 3I50L 1ES0B 3E6HB 4BFRA 1HEZB 3S35H 3ALWA 5DWPA 2EVJA 4XO9A 3RIKA 3GJEB 3V8OA 4A2DA 3TO4B 4H8HA 4ZPVA 1GH7A 3S35X 3FQXB 3IXAA 4HOMA 4GS7B 1KPVA 4NZ8A 1OM9A 1P69B 4JN1H 4MCYA 5DK3A 2PTVA 2YK1L 2R15A 4QNPE 4W6YB 1UVQA 3G5VA 2EXSA 1BJ8A 3IETB 4UDUB 2KLSA 4U1GC 3II2A 3BH9A 3HR5A 4J5VA 4F24A 5CN3A 4H5SA 1HL4A 1XF5A 2R2BB 2R69L 4HEPA 4EIZC 5E00B 3V6OA 1KFAH 3DHJA 4HISA 1A2YB 1OAXH 1LO2L 4ZSOA 5F7NC 3ULVD 4L8CA 4UINH 3HI1B 3H7BA 4GSDH 3BYTA 3S5LA 3RFZA 4MX7A 1D7FA 1Z6JT 2ATKB 2YJLA 4UV4H 1GXEA 4B9JA 3QB7C 1KCUH 3KPSA 3BESR 3BHBA 1CR9L 4PJDB 3TS8A 1S7SA 3TT1L 1YEDA 2YWYA 3AITA 5F1IA 1RZPA 1U8HB 1EHLH 4X50A 2KL6A 1XGUB 1JPFA 4XI5D 2IH1A 3CHOA 1DBKH 5I5MA 4KXZH 3ESPA 2WJ7A 5D1XD 2UYLB 3DX0A 1KTCA 4ZD3H 2VGLM 4QXTA 3SE8H 3D39B 4FQCH 1NMAH 1V10A 3WFCL 3L9BA 1ZS8A 2VZTA 5HI4C 1GS7A 5IKCB 1B9ZA 3LEVH 2CNYA 3DDFA 2D3VA 1XTMA 4P5TD 5EBWB 3D05A 1DHKA 2ZWKA 1D3CA 2APFA 3W11D 5FKPA 4QCIA 3K46A 2ICCA 1AQHA 1XWVA 5F89B 4EZMA 1VFMA 1BQLL 2CHWA 1RK7A 2WO4A 4HBCL 4LRNH 4PJHE 2HPOA 1LDSA 2JIXB 3PRZA 4H88L 3KXFA 4NNPH 5JPMC 5JLZB 1J1XL 1SJHB 4YXKL 4XNMA 3KW7A 3UTTB 1GA2A 3ZE1B 1OTUD 2OSWA 4BH7A 1HYSD 4ADIA 1K85A 4JFDD 3J07A 4HCRH 5J7CC 1AR2A 4PJGA 1Y1UA 4TUJB 4X7CC 1XR8A 1SM3L 3V4LA 5BOJA 3KD4A 3SDAC 2HT2C 1E4XH 2HFGL 1TR7A 4U1SB 1DBBH 1MUJA 1TJHL 4X80L 3A6BL 1BX2A 1QI5A 4PRNA 2XX0A 4MJIA 1FGNL 1VJSA 3ULUD 3VGEA 4UM9A 2D3NA 4QRUB 5T8IA 3TOPA 5IVXB 2JCWA 2ZAIA 2AK4A 5DD6B 5EPMB 4QRRA 3HC2A 3NEEA 5LNEA 3GHPA 4N0UA 2DH3A 4FHBD 4L4VB 5HHVH 4CADB 3LKRB 5F0LB 1FYTA 1HSAB 2AJZB 1CXHA 1F4WL 4EJ1C 1I9IL 3TO2A 2AXGB 2EILB 5CN1A 4WI5A 1CFTA 4NB7A 3U46B 1X5HA 2OXHA 1QUNB 4I9XA 5KVFE 3IDMA 2F8XC 1OV8A 3GXTA 1JL8A 1D9KA 5FYKL 4PJ6A 5AD0A 3QQDB 1U8KB 3ETTA 5D5MF 1ES0A 1HEZA 4N90E 2H47C 4OQTL 1VB9A 1Q72H 3QNZA 4AXWA 1F1DA 4JFQA 2BVOB 3TO4A 1A9EB 3HUJF 3H8NA 5AQ0A 1TJIL 4P2YA 2G5BB 4GAYB 1T66C 1PZ3A 4NI3A 5JMOC 1SHXA 1ZSHA 1MFVA 4ABUA 3IAPA 3UTQB 4ZUWB 1RVFL 3HZMB 2IC2A 4NO0D 2DQGL 3IETA 4UDUA 3WLWC 4LAQL 1NKGA 4WGVB 1PFCA 1GZPB 3CWGA 4OGXL 1KEMH 4L8BB 1NIAA 3P2DA 1CZ8H 1MAJA 4YHPB 2IOMA 2A99A 3ARUA 3UO1L 2WN2A 3GM0A 4R97B 1TITA 2R2BA 4NQDD 2V4LA 5E00A 3HI5L 1A2YA 3BP5A 3HN3A 1KCWA 3HI1A 2Y7LA 3GSQA 4QGTA 5EC1B 2ATKA 1C7TA 4J8RA 3MXVL 3ARRA 4PJDA 4MHHG 4NXSA 1U8HA 4KXCA 4PG2C 4PY8J 1A7QL 1P84K 2XTSA 4PQXA 5IJBC 1XGUA 2IGTA 3J7HA 4Z7AA 3AWEA 3CUPB 1XR9B 3DTXB 4DHLA 5H37H 2UYLA 2R2CA 1FNAA 4B97A 1E4KA 2D7TL 4NN7B 4TL4A 3D39A 5IT2L 3NSFA 2NYYD 4LOUD 1BA9A 1KV3A 2VLRB 4O2FA 5IKCA 2DLHA 3LQAC 4JG0H 4ZQTA 1D7BA 1P2CB 1T2XA 4W70A 2E0PA 3L5HA 1NCJA 1NCAL 3QFJD 3MV8B 1MFMA 1P1ZB 4HWBA 4QAMB 4IBWA 2KC0A 5EZIH 5MP6L 4PWIA 1CGUA 1VESA 2XIBA 4HSCX 2CK2A 2Y7MA 4J3BA 3DLQR 4XN5A 2H0FA 2P42B 3A6CL 3GFUA 4YHYC 5JLZA 4J7RA 1F8TH 1YDPB 4LIQL 1IAMA 4KK8C 2IH3A 5AYTA 3UTTA 1OQXA 1LWJA 3APDA 4LSTH 2XFGB 3WAJA 4MHHI 4R7LA 2V5YA 1CGYA 1RZFL 4HJJH 3PXHA 2Q7NA 1AIFA 1EFQA 1PU0A 3FUHA 4U1SA 4U6HA 2FHCA 4Z3JA 3D69B 1A02N 2J1YA 2Y7QB 3IJ7A 3SGKC 2Y5EA 4QRUA 1Y18B 4TQ8A 1MIEH 5DD6A 3SDDD 1MPAL 3PP3K 2NNAB 3FSVA 5EPMA 1XD0A 3IVKB 4LVEA 3UZVA 4DN3H 2JV6A 4RDQF 4L4VA 3LKRA 4KHXL 4UOQA 1NEPA 2AJZA 1OAKH 2AEPL 3MRCA 4B9YA 2AXGA 3QDMB 1KGWA 2QSCL 4XOAA 1FZKA 1B3JA 3MJ6A 4P4KC 1QUNA 3U46A 3FC8A 1COBA 3QEQB 1A6UL 1AKJD 3HAEH 1Q0EA 2H26B 5KZCB 4TVPE 3QQDA 1U8KA 4K94C 1QR1B 1JN6A 2Z7ZA 5FYJD 3AG1B 2NY5C 3VDAA 4YXLH 1ZLSH 1T6VN 1LNUB 4NWUH 2P9RA 5AYUH 4CKQA 4F7EB 3C5ZA 5JMRA 4BXSV 5ESAA 1FVCA 1HESA 1L0YA 1SOSA 4OKVB 1A9EA 1O9ZA 2XQ0A 1SEBB 3EH2A 4H8WH 4XWOD 1OWRM 4U6YB 4FERA 2PO6D 2G5BA 4GAYA 5GSRA 3MUHL 4QEGA 3FQ2A 4UTCA 4RX4D 4K2UH 2K4WA 3UTQA 4ZUWA 5TQ2L 4FP8L 4NRYB 2VH5H 4M1GH 3HZMA 2N01B 5I9QC 3EUUA 3IFPB 2F5AL 4PVMA 1GZPA 1AQ8A 3FQUB 2BIMA 1OAYL 1TQCB 1JJUA 2JTYA 4YHPA 3MLYL 3UBXG 4CUCA 1P84J 2D31B 3MRKB 1BVZA 5GPRA 4L4JA 4M62H 4Q97A 1EEQA 3SKOB 2B1AH 2NDFA 3MNMA 4JCWA 3CFKA 2BS9A 3TPKA 3UYRL 4WF7A 1JGLL 1LP9E 2NZ9C 4MAYC 3EYVB 1O6SA 3GSOA 2E9WA 3RVXD 1NMCC 2CBTA 2D3LA 2NMSA 3EJUA 4XP9H 1G6RH 1MELA 3CUPA 1XR9A 1ODAA 4QTHA 2MIZA 2P5WD 2I5YH 3F5WB 2BCMA 2OJ1A 4KXBA 5D72H 4LGSB 1LK3L 2Z1PA 5I71C 1PX4A 5F8QC 2VLRA 4J6RL 4M6OL 2CGRL 1NIBA 4ELMF 2XN2A 2Q1EA 5T1LD 1OGAB 5F9DC 3D4YA 4G83A 1OPGL 3WDHA 4APQC 2WXOA 3GUTB 3UBXI 1UACH 2WUCH 5E03A 5FOJA 1HQRA 2BHUA 3QIWA 4U1MA 2ZNXA 1NBYA 4OV5A 2FWOA 3JV6B 4FL4C 1E5YA 1FAIH 5EWIL 1YDPA 2K7QA 4Y4KB 1MCBA 4GRWF 3UZEA 4D2NA 4XP4L 3FQRB 2X1PA 3ABKB 5DZPA 4DOHB 1I8IB 4X9BA 3GBDA 4MCZB 2BZCA 2G0KA 2H2SC 4JW3A 1ILUA 2WP3T 1WFUA 3R8QA 2JCCF 1RP9A 4G3YH 1EJ8A 3D69A 3BRDA 4FYQA 4IRJD 5JR1L 1L9NA 1NBVH 4K0OA 2NXZD 1Q94B 5I1GH 4LSRH 4X7FC 3GLAA 3BJ91 1JFHA 3QI9A 1Y18A 4XVOA 2XA3A 5E9DD 1ETB1 1QFWH 4HPYL 3TCTA 3DK0A 2VNCA 3LNGA 1UA7A 4WSJA 1FH5H 1QBLL 3CZJA 1JI2A 2ODIA 4AW7A 2B5IB 1OTSC 2NY4B 4MXQC 5C0CB 4RESB 3BE1L 4XX5A 5FKAB 1NIDA 3G5ZB 4RMUA 2QPUA 3QEQA 2EDTA 5T33H 1BV8A 3E7JA 2XKSA 4IK7A 2YAEA 4G43A 5HDWA 3ZKMC 1MCFA 1WVZA 1YJDC 3OLDA 2VRAA 3OXRB 1QR1A 5EU4B 4I77H 12E8H 1ZT7B 3BWSA 5KVDH 1L0XA 4C55A 2APWA 1LNUA 5DEZA 4NCC1 1BAFL 1K72A 5EBLA 1DSWA 4F7EA 3NCMA 2ITDB 2BNRB 3ARBC 2PCPB 4YDKH 1BXUA 3VD1A 4B9IA 2YD9A 1SEBA 4P2QD 4GLRI 4JREC 5A7BA 2B2XH 1X5MA 1LEIB 2WW8A 5E1AB 4H8UA 2WLNA 4FD0A 1YNKL 2X7LB 4NRYA 2VDOH 4X4ZA 2X44D 3BVVA 2O26U 5B21A 2UV3A 3D7PA 3IFPA 3LH2L 2IPUK 2ZIDA 3FQUA 4DFHA 1CQKA 3K6OA 4MJ2A 3S35L 4F15C 2Q9OA 5D8JH 1EEYB 4MNQD 5GJTH 2MPVA 4ABQA 2YPLE 5GZOA 5J06A 4JRXA 1OY3B 1U3HD 1TJGH 5MEOB 5DHDA 2BSBA 2JJVA 3OR7A 2EDXA 4GSQA 1CVSC 2MOQA 4PTTB 4WWKC 4OJYA 5LAPA 1DQTA 1PG7H 4LVOB 3F7VB 3EHBD 1RIHL 2IALA 4OVVA 2WXFA 1GKOA 2BSDA 2D7PA 2TSAA 1PG7X 2IBZY 1NCHA 1BQHG 3W2DH 2GHZA 3FB5B 3F5WA 4BFBD 4LSQH 1OSPH 1MHEB 4AVJA 4X5XB 3QS2A 3TASA 1KFAL 1QLFB 3C60D 3VNYA 3OJVC 3T09A 1OAXL 1BIHA 5DI8B 4Z7UB 4BZ2A 4P5MA 4UINL 2YRPA 3HAEB 4F8TA 1WA1X 4GSDL 3UIYA 4UV4L 5DGQA 1TO5A 5L4JA 1KCUL 2A38A 1Z3GH 5I0ZA 1LK2A 2MOVA 4TSBH 1EHLL 4M9PA 3ZTJH 3GS4A 3T0DA 3AREB 4PMFA 1KNOB 1DBKL 3JV6A 2ZUWA 4PJCF 2DAVA 1F45A 4Y4KA 1OB1A 3OJDA 3SE8L 4FQCL 4MRCA 1NMAL 3MNDA 3ES6B 3NIFB 4HD9A 4OF0A 2CGZA 3I3DA 2Z92B 5E6YA 3LEVL 1I8IA 4MCZA 2YD5A 1VACB 3HE7B 3SDXB 4DEWA 1URIA 4LLUB 4LASH 3PG2A 4PRPE 2EIJB 2FEJA 3ZE2B 4XPFH 1Z5YD 1J9SA 1MI5E 2IDQA 1VENA 3WIAA 4Z23A 5JW3H 2A0LD 1BJMA 2H0EA 3U9PL 5F1NB 5FGCB 4LRNL 4XODA 4GYBA 1J10A 1KJ3H 2W60B 4HMEA 2YBRB 4XNZC 2R2HB 4NNPL 4U1GB 5KS9B 1WLHA 3TH4T 1UH2A 1YMHB 2JWYA 2GVYA 3T6XA 4ZUUB 4DH2A 1UJ3A 4HCRL 5IBUB 2YPVH 4V1DE 4NZJA 4OF7A 2Q7AA 1E4XL 2D2OA 1U8IB 2EH8H 2VUKA 3QWQB 3EOTH 5FKAA 1DBBL 2NNCA 1S6NA 2YGVA 2E27H 1LQSR 3MUY1 4Z7WE 1VERA 4OFKA 3MTRA 5I0XA 2W1NA 3DVGB 4NQXB 3OXRA 1NCDH 1PG7W 4K9EC 2XT1B 3D06A 1QSFD 3EYFB 4GRLD 1ZT7A 4GG6B 2EVGA 1HE7A 1P7QD 4JFFD 2G2RB 3TT3L 3QK0A 4Y2DD 4LLWB 3AB0C 2YSSB 5HHVL 1KWGA 2AHIA 4OZFA 1RZ8B 2ITDA 4IK6A 4JDTH 4K94H 1E90A 2AP2A 3WNNA 3OKOA 2NY5H 3BLKA 4XCNA 1QBAA 2C7UA 1LEIA 1U95B 3BP4B 3GSWB 3Q2VA 5E1AA 3AABA 1HWHB 3W9EA 1JNJA 3VI3F 4BZ2L 2X7LA 2V9RA 4CAGA 1I3GH 4GP4B 3B8SA 1BDYA 4WDIA 1JXKA 1H3UA 3M86A 1SMDA 1GGUA 5BZXA 4P8QA 1CYXA 2YR3A 3TA3D 5FV2A 1EEYA 1G4MA 5JPMB 4HFWA 3EZJB 2F15A 5IK3B 4K8RH 4WJKB 5D4JA 1J9RA 3VGBA 2OMBA 3CFMA 2CR6A 2Z31B 2AFNA 2JF1A 4OIAA 4GEIA 4ABVA 4NKQB 1U91A 3SDAB 4ES9A 3LX9A 2XN9B 2ZKYA 3D33A 3T4YB 4FFYH 5JW4R 3KPPB 1TVDA 3S7GA 3ULVF 3VFUA 3F7VA 2PW1B 4WAFA 5L0QB 5ISZE 2EDFA 1KTKE 3PAUA 1GJWA 4LSSH 7PCYA 4G9FB 1WC7B 5A2BA 1KEML 5TGBB 4ZDHA 3S3JA 4HK3J 1JRHI 1DVQA 4X5XA 1G1YA 2FGZA 5C0RL 1TETL 2ZX6A 4JM2D 5LKNA 1QLFA 3ARFC 1HTYA 3ALPA 3JV0A 5DI8A 3QHZL 3KLDA 2J44A 3VFSB 4P57B 3WNKA 1O6TA 2VZSA 3D2TA 2H3NB 4M8QA 4Q14A 2Y2TA 1Z9PA 1TQBC 4ACTA 2VXUH 2XIIA 2GUYA 2LE9A 3AVEA 3RWIB 1JZ5A 1U2YA 2R1XA 2PYEE 2VLJD 1KNOA 2VW7A 3AREA 4D0BB 4JKMA 2A9DA 4GINA 2YD2A 3MLXL 2XWRA 3N1QC 5BV7C 4F3FB 3QC6X 3ZKQD 4RZCB 1PJWA 5C0BE 3ES6A 2ZCLH 4HXAH 5EOTA 3H3KA 2K8MA 3RZWA 2IQ9H 4MGXA 4JG0L 5BRZD 1EZSA 3K72B 3N42F 5EG6C 1MRDH 3CVHH 3T2OA 1VACA 4JVWA 5JXAH 2ZSWB 3QWOA 4M7ZC 4U1IB 5IV2A 2X0UA 4F2EA 1KGJA 5F1NA 5EZIL 3R19A 4XBEL 4MXVF 3E38A 2W60A 2KT6A 4J27A 5FW7A 2YBRA 2LT9A 5AW8B 2R2HA 1X3DA 1F8TL 5KS9A 1DQDH 1REIA 3INUH 4Y9EA 5GHWH 4JCMA 1YMHA 4Y8DC 1KCLA 2Y6SC 4ZUUA 2WK2A 1WFOA 4KKLC 4HJIA 4HJJL 2E7LC 1U8IA 2NNXA 3T2PA 1IM9D 2NQ3A 3D3VE 4PRDA 2KPWA 2ITFA 3UGXA 4KK9D 1UOKA 3P4LA 3V5HB 5KVEH 4NQXA 5BW7C 1T6WA 1JOIA 4PIRF 3EYFA 5IW3A 1UD4A 2C5DC 4BV1A 2W88A 1N5AB 2G2RA 5E6ID 1P7BA 2ZP9A 4DN3L 1YJDH 2YSSA 3CSPA 4Z7VF 1RZ8A 3CX5K 3QIUD 5D2NC 5BO1L 2IQAB 1OAKL 4AL8H 1X5ZA 3D25B 2FEEL 3LNHA 2L4OA 5KYYB 5FECB 1E4JA 4H25A 1U95A 4QXUH 3LVTA 4F1ZA 3UYOD 3QDAA 5IROD 4PGZA 4GW1B 2NY2D 4EQ3A 1OARH 4KJPC 2FQFA 5IJDC 1MW3A 3MLSH 1CTOA 4N5ED 4AGMA 3IKCA 4GNKB 1JHTB 2FECI 1R6VA 4YHYB 4YXLL 1ZLSL 3OLGA 1DVUA 5IW1A 3EF7A 3FQYA 2FBOJ 4BDVB 1DJGA 4NWUL 2ENPA 5AYUL 5IK3A 3TH2T 1NC4D 5IHBA 1EV2E 1CXFA 2MNJB 3CFEB 5D7JD 3E3QC 4CJ0A 2K6ZA 4H8WL 4HIPA 5GIRA 4BA0A 4WI7A 5FF6B 4JR9H 1PZCA 4FJ6A 4YDZA 3VI4F 2XN9A 2P5EE 4K2UL 4Z0XB 5EORH 3KPNB 3V4UH 5A2IH 2VH5L 5CKGA 4RDBA 2PW1A 1F3DH 1RZGB 4OBSA 3BXNB 2OW7A 1VLXA 2ROYA 3VE0B 1WC7A 1W0VA 3C8HA 4MB5A 4NKIH 5TGBA 2AEOA 4L3FA 4M43H 3SBWC 4U0RC 2VDQB 3TYGH 5I6XB 1UZ6E 5E8DH 3D0LA 4G8GB 4ODHH 4HV8B 4M62L 5CD3B 2BWDA 2B1AL 3QUYC 3VFSA 4CN4A 4ZO9A 5HHMD 3ZDYE 2PR4H 3JWDH 4LO9A 5HJ3B 5KUKA 3ML9A 3OL2A 1WD8A 4BFIA 3RWIA 4QT5B 4BM7A 3FUMA 3K6SB 3L16A 4XP9L 4LMQI 4JO2H 4D0BA 1UD2A 1KCSH 5G4OA 2XACC 2CZNA 3OF6A 4LT7A 4UQEA 4E36A 1BVNP 3MBXH 3MJ8B 4PRIB 4ELDA 2I5YL 5IEKB 5L7XH 4HMCA 4X9YA 5D72L 3FB6B 5T5FH 2CJUH 2KH2B 3NSJA 4JRYD 4EAEA 4JO1L 4MD4B 3VXPB 3DJZA 4HMDA 5D4HA 5SX4H 5L9DH 3K72A 2XFXB 3GLDA 1C8QA 3KPTA 3OMNB 3PDDA 3TBTB 3IPEA 4MMZC 5DK2B 1JDAA 1DBMH 2J55A 3R1GL 3NFPB 4DN4H 1ZVSB 43CAB 4U1IA 1IGCH 2AMGA 2X28A 1HHJB 1AO7E 3BAWA 1JGEB 1UACL 3MLZH 3PUCA 3TEZA 2VMDA 1KXQE 3ARTA 2WIIB 3PHAA 1FNLA 35C8H 3LSOA 5I9QB 1IAIH 3NCJH 2YKKA 1I1FA 1FAIL 2EAEA 1F5WA 2F53A 1EWHA 5E1QA 3WNIA 3FQWB 1PKOA 4MFHA 1G7IA 2GAZB 3KYNB 1JK8B 1BFTA 4DESA 3DRQA 5KSBB 4R96B 2GKIA 3K6FA 3PXJA 5DDHA 4NZRH 4ZMXA 5JIDA 4BSJA 3HG3A 4G3YL 3CX5J 1NBVL 5DO2C 3TWCH 3N44F 5DJ0B 4FG6D 5I1GL 4MAYB 4LSRL 5HDBB 3V5HA 3ZBMA 1NMCB 2L3BA 2ZTBA 2JE8A 3ULVC 2Y2WA 2X9YA 2DWTA 5CN2A 2DL9A 3QEGH 4QRPB 1QFWL 1N5AA 3W9DA 4YHLH 3E80A 3VXRB 4ODWB 2L7UA 4IKNA 3P54A 3BD5A 1FH5L 5I71B 1FWXA 2IQAA 2H6PA 5IQ9B 3D25A 2NX5D 1BAWA 2QQKH 5KYYA 3V9FA 1TCRB 4PGBB 5DO8A 5E9NA 3A23A 4YE4H 5D1XC 5KG9B 3MO1B 2WINB 4GW1A 1ADWA 4TSCH 5T33L 3HVDA 2DM3A 2QTVA 3GC3A 3BZEB 4PUBH 2IVFC 4ZMYA 4BWUA 3B83A 3PWLB 2CLZB 4I77L 12E8L 5KVDL 1W15A 3NIDE 3W11C 5I0WA 5L2KE 4XOCA 1ITCA 3FCTB 1JHTA 1NPNA 3CVHB 4FL4B 2VERN 1U8CA 1ZEAH 2XPYA 3F04A 5DRNB 4BDVA 1DDHB 1CXLA 1W6WA 2H2PD 3LY6A 3CFEA 1I7ZB 1EMTH 2RR3A 5CLZA 3B9VA 4YDKL 4XMZA 5DZ9A 4PJAF 3ZHFA 2AQPA 4F33B 5FF6A 2FR4B 4QKTA 4AW4A 4X5RA 2B2XL 3Q1SH 1X5IA 1T89C 3QXDB 3X1NA 2DQUH 4X6CF 4Z0XA 3MCLH 3NCBB 3KPNA 1OTUC 1HYSC 2H7WA 2VDOL 3MYZA 3GBMH 2ZX7A 4WTQA 1RZGA 2BOCB 3SGKA 2CJSA 3BXNA 3F7LA 3VE0A 1KJMB 2F61A 2VT0A 1WFJA 1DJXA 2YPVA 2W94A 1RHFA 4ZQKB 4S2SA 5D8JL 4UBDC 5IBLC 3A24A 4Z7QF 2A4ZA 3U4AA 5GJTL 2W9LA 4BELD 1OCWH 3B2XA 4G8GA 4UZGA 4YHIA 2ZXDA 3ULUC 1TJGL 5CD3A 2XZCH 1CWVA 4FTVD 4CVUA 4XT1C 3MV9E 1OPOA 4RAHA 1BPVA 2FATH 4OGYH 3S5ZA 5IIEA 5DJDB 1WIPA 4P4KA 1MCCA 2X4OB 3PV6B 1PY9A 1PG7L 3X3FH 3KPRE 1U8OB 1Z9MA 3TX4A 4QT5A 4L4TA 3K6SA 2BDNL 2M2DA 1EZVX 1HHKB 3ZDXF 3KLQA 5TDOB 2BCKA 4NO5B 3QJQB 4JPQA 3W2DL 4PRIA 1SN5A 4N2MA 5IEKA 3UZQA 3EGXB 4LSQL 1OSPL 2DICA 4HCGA 5I6MA 3P77B 4QYOA 3QYNA 3VXPA 5IW6B 3BKMH 1P5UC 1E5AA 5IY5B 4KUCD 4TLSA 3HR6A 1KN2L 1JNLH 2XFXA 3ARBB 1HL8A 5BV7H 4R7DA 5HY9B 1DVFD 2G5UA 4N68A 5I28A 1ZVSA 2Y36L 43CAA 2WBKA 1Z3GL 4B41A 3BH4A 1TQVA 1HHJA 3WUWB 1JGEA 1U6AH 3LQAL 1ID5I 5ESQB 3S2AA 3F7PC 3O3BA 3FYIB 1HT6A 5DFWH 4R5XA 5A2KH 1IC5H 2QEJA 4PW3A 5JIMA 3PLYA 2MKWA 1OE2A 2VM3A 2B59B 1JDDA 5BVJA 3FQWA 3FZUD 3VXNB 4F15B 2VLME 3KYNA 4WW2F 3FT0A 4AQOA 3NTCH 3ZQXA 1CMOA 2HB0A 1UURA 2NRDA 1JPST 3VFWB 1DANT 4FFYA 3TVMC 2WQSA 3HNVH 4AGOA 4LBAA 3CZFA 4JFEE 3MC0A 1BBDH 4LASL 1E42A 1T03H 3LYRA 3NZHH 3EO9H 4JPVL 4XPFL 3RQ3A 4AUYA 5JW3L 4WWKB 1ZOXA 5DJ0A 4KFMA 1NANI 3BWZA 4A7UA 4MAYA 1MRFH 5AB2A 4JHWH 2WGXA 1KJ3L 4A38A 5HYJE 5IOKA 3WN5C 2ZG3A 3M1CA 2FLBT 2GSMB 1KYUA 3M07A 4ODWA 1FVDB 1UEMA 4HUCA 2Y1AA 4GXUN 2YPVL 4Y1SA 1WTLA 5IQ9A 4CA4A 2ENYA 25C8H 4KVNL 4YFDB 2IGLA 2XN1A 2DS4A 2EH8L 2KZBA 4AC2A 3EOTL 3T0BA 2B16A 5SWZA 3RWFB 3MO1A 5KG9A 2E27L 1IC7H 4Z7NE 4ANVA 3O6FD 4APQA 1IBGH 5CU9A 1BCIA 1NFKA 5T3ZH 1MF2H 3BZEA 3R7RA 3NK4A 1Q0YH 2GBAA 3TEXA 3OG4B 3PWLA 2CLZA 1XBDA 3STZB 5ESVA 2A74C 3CVHA 4M1CD 3CH1B 5F3FA 4ETYA 1AQMA 5DRNA 5D5MA 5GRVL 2CDEB 3LXUX 4K94L 4JDTL 4YHKH 2CBMA 1I7ZA 1UH3A 3EADA 3QHTC 5LQBL 3SJVE 1PZ5B 2NY5L 3MV11 2YZ1A 1N2RB 3QXDA 3LH8A 1SQMA 5E1IA 4BUHA 3I6KB 1I3GL 3U82B 4G59C 3CHRA 4D9LH 3CHPA 5KBNC 1KJMA 3WO3B 4G8AC 3UGUA 1FPTH 2ESVD 3UJTH 1WA0X 4XNZB 5CLTA 1LWHA 4ZQKA 4HG4J 1E5UI 3O81A 2J6EA 2AF2A 5D4IA 4K8RL 2IF7A 8PAZA 3N41F 3QFDA 5CXPA 3DX2A 3VFTB 3IS1X 3MRBB 3EJYD 4IKJA 3SDDC 4NUPA 2BP8B 2XUWA 3IMBA 2I32A 5EA0H 2ZF9A 1YPZF 4N24A 4IGBD 4ATWA 2X4OA 5JQ6L 4FFYL 3QJVB 4K9JA 3U4EA 4PSPA 4GBXC 4HXBH 4BK4A 2NUTB 2LU7A 4ORGB 4YXHL 1HHKA 1HSBA 1TPXC 2XKUA 2W65B 5TDOA 4JANB 1K2DA 4NO5A 1KDIA 4J6IA 4PH8A 3O3UN 4U1JA 1AJ7H 2ADJA 3AXIA 3EGXA 4MMXC 4DAGH 3P77A 4WI0B 2ZCZA 4DVBA 5CEZH 1UXMA 4FQJH 3ARBA 1I8MA 5G5DB 5HY9A 1S9YB 4PJ7B 3WV0A 1NGXB 2Z93A 3RWEB 5DC0A 1YA5A 3CZUB 5ENWB 4RFNC 4B9ZA 1SHSA 3WUWA 4F5CA 2VXUL 5FWRA 5ESQA 1KMGA 1CU4H 3ZOAA 1BD2B 5KEZA 5F7DA 4M8VA 5F0MB 2XYBA 4WSKA 4XWOC 2PO6C 2X40A 3UERA 1R47A 4JQIH 2LU4A 2O6FA 4G6JH 3FN0L 4H26B 2MH4A 3VXNA 4HXAL 2F9BT 5GQBA 1GY1A 4XH2B 2BP5M 2IQ9L 5AW0B 3HG5A 1JK9B 2VE6A 1MRDL 3CVHL 5JXAL 2YQ3A 2VR9A 4LCCC 1QW8A 1SXBA 2ZOKB 4WWKA 3VMPA 2TRHA 4YZFE 2GPZA 1QSEA 1U8LB 1D2OA 1UOLA 2ZSVB 1ADQH 2XNAA 3ECWA 3DX4A 2BC4B 2OZ4H 3QWRD 3MNVB 4N2BA 7PAZA 1DQIA 5GJSH 4AK1A 1DQDL 3INUL 5GHWL 1XB3A 2R0KL 5HYEA 1TLKA 4FQLH 3UTPD 3RVXC 3NEXA 1M7IB 4CDHA 1UFUA 1INQA 1IKFH 3ARFB 4FTDA 4B3EA 1K4CB 5C09E 1M53A 2BP3A 3R18A 2MQ3A 1A3ZA 1FNHA 1CICD 5FWQA 1OSEA 1CD0A 4KHTH 3RWFA 3O3DA 3DX8B 3FO0H 1PLBA 4F37F 4U33A 3GTVA 1TQBB 5DRZB 5KVEL 4Q4EA 1ETZB 1VSCA 3LZLA 1IMHC 3VUAA 3MHZA 5CKAA 1F1GA 4HHWA 1IU1A 3STZA 1G9HA 3AM8C 5CJBA 5BV7B 1LMKA 3X1FA 5EN2B 3CH1A 1YJDL 3AT8A 1SBSH 2CDEA 3KJ6L 5B39B 5MENA 5IGXL 5AUMA 3JXAA 1PZ5A 4MDJB 3LZOA 5DCCA 1SZNA 1AMYA 1N2RA 2B39A 3V7MA 4QXUL 5D7IB 4MD5B 4EN3A 4ZFFA 1YNTF 3MRIB 2VMCA 1OARL 3I6KA 4NQED 4HGWB 5GRVK 4MQXD 3LTVA 3MLSL 3SPVB 4Y5VA 5D96C 2DLFH 5F1KC 1L0PA 1CPUA 1DVZA 3H9SA 3OC5A 2NXZC 5FYKE 1A1MA 3BSHA 4OLWH 5BZWB 1ULVA 2G60H 2OMTB 4WW2C 3VFTA 3MRBA 2QVIA 4JR9L 1ZCRA 2A4EA 4PBWD 3CZKA 2BP8A 5TF0A 2GEQA 2EXWD 1O7DC 2C3HA 4LFHG 2ZUUA 5EORL 3FCSB 1EAJA 2B4CH 3L7FA 4XN4A 3N2JA 5D7EA 3Q1EA 4JHVA 2NUTA 2R56H 4ORGA 1NLDH 5CCJA 3O41A 5JDJA 1JZ6A 4NKIL 1HH9B 2W65A 3NN8B 4JANA 4ODUB 4AJWA 5IMLB 4M43L 3TYGL 1OIOA 1VFBB 1XGTB 1QRND 4G70B 1IBHA 2JJTC 4WHTB 4Y2NA 2MRYA 2NTSP 5E8DL 1RZ7H 1WG3A 4ODHL 3MLRH 1CO1A 3KYOB 5G5DA 3GI8H 4I5BA 3ZQ9A 4PJ7A 1NGXA 3ARPA 3FTWA 2MTPA 2PR4L 2HG5B 2M8XA 3JWDL 4MSWB 3RWEA 4C56B 1HZLA 5ENWA 4XC1H 1PDKB 5I8CB 3D08A 1GGYA 1BD2A 1QLEH 3LCYA 2A9MH 1KCBA 2XY2A 4O2CB 5L88H 4A68A 4JO2L 3TBVA 1KCSL 4UDTA 3MBXL 2IAAC 1AP2B 4FMFA 2BM3A 3HVNA 5L7XL 4NNYB 5T5FL 4H26A 4S1DD 2CJUL 4GKLA 1B0IA 4XE0A 4KK6D 1GW6A 2J5WA 3EZ8A 4XH2A 5H8DA 5L9DL 2HFEB 4OBRA 4ELME 1JK9A 2IMMA 4IKIA 4UMSA 4OZGB 4YHNB 1HKFA 5DJ8B 3FFCD 3VG9C 2EO1A 4DN4L 2YD3A 1TYEB 5LLIC 1IGCL 2ZOKA 3MLTB 4LDEB 1XH0A 1PPIA 4D7BA 3MLZL 1DUZA 2E8YA 2IANB 1DE4B 1U8LA 1U3HC 2OMNA 4HUWB 4JKPL 2ZSVA 4WNJA 1A9VA 1RZKH 35C8L 2O6DA 3NCJL 4YPJA 2BC4A 3VXMD 3AW5A 4YE0A 1MIMH 2P7TB 2X4QB 4JHBA 2ZG1A 4OFYD 4XNQB 1KBWA 3A47A 2VC2H 4U0RB 2XV3A 4X7EC 3EHBC 3PAVA 1M7IA 3FOMB 1C12B 3ARFA 1YMMD 1PZSA 1K4CA 3VRLE 3QG6B 5T1KD 3QUYB 4NZRL 1M71A 1IQDB 3TWYA 2FJFB 4E9VA 4LIQE 2VLKB 3DX8A 4J3TA 3N04A 5GGSY 3TWCL 4YDIH 1WEJH 3AS1A 2YD6A 1DLFL 4KZDH 3BD4A 4I1RA 1P4IH 3BAEH 1ETZA 3NK3A 2HLFD 2GK2A 3NOIA 4FXTA 4LEXH 1M3IA 3QEGL 1T22B 3WMPA 3T0EB 4YHLL 1WS7A 2WAHA 1BECA 5EN2A 1AXSA 5SV3A 5I1DA 3BIBX 4NNXB 3SKJH 3WDIA 5B39A 1KXVC 1MAMH 1VKXB 4MDJA 1N0XL 1JGDA 1N64H 3ZPDA 5BOPA 2QQKL 1FRGH 2XTLA 2X12A 1U2CA 4PRHB 4OCMC 4MMZB 1FVEA 5CUSH 4YE4L 4MD5A 5D7IA 3IWUA 3QSKB 3VB9A 4HULB 2FD6H 4FI8A 3MRIA 3K7UA 4TSCL 4FA7B 3APMA 1EFXB 3QUMB 4DP5X 4LSUH 2CUHA 2WXLA 2JELL 4RWYH 5JYMA 3L1FA 3SPVA 2N1KA 4HT1H 1UCBH 2BOLA 5FX3A 4KZEH 3IBOA 1FN4A 5ACZA 1X5AA 3Q7JA 1SJVA 1ZEAL 2ALWA 5F6HJ 2Z9TA 5BZWA 2DOCA 2LLLA 4E9SA 5FO2A 2OMTA 5TDPB 2L7EA 4PS8A 2E7LA 1U8QA 3Q1SL 4HALA 3L4XA 4PJDE 2I07A 1UT9A 2DQUL 4M5TA 3E8UH 3MCLL 4G5ZH 3GBML 1WZMA 5I76B 4XXWC 4NO2B 5BW7A 5HGBA 1HH9A 1CUOA 4ODUA 3D39E 3I84A 2WWKT 2R27A 5IMLA 3ZDZF 3F12A 3FK3A 1VFBA 4I18C 5L8LB 2HJLB 1XGTA 2UUDH 3AT9A 4WHTA 3IDNB 5AVUB 1OCWL 2J1WA 3FN9A 1AGBB 4OZIF 3V4VH 4ECNA 3KYOA 5D2NA 3K91A 3Q44A 3LXBA 4GRLC 5J3HD 1RXLA 3CN4A 4C56A 4MSWA 1JGUH 4OGYL 1SHMA 4Y2DC 5D1XB 1PDKA 5I8CA 2Y25A 3X3FL 1VFOA 4O2CA 2AQQA 1WZ1H 4U0QB 4P5TB 3B7SA 4R4FH 1CURA 1X5KA 1BREA 3UTTE 3ZE1E 1AP2A 4N8VA 5KOVC 4R4BB 4NNYA 5I30H 4M5ZH 1FFQA 1SXAA 4WNQB 3VSUA 2AERT 3BWUC 3BKML 4YAQA 1IBBA 2HFEA 4PJCA 1N59B 4E41E 1RJYB 4OZGA 4YHNA 5BV7L 2CDGB 5DJ8A 1P1VA 1SJEB 4I1NB 1EDYA 4N2CA 4DZ8A 2CBQA 2AQ3A 3LNIA 3RL2B 3TA3C 3MLTA 1U4FA 5IVXE 4I85A 3B7TA 4GLRH 5H35A 4KC3B 3MJ7A 4TQPA 2IANA 4HUWA 2J2ZB 4OD2B 1KB3A 4JFDB 2F0CA 1A1OB 2WUBH 2OKMA 4MXWH 2BVUA 2XBDA 3IDUA 1A25A 3PNWB 4L4VE 2P7TA 2X4QA 3PFQA 3FQTB 4XNQA 2D03H 2HLAB 1Y07A 2FSEB 2LU5A 4PV8B 2FLMA 4CVZB 2H6UA 2WIMA 3NTCL 4KH2A 1EZLA 4PS4L 1YVLA 3DX7B 1C12A 3FOMA 4GPVA 4NZUH 4QF1A 3HNVL 4N26A 1R3LB 1BBDL 3CK0H 3QG6A 3BVUA 3QUYA 1T03L 1F18A 1H8LA 1IQDA 3EO9L 2FJFA 3NZHL 4L37A 3RPIA 5DVKA 2R23A 1I7UB 2G3XA 2VLKA 1QPKA 3QZPA 3D34A 3NSDA 4L05A 5CWSB 1I75A 1JVOA 1MRFL 3U7AA 4JM2C 4JHWL 4WK2B 5H2BB 2F74B 3ME0B 5AAPA 3FW6A 5I8KL 3WOVA 1OP3H 2DJSA 4F93B 1T22A 2LFEA 2OMYB 5ADOH 3GKZA 3OHXC 4I9WE 3EDJA 4UCFA 5AW1B 3HB3D 4NNXA 4DPCX 1HIML 2CR0A 3Q06A 5LCVH 1DUYB 1P5UB 3V4PH 25C8L 2HRPH 2QKSA 3FQNB 3KGTA 1KG0B 1QLEB 3EKCA 3VWKD 2Q20A 4YHMH 4PRHA 1IGIH 4MMZA 2R59A 1IFRA 2VISA 4AL8C 2BVYA 1IC7L 1UB5B 1CS6A 1MAKA 4ZJ9A 3TL5A 1IBGL 4JQIA 3QUMA 4QJ5B 5DQ9B 2LFGA 1MF2L 3JYCA 5T3ZL 1LXMA 4UYPA 5EUOF 4E42B 4OCWH 2WHVA 1E9QB 1RUKH 1XGYH 3KPSD 2YFOA 2P46B 2ZXAA 3TBSB 3LHAA 2HRHA 3PXLA 1D2PA 3WJLA 1HFUA 2V9TA 3AQYA 2PTTB 3K81A 2FO4A 4YHKL 5FFLA 3SKMA 1NBQA 1A66A 3MUGB 1RV6X 4NO0B 5TDPA 4OCNC 3FSOA 1OGPA 2K0RA 2CG9X 4L3EE 2OZ4A 3UO8B 2QADD 3VI3E 2X4RB 1S9KC 3KM1A 2X42A 4PW4A 5DHMC 4NQDB 3V5KB 4G6KL 4NO2A 4M8RA 5MEPB 5ID0A 2Y6TE 4TN9A 4P4RB 1FPTL 3UJTL 3N55A 1S7QB 5DMIH 3KVPA 3OKEB 2HJLA 2XHNA 4H2AA 4W9CC 1S9XB 4L1SA 3IDNA 3DX6B 4FABH 4AY0A 1L7TL 3BIKA 5CJXC 4ISVB 3GXDA 3HEIB 2XTJC 2ERJC 3MV8E 1IJ9A 3SBRA 5EA0L 3U9WA 3X12A 1EGJH 1T0NB 3JVFC 4R90H 2DRUA 4X5PA 5E6IC 5EU7E 5D6CA 5D1XA 4ZO7A 1TQSA 5EO1B 3QIUC 4HXBL 2CH8A 1X4YA 4NEHB 4DETA 4NQTA 1BWWA 3MUUA 1YY9D 5I5JA 4NP9A 2OXGB 2ZONA 1AJ7L 5BPPA 1T1XB 4R4BA 4KKRA 5IROC 1F4YH 2HAZA 3VG0H 3VD2A 5FXCH 2NY2C 1RK1B 3F01A 3QFJB 4WNQA 2WKGA 5CEZL 1ZE3C 4M5SA 4M7LT 4NS0A 5SX5H 4FQJL 3X1EA 3V10A 1RJYA 4QHPA 2GUOA 2CDGA 1DJWA 4N5EC 3BZ5A 5CBAB 4F80A 5DXWA 1SJEA 2BSTB 4A2MA 4FULA 4ZW3A 3T1FB 5M95B 2P8PB 3UBXB 3RL2A 4HEPG 1T89A 1D5BB 5J5EA 2QPEB 3FF8A 4BCZA 3LQZB 4RMRA 1CU4L 2YD4A 5D7JC 2J2ZA 3II1A 1A3LH 4NZDA 4JFDA 4OD2A 3AADB 5BNXD 1A1OA 2Y24A 1VRSA 3SHSA 4Z76B 2G9KA 1OE3A