3BQVA

Crystal structure of the double mutant d44a d45a plastocyanin from phormidium laminosum
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
105
structure length
105
Chain Sequence
ETFTVKMGADSGLLQFEPANVTVHPGDTVKWVNNKLPPHNILFAAKQVPGASKELADKLSHSQLMFSPGESYEITFSSDFPAGTYTYYCAPHRGAGMVGKITVEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High resolution structures of plastocyanin from Phormidium laminosum and D44A, D45A double mutant
rcsb
molecule keywords Plastocyanin
source organism Phormidium laminosum
molecule tags Electron transport
total genus 22
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2007-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3bqvA00
1TKWA 3ABMB 2BP0A 4DP6X 2XWZA 2XVBA 4YSPA 1NIAA 2JKWA 4E9RA 1NDTA 1KYAA 3NSDA 2GIMA 4YSAA 1WS7A 2BZCA 1GR7A 2IAAC 2IWKA 1SNRA 1UATA 4GP5B 1BQ5A 2E86A 1BAWA 4YSCA 4Q8BA 1AAJA 3FSVA 1HAWA 2PP8A 4TXVB 1KBVA 2BW5A 4WTQA 2IH9A 1XMEB 1MDAA 4DP0X 2EIMB 4G70B 3EH5B 2PP7A 3NYKA 1JZEA 2JXMA 5E9NA 2YAMA 1CURA 2X88A 4GY4A 3CVCA 5D4IA 2HX8A 1AS6A 1ZIAA 1SHXA 1JVLA 2LLNA 5B1AB 2XUWA 2BWIA 1WA2X 3NJHA 3S8FB 3FSAA 2WO3B 3FYIB 3RYMA 4F2EA 2QDWA 4KOCA 3HEIB 1OCZB 1E30A 2CUAA 4DP4X 2HRHA 3ZDWA 1OCRB 4CSZA 3UAEA 3FQ2A 1EHKB 4UF7C 2VSKB 2QPDB 1GY2A 4KNSA 4YSDA 5F7BA 3SBRA 1HAUA 3AW5A 3GXUB 1L9RA 4HZ1A 5PAZA 5FC9A 5I6MA 2YAFA 4YSOA 2R7EB 4A2GA 2IWFA 1E5ZA 5B1JA 3DKHA 4HHWA 1J9QA 2FQGA 5I6PA 1CC3A 1JOIA 3CVDA 4HCIA 2PPCA 1N70A 2PPDA 2IDFA 1NWPA 2ZXWB 3G5WA 2EINB 4RH4A 1BXAA 1A3ZA 4PCYA 1OE1A 1MZYA 3NT0A 3EF4A 4DP8X 4G72B 4BDVA 4A2DA 2PCFA 4K9JA 5I5JA 5I6OA 3AG4B 1AZRA 2J56A 1SFHA 2OJ1A 3OMAB 1ASOA 3V9EA 1SFDA 2YAEA 1ETJA 4E9TA 1ZV2A 1EZLA 3NJMA 4YSEA 2XYBA 2YAHA 1GS6X 1IKOP 1OV8A 1KDIA 5AFAA 2GC4C 4DP9X 1ASQA 2FTAA 1DYZA 3SQRA 1BQRA 3OM3B 4E9VA 1SJMA 1TEGA 2AZAA 4GYBA 1JZIA 4N8UA 3TU6A 3WNJA 1A4AA 4G7RB 2W8CA 2ZONA 3GYRA 2IDSA 2IDUA 5B1BB 4CSPA 2QT6A 4ZK8A 2XV3A 3N2JA 1PMYA 1KV7A 2IWEA 5F7AA 1CUOA 4KNTA 1WA1X 4Q89A 4HCGA 4NERA 4P5RA 3X1NA 3PAVA 5B7EA 1GS8A 2FQDA 4YSRA 1B3IA 4HIPA 4AKPA 3AG2B 2UXTA 3NP4A 2DWTA 2IDTA 1KBWA 2Q5BA 3FYEB 1JVOA 2UXGA 3UAAA 1NIBA 4HALA 3FPXA 2EILB 1J9TA 3EHBB 1R1CA 2PCYA 3PLYA 1JXDA 1NIFA 4NAJA 5I6LA 3JT2A 2FT6A 1JZGA 2YAQA 3PPSA 4P5SA 4E9QA 4DPCX 4G7QB 4E9XA 1IC0A 2BHFA 3BQVA 2GHZA 3OQRA 1XB8A 2MRYA 2VM4A 2XLLA 4AKOA 2YAPA 1BQKA 2DV6A 2FQEA 2P80D 1ADWA 4HAKA 6PCYA 1RKRA 3WG7B 3UABA 3QJQB 3S3CB 3ABLB 3MBWB 2VN3A 1IUZA 2VM3A 3QJSB 1RZQA 1SDDB 3X1FA 2BZ7A 2QDVA 1KGYE 1OE3A 4EF3A 2BP8A 5B1JC 2UXFA 2XXGA 3NJKA 3FQ1A 1I53A 1AZCA 2AANA 2NRDA 3CDZB 3QJTB 4AI7A 2BP0B 3OMIB 1NPJA 1QHQA 2Q9OA 7PCYA 2XX1A 3T6WA 5PCYA 2CCWA 4YVUA 1AG6A 4L0PB 2BWDA 2HZHA 2PP9A 6PAZA 3X1EA 4A66A 1E5YA 4KO7A 1AZNA 4UANA 3S3DB 3FT0A 2YXVA 1TEFA 4DP2X 1NWOA 2HLEB 3DTUB 5I5MA 1KCBA 2OV0A 1AS8A 2JFCA 3C75A 3PCYA 5TK2A 1V10A 4F7KA 1KDJA 4E9YA 2FWLB 2H5UA 3V9CA 4G71B 2FT8A 1PCSA 4A2HA 1PZAA 1V55B 2HRGA 9PCYA 2XX0A 1L9PA 2YAOA 3AG3B 5D4JA 3FU9A 1ILUA 4YSUA 2J57A 4BWWA 5AZUA 1ASPA 1IBZA 3KW7A 2HX7A 2BO0A 2YARA 3NJFA 1FFTB 1N68A 1A4BA 3UGEA 4DP7X 5A7EA 2N0MA 1JZJA 2EIKB 3FSWA 3AG1B 2H3XC 3QQXA 5B1KA 3H56A 4HCFA 4BXVA 3H4FA 1AQ8A 1GYCA 4F2FA 1NTDA 3NSCA 1JERA 1NIDA 4A2EA 1QLEB 1URIA 2YQBA 1PLCA 1E67A 3FU7A 3NJGA 3PXLA 4KO9A 4M3HA 2FT7A 1AANA 1OE2A 3FSZA 4NB7A 4YSQA 1WAEA 1YLBB 1J9RA 1JZFA 3FU8A 1TU2A 2GC7C 3IE9A 3HB3B 4DP1X 2BW4A 1X9UA 2I85A 2GI0A 3N55A 4JKNA 2RACA 1SF3A 3WIAA 3ZIYA 1GY1A 4E9SA 1HFUA 3CZUB 5I6NA 4M4RB 4JHVA 4BWTA 4GP4B 3NSYA 4BDVB 2A3TA 1J5CA 2TSBA 1J5DA 2UX7A 3T6ZA 3IN2A 3NJIA 2GB2A 3ASNB 3U25A 3FPYA 1PF3A 2XV0A 4X4KA 1W8EA 3NSFA 3ZX1A 2VSMB 3PAUA 1ZPUA 2VMJA 3TBBA 2HX9A 2CJ3A 3X2QB 3S8GB 1X9RA 1SHWA 3NJLA 4UAHA 3TASA 4DPBX 3QPKA 4DPAX 3DIVA 3JTBA 1W6WA 1V54B 1M56B 3WNIA 1L9QA 2WSDA 1JZHA 2AFNA 2TSAA 1AOZA 2IDQA 4KO6A 5B7MA 4MFHA 1PAZA 2I7OA 3TBCA 1CYXA 1F56A 1RZPA 3IN0A 4YSSA 3ASOB 2B3IA 1BYOA 2Y69B 1PLAA 1OOWA 2PPAA 3OMNB 3IEAA 5I28A 1SF5A 3CG8A 1IBYA 3WI9A 2DYRB 5ANHA 3GDCA 2PLTA 2FQFA 2MTAA 1KCWA 1A4CA 5LDUA 3ZBMA 1DZ0A 3D12B 4DP5X 1ET5A 1FA4A 1ILSA 4A68A 1XB6A 3BVDB 4BXSV 1NIEA 3NJNA 1L9SA 2GSMB 2X87A 2IH8A 1BXUA 1ET7A 1ZDQA 3EH3B 2CALA 5TK4A 1PNCA 1A65A 2R7EA 3NJJA 3T71A 4KOBA 1OCOB 3WKPA 1VLXA 4QKTA 1NICA 4PAZA 4W9ZA 3NP3A 4QLWA 1ZDSA 3CVBA 4YL4A 4GP8B 2FJSA 3T6XA 4AX3A 2PPEA 2WO2B 4E9WA 1GSKA 1AS7A 4YVNA 2Y1AA 2GBAA 1GS7A 1W6LA 1XB3A 2ZOOA 2HXAA 5B3SB 5I5IA 1PZCA 1WA0X 2H47C 2P80A 1AG0A 3S3BB 3H4HA 3T6VA 2BP8B 1NZRA 1MZZA 2QPEB 1NINA 3UACA 1PLBA 7PAZA 1E65A 4BK5C 4WKXA 1PY0A 4A67A 3SBPA 3QJUB 3AZUA 4JHUA 5I6KA 2CAKA 3X1GA 1RCYA 2J55A 3FS9A 1BXVA 1ET8A 1M9WA 2DWSA 3AY2A 3L45A 4YSTA 8PAZA 1AR1B 3TA4D 4N4YB 4HHGA 1AACA 3PAZA 2XU9A 1L9TA 1BEXA 4KO5A 2I7SA 5EHFA 1JXFA 1ZIBA 2DYSB 2CBPA 1MG2C 2XV2A 1CYWA 1GW0A 3SBQA 2AZUA 4GXFA 4G7SB 4ENZA 4AKQA 3FQYA 1OF0A 3ABGA 1J9SA 2VW7A 4KNUA 2B08A 3QJVB 4BWUA 2FNWA 1PZBA 2J5WA 2PPFA 1QNIA 1AIZA 4W1TA 1A8ZA 2AVFA 1T5KA 3UADA 4A2FA 2YXWA 2DY2A 5D4HA 1AZUA 4FAAB 3T9WA 3ERXA 3QJRB 3IBOA 1M57B 1WS8A 3X1BA 1JXGA 5I26A 2UXVA 2XXFA 2OCCB 3WKQA 1BYPA 3KW8A 4AZUA 5IY5B 1ID2A 5B7FA 2UX6A 3ABKB 3FU7B 1NPNA 4FA7B 1OCCB 2VW6A 3EH4B 1SDDA 2EIJB 1FWXA 2ZWNA 3OD3A 1L9OA 1AZBA 5AKRA 2VW4A 3MX0B 1MG3C 1PNDA 2W88A 3CDZA
chains in the Genus database with same CATH superfamily
3LPPA 1D6VH 2ZSWA 4I85A 4PJDA 4OIBA 2A9NL 1ETZB 3WXVL 3T0EB 4XMPH 2GJRA 3ZXAC 4MCZA 1FI8C 3QUXC 4O9HL 2UZXA 2E5EA 1TO5A 2ICWJ 2Q86A 4LHJB 1MLCB 2CBQA 3MRBA 3KPMA 5AVZB 1XIWC 2LVEA 4L1SA 4EN3A 1MCOH 4N6RB 4N0UE 1MCCA 1BQLL 1UACH 2OL3H 2MOVA 2TRHA 4CADB 2BZCA 3QS3A 4FEMA 4MB4A 3ARYA 1HHJB 2R4RL 3VXNA 2VB5A 3O6FB 4WNQA 3C08L 4GRLC 1IGYB 3TL5A 1FFOA 1H9VA 2GUOB 5B4MD 5IZ7A 2BOCB 4AXWB 3LXAA 1PSKL 4OD3H 3I2CL 3GSOA 4TUJB 5GGRA 3C60C 2V5MA 5DQJA 4WU5A 1F8TL 2NUPA 3EJZD 2PTUA 5GSVB 1J1OH 4NN7B 1AS6A 5C3TA 2JELH 2VOTA 1SYSA 4BKSC 4ZO6A 2B7DT 3EGDB 1EJOL 4Z9KB 2X53A 2Y6TE 4ONFL 3B43A 3C8KA 3O0LA 1ZK5A 4GRMA 4MXWL 3B2UD 5TQ0H 4GBXB 2EUXA 1VEMA 3VMNA 4J6RH 3ULUD 1IT9L 5IFJA 4P3CL 5D1ZI 5ILTL 2W91A 1EMTL 1S8DA 5HDLA 2Y7OA 3HN3A 5IUSA 2O61B 2GSIB 3ARBA 4QOKA 1Z5HA 3ZDWA 3N41F 4LO9A 5FDWA 2BNUB 4N25A 3MLXH 1GY2A 1M71B 2GABA 5C0FB 4YDLB 3R06A 4HJTA 5GRWA 3TN0B 4FI7A 5F1KC 4R4FH 4M3JA 1SOSA 4JHBA 3UCRA 4BM7A 2Y23A 3WGUB 4Y1AD 1IZJA 2ESVB 4AT6B 4M6AA 4F27A 5JPMB 4NNPL 4G5ZH 3CK0H 5FDYA 2QZQA 4P3WA 3QORB 1ECYA 3DUSB 1FORL 4MNHB 2VN5A 1Z0MA 5DXWA 2AJZA 3WDJA 1B0RB 1N8ZB 2PPDA 5AAWA 5AZ2H 2X9WA 1ZANH 2W5PA 4ADJA 2BIOA 3ATDA 3QXDB 5FCSH 5FM4A 2XRAL 1D9KD 2WBKA 3ISRA 5CN2A 4BDVA 3TH2T 2J88H 4RAUB 3SDCA 4APXB 4UT9H 2D0FA 2P45B 3QDME 1X5GA 2IPTL 2XWBB 4YHLH 5DUPH 5DFVD 5CILH 5LBSH 3V6ZB 4PJXF 1URLA 1NAKH 2BJML 2X5PA 2XKSA 4JY6A 5KVDH 3BUDA 1HKFA 4M93C 4LOUC 4Z5RA 3B7SA 3UBXB 3TT3H 1YEFH 1F2XK 1T6VN 2M83A 1ZV2A 2WQSA 1ZXKA 1H3GA 1J5HA 3PABB 4M1DH 4LRIC 3F58H 5JOFB 2X1PA 3L9RB 5IEHB 2QBWA 4XNMB 1DUZB 1S7UA 3NZ8B 1MHEB 2FTAA 1UZ8B 3FTSA 4S1SL 4HHAA 1DQDH 1AFVH 4GS7C 1R3HB 1TEGA 2GHWB 4DN3H 4EXPX 4AYID 1Q9WB 3SGDI 5I1EH 4OM0H 3NABH 3CHRA 1RP9A 2AEWA 4N2MA 4R8WL 4BZ2H 4N2IA 3MRGB 5DJXA 3VH8G 2AK1H 2C5DC 2F74A 3TYGH 3OKLA 2BSRB 1BQSA 4XMPL 2LV4A 1WA1X 1BREA 1E6JL 1J1PH 4NZUH 4DKTA 3U2SB 2VUOA 5CEXB 5E94B 2H4EA 5FCUL 2GIYA 4AMXA 2AS5M 3MJ7A 2BVPA 1XTMA 1MCOL 4HV8B 5F7UA 3IAQA 2OL3L 2WN2A 4GINA 2VR9A 2XFXA 4X4YB 2B3RA 1DHKA 2Z34A 3BN3B 4HALA 3M7OA 4XXWA 3MJWA 1X6LA 4OFYA 1AD0B 2CLRB 3OHXA 1NCTA 4XHQA 4QO1B 3QJHA 5DUBA 5T8IA 2AK4B 2AJSH 2VTFA 4H4NA 1T5WA 2VLJB 4PJBF 2BVQA 2APXA 3VXRA 1F42A 1UGNA 3MNWA 1F3JB 3U9UA 1ULVA 3MBXH 1GGBH 4NGHH 3PGDA 4YK4B 3VGAC 3M86A 1NFAA 1BQKA 3GXIA 3N41B 4G8EA 1NM9A 4PY7A 2YQ2A 2FLMA 1I7TA 2NY5H 4R7LA 3W39A 3RGBA 5C09E 2JLLA 5TQ0L 4NJAL 4X83A 1PEWA 1MCWW 1FNLA 1SN0A 4J6RL 1KPUB 4HWZA 3HZKA 4LEEA 3MLZH 3MRFA 2QSVA 4KKRA 3VYPA 3MLUH 1G9NL 4Y2DD 5SV4A 3DV4A 4DF9A 1S7TB 1XSIA 3C2SA 3Q0HA 4MD0A 1DQJB 5HDQH 3FOLA 4H1LA 3ZR6A 1G7IB 5EU5A 3QJTB 1V8HA 4L23A 4WW2F 5TE4H 1UCBH 3G6JE 3QNZB 3MLXL 4ZW7A 5HYSA 5PCYA 1RUAH 1G9MC 2ZG2A 2EE6A 2H8PB 5JW3H 1I8AA 4Z23A 2IBZX 5G2NA 3CFEB 5KAQF 1YNKH 5B21A 4PJXB 4JO8A 1IFHL 5MEOB 2JF1A 2X42A 5F71A 2WQUA 2HLEB 3QO0A 4X98A 1ZANL 1H3TA 3RY5A 1AS8A 2FHBA 4HSCX 2VWEE 1ONQB 1UURA 2RHEA 2WYIA 1MF2H 1HL9A 4GT7A 3QDAA 4UT9L 2NY0D 3RU8H 3CIQA 3VGEA 5DUPL 3GEWB 1A47A 3ARGD 1ES0A 1L9PA 2VLKA 4P4RB 5CILL 5LBSL 5EUOF 3WNKA 3MGOA 4J1UB 3M1BA 3VI4E 4BCYA 4YX2H 3B7TA 1YAZA 3G6DH 1ILUA 3WL9B 4NRZB 3EJTA 5AZUA 4N90D 1YEFL 1P6FA 4YFLF 1GOFA 1BZ7B 4PJAA 4M1DL 3AWEA 1CDJA 4J8RA 1BP3B 1TITA 3D0LA 3Q1SL 3VFUB 3WTYA 4M1GH 5E5LA 2H3XC 3QQXA 5MHSD 3H56A 3AAZB 3H4FA 2VXUH 3ZUNC 1VFUA 3D85D 4UDUB 3SCMB 4HOZA 5E6IC 4OM0L 4P9MH 3B5HA 1Q1JH 2HVKB 1OE2A 3WY2A 5JQIB 5L88L 1G9EA 1TQBC 2FZ3A 3LN4B 2JQMA 1IKNA 3NN8B 1XGRA 2Q7YB 5F9WB 5T3ZD 4G1EB 1TETH 1F3DJ 3TYFB 1UH2A 2X4RB 4NZUL 3HBQA 4Y7MA 4FG4A 4PJBB 1U8OA 1BVLA 1JPFB 2APFA 4U1IA 3BVWA 3ELQA 5E2VH 3IM1A 1MFCL 1RFDH 2ZCHH 1FGNH 4JHVA 3V0JA 4HK3J 2OZ4A 4Z3FA 2IH1A 1RJZA 4I1RA 1G7HB 4U49A 2Q10A 4NUPA 1MFNA 3NRQA 5E2WL 2BY0A 3KS0H 4HD9A 3AQDA 3T4YB 1ZLVK 3ZX1A 4LAJH 1PZ2A 3V4PH 2FR4A 3TNMA 3IVKA 1QSFE 4HKXA 3S8GB 5TQ2H 2A83B 1JNLH 5D7HA 3TVMC 2AI0H 4AJ0A 1N18A 2A9MH 2BHZA 3ZDXF 1GGBL 2DM3A 4NGHL 1W6WA 1KLUB 1CFTA 3D34A 1KXVA 4WW2B 1N10A 1BAFH 5IBUB 4YXHH 5JW4M 5K9QG 2NDGA 2APVA 2NY5L 4K5MA 4F5CE 5K9KA 3ULSB 2C3XA 2WWKT 2DJ4A 4L4TB 4ZUUA 3RG1C 3WJMB 4CVZA 3MLUL 3HS8A 3OKOA 4NLHA 1X7QA 2XZQL 4KI5D 4QOKD 1AR1C 2GTQA 1DLFH 4AUUA 3HS9A 3HVNA 4H2AA 5G4MA 5TE4L 5D1ZD 1UCBL 5I8CA 3OZ9L 3MLVH 4NOFA 4P2QD 2HWZH 4MMZB 3APFA 4PBDA 2HFTA 2NTFB 4XVOA 3LHPH 1S9WB 2WWNA 2WXQA 3OKDA 4HJIA 4NQDE 4L8SA 1NSNL 4QLRA 1LL1A 4K55A 3IETA 3V6OC 5D7SH 4CU7A 5JW3L 1ET5A 3P40A 3O8XC 5HJ3A 4WTZG 1L9SA 5EUOB 1LEKB 5DHXB 1T22B 1T1YA 2VDQH 2X3BA 1DEDA 1ZLWK 2ZTBA 1E40A 1IGTA 4YUEH 1E9PA 5GS2D 4PRPB 4MAYA 3BCDA 1Q90A 2EKJA 1MF2L 3H3BC 3SDCD 1KY7A 1NDMB 3S4SB 5BO1H 4LZKA 1FBIL 3V7AE 5C1MB 5JOEA 2D4DA 2G3MA 2XVLA 5BQ7B 5DCCA 3KLHD 1Y7VA 2BSCA 5ESVB 3FQNB 2HH0L 4YX2L 5T3ZH 2PCPB 1S7WA 5B3NA 2JKNA 4X4XA 2FHCA 4UV7L 2YS4A 3UTQB 2NY2D 1MCJA 1FL5B 3O3DA 4TUOA 1Y1DA 4O5LH 1WD8A 2BP8B 1AIFB 2B5IC 2MJWA 5KBKA 5SWZA 1CD9B 1PYWA 1A66A 4X5LA 1KNOB 4LVEA 4M1GL 1LEGA 3D39D 5LDSA 1NEZB 3TO2A 5GRYA 2N7SA 1HE7A 4JG0H 2WNWA 4HIEA 4HISA 1Q1JL 3T1FA 2BM3A 1BMGA 1E3ZA 4JPSA 8PAZA 2AXWA 5IKCB 3P02A 3W0WD 2HTKD 4NNXB 1HQ4B 3Q2VA 4JJHA 4R90H 5AYQA 2D9CA 4OGZA 1U92B 5DVPA 4KXZH 3Q43A 2J8UA 2WGNB 4HKZA 4WKZA 5DJ2B 3ZDXB 3P0VH 2WLHA 1MWAB 5E2VL 1RFDL 3SKJH 4PJ8C 1FGNL 4G83A 4AGNA 4PP1C 1KB5B 3MLSH 3MUHL 1MG2C 3MRKA 4H5SA 1EEYB 2XXMB 4F1ZA 1GAFH 5DRXA 3TPUB 4HMDA 2JB6A 1ANUA 1KIQB 1SXCA 1I4FB 3CQQA 4X6BB 5J06A 3V5HA 3N85H 3O2WH 4XXCC 4I0PC 1Y0LB 3UGXA 2HT3C 4NP4H 4XWGH 4RDBA 3U79A 4QRSB 3V4PL 3VXRD 5TQ2L 3UADA 1JNLL 1BJMA 3HA0A 4K0OA 2AI0L 5ACLA 4L0YA 3WUWG 2A9ML 4AYGA 2CCVA 3TZVB 1HSAA 4QGTA 1NGXA 3RUGA 2WZ5A 2OMWB 1BGXH 3ZKMC 4LKXB 4YXHL 1FO0B 2EXYC 2HFEA 3CZJA 1D5MA 4JFUA 2ED6A 4RWYH 2QSQA 1OAQH 3ZE0F 4XCYA 4DZ8A 2V9TA 4FCHA 3JV4A 1OZTG 5GS2H 1JHTB 3VFWA 1OSZB 4UOW0 4D0BB 4DVBB 4GSDH 5L6YH 1A7QH 4FA7B 3TLRA 3TH3T 2DTSA 2V7HB 3MLVL 5EWIH 2HWZL 4WWKB 4FLOA 4NFDA 1AY1H 3LHPL 4L8BA 5HGDB 4XBGB 1H3UA 2YMOA 3PL6C 4RFEB 2BP0A 1BFOB 5D7SL 1QBLH 4YSPA 3QIUA 1KXTA 3KLAA 4CMHB 4OF3A 2DQCL 5F7FA 3ZN6A 4X2UA 2N7AA 2VDQL 3CE1A 4YBQD 3J27A 5G55A 1LK2B 2AXJA 4YUEL 1HJBC 4LCYA 5D55A 2HMIC 4YXLL 4P23B 1SHMA 4UV4H 2G9HB 3PRZA 4IMLB 3ZYJA 4UQ3A 3WN5B 1KIRB 2VGLM 3VDBA 5GZOA 1WZKA 3DETD 3V95A 1H3WM 4JK0D 2VLKD 1WC7A 5F6HJ 2CU9A 3T8VA 1KFAL 1P7KB 3EYVB 1IL1A 4Y2OA 43C9A 1P5VB 3SJVB 1F6FB 4GAAA 3WKML 2XETA 5FO8A 2X70A 2DEWX 3A21A 3CVCA 4C58B 4X0KB 1MPAH 4LVNB 4O5LL 1UADC 2QVIA 3VI4A 3IDXL 2O5XH 3NIFF 2EYTA 3HG4A 3RX8A 5CGTA 3WELA 1L9NA 2O5ZH 2X28A 1WCBB 1X5MA 3BN9D 3DVNB 4N87A 4AYDC 5HSFA 2MCMA 3RDJA 2DS4A 5ADOL 1HINH 4N3TA 3CVHA 1BQHB 3HPLA 4NENB 4DT2A 4F2EA 2F61A 1J1XL 3NOIA 4OFKA 1C16A 1IAKB 3QG6B 4KOCA 4BFBD 4F3FB 4LMQE 1UWGH 3QUZC 4IBQA 2V33A 2GSGB 4FL4B 4LCCA 4YDJB 4MBOA 4YSDA 4IQHA 3VXPA 1UKSA 4LPVA 3T1WA 1XGUB 4R90L 2OR8A 4HS8H 4FGMA 2V2TB 3VXSB 2ICCA 5ETUB 4A2GA 5EMYA 5AB0A 1EBPA 2E9WA 5B1JA 3P0VL 2Y5TA 3SKJL 1KEML 5AW9B 1GZPB 2R27A 4KROC 1ZSDB 6CGTA 1GAFL 4WIQA 3G7TA 5D72H 1UWXH 1IE5A 3QUXB 4Y4HA 1EZSA 3NFPA 3NAAH 4PP2B 4RRPA 1FNGA 2GTZA 2W60B 5LXGL 4BIKA 4H1LH 5D6CB 3O2WL 3QWQB 1XIWB 2SODB 3SO3C 2IALA 4NP4L 3G5XA 3HI6H 3E3QE 4E41A 4ODBD 3VM5A 2OTPA 2J4WL 4PJIF 2CA4A 4FXGC 3CFBA 3FT4B 5E00A 4JLRB 3KPOB 4G80A 3W2DH 3GB7B 2NY1C 1BGXL 2PYEB 4XMVA 4ZPVB 2AEPL 3GSNB 3EOBB 4GRLB 1T4KA 5IQNA 4XNUL 1H3PH 2YQ3A 4RZKA 4NX0A 1OAQL 4N5UA 5LKNA 3VI3F 2G60H 3C60B 1ZHNA 5H35B 2OXGB 2YAHA 3L1FA 2A6DB 4QI3A 2YOAA 4KKAC 3H0TA 4HETA 3AM8C 4FQLH 2H26A 2OK0H 3ILEA 1RP8A 1BZ8A 1A7QL 4E9VA 1MCFA 3E6FA 5L6YL 2D3LA 2H9GA 3V6FB 4NM8H 5SX5K 5DFAA 4BYHA 2P8PB 3F6LA 4J4PD 4TLSA 1ZT4B 5F0LB 2EJ1A 3PWJB 4AK2A 4ZODA 4NJ9H 1L3WA 1WP6A 3BWAB 1KGIA 1SY6L 1TJHL 2XV3A 1TNMA 3U0TB 4KKZA 1M1XA 3E38A 4K4KA 4AUYA 4XTRD 3DTXA 4XP1L 2ZOWA 4ZMZA 4I1PA 1ZTXE 5C6TL 3DMMA 1WBZA 1BAGA 2IADB 3AG2B 1Q0XH 3EGXB 5DMKB 1R0AH 3DHMA 1IM9B 5FPIA 5T3XL 3T8MA 4XOAA 4D7BA 1SVZA 4FZEH 4MAYD 4WO0A 3ZTNH 1O6SB 2OX5B 1F3DH 4NQTA 2NR6A 5EIQA 3GGWA 2V2WA 4FQHA 1LP9B 3NIFB 5D7LA 5I1HH 2WKGA 3CSPA 3PWVB 3BGFC 1XH2A 3SDXF 1ZXQA 4LHUD 5CZXD 5JO5A 3OQRA 1N5AB 4L4VE 4M6NH 2EECA 3UXFA 4OZHA 1AC0A 3QDMD 4NT6A 1G43A 1SDAB 2VLME 4OF7A 5J13C 2ENSA 3MR9B 3RFZC 2IDCA 3VD2A 1OOAA 1OGPA 4PSPA 4K5LA 2IPKA 1T0OA 3BPLC 4M93B 4J2XA 1HINL 2VABA 1SOKA 4PJ7B 2WQXA 4XPBL 5HHMB 2ARJB 3DO7B 4OV5A 2XXGA 1SM3H 1YEIH 4GW1A 3AJ7A 4NDMB 3RPBA 3PDOA 4JFFB 4MDIB 5DZNA 1KMGA 3DI2B 1JK9B 3KH3A 4H7VA 1HL5A 3OF6D 2GJ6E 1QRKA 2RA1A 4OGYH 7PCYA 1MFVA 2EADA 4GS7B 3VD7A 3DUUB 4MDJB 1AG6A 1RURH 3FU6A 4PUBL 2K6YA 4KXBA 4PJIB 2R2BB 1BF5A 1VADB 2ITCB 5DMIH 5FYKE 1JN6B 1QA9A 2H1XA 5DD5L 1DP0A 1AZNA 1YN6A 3H7BB 5D72L 2V2XA 1RD6A 2YXVA 4ZFFB 3EJPA 3NAAL 5TGBB 1AR2A 2OV0A 3F7LA 5MERA 3VI3B 2XVGA 4A37A 1GGUA 4KUCF 4OAWA 4U1LB 4EKJA 3HI6L 5JHDE 3DSNB 3UJIH 3MU3A 4UIMB 1E3FA 1MEXL 4N2CA 5IBLD 3VH8A 3QA3B 5FIEA 3W2DL 2R1XB 4LB8A 3TIDA 2DMBA 2H0JA 3OQ3B 5AEAA 4X6DE 1KCVL 2GT9B 1UVQA 1H3PL 2V6HA 1KUMA 3P1VA 4JFHD 1W15A 2G2NA 4JFXB 3R8BB 3RGHA 1J0HA 5F72S 3CXDH 4C55A 3VGAB 5C0GA 2X6AA 4NWTH 1F02I 5GS1C 3FUFA 3VD4A 5F89B 2EIKB 3EAKA 3OWRA 4OLUL 4Y1SA 5C0BA 3IMBA 4PRHB 4B60A 2IQAB 1E4WH 4Z76B 5LBVA 1CZ8L 3QVAA 1FVCA 4HG4J 3T2NL 3NSCA 3D4CA 4NM8L 3WY3A 3O2VL 1WTGT 2IMMA 4MQ7B 5TE6L 1GMEA 5AL0A 1TT6A 2BRRH 1X5HA 1PZSA 4NB7A 2LOEA 2AP2A 4UIKL 2YBRA 3SDDC 4FFWD 1OW0C 1TU2A 3T5WA 4JFYA 1WICA 3QIUD 5H37G 4ELMF 3LNGA 3SDXB 4G1MA 5KANG 4YIQB 4Z6AT 2YXMA 3RRQA 1E6OH 2VR7A 1RJLB 1Q0XL 2N1TE 4LFHD 4W9HC 3FDWA 5KBNC 3NCEB 4FZEL 5E8OB 2B9AA 2XV6B 2GB2A 4P07A 3QNXB 4I48A 5GZOD 1CGSH 4LLQA 2LTQC 3KLDA 4P2AA 4JFZH 5FLUA 4KKLD 2EXSA 3ES6A 4A7TA 5K69A 4ZS7H 3SYCA 4M6NL 4WK0B 1M56B 1QOKA 3LHAA 2VL5A 3P77B 4HPOL 5DC4B 5IF0A 1QSEB 2DLFH 2HCZX 3QZOA 4H20L 4KPHH 5IR1A 2OZ4L 3GSUA 4C56E 3BQUD 3TBWB 4A04A 4F2MB 5BZWA 3N1MC 3TWCH 4NWUL 2I9TB 1AXTH 4CILA 1B4TA 1GL4B 1PFOA 4D9LL 1KCUH 1XTLA 1TZHA 1QFOA 2FIKB 1HK6A 4FNLH 3OMZA 3BVNA 4ZYKB 1S9YA 3BPCA 1SM3L 4JJOA 4LMQI 1D7BA 4ODHH 3T2PA 5E5MA 4JBSA 3T0EE 1U95A 1JZ4A 1P9MC 3FAWA 3HRPA 2ATPA 4NZJA 4OGYL 3RPKA 3GKWL 3BSZA 3P73A 2BIMA 2VC2L 1RURL 1UG9A 2V7NB 1LD9B 3N3EA 5E6IB 1NAMB 2E9JA 1JPSH 1MHHA 4FG0A 1SLWA 1DZ0A 2DQHL 4U1MA 5I8EB 5FHBH 4PV9A 1TQBB 2ZUXA 4EIBA 4M56A 1XAKA 2FK9A 4LKCA 3EOTH 3RWJB 1NUNB 5IFHL 4QT5A 4HH8A 2JI3A 2OJEB 1E2ZA 5E8DL 3V4VB 4JDTL 3HBGA 1DZBA 4UAOC 4V11A 1S7RA 3RLSA 1YEEL 2WZ6A 3OV6A 3BP4B 5EOTB 3S35H 3F85A 5LVEA 1VLXA 3MLTA 3R7RA 3CJJA 3ALWA 1W0WB 3UJIL 4ECNA 5J1AB 4R4BB 1OKEA 2GEQA 4U6HA 2ZCLL 1TTGA 3KPRA 2ZWYA 3VFTA 4G42A 4N2EA 1LMIA 3MUGA 2XWRA 1PG7X 4NHCL 5CLXA 5F88A 2FJSA 5K1VA 4MS8C 5B8CC 2C3VA 2BIIA 2J1YA 1JVKA 4OZFB 3MRLA 3LZRA 3CH8A 2Q3AA 2WYZA 4MJHA 4IJTA 3TVMB 3KL0A 1A3RH 2BXZA 3V55A 7FABH 5B1CA 2O26U 5DSCA 2YXFA 3PUCA 3BO8B 3UAJA 4KNQA 2EE0A 4NWTL 3WS6C 4IK6A 3CN0A 3K6SB 1TOXA 2NY3D 3GIVA 3VFMA 3FB8A 3TCXA 4ELMB 1HI6B 1E4WL 1MHCB 2C7FA 2KI6A 3L2NA 2JTDA 2UZIH 1F6AB 2W95A 3L3KB 3N91A 3FQRA 1YEJL 5INDA 3AFLA 2CAKA 2J55A 3CFCH 4HVBA 2ESVE 3V8OA 3DDFA 2OAAA 2BRRL 1KN4H 3L45A 5BPPA 1MRDL 3RZCA 3M8OH 4BKLB 3GI9L 2Z8SA 1G1CA 1AR1B 2A0LD 4GUQA 2VE6A 3GNML 1DCLA 4QGYA 1I85C 5HGBB 3BGMB 5EU7C 1RZIB 3G5YB 1NMAH 4Y19A 3W1ZA 3MRDA 3DMMD 1IM3B 4NQDD 5ALCH 4BH7A 1IQWL 3BVVA 5BV7L 2EC8A 4JGUA 3L3HA 3BH9A 2WCSA 3CVHH 4QR7A 4N2OA 3O8XB 3L7FA 4HZLB 4I89A 1DJWA 2NR6D 2VDRL 5D7LD 3RFRA 3ILPA 4RMUA 1CIDA 4YPGA 1M3JA 1N2RB 1I1YA 2E0PA 1UD2A 3HE7A 4FYSA 2AXHA 1DN0B 5AVRB 1D5ZA 3CX5J 4QY8A 5I16A 3QJRB 1PW3A 3IBOA 5HHPB 3SYAA 4ZX6A 4PRAA 4R2GC 5T1KD 1TVBB 3CSBA 1BA9A 5LAPA 1JXGA 3QEGL 1CT8A 1IAII 3ZZQA 1GCFA 4WTZA 2XXFA 3J2PA 4AVIA 2DPKA 2VXTL 4AC2A 1CF8H 3KPSB 3TWCL 5K39A 5TH2A 3UBGA 1MIMH 2NXZC 5HHXH 3DX1A 2BFGA 4HKBB 3QDHA 3B2MA 3NQKA 4NO2B 1EHNA 2B5IB 2J5LC 4ODHL 1K2DA 3NEXA 4MA1C 1OCCB 5CEYA 1AGDB 1DJYA 2ADFH 1TDQA 1VSCA 3ZDYF 3LKRA 4BQCA 1L9OA 1AZBA 1T2JA 3L4UA 3CN2A 1DJXA 3OKEB 4MJIA 2VITA 2XJLA 3ZT6A 4CN1A 1JPSL 1GYVA 4DP6X 2XWZA 4LLWA 5DURB 2ZPKL 2JKWA 3C6EA 1SOXA 4ODVL 3EOTL 2XN1A 3US0A 2ZUTA 2K8MA 1RSFA 2AK4E 6FABL 2VLJE 4FMKA 1KGUA 1WS7A 2ODHA 4Y7OC 4PJ8B 1XO8A 2QTVA 2G5BB 3BUQA 3QSKB 3F65A 1K4CB 1TYJA 2GY7B 1XXDC 4YEFA 4LSTL 5JMRA 4UM9B 5JHDA 2DKMA 1T1XA 4I0PB 3WO4C 3VQ1C 2YAMA 4XVUD 4FLQA 3LQZA 5DF0A 1J8HE 1I7UB 2AKRA 1BLIA 3FB5A 5CSBA 1G6RL 4X8JB 5E6RB 3VTMA 7FABL 3HOGA 2CKBB 5IW1B 4K7PH 2IANB 1DQTA 1Z9LA 4CVXB 4G9FA 1MAMH 4XPHH 1T1WB 4AGQA 4F80A 1F90L 4L3EB 5CJOH 5DFTA 2WVVB 2VT0A 4ZOEA 5CM1A 2WO3B 3EBAA 3ETSA 2UZIL 4HJUA 4ICWA 4LNRB 5JHLA 1TTCA 2PR4H 2CMRH 5KEZA 4AQAB 2E9IA 3QUYA 4HJGA 4GO9A 3ARVA 3WUWA 3P9MA 1E9QB 1KN4L 2NY6C 3M8OL 3PS6A 5FGRA 1NA8A 4KNSA 4TNVF 2DQDH 5F7BA 1IVTA 2MPAH 4PJXE 3AREA 4OB5H 2WZPD 1JGIA 3KYOA 4BD4A 5JW4R 1A7OH 4IRJD 4PLJD 3WAKA 1QAWA 2VQ4A 4H8HA 2WSKA 5ALCL 3B34A 2Z4QB 3QBTB 3PL6B 3BP7B 3GHEL 4I4WB 5EC2B 4ZFOB 1R3JA 1UWEH 5HI5D 1VGEL 3L3OA 1BVZA 4AEFA 3NFSL 4HEPG 3V52L 5EO0A 4JANA 1NKOA 5A2FA 4YHNB 3MO1A 3SGEH 2I24N 5I5JA 2DL9A 3D7PA 4KHTH 4O02B 4PRIA 2P8LA 4U1SB 3ESPA 2WHVA 4AQEB 3X12A 1FFPA 3KL5A 1P4BL 3G6AA 1MRCH 2ZUVA 3HTLX 1ZEAH 4HKJB 5AOMA 2OJ1A 3OMAB 2VDMB 1MFEL 2OS7A 1X5LA 4LLAA 3ZDYB 3K8LA 2XZAL 5FKAB 4G7VH 3SQBB 1OWWA 5CU5A 1QEWB 3RJQB 1MIML 2I9LB 5HHXL 3PJSA 3S6CA 3G5VA 2QGDA 5ID1B 4C56A 3HUJA 1HVXA 2X1OA 2YSSB 3LPWA 3NIGB 4PGCA 2OW7A 4TULH 3ZKXC 4HULB 1UXWA 2R69L 5BVJA 4Q9CA 1A9EA 3ECUA 2ADFL 2VZTA 3UDWC 5F7HA 3NA4A 4PJBE 1SEQH 5IB2B 3GRWA 1VACB 3QUZB 2FHFA 5AKVA 3EH1A 3TJEL 4ABWA 2CK2A 2E4FA 1HH6B 2BC4B 2ISDA 4JZNA 2YD1A 4NUJB 2CDGA 5E4OA 2E75C 3QXAA 3UG5A 1CL7L 4AV0A 3U1PA 2DWTA 3M1CA 4I1NB 1X6NA 4OW6A 3CZFA 2UXGA 2A6KA 3FUDA 1HOCA 4ZUWB 2R4SH 2J1KA 3F01A 1GIGH 3QUKB 3RX9A 4KROB 4TSCL 1CVSC 4DFIA 3V4UH 4YHPA 5D9SB 3LB6C 3KJ6H 5ENWA 3CMGA 4QYOA 4QD2E 4ZO8A 1GHFH 5C08B 3JTTB 4AH2B 1WT5A 4PTUB 2G2RB 1XD1A 2MRYA 1QW8A 4LCWE 4L4TE 2MTPA 4F37K 5LXVA 2D31B 2KL6A 4FXGB 3WFHB 3SPVB 1WV7T 5KBPA 1JD7A 1R19A 3NSJA 2NY1B 1MAML 2HT4C 3T4AC 2Z31C 5AW0B 1DVXA 5CJOL 1RPKA 1IUZA 2E8YA 1KPRB 4AQZA 4PBXA 3VU2A 1IBGH 5BJTA 3PWLA 5ID0A 3X13B 2PR4L 2HKHH 3TT1H 1I53A 4KZEH 3DUHA 4XN2A 4B53A 4LDCA 3HLAB 4FTDA 4D8PA 1AGBA 1S3KL 4B9PA 2MPAL 2BCMA 3FRPB 4HOMA 5J1TC 4OB5L 4YVUA 3O4LB 1A7OL 4DEPB 2BOBA 3EJRA 2OQJA 2EYRA 2Z35B 2PP9A 4PJFA 4Y19D 4YDNA 4PRPE 2R0KL 3G04B 1KIUA 4N68A 1M6OA 4B5ZA 4ODWB 9CGTA 5IWLC 4F92B 1UXMA 1GC1H 2BXYA 5E1QA 5C0AB 1UWEL 3LN5A 3D3VA 3EYSH 3MGTA 3MRMB 1TEFA 5KG9B 1P1ZB 2VKXA 4F9PC 4XX1G 2F53A 2EICA 1IRAY 1P1VA 3BRFA 4E9YA 4GEIA 1MI5A 2ZOKA 3BSZH 4P2RE 4M6OH 3UBXI 4KHTL 3GBEA 3MV8A 5EB9A 4MQXC 4RQQB 3MREB 2C4FT 1CFQA 4MCNA 3L5JA 5GJSH 1MRCL 3KWWB 5K59E 4DGIL 3HAEG 1KJ2B 4P49A 4XCFL 3MCKB 2BPBA 3FTGA 2R1YA 3BGFB 1NPUA 3BIKB 3D2UA 4FFTA 4URKA 2GW5A 3C2AH 4G7VL 1U93B 2GIXA 1QLEL 2VLMD 1QW9A 3SD2A 2X4SB 3PHOA 2K3TA 1S7SB 4GRWH 5J13B 1PAMA 3OR7A 2WNGA 4TULL 3RFZB 5T1LD 2F58H 3C5ZC 1XGQB 2WQVA 3LKPB 4UQDA 1BBJA 1JERA 1NIDA 4PJ9A 4KX7A 4U33A 5BNXD 1URIA 1SEQL 5GRUH 3FU5A 1HYRC 3A6CL 1ACXA 1QBAA 4MJJA 2FECI 1R5WB 2GJ6D 4MCMA 3CBJB 2JK5B 1J8KA 1JNHA 3M17A 5CGYC 2BW4A 3TH4T 1OL0A 1G9NC 4PM1A 3HFFA 1JIBA 3LNFA 5DTFB 3U6XS 5J9PB 5ECJE 1SF3A 1T7WA 3MYJB 4R7DB 4Y5YA 3X11B 1FQ9C 2BNRA 2ZT9C 3WFZA 4X6EA 4HS3A 8CGTA 3TBVA 5GS0L 3NSYA 4QRBA 4OLXL 5A40E 4KMLB 5K9OB 1GIGL 4HWBA 3V4UL 1TFHA 2JI2A 3KJ6L 2E76C 3O6ML 3V0IA 1GHFL 1PVHA 3DK2A 3VAEA 5JHDD 4MVBC 4R0LC 5IQ9B 4PPTA 4HUUA 3D18B 4GLRH 2RIKA 2JI1A 3WGVB 4IOIB 1VZIA 5KBLA 1CJYA 2OR9H 3PWNA 1YC8A 1LO0H 3RGVC 1V7NL 1KBGL 5E99H 2FNBA 4NUMA 4KTEL 2R0LH 3FCSA 1OAZH 4G9FD 5EA0L 5K9JH 3GMQB 3WHXA 2HUEA 5DJ6B 1J8HA 4TVPD 2CSPA 1IBGL 4ERSH 2WOYA 1MFBH 1EEUA 4LESA 2BSSA 3L81A 5D2LF 5FO7B 4YSSA 5L8JB 1GSMA 2WTPA 1AKJB 4AEEA 2HKHL 3TT1L 2VQTA 5GS1B 4KZEL 1A6WH 4KQ0A 3QIBD 1U91B 4GIOA 1A6ZB 1MH5A 2N56A 2X2YA 3L3DA 2IGLA 3KPPB 1SHSA 3P4NA 3JTSB 5KVEE 1VKXB 2CO2A 1F58H 4AVKA 4EAEA 2F7RA 3RHWK 5IHZA 2XACC 3KGTA 3V9FA 2WQRA 4L3FA 3BVDB 3SDDB 1K6QH 2X87A 5KYUA 5B4MC 2AITA 1HXKA 3NJJA 5IJBC 3T71A 1WISA 5LG1A 2NNXA 2AQSA 3CFJA 4JN2B 4CL7A 2R2HA 3POHA 4FXKA 2KPNA 5DK3A 5FECA 3JZ7A 3SJVE 4QKTA 4DGYH 4X6CE 3VA2C 1D5XA 4L1LA 2FEDC 1YN7A 2HSIA 2O5NA 5DHYB 1JZ2A 1EO8H 2K45A 2VJ0A 3B2UC 2I60L 2LR4A 4FABH 5GJSL 4YR6B 5IMLA 2WINB 2OXHB 2LTQB 2WLJA 1AS7A 5H37A 4F24A 4BRJA 5BZXA 1BD2A 1XB3A 1DSFL 4UI2A 4XMZA 3S3BB 1AG0A 4O2FA 1P6AB 1MHPL 1PLBA 4KI1A 5FYLL 1UEYA 2J3SA 4C56D 4PEEA 1DVFC 2DICA 4G6AD 1YEKH 3BAWA 3QH3A 4JPIB 3TO4A 4M9PA 4I3SH 4ZTOH 3VXSE 2NY5C 5GRUL 3LZOA 1D5RA 4PCTA 2DWSA 4M6ML 1JRHH 4Z3TA 2Z0BA 2NW3A 4X9IA 4OZFG 3VFVB 3I6KB 1Y1UA 4N4YB 5HJGA 4ZRGA 5CEZH 3FHQA 4OCWH 1CR9L 2GTWB 1SLVA 4HT1L 5EU6B 4L5FE 1NC2B 4M5TA 1AMYA 4TVPH 3S37X 3E0GA 1JXFA 3OB0K 2ICEC 2PW1B 3WLWD 2RAMA 1B4LA 3II1A 3DIFB 5AVSB 4UDTA 1FC2D 4UT7L 1Z7JA 2WD0A 2I25N 4WSJA 1FZMA 2PYEE 3D4ZA 1TQTA 5ESAB 3EOYG 3AQXA 5MENA 1E27B 1VPOL 3CPLA 4UAOB 1T3FB 5D2LB 2X0WA 4Z95H 1M2OA 4XVTH 1U36A 4LCIH 1OP5K 1LO0L 1TFPA 2JJSA 5BZDB 5E99L 2AAAA 4GBXD 4XPTH 4XWOC 5C0CA 4ZQKB 5B8CB 2R0LL 3GSVB 1OAZL 3HI5L 4MB5A 2UY6A 4LCWA 5K9JL 4QRAA 2VL4A 3KVPA 2AV7B 4PH8A 2B0SL 4ERSL 3T0AA 1T21B 4XVSH 1KEGH 1R3LB 1S9XA 1DE4B 1JYNA 4P46A 1JCKA 3CSYA 2WCGA 3GPSA 1A6WL 2FWUA 1VHPA 4ODUB 1IEBA 3VM7A 3ZL4H 4K9EH 3B8SA 2EDQA 3CVIL 3QR1A 5AQ0A 1P4LA 3FCTB 4BFKA 5IP4A 5IHUL 4KK8C 2ESVD 4NCC2 1F58L 5IW6A 2Z93B 5E51A 5IVZB 5ICZA 2DQUH 3QDGA 4HYTB 4YFLI 3MV7A 2G75B 1FH2A 3CLFH 4NHUA 1LP9E 1K6QL 3NIFE 5SX5H 1BX2B 3RWFA 3D3VD 5DUMH 5KSAA 2AF2A 3BAYA 1Y6KR 2LLLA 3S96B 4ZXBA 2F53D 2J2ZA 3C9NA 5AAMA 4QTIH 1MI5D 3NTCH 1MCBA 2VAAB 2PW2B 3DHPA 3KPLB 3MV8D 3GRWH 1EO8L 4YDKH 5EO1A 1SN5A 2ZOLB 1LTXA 3F05A 1TMQA 1UM6H 4N28A 1JZEA 4P2RA 4Y2DC 5E9NA 1ROWA 2VR4A 1ZLUH 3TJPA 4ZDHB 3D2UD 4PJ7E 4DGUA 3DX2A 5HHME 3MLPA 4JE4B 1SHXA 1JVLA 2NSMA 1DSWA 5DJYB 1CGTA 4JFFE 4R2GB 4CDGC 1C12B 1SPDA 1WA2X 4GMSL 3L4VA 5FUCC 3NJHA 4LF3B 2HJFB 3ZW3A 3SIKA 3O2DA 3HEIB 4PJ9D 4MBRA 2HRHA 4Y0GA 1G0DA 2NXZB 4ZFQA 4PJIE 4DAGH 2OCJA 4U31A 4PBVC 2QPDB 3OKNB 1JRHL 4GAGL 1AQMA 2J5LB 2DQIL 4HUWB 3CHSA 4RIRA 2MOQA 4MA1B 1AGCB 5CEZL 2QHRH 5PAZA 3DX9A 4YSOA 5D5MB 4GKSB 3VI3E 4HHWA 1ZT1B 4TL4A 4TVPL 5DVMA 3QQ9D 4X9FA 4N3UA 3UAFA 5ERWA 4AEHL 3ARQA 3REVA 5JHLL 1M2VB 3TFBA 4JE0A 2AK4D 4HUMB 3EYQD 2BVYA 4N1HB 5DWPA 4KMTH 4D0CA 5DDHA 4KK9D 5IJDC 3GLDA 4OIIL 1FNAA 4OV6F 3CDYA 3II2A 5JIDA 3C5SB 4Z95L 4XVTL 4OLWH 2J56A 4GIPD 3W9EB 4NQXA 1EO5A 4LCIL 4WTWA 4ZS6C 1NDGA 3HR5B 3QIWA 3RNKA 4PRHE 3EFFB 4XPTL 1PCXA 4ZMYA 1U8JA 1J8HD 3WO4B 1KGCE 1ICTA 4Y5VC 2VLLB 3ZT7A 5A2BA 2MFNA 3EO9H 1FE8H 3CDGB 3QZNA 1ZJAA 3WN6A 3ZDZF 3O3AA 5FK9B 4AGLA 4ZFZB 4MLSA 1OSYA 2ZQKA 5EZJB 1EDYA 1AHMA 2MMXA 3ZL4L 4GKNB 2UZYB 1JZIA 3SDXE 3CV5A 4EN3C 1OD7A 1PZDA 1VGKA 3PY9A 4M03A 5E1AA 1YCSA 4ZUSB 1OGAB 5EIIB 4F93B 1WFJA 4YAQA 3WTTA 2DQUL 5I82A 2NY6B 3MCYA 2LVCA 3QJFB 4KNTA 1FZKB 5GGUA 1S7XA 3ZU8A 3CLFL 3GBDA 3JQOB 2E6QA 5CCHE 3C09C 4KJWD 3U2JA 3UPRA 1K8IB 4HIPA 3OHMB 2F5BH 2OW6A 3MZGB 4HIIB 4WWNA 3FYEB 2P47B 4WI8A 3MYZA 1OO2A 3FPXA 4WEMB 1FN4A 1P4IH 1IARB 3OAYH 4QTIL 3NTCL 3DJTA 1BIIA 3BHBB 4OVUA 4PWEA 4OUUA 3T8XB 5GGSA 3JV0A 2AQ1A 3GRWL 4X5WB 1RVFL 2Z64C 1SEBA 4E42B 2X2HA 3PREA 4B3VA 2BHFA 2ZUYA 5J1SC 1UB5A 4Q6KA 4F2ME 2DYPA 4X6CA 5IEKA 3BQVA 4XH2B 4XP5L 1XB8A 1BOYA 4CU8A 3K0YA 2VM4A 3GMRA 3MNZA 3ARBC 4KI5C 4P2OA 1BD2D 4QRRB 1GKOA 2ZAIA 3BH4A 5T1MA 2AJVH 4HK3N 4A63A 4ISVB 4K07A 4OR1A 1DUYB 3L4TA 3FONA 3S3CB 3NVQA 3WTVA 1YYLL 1T20A 4HEPA 4HC1A 2YA0A 4HWBH 4NYLB 3SCMD 1RERA 3NRPA 2Q2EB 3TO4D 1U58B 1YC7A 4RDQG 3NJKA 1GYWA 3W9DB 4MJ5A 4K5NA 5CKAA 3QCUL 4GO8A 1U3ZA 2G4GA 2IXQA 1DJGA 3ZKXB 4BKTC 1I7RB 1MLBB 4WHDA 4EUPG 2X10A 5AAWC 2GCYB 4F8NA 2HVJB 2XQBL 4O51B 5CZVL 5DMYA 1QFUH 4TQHA 5HVHC 1E2WA 4EVNB 3QUMA 1CG9A 3I74A 3IKCA 4AY0A 4F1SA 3BE1L 4EDWH 2V9RA 3SDCC 2DMCA 4KO7A 4PJGF 4D9QE 4PGJA 3KLHC 4P4KA 1EAOA 2E74C 1OAXL 2IFFH 4K2UL 3NFNB 3DTUB 1FHNA 5EC1B 3KHOA 5HDBF 2I07B 2MQCA 4E0RB 4KMTL 2VDKH 1JDCA 4F7KA 2FO8A 3V9CA 2H0PA 5D93C 1PCSA 3BEVA 2YWYA 3ZDZB 4XZUB 1G7MA 3EZJB 4OGAD 2EACA 3AG3B 4JM4H 2M8XA 3FU9A 1A7NL 5HP5A 5CF3A 1G5GA 4ELME 3CCHB 5TE7L 5ABDE 4R96A 4LCWD 2Q8AH 3LH8A 3WMQA 2JSFA 4JMXA 4NBXB 3WV0A 2Z92B 4X7FC 4UMGA 3APDA 2UUDK 2PXYA 3UGEA 3EO9L 1A4BA 1FE8L 3BOVA 4MCYB 3VX1A 1SBSH 4DVRH 4NKOA 2HTKC 3L95B 4LRNH 4P46D 1IQDA 1NOAA 1Q9KA 3T4AB 2Z31B 2OSLA 1K9TA 4JB9H 3P4MB 4G8GA 4XBPB 1JK8B 1E67A 3NJGA 4N8VG 4O2CB 4FQIH 3UERA 1IO4C 2FT7A 5LN8A 1QSVA 5DJZB 3X3FL 2ZUSA 4XXWC 3ARWA 3V6OE 3QDGD 3OHXC 4O4YH 2H45A 4QJ3B 5C0DB 4UBDD 4L18A 5GRVK 2NXYD 5I9QC 5M94B 3CFNA 3ZIYA 1TQWA 2OMYA 1HFUA 3VD9A 3QFDA 5KSAD 4K3DH 3DDGA 4GKZB 4PRPD 3X14B 4W9JC 1U8CB 3PPEA 1ZA3A 1I8IB 3HG5A 4M7KH 4XAKE 1P4IL 4JDEB 4J3BA 1PG7W 1LLAA 2NW2B 2K70A 3LH2H 4OQ1A 5E4EC 2XZZA 3KBHE 1RJCA 3EFOA 4DPAX 4P2RD 2XWTB 1KXQA 2CO7B 2EDKA 3EBHA 3K6OA 1AGEA 4WGVB 1E0OB 2YRZA 2BMKB 4WEEA 2AJVL 2Q2LA 4XRCB 3U7WL 2OL3B 5MI0C 1G1YA 1Q0YH 3GMLA 2EH8H 4QHKI 2X0UA 3STBA 4TNVK 4F7MA 2OMXB 1I3RB 1ORSA 2JLPA 3MV9A 2Z8RA 3POCA 4LRIA 1TTAA 2YD6A 1NCWH 1N67A 4JO1L 1BYOA 2DQJH 3OKMA 1NCUA 5KS9A 2YD7A 1CU4H 3UP6A 5ICXA 5ITBL 5DJ0B 5I8OH 2HTLD 2D7PA 4YBQC 4ZUTB 3S98A 2W07A 3OXRB 3C5ZB 4L8DA 3HAEA 1QFUL 2ZWKA 3ARRA 2HJKA 3C87A 5CP7A 2QKSA 5C8JB 2HG5A 3K6DA 4QPEA 4BEIA 3MOAH 4YHYC 2DLHA 2OMVA 2FATL 4BXSV 2XPYA 1XR8B 3QQDA 1RUMH 2DWYA 1MXGA 2F54A 5FYJE 5SWSB 2ADGA 3QNYA 1S5IH 5JW5A 2WQWA 3BDYH 5F93C 2WXKA 5EN2B 5I76B 2XIIA 2JKRM 1GKEA 1SOQA 3M07A 4AQ1A 1NBYA 2CLVA 1IEHA 1DBBH 2PO6A 1F4XL 2VXQL 4YXKH 1E90A 1TTFA 1FFRA 4JM4L 3BKYL 1GGCH 1KYOJ 4L3EE 3FSOA 3VFRB 1I8MB 4WSKA 2OMTB 5JIIA 3T77A 4FFZA 4F8OA 2GBAA 2Q8AL 1LNUB 4QCIB 2LGNA 3O81A 3VXOA 3ULAB 1IGIH 5HDOA 1IKNC 1SBSL 4TVUA 3RGVB 3OAZH 1SVCP 3KWVA 4LRNL 1JZ6A 3LXBA 5EU3B 3UZVA 5HHQB 1PZ3A 4O58H 2CBTA 1H5BB 4WWKD 4Z1PA 3RY4A 2YGVA 4JB9L 5DR5H 5F96H 4Z7AA 1YUKB 1UXSA 1A7BA 2YGPA 2VDOH 3QAZC 4FQIL 4X4ME 5D1XA 2CO6B 1VESA 3QJXA 4GI9A 4YSTA 3ARDA 4P59L 4JJ5A 1RUKH 4RGOH 2Z7YA 2DLIA 3NH7H 3WXWH 1I9JH 1XF5A 4O4YL 4A7UA 4QAMB 2CBOA 3PAZA 5C0IB 3U0PB 3DC0A 5CJXA 3GSXB 1X4XA 3ZMEA 1NQBA 2APWA 4K3DL 5DZAA 1QMUA 3L5WA 3HRZA 2MCAA 2XV2A 4P23D 3HLKA 3T65B 1CYWA 4WI2A 2C3GA 1UGKA 4M7KL 3IT8D 1KXVC 3O2DH 1PDKB 2B2XH 3MJ9L 5IB1A 3K5RA 4CAGA 3ABGA 3FO0H 5HI4D 4Z7QF 1H9DA 2P43B 5F0JB 4M7LT 3WIFA 2Q76B 3QJOA 1JJUA 2PPFA 5CBEA 2P3YA 4GSXA 4W1TA 3LH2L 3TBSA 4WY7H 4CVWA 1A9BB 1T5KA 4OIAA 3HG3A 4CMMA 3ZDYE 5LAXA 4DERA 2OSYA 5FGBA 1EHAA 2YUZA 1JCVA 5LGYA 4DK5A 5HPOA 4Z7VF 3KDMB 5BXFB 2ZG1A 3KBPA 3NIGE 4ONOA 4LK4A 4CW1A 1AXSB 4QHUA 3A6BH 1Q0YL 3QQ3B 4H0GA 5IY5B 5CGBA 1JFHA 2XPGA 4KDVA 4JGNA 4L8SC 3V5DB 3W81A 1XF2B 2LHAA 1NCWL 1C08A 3I9PA 3VFNB 2FVNA 4PJ5B 3ZOAA 1CU4L 2VW6A 3EH4B 1ED3B 1DVFB 5I8OL 4TOYH 5DVLA 4ZW5A 3LKSA 5E2JA 4KAQH 3KYMA 4DEUA 3VXSD 5F7NC 1HXMA 1OT1A 2IIJA 2UY7B 4QJ4B 2B59B 2ITFA 4MAYC 2WBWB 1FLRH 3GMNA 3MOAL 2ALWA 3FO1B 1N9PA 1BF8A 4Q9RL 4QRQA 4MHHI 5D7IF 3WIHA 1WQVT 2CGYA 2EH7H 5TTRA 1FRGH 3ZYIA 2X4QB 3N06B 4P4KD 1XQ4A 2A73A 4GAJL 4QWWC 4DK6A 5CZXC 2OPCA 4OM1H 4AITA 3F12A 1XIWD 1O75A 1AHKA 5C08E 4BZYA 2NYYC 2FWOA 1QZ1A 1AI1H 1VZGA 4FJZA 1TJIH 4QMEA 3EKCA 4OCSH 4ZX4A 2ICEB 4NCC1 5F7WC 1AAJA 2ZYIA 5LNEA 3BT0A 4MASA 4NKDB 2YRPA 4J2QA 3KPQB 2I27N 5FF6B 4YXKL 2PYED 5B3JE 5BV7C 2ERJC 3CQPA 3V79C 4LL9A 5IMOB 1KACB 4TNWF 4E9LA 1KTJA 3EYFB 2EDEA 4G70B 2VSDA 3ME0A 1CURA 5ALBH 1WHPA 4UNUA 3R4RA 4AM0B 2BSDA 3LRSB 3ZHFA 1OF2A 4Q58C 4YHKH 5B1AB 3BAJA 1XF4B 2RFXA 4FNUA 5CWSB 4TV3A 2BNQE 4I77H 4RBPK 2GBTA 4PRNB 4ANUA 4EZJA 1FYTA 4FCAA 3O4LE 1OCZB 5DR5L 2DW5A 3MOBH 5F7DB 5F96L 1A02N 5DJ8A 5D71H 2VDOL 4ZPTB 2YEVB 2BP5M 3U6RA 3QJZA 2OTUA 1ZS8A 1WAAF 1ZLDA 4JRYB 4LBEB 1FG9C 4NZTH 4Z7QB 4UINH 1RUKL 1PG7L 4PGEB 5EEYA 3WXWL 1QFWH 5C0AE 1I9JL 3OX8A 1DBAH 1AYRA 1JXKA 1ORQB 2JJTA 3FFDA 1IM9D 3IFNH 3Q6GH 1KTKE 1MJUH 2YRLA 5KUMA 4P3DB 1JG9A 4LSVH 4HC1H 4Z7VB 4NEHB 4PJDF 5E8NA 4U1JA 5LCVA 2B2XL 1N70A 2OP4L 1NWPA 4RH4A 5F97E 4IU2B 3ATFA 1WYJA 1O7DC 5G4NA 4GW5A 7TAAA 2OBGA 1BM3H 1M7XA 4QTHA 4FNRA 5E1HB 1XH3A 1CO1A 2V0AA 4ALAH 4QRTB 4ES8A 2IWGA 3EJCA 3QUMH 4XB8A 4NKMB 1Z5LB 4KTYA 4H8QA 2YD2A 1E28A 4G6KH 2ORBL 1ASOA 2YEZB 5FUOH 5GRXG 3VJ6A 1NGYB 2ENPA 4LOUD 4IGBA 4WFHD 4Y2DB 2WLIB 4J8QA 4XN5A 2CRIA 2ZYHA 3MV9D 5EFIA 4FFWC 3F04A 4JFFD 5FUZH 3RWCA 3VRJA 1I1AA 5D7IB 3IJ9A 5E8PB 3V4PB 3QIUC 4ZG1A 5A2JH 4OGXH 3GSRB 3O3EB 4TOYL 1GRWA 2ZF9A 3MFGB 1ZTMA 3JUYA 4QHLA 3B9AA 5HHNA 4N0YH 3UFIA 3UTSB 4KAQL 4JY4A 1M4KA 2R0WH 4KVPA 2CHDA 1E3XA 2AJ3A 5E95B 3UJTH 4FI8A 1FAKT 1K3IA 4KTGA 2CR0A 1LE5B 4KI5F 1FLRL 1YY9D 2Q6WB 4IS6A 3WE6B 1NFIA 2XJKA 5C70A 4A7VA 5GZOC 2EH7L 4HSQA 5FFGA 4OM1L 3IPFA 1WZAA 2ZXDA 4EJ1C 2X6BA 1N3NB 2CCLA 1AI1L 1QFHA 3B6SB 3FT9A 3GDBA 3ROOB 4OCSL 2XN9A 2NY0B 5DHVA 4GUCA 2NLJB 4HX1B 4RGNC 3SDYH 2PTTA 5E9AA 1JGDB 3RBSA 5BS0A 1PLGH 1AD9A 4XXCA 3WJJA 2JKTM 5I74C 3C8DA 4DPCX 2QLYA 2DWEA 3RWHA 1RL1A 4TNFA 4LGRB 5JDSA 4RFOL 4HF5L 4Y5XB 2VCOA 3DURA 5HXMA 4PI2A 1UT9A 2HRLA 4PB0H 2VDQB 2APBA 5I0XA 1T7VA 1W9XA 3OPZH 4XMUA 1KIPB 4C47A 3FHAA 4ONGH 1SDDB 3K72B 4N2DA 1E4JA 1KGCD 4KITB 2BZ7A 5MEQA 4YHIA 4Z18A 2ICWB 4FHKA 3PDDA 4NRXB 4Y5VB 5B1JC 3MOBL 1BZ9A 1HT6A 2O93L 2A5UA 4HS6A 4TS6A 4BUHA 1AZCA 2G0KA 4EDXA 2AANA 4N85A 4PJDB 2ZSWB 3FT3A 1L0XA 2Q9OA 4HDIA 4MCZB 1YJDH 4UINL 4Y4HC 3T6WA 2A9AA 5DGRA 2UZXB 5CNHA 2Q86B 4P5TA 4WWOA 2WLYA 1M05A 2VH5H 2RTTA 3KPMB 1DBAL 3MRBB 4X4MA 4AJWA 1G7QA 2NSXA 5HI3C 4EN3B 5C71A 2D0GA 1QUNA 3QEQA 1FDLL 3SKNA 3Q6GL 2EVHA 1MJUL 1A64A 1JV5A 2RQ8A 4LSVL 3L3IA 4HC1L 4W4OA 2R29L 2Y4SA 3KAAA 4WNQB 3UC2A 5K93A 1FFOB 3C09B 1N7MH 4KVCH 3ZZ1A 1J10A 2HB0A 3HFMH 1G7PA 43CAA 1HE8A 3GSOB 2DQ6A 3I75A 5GGRB 1TSHA 5DQJB 1CLOL 4WU5B 2NUPB 3QK0A 3HAEH 1BOGA 3SE9H 1SYSB 1ZHLA 2NY3C 1JZDC 2G2PA 5GGQH 1X44A 1P84J 3C8KB 1G4MA 5BOJA 4GRMB 5C2UB 4G6KL 5FUOL 1K3ZA 2DL2A 4PWHA 5IFJB 2MWCA 1MW0A 5HPMA 3MLWH 3LNIA 1S8DB 5CN3A 3ARBB 3MRCA 3ETBF 4QOKB 4M9OA 5I1IH 3WSQL 3U9PH 4NFBA 1IIKA 2A0LC 4XMWA 2FRGP 2QQNH 4GKLA 2D73A 2BRQA 2YUVA 4XOCA 5FDWB 4TSAH 5B1KA 3BUIA 5LN4A 3R06B 3NZUA 3DMMC 4OGXL 5IHHA 1W8OA 3W57A 5EU6E 4L37A 2R0WL 3P11L 1JGLL 1I7ZA 3UJTL 5F1SA 4FFZH 2NR6C 4M7JH 4PJ6A 1WE5A 1TQVA 5AW8B 5DQDL 1S9VA 2AJZB 1JPTH 1U8NA 3ALXA 3PWPA 2CIKA 5HVHB 3H8NA 3WE1A 3TESA 2R1WA 4YDIH 3GINA 3UTPE 4BDVB 4G8AC 4KV5F 5D2LE 4JRXA 3SDCB 2FE0A 3KCPA 2UX7A 1CYGA 3NJIA 1DANT 3QEHA 4FQQA 5DT1L 5LBGA 3SDYL 3NSFA 2XNAA 4JY6B 1TYRA 5F9OH 4EUPA 4FFVD 4FXTA 3WTSA 2L4OA 2Z1KA 3B7RL 4Z5RB 3NJLA 4UAHA 3QPKA 3TVMD 3DIVA 3Q44A 2WC7A 5EZIH 3EIFA 4TF4A 1PQZA 1E9OA 3M6DA 5D93B 3DX8A 2BHYA 1T2QH 4PB0L 1U4EA 2TSAA 1S7UB 1BJ8A 1VRSA 4HHAB 1W80A 4ZFGL 1ERNA 2VDNH 3UJJH 32C2A 1FYTD 4QEGA 2CO1A 3CD4A 4IIQA 5DJXB 1E5UI 1AR1D 3OMNB 3MRHA 4LSPL 2F74B 3MFFA 3OKLB 2EVIA 4LPUA 2BNQA 4ANKA 1RZFH 3WI9A 1YJDL 2ED7A 1QYGL 3RVTC 4AGOA 4L9DA 2BP3A 2VH5L 4QRUA 1H3XA 1IM3D 5EU7E 3IMWA 3MJ7B 2BVPB 4AJVA 4OQTL 1SMOA 4K7FA 2UVFA 2XFXB 1E5BA 4TUKH 3RIAF 3FT1A 4IOSD 3NK4A 4HXBH 3OHXB 3GWJA 5LB1A 3TA3A 1CCZA 3QJHB 5DUBB 5I9QB 4Z0BH 4XMLH 3C6LA 1T5WB 4KVCL 3VXRB 2BVQB 5DRZA 5SWQA 3MNWB 3U9UB 2HRPL 1LO4H 3MXWH 3PGDB 4N8VA 4XAKD 4XO4A 2Q87A 4G8EB 3N40P 4QLWA 3SE9L 3DX0A 4PY7B 5DLMH 1I7TB 4OSUH 2YLKA 3EO1A 2PPEA 3W39B 1ZGLP 4U1KA 2X12A 3KWXA 2J8HA 3U2IA 3WIHH 5E4EB 4HWZB 3HZKB 2LLGA 2Y1AA 3BX7C 4MA3A 4HD5A 3MRFB 3V4VH 3FT2A 4IGBD 1PZCA 3DV4B 1DBMH 1XXFC 4MD0B 5I1IL 3FOLB 3BVTA 4H1LB 4NN5C 3U9PL 1QG3A 4KUZH 2EIBA 1BEYH 1I1AD 2QQNL 1HOEA 4G7YH 5E6YA 5EU5B 1CDGA 3S5LG 4UOZA 7PAZA 4TSAL 1KB3A 4BFFA 1TNNA 4PLJC 5MI0B 5HYSB 1R3KA 2Y7LA 2SEBA 5D5ME 4OZFH 2W38A 4WNJA 4A38A 2I5YH 2PCXA 1QPXA 4KGLA 5HI5C 2EEXA 4FFZL 4BQ8A 5DURD 4M7JL 4H44C 4HLEA 1RY7B 1JPTL 5ICUA 1D2OA 3U6XA 3QO0B 4X98B 3CPUA 2H6PA 4OJEH 3E9UA 3U36A 5JHMA 2K1MA 4N2AA 5IHLB 1SUJA 4PP1D 2NT0A 4YDIL 3D0AA 4YHYB 5IIEA 4YC2C 4GQZA 3KPTA 4ENZA 1OF0A 1XCQA 2WIIA 3KJ4B 5EV7A 3QJVB 4BWUA 1BVKA 1ES0B 2EDNA 1IKFL 2D3JA 2VLKB 4PYGA 3MGOB 2P24A 3M1BB 4UM9D 1A8ZA 5F9OL 2ZOTA 4GT0A 2FJGA 3EDFA 1GC1C 4EMZA 1KTDA 3B2PA 4JDVA 5EZIL 1M57B 1P2CA 4YHMH 4PJAB 1HNGA 5I26A 1B2YA 4J8RB 3RPIA 3D0LB 4HPYH 4L3ED 4Z7NF 1YMHA 2EXYD 2KH2B 4F9LA 4XPFH 1S6NA 5LCVH 1XDTT 3L54A 3HMWH 3UJJL 3S37H 2QQKL 4Z78A 2X6MA 4ZQTA 2FZ3B 1U6AH 1XGRB 4IIZA 1NOFA 2Z4TA 1RZFL 4KRPC 1MFMA 4DGWC 1U8OB 1BVLB 1FG2A 4U1IB 1HSBA 5J89A 5C7XH 1TKWA 1GYUA 3QAZB 4QHNA 3QEQD 3PL6D 5IQMA 2RQEA 2IH1B 4WO4A 4UTBA 1RJZB 4TUKL 3TC9A 4E9RA 4X5QA 2ZX5A 4HXBL 2BH0A 4P99A 3H2QA 4X8GA 4Z0BL 4RZCA 4XMLL 2FR4B 1J0YA 3TNMB 3IVKB 4HKXB 2OSWA 3LAFA 4Q6IA 2FBOJ 2J8UF 3KLLA 3PV7A 2EIZA 5H4YA 4X7TA 4KHXH 1LO4L 1VCAA 3MXWL 3FBQA 4B9FA 4J3UA 2AC0A 4XP9L 1L7TH 1UD8A 4QRRE 3UAJC 1CFTB 4PV8A 1XBRA 2WQ8A 3QHZH 4G6MH 4RNRA 1OAUH 5DLML 2YUWA 5EIVA 3H9SA 3ZGIA 5K9KB 1Q94A 3ARTA 3L48A 1KB9J 1AQDA 2XTJD 3WIHL 4AJYV 3B3IA 5JORA 4HZAA 5D4IA 4ZUUB 3VMOA 1RUPH 1UTDA 4PLOB 3VCLA 4CVZB 1IBBA 3ZK0A 4B95C 3OKOB 5DK0A 1X7QB 2WNXA 1ZGLA 2CZNA 3RZCC 1BLNA 4N86A 5DA4A 3RFZA 5E08H 4FJYA 3RUGF 4OGQC 4MMXC 5I8CB 3BC9A 2HVBA 5DHVH 3UYRH 1CXLA 3CFQA 1THCA 2X4TA 3V6ZA 3OKDB 1Z3GL 4XBMA 1NCAH 4L8SB 3ZO0A 3C6SA 3IETB 2WB7A 3EW3B 1IC5H 5HJ3B 1T66D 3DRTA 4NM4L 3PP3H 3CGTA 3AW5A 4HZ1A 2AEIT 5FC9A 4F8TA 1VB9A 4AZ8A 1T1YB 4WI0A 3HE7C 1IGTB 3VRIA 4FQJH 1E9PB 3EHBC 4MAYB 1ZJBA 1BSIA 2OULB 2P46B 2DQGL 4HU2A 3CVDA 4EIGB 3H55A 4JRXD 2RGSA 3ZDZE 2GJZA 4GUOA 1YMME 2ZXWB 4LVHC 2EINB 4Z7NB 1K85A 2X4PA 4AIXA 5CLWA 1XGPA 4OD1L 1OSPH 3D52A 3M45A 1S7WB 4JCMA 2QFRA 2MKWA 1OPOA 4X4XB 1N19A 3ZSTA 3F7PC 2BS8A 2P5EA 4KFZC 1XR9A 2DD8H 3O3DB 4TUOB 4YHML 1QATA 5SWZB 1KENL 2PYFA 2XHNA 1HESA 1PYWB 4HPYL 1LHZA 2ERJB 2YSTA 2COQA 5AZEH 3MGAA 1LEGB 5KW9H 4XPFL 5LCVL 4PCKA 1EPFA 1EZLA 3TO2B 3HMWL 3G9AB 1DSYA 3JWNG 4I9XA 3VE0A 3S37L 4F7TA 2DJSA 4HIEB 1IKOP 2VQUA 3QG7H 4Y9EA 3MLYL 2QSCL 3T1FB 4DP9X 4ZMXA 1DYZA 2QLVB 2ZWSA 3AS1A 4KKAD 3SQRA 1DL7L 1U6AL 3VI4F 5JYMA 1FAIH 1YEGL 4ZT1A 2BNQD 4LDLB 1J48A 2QADD 3ZRCC 1EQWA 1XEDA 2J8UB 4HKZB 4WKZB 2BWQA 4V33A 5C7XL 2E7HA 1S4IA 4CSPA 3OJMB 1DQQA 4KXAA 3MRKB 4H5SB 3OVUB 4EO5A 4OJCA 4Z7IA 5DRXB 5C0AD 1CLYH 4OJDH 2JB6B 3ESMA 3F6JA 3PAVA 5GHWL 1B3IA 3F2LA 3TA3D 3ORJA 4TKWA 3V5HB 2K4WA 1KBWA 4HIJA 4J3OG 4LIQE 2Q5BA 5FYKU 1NIBA 3QQ4A 4KHXL 2PCYA 1HSAB 1NIFA 1L7TL 1NGXB 3RUGB 3UYPA 4N0FA 3S97C 2AQNA 1M7DA 3QHZL 4G6ML 1OAUL 4LP4A 3AC0A 2KZBA 1ZWIA 2HFEB 3LZNA 1D5MB 1VF5C 3W82A 2CNYA 4XCYB 4DZ8B 1ZD6A 5M95B 5I2IA 1OXYA 2JQZA 3JV4B 3QUYC 2E7DA 4XNYL 1RKRA 3VFWB 4LCUA 5E08L 1CLZH 1E4HA 5DJCA 4HEME 1BM7A 3AREC 1ONQA 1Z0NA 5IB4A 4ZJ9A 4JG5A 4ZTPH 1FNHA 1NCGA 3UYRL 3WDHA 4L8BB 4EUPH 4W9LC 4Z3IA 1NCAL 2BP0B 1NFDA 4NRYA 1INQA 4R9HA 3L3OC 1IC5L 3QIUB 1KXTB 1KPVA 3KLAB 1M7UA 3OWEA 3WFCH 2F9BT 2R2EA 4YOKA 4V2BA 2QTEA 3MUJA 3II3A 4FQJL 3UO8B 4LCYB 4K9EC 2CHNA 4KQ4H 5SX4H 4F91B 5E0FA 1C5CH 1IAIM 4UQ3B 3B37A 3D5OF 3I9IA 1VJSA 2DF3A 1VFBA 2B4CH 5IHBA 1WC7B 1OSPL 3QCTH 4Y2OB 1IL1B 2OI9C 2F7PA 4U6YA 43C9B 2Q7YA 4LLMA 4XN4A 5FO8B 3L4YA 4GIAA 2X70B 4FHJA 4GW4A 1PZAA 4B5EA 2EABA 4KWUA 2DD8L 5JIHA 4IU3A 1PX4A 4RGNB 3KNBA 3VI4B 2EYTB 2Q8BL 3IRPX 4G6AC 3BP6A 1OTUC 5D70H 5I74B 4Y9BA 2A6IA 1FC1A 5AZEL 3CVHB 3HPLB 5KW9L 1HCZA 1SDYA 3VRLF 1CK0L 5E6ZA 5ESQA 1C16B 1U8KA 5C6WH 3TURA 2NY7H 3NJFA 5A7EA 3ECQA 2DKSA 4OZHF 1AKJD 4H13C 4NO5A 3AUVA 1B6DA 1J88A 5KYXA 5KVDE 1JWSA 4LCCB 3SSGA 3UBFA 2Y7QA 5C9JA 3AMKA 3VXPB 1A0QH 2GEEA 4F2FA 5LGJA 5CUSL 1Y18A 4A2EA 4CUCA 3U46A 4YEEA 4YSQA 1F11A 3UPAA 4UNIA 2Y5TB 1YLBB 4ZMWA 1I3VA 3MROA 1KELH 2JKSA 3H6AA 2NX5E 3SDDD 5JA9A 3B2VH 4K3GA 2HN7A 1CLYL 3ZUCA 4Y4HB 3NFPB 3WIAA 1JFQL 2AQPA 1FNGB 4OJFH 2GTZB 1JSYA 5FGSA 3CC5A 2IALB 4BWTA 3G5XB 4GP4B 4TNGA 4TNWK 1HZHH 3TCLA 4E41B 4G59C 1MY7A 3ARFA 3AWGA 1NOLA 2XQYG 3CFBB 5E00B 4G80B 2HFFA 5TJWK 5KYYA 1R17A 2GQHA 1BZOA 4YGVA 2YQGA 3KXFA 3FUJA 1T4KB 5E4AA 3RWIA 2XC8A 3VXTA 2HX9A 3H9SD 5IT2L 3PNWA 2ZD0A 3IB4A 2AGJH 3HKZA 3NSXA 3EH2A 1ZHNB 3G5ZA 4OLZL 4Z3EA 3K8KA 3GBML 1P53A 1UQSA 2NY3B 3H0TB 4OIFA 3FKUS 3QFGA 5FW6A 1DDTA 1ZHKA 2H26B 4PJ5E 4TTDC 2X4UA 3EGSA 3E6FB 5EF3A 3QULA 2H9GB 3QS2A 3NRFA 4AYMC 1CYXA 3QRFM 3VG0H 2XOTA 2EP6A 4X8CA 2HKFH 2N3JA 1M1XB 2YJLA 4YWGL 2XG4A 2A1WH 4LLDA 3DTXB 5GZNA 2PLTA 3WFCL 3DMMB 1WBZB 4Q0XL 5EU6D 1NC2D 3U7AA 3U83A 2AV1A 5I1DA 3BWUC 1FNSH 3BD4A 3GM0A 2J6WA 4JVWA 5IQ7H 4WFGE 3VD0A 2ETWA 4KQ4L 2J6EL 3GGWB 1LGVA 2V2WB 3GJFA 4FQHB 4GAYA 5D7LB 2CALA 4JKMA 4LEBA 2EEFA 2DI7A 2B4CL 1CB4A 4AG4L 5BVPH 1RU9H 4MD5A 1XV8A 5H94A 3LZFH 1SJEA 3A23A 1A7RH 5JO5B 1CDBA 4OZHB 4HBCH 3RWDA 1YMMA 4NT6B 3CVBA 5EOCJ 1XGYH 1N6QL 2QJDA 2D7MA 2WO2B 2ZOUA 4AX3A 4AMKH 4DO6A 1JZ8A 4MS8D 2HKAA 2P4AB 2EDYA 5D70L 5J6HA 4UTBH 4HIQA 4PJ9C 2IPKB 3CAFA 3STLA 1GS7A 3CQFA 2VABB 2EXWD 3C5JA 3ZHKA 5FR3A 4OV5B 2Z91A 2QPEB 4GW1B 4X4ZA 3PDOB 1AJ7L 1DO5A 5T1DH 4JRYE 4Z7QE 2WJ7A 5TDOA 2BY2A 2TRYA 4NO0A 4ANWA 4ES9A 4MLIA 3LKNA 4Y5YC 1G7JA 2OYKA 4LKXA 2XQYK 1QKZH 4AYBA 1DCEA 1QA9B 1BPLB 1KELL 3HN8A 3QFJA 4Z7VE 4K23H 1QEXA 3KEHA 1YN6B 2CPUA 3EYQC 3FF8A 2V2XB 3FF7A 2WXIA 1VFMA 2JWYA 2H1PH 4KK9C 3DGGA 3PUUA 3EBGA 5MERB 5DJDA 5EHFA 4OAWB 2AVGA 2CBPA 1HZHL 4JKWA 3BFWA 3IFPA 3VH8B 3MLRH 5JA8B 3TIDB 5E8EA 1KBPA 2Z8VC 2XFGB 1SQ2N 3KYNA 5IGXH 3WFDL 3FUMA 1UVQB 5I1KH 4PWIA 4Y89A 5CSZA 5I1AA 2AGJL 3IGKA 1JD9A 4EE2A 3WUZA 1RZ7H 1U8MA 4GRWF 1PFCA 3T0VA 3DECA 3R1GL 5C0GB 1T04A 3NGBC 5D7IE 2PETA 5C0BB 3VG9C 5I0DA 2JE8A 4R5TA 1BYPA 5FUCE 4BHUI 2P5WE 1GA2A 4WLCA 1D7DA 1FVCB 4AW7A 2YA2A 2CH8A 1G84A 3ABKB 1GCYA 3UTSE 4DKFL 5JZ7C 3FQTA 2NXZD 4BJLA 2MHAA 1Q8MA 2OMNA 3VG0L 1B0WA 2WXFA 2YBRB 1LVEA 2KC0A 2VXVH 1TU2B 2HKFL 2O1AA 2WN3A 4JFYB 3EOAA 3TFKD 2A1WL 1TJXA 1JPEA 4G1MB 3UL4A 5TPWH 4FXKC 3CDZA 2A6JA 1FL6A 5HHOA 4NPYA 1FNSL 3S3PA 4ZMTA 4NS0A 1WZLA 1F4AA 3K4ZA 3LIZA 3S5LA 2CJUH 4I48B 4LLQB 4H26A 4EI6A 3HG1A 3GHPA 1RU9L 4MA8H 4V1DA 3VGFA 1SNRA 3JWDL 5JXEA 1BQ5A 3LZFL 3ES6B 1HKLH 1MWOA 1INDH 5KJ4A 4BELD 1A7RL 4DIXA 2YFNA 2DN7A 3PXHA 5B38G 3KGUA 3L5IA 4YC2B 1WAAE 1JE6A 1KBVA 2VL5B 5IF0B 1XGYL 4JAMA 2FO4A 1XMEB 4Z7OB 5EF2A 2EIMB 2Z65C 5IR1B 3GSUB 1DEEA 1JMXA 4UTBL 5BZWB 4R0LA 5AOZA 3BUTA 3FBKA 4N9GA 3TO4C 3UZEA 3B2DC 4IW4C 4DKEH 1TZHB 3BVNB 2F2HA 1S9YB 2E7BA 3BPCB 4I0KA 4R7NA 3IMVA 4PJDE 1SZNA 5E5MB 5T3ZE 1U95B 5T1DL 4DETA 4B97A 1UWXK 2ATPB 4TPRH 1RZKH 1CICA 3P73B 4DKAA 1PZ5A 2Z1PA 2YZ1A 1QSZA 3UTTA 1GJWA 4G6JH 1EDQA 4CSZA 4G3YH 3ML9A 2EDBA 1MHHB 3DHJA 1QKZL 3P2BA 4U1MB 1DQLH 2QVMA 1JWMA 1PIFA 3BLBA 3HNTH 4GOSA 4PV9B 4GNKB 4QYAA 3UOAB 5HBBA 4LKCB 3RQ3A 3F62A 1OWRM 4KJYA 4QT5B 4LXFA 4KRPB 1EH9A 4UILH 2H1PL 1S7RB 1WIPA 1YQVH 2GVYA 3DKHA 2EVGA 4NNYA 1CQKA 3LIUA 1H6FA 2NX5A 4GRWB 1NBCA 3IJHA 3MLTB 5DZ9A 3ZMNA 5J11B 4IDLA 1JOIA 2F18A 3LV3A 4H8UA 4QRPA 3IXAA 4U6HB 1WWBX 4NUQA 5JYLA 3KPRB 3VFTB 4E36A 4G42B 4NCDA 3MUGB 5F1OB 5F88B 2HJLA 2JJSC 4JQVA 4M1CC 2EEBA 2DWDA 3B7YA 3INUH 1OE1A 2C3VB 3NT0A 4XCEA 3GSQA 5IGXL 3MRLB 4WI3A 3SE8H 3HVDA 4G72B 4Q2ZA 3AY4A 1TJGL 4WW1A 1MFAL 4QRRD 3Q8EA 5DSCB 1RZ7L 4P46C 4KI5E 4QOKE 4MQTB 5LWYH 3GIVB 4FG6D 3RWEA 3FB8B 3VFMB 3V9EA 5KJRH 3HE6A 1MIEH 1ETJA 1KTLA 5IBTH 4CGTA 3FQRB 5INDB 4JDZA 1U8PA 1H6UA 1R5IA 5I1JH 2EE9A 4S0SD 1U30A 3RZCB 2A9BA 3RILA 3OSKA 3IDJA 2NXYC 3MOQA 4X6DF 3RBGA 2VE6B 2VXVL 5ECGA 1TPXC 3RIAK 5KSAC 2OMZA 3K6NA 5HVGB 5T5FA 4BK4A 3IFLH 3HHSA 3KVQA 4W93A 4Y19B 4ZXBC 3MRDB 4BH7B 1PX3A 5TPWL 1E43A 4FTVA 1AQHA 5AAMC 3RIFK 3U4KA 1INEH 1UZGA 3BH9B 2B14A 3L3HB 1I8KA 2DWXA 4XP6H 4ZD3H 1ZV5A 4XN7A 4PGDA 4XO5A 3L7FB 1DTUA 1S9KC 3ILPB 4YPGB 5HYQA 4UOQA 4EZMA 1I1YB 2CJUL 4JO4L 4RA0C 3ZO9A 1LO5A 3HE7B 4MA8L 2RCSL 1D5ZB 1HKLL 2W9EH 3VXUE 1W0VA 3EHBB 1P7HL 4QY8B 5I16B 4UZGA 3B1TA 1YMMD 4X99A 4NAJA 3EJYD 4PRAB 1TLKA 4U6XA 3LB6D 1EAPA 4LVHB 4E9QA 1CT8B 3GXTA 4N2BA 4WUKH 3KPNA 4E9XA 4MDRA 4CBPA 2CXGA 1JTOA 1L5GA 1XEUA 1KT2A 2W9DL 3BFQG 3T3ME 1HL8A 5K39B 5TH2B 4DKEL 5KOMC 2VR6A