The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
98
|
sequence length |
347
|
structure length |
347
|
Chain Sequence |
AMALNTNQLFAYLNRGDIAEFKFSPLFTTLFFPNVATFSTQNIMLDTLDIEEVTMSAFCSPMVGSQVQRDKGYETSTIKPGYMKPKHEIDPTKTIMRMAGEDPAQLNDPTYRRMRLITGNMRRQINAIKARVEWLAVNAVTTGKNIIEGEGIERYEIDWKIPEKNIIEQADGKKWSEQDKETHYPIYDIELYADQAGCPANVMIMGAEVWRTLRSFKKFRELYDLSRGSESAAELACKNLGEVVSFKGYLGDLALIVYSGKYTDSDGTEKYFLEPDLLVLGNTNNKGLVAYGAIMDQEAVRTGATQNMFYPKNWIEDGDPAIEYVQTHSAPQPVPADIRKFVTVKIA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Structural genomics, unknown function
|
| molecule keywords |
Putative capsid protein of prophage
|
| publication title |
The crystal structure of the putative capsid protein of prophage (E.coli CFT073).
rcsb |
| source organism |
Escherichia coli cft073
|
| total genus |
98
|
| structure length |
347
|
| sequence length |
347
|
| ec nomenclature | |
| pdb deposition date | 2007-12-20 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF03864 | Phage_cap_E | Phage major capsid protein E |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | Super Roll | putative capsid protein of prophage fold | putative capsid protein of prophage domain like | ||
| Alpha Beta | 2-Layer Sandwich | capsid protein of prophage fold | capsid protein of prophage domain |
#chains in the Genus database with same CATH superfamily 3BQW A; #chains in the Genus database with same CATH topology 3BQW A; #chains in the Genus database with same CATH homology 3BQW A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
