3BR1A

Crystal structure of the complex of dequalinium bound to qacr(e90q), a mutant of a multidrug binding transcriptional repressor
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
186
structure length
186
Chain Sequence
b'NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTQYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator qacR
publication title Formal electrostatic interactions do not govern QacR-cation affinity
rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 82
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2007-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3br1A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3br1A02
1ETQA 4M3EA 4A3DJ 1XS9A 2LVSA 3Q0WA 4JX4A 2RHAA 2DA2A 2R5YA 5J1UA 5EEAA 1T33A 3JRDA 3S1NJ 1IDZA 1ETKA 5F0HA 3NI7A 5GPAA 4RBOA 3L1PA 2GENA 2DA6A 3BR6A 2LKXA 3HB9A 1JJ8C 3LJLA 5FJ8J 2HKUA 1UG2A 1ETXA 2FQ4A 1Q1VA 2IBDA 5IOYA 4I6ZA 2ZCXA 1ORKA 5F27A 2CRGA 3VVYA 2UXPA 4GFBA 2EQRA 1NK3P 2VI6A 2OPTA 3LNQA 2NOGA 5F0CA 3A03A 1DU6A 2G3BA 1ZK8A 3B6CA 3GTQJ 3VOXA 4AUXA 4V2FA 5FKKA 2TRTA 3S1RJ 3E7QA 3LSJA 2EZLA 2B63J 4IEJA 4XK4A 2DG8A 4DZPA 1I6HJ 1B8IB 3ZQCA 1ETYA 3M4OJ 3OOUA 5EZGA 5IYDJ 5FLMJ 5FHPA 3RD3A 3AQSA 5EDNA 4B3AA 5IP9J 5IPAA 4MFDA 1GT0C 3HTAA 2JMWA 2EBIA 2XGDA 3H0GJ 3BT9A 5D18A 3HGGA 1FIAA 1K61A 1LFBA 2X6OA 3BTLA 3VW1A 1VNDA 1JKOC 4A3BJ 3S16J 3VP5A 2VPRA 3VVZA 1T56A 3BQZA 2W53A 3E7LA 4G12A 2HYTA 1U8BA 3VIBA 1FTTA 2ECCA 2JK3A 2NVYJ 2WAQN 2G7GA 3GTPJ 5IYBJ 1AU7A 2LFBA 2QWTA 5IP7J 2MGQA 4DYRA 2XPVA 2Y31A 1LE8A 2H1KA 1IC8A 1HCRA 3S17J 5E3MA 3I4NJ 2M0CA 2HXOA 1P7IA 4A3IJ 1JKRC 3NRGA 1JT0A 2RAEA 4UUTA 2F07A 2G7SA 2NP5A 2ME6A 5GPCA 1U9OA 3BCGA 4W97A 4IHYA 5EG0B 3JRGA 4JP0A 2FBQA 1BW6A 3S5RA 3NPIA 3COLA 2DMUA 3QKXA 1RESA 3HOWJ 3GTGJ 4NELA 1MBKA 2LLKA 1WI3A 3WHBA 5IP6A 3ON4A 1MH4A 4BY7J 2JJ7A 2AHQA 1FIPA 3QPLA 4D5CA 2XGEA 3HEFA 2HI3A 3T6NA 2DMNA 2GM4A 3P9TA 3BJBA 5EGOB 2HYJA 2L0KA 3BR2A 3D1NI 4MXMA 3A01A 1ZR4A 5EYRA 2UXUA 1UI6A 1RKTA 3BTCA 3ZQGA 2NP3A 3HKZN 2IU5A 3PASA 2HOSA 2UXIA 3A02A 3F1BA 4XIDA 1E3OC 2WUIA 2NS7A 3ZQHA 2YS9A 3FRQA 1MSFC 2E2JJ 1ZQ3P 1IG7A 5FLVA 2O7OA 1UI5A 2HQ5A 1VFCA 2E1OA 3G1LA 2V57A 1UMQA 4M3BA 1FEXA 3K7AJ 4A69C 2R5ZB 3KKCA 3VOKA 5C3EJ 3WHCA 4X6AJ 4RDUA 4HKUA 2VUMJ 3NXCA 2Y9YA 2DJNA 5JLXA 4FTHA 3PPBA 2YU9J 4YZEA 2Y9ZA 3AQTA 2JN6A 5HODA 3JSJA 2O7TA 3EUPA 2ZOZA 1B8IA 2MG4A 4HNVA 4QSHA 3LSPA 1WH5A 4BXXJ 5J1YA 3MNLA 4M3DA 5FKNA 2FJ1A 3JRCA 3DPJA 2EH3A 1F36A 5M5XJ 2JA5J 3LSRA 4M3FA 4A93J 5GP9A 5D19A 1JUSA 3LWJA 3HM5A 3FISA 3RZDJ 1HDDC 1QVTA 4FE7A 2DA1A 5K58A 1MBEA 1Z77A 5C44J 2ID6A 2XSDC 3CCYA 3PO2J 3HE0A 2ECBA 1IJWC 2XGCA 3BHQA 3NARA 2QTQA 1Z0XA 2M34A 2HXIA 3JRAA 2DA7A 4C3HJ 3KNWA 2DMPA 2QF7A 2UXHA 1AKHB 2OF7A 2YUSA 4XRSG 2JA6J 2DTZA 3GTJJ 5EG0A 1PUFB 1MH3A 1JKPC 3CDLA 2L7FP 2TCTA 1MBHA 4W1UA 2COBA 4C2MJ 3B81A 2K9QA 1TWGJ 1SANA 1MBFA 5IOZA 3VVXA 3GEUA 1ZTRA 2NVQJ 1S7EA 2GFNA 4FCYA 2ID3A 3ZQLA 3V78A 1WGXA 3S1MJ 2JA8J 3VW0A 3IH2A 1X2MA 2EZKA 2E2IJ 2OERA 5JLWA 4BKXA 3VUQA 2MSYA 2ELKA 2M8GX 4MO7A 4NDLA 5EGOA 2NVTJ 3S2DJ 4XRMA 3DEWA 2CQQA 5BNGA 2X9DA 3S15J 1WPKA 3FK6A 1WH7A 1ITYA 2EZHA 3BQYA 1BA5A 4A3JJ 3ANGA 4GCKA 4CYCB 5E3OA 2R92J 3NNRA 4D7NA 1IGNA 3BR1A 3LSGA 2O8KA 2QKOA 4A3FJ 3CMYA 2Y30A 3TW7A 3MN2A 2XPUA 4V2GA 3G56A 2FX0A 2QCOA 2HOTA 3S2HJ 5HBUA 2DG7A 3EGQA 5E3NA 4M6VA 2K9NA 3CJDA 3RKQA 4MFEA 1ETOA 2P81A 2ZOYA 3HOUJ 3G1OA 1A6IA 4I76A 2R5ZA 2VKEA 1K83J 2LTPA 4L5EA 5C4YA 2NS8A 1ZKGA 3IV5A 4C3JJ 1CQTA 2K40A 2W48A 4XRSA 4JL3A 3QPSA 3G7RA 4AYBN 1X58A 3BTJA 2GLOA 5EFYA 3HBLA 3RZOJ 4A3CJ 2NX4A 2E19A 3ZQFA 4EEFG 2ZCNA 1OCPA 1D5YA 2K9SA 2M2EA 5F08A 4DZJA 1A5JA 2QOPA 5EF6A 1QVUA 4GCTA 1MNMC 1H8AC 2CUFA 4ACIA 3G1MA 2LD5A 2ZB9A 4JNNA 1O4XA 3TEDA 3GTKJ 4ABZA 5HAWA 4GFKA 2XDNA 1TWAJ 3HOXJ 4UUSB 3CWRA 1H88C 4IHXA 1GUUA 1ZR2A 3JRHA 2L7ZA 1I50J 4B1RA 3SJMA 2O9LA 2WGBA 2D5VA 3QBMA 1GDTA 3BR3A 2DA3A 4FE4A 4BBSJ 2UXOA 3IH3A 3UKGA 4ICHA 5D1RA 4A3MJ 1R9TJ 5FKLA 2GBYA 3Q3SA 3BR0A 5CW8A 3BRUA 5DAJA 9ANTA 3FIWA 4CGRA 3CQZJ 1AKHA 3VW2A 3BG3A 3HGYA 1JUPA 1W0UA 3BR5A 3BG9A 5K7HA 3QQAA 1JKQC 1PUFA 1YRNB 3NAUA 1DU0A 4QTRA 2XRLA 2CUEA 3LOCA 3GTLJ 1MBJA 2PMZN 5FKOA 2KT0A 1X2NA 2VKVA 2L9RA 1QRYA 1FJLA 3GBGA 5HSZA 3ANPA 4BY1J 4A3GJ 4J19A 3ON2A 4A3EJ 1MBGA 5FMPA 3HOYJ 3FK7A 5DTDA 1VI0A 1U9NA 3HOZJ 4XICA 1LFUP 1U78A 2LP0A 5F1JA 2HOAA 2XPWA 2Y0SN 1SGMA 3KZ9A 1HLVA 3GTOJ 1G2HA 4NN1A 4IHWA 1OJLA 5M5WJ 4CYCA 1ETVA 5H9TA 1P7JA 3H3VK 5IYCJ 2H8RA 1VF9A 2REKA 1RPWA 4S0HB 3MKLA 2FD5A 4MLOA 4M3GA 1B72B 2HDDA 5K7ZA 2IAIA 1BL0A 3FKIJ 2WV1A 5J1RA 2EZIA 5M3FJ 4JX6A 4D5FA 5E3LA 1AHDP 2DA5A 4AC0A 5AQCA 3BTIA 3JREA 3Q0UA 3M3YJ 1JJ6C 4DYQA 3JRBA 2ME0A 3SDGA 2GUHA 5CXIA 4JYKA 3LHQA 1MSEC 2R5YB 1RR7A 3IUVA 2ZCMA 5M5YJ 1BJZA 3C07A 3HTHA 1JTXA 1XC5A 1I3QJ 2G7LA 3Q0VA 1TWFJ 5C4JJ 4IHVA 2PBXA 1EF4A 3OSGA 1OCTC 4Y7NJ 2I10A 1WCMJ 3JRFA 5FGLA 2CJJA 3JRIA 3DCFA 1RKWA 1IDYA 1Y1WJ 3GTMJ 4A3KJ 3HTIA 3I4MJ 1FTZA 4UUSA 1XG1A 2LK2A 2M9HA 5EZHA 5C4XJ 4AC6A 2PZ9A 3O60A 2D6YA 4JKZA 3HIMA 5J3LA 3ZOBA 3OSFA 1HF0A 2E2HJ 2NVXJ 4DW6A 2DMTA 2LY9A 1BW5A 2X48A 3W6VA 3PM1A 2LR8A 5F0FA 3O8GA 1JGGA 3BNIA 2WB1N 3RQIA 2CU7A 1W0TA 4L62A 2Q24A 2CQXA 1ZGWA 4X1EA 2OI8A 3B6AA 4BBRJ 4MK6A 2QIBA 3TP3A 2XB0X 4C3IJ 4GFLA 2RASA 4QIWN 1GV2A 1YRNA 4B4CA 3IH4A 2XB5A 5F04A 2R7ZJ 3HDDA 3V6GA 3SFIA 4DYCA 3MVPA 1IRZA 1TC3C 4D7MA 4LOCA 2DMQA 2YVHA 4FISA 1QPIA 1JTYA 3ZQIA 1LE8B 3S14J 1NTCA 1JT6A 4JX5A 1Y1VJ 3O8HA 4Y52J 2JWTA 4MIMA 2AO9A 3GZIA 4PXIA 2Y2ZA 3CRJA 1APLC 3JR9A 1JUMA 1OFCX 3VPRA 2YVEA 2L7MP 1TWCJ 2IEKA 4A3LJ 1IUFA 4AF5A 2KDZA 1NK2P 5K7FA 3S1QJ 2N8GA 1IV6A 1GV5A 1ETWA 3OIOA 1UHSA 1B72A 5DS9A 3HTJA 1HDPA 1ENHA 3K2AA 1TWHJ 5FKMA 1H89C 2DN0A 3C2BA 2MW8A 1SFOJ 1F43A 3TP0A 4KWAA 3PO3J 2R0QC 1RETA 1HOMA 3HOVJ 2G0EA 3BG5A 5CXGA 3TW6A 4ME9A 4UDSA 2DA4A 3F0CA 1GVDA 3A01B 3KKDA 5M3MJ 2JA7J 3RH2A 1POGA 2R93J 4GCLA
chains in the Genus database with same CATH superfamily
1ETQA 3DBHB 4C2UA 3QPTA 4IOAF 3DLLF 4JX4A 1V4RA 2RHAA 2LC2A 2RNGA 3VWBA 3U1KA 5D5WB 5F0HA 1AOYA 3LJLA 2DA6A 2E71A 3L09A 2IW5A 3BPVA 4GYIA 3E0JB 3K4KA 4UV8A 3BZCA 2IBDA 5IOYA 4UVCA 1X4OA 4I6ZA 1ZRCA 1UCRA 4JK1X 2CRGA 2H1LA 5F27A 2ZCXA 2L01A 1NK3P 2ICWG 5F0CA 3ZR8X 1DQUA 1DPUA 5GAGJ 3FMRA 2G3BA 1ZK8A 2FXAA 3GTQJ 4AIDA 3CJRB 4AUXA 1QBJA 2NS0A 2DG8A 1IN6A 4XK4A 4KITB 4YIFA 1B8IB 1ETYA 3M4OJ 2VASA 3GZ5A 5E20A 1WRJA 4UY8I 3KZZA 2BY2A 2V6EA 3K8PC 2QM3A 1SFXA 4B44A 3J80Z 4E7JA 4U9LA 1Z6RA 3HTAA 1N75A 1STZA 2KZVA 2KFDA 3LSTA 2EBIA 2MC4A 4M9XA 4RS8A 5CPRB 4CXFA 5D18A 3HGGA 1TZLA 2PQ8A 2VBWA 1LFBA 2X6OA 4RA2A 4AD9A 1JKOC 2CQNA 3VVZA 1XSDA 2X6WA 1MJBA 4G12A 3VIBA 1Z6TA 3W2WA 4F52A 2JZYA 2HQAA 2X1EA 3K70C 4PFOA 1B4AA 1OR7A 2JSPA 4WX9A 1FP2A 5IT9Z 1HKTA 5LHGA 2MFZA 3GEZA 1ZYRF 4NQWA 3OYGA 3GX4X 2M0CA 3NRVA 2HXOA 3C1DA 2HQNA 2RAEA 3ZCOA 1VQLI 1W5TA 2F07A 2HPMA 3FXMA 2ME6A 2VC0A 3I4PA 4RGSA 5EG0B 3R0AA 5L3EA 1OYYA 1XD7A 1JGSA 3B73A 4LITA 5H20A 1I1GA 4XKCA 2GWRA 2DT5A 3ZMSA 1YOVB 3KYLA 3E97A 1TL8A 4BXUA 1ZREA 1KONA 1Z91A 4U7BA 3ON4A 2ETHA 2AHQA 4HEA2 3E1SA 3TDUC 2QQ8A 4MEYF 3HEFA 5J8CA 1K78A 3I9V2 5EGOB 2HYJA 2MD5A 3BR2A 3GW2A 2R3SA 3WTXC 5LD2C 1BBYA 2NYXA 4MXMA 3KP5A 3CO7C 4U9NA 3R4KA 1VQ5I 3BTCA 2IU5A 1HXDA 3FHNA 3OYCA 3HHHA 3F1BA 4XIDA 3O6BB 2WUIA 1TLHB 1BI0A 3KETA 4OMZA 1OMIA 2KIQA 4N9IA 1U6GA 2COMA 1ZQ3P 2E35A 1B9NA 1OCOH 2HQ5A 4M72A 2E1OA 3G1LA 4C2TA 4PJ0C 3RTRA 5ICFA 4CYDA 1V5EA 1S7OA 3EUAA 4A69C 4X6AJ 4Y33A 4H0EA 2O3FA 3HSRA 1Z7LA 2VUMJ 2VBYA 2VXDA 3O2PE 3WGIA 3T8RA 2F5EA 1B1BA 3LSHA 1FNNA 3UNGC 5HODA 3EUPA 2EIJH 1B8IA 2BGCA 3KP3A 4BXXJ 2RN7A 1J09A 2B9SA 2HVSA 4EM0B 3KZIC 2EH3A 3KE2A 3S93A 1OYWA 5DM6F 1GLNA 2HPIA 2W85A 2CS3A 4M3FA 5H6RA 4PJLA 3OV8A 3FISA 5EEHA 1XX5A 3RJPA 1RR8C 1Y56A 1SAXA 4E7SA 1FYKA 2DA1A 5L3GA 1MBEA 1XPXA 1Z77A 1MMAA 3HE0A 2XGCA 4HG2A 3BHQA 4WK8F 3JSOA 3NARA 4ZDLA 4A0XA 5ICCA 2M34A 4OD4A 1BOBA 3ERMA 2DMPA 3ABMH 2JQ7A 2UXHA 3HYIA 4QPOA 4PCQA 2GIZA 2WA0A 2KLOA 1M1EB 1ZLJA 1V55H 1LPQA 2DT6A 4KIFA 1X3ZB 5DD4A 5D8KB 1U8RA 1XGNA 1QZYA 2DTZA 5K5RA 3GTJJ 1LDJA 3AFHA 4DQ2A 1U3EM 2WY8Q 5EG0A 1PUFB 1JKPC 3VYRB 4HDUA 2BXZA 3I58A 2P7VB 1P92A 1QHHD 1SANA 1TWGJ 2D1HA 2OQGA 2VE8A 5JVTA 5IOZA 1USSA 3D5RC 2A05A 2XASA 2ID3A 2P5KA 3DWLE 3MCZA 3PNYA 2E2IJ 2PX9A 2OBPA 3VUQA 5EGOA 2Z3YA 2ZFUA 3MKYB 1KGSA 2TDXA 3DEWA 2X9DA 3S15J 4OD5A 2RGVA 1IN7A 1ITYA 2M45A 2XAUA 2EZHA 3HG9A 4KT6A 4IKFA 3DKXA 4GCKA 4CYCB 2BVLA 2R92J 3NNRA 2CFOA 3H9QA 1VQ6I 4OIPF 3CF5F 2GA2A 1YI2I 3L2WA 3G56A 2FX0A 2HOTA 3S2HJ 5D5UB 4A6DA 3EGQA 4I02A 3J80K 1PJRA 1FYMA 2Z9OA 2P81A 3G1OA 4I76A 4UB8C 3C18A 4ENNA 1P4WA 3CCLI 1YHQI 4AVPA 4C3JJ 4KNYA 2XAJA 3QPSA 1QGPA 3BTJA 3DP7A 5DCMB 5K5OA 2KRFA 3K1PA 2O5RA 3RZOJ 4A3CJ 1BR4A 2ZCNA 2O0YA 3KEOA 4FASD 1A5JA 5F08A 2VQCA 1HW2A 5EF6A 1QVUA 2FA5A 5HS9A 2MH9A 3AKZA 3BDDA 5D5VB 4M9SA 5IT9K 1MMSA 4QWQA 2BE5F 4U0WA 2X51A 4HBLA 3HTUA 4KFCA 3CLQA 3GTKJ 5LGUA 2QSHX 2EV6A 4GFKA 2F5FA 3S3MA 2CMPA 4UUSB 3AG2H 3P9IA 3KP7A 1OISA 1GDTA 5J40A 3G73A 2MA3A 4M6YA 2DA3A 2E1MB 1SAUA 4ICHA 4ZYGA 2ZJRF 3FX3A 2GBYA 3AL0B 3GZNB 3Q3SA 1AA7A 3BR0A 4XRFA 1LQ1A 3BRUA 4ETSA 5E17F 3FIWA 2HKOA 3TO7A 1R1VA 3MD2A 3W2AA 3HGYA 3I3LA 3SEZA 1D1AA 4F7ZA 5CKTA 1PUFA 3NAUA 1YITI 1WKMA 3BCBA 2IT0A 2XRLA 2MABA 1ULYA 2P6SA 1D8KA 1TT0A 2XDVA 3CDHA 5D6EA 4E7HA 1FJLA 2B3WA 1F5TA 5HSZA 3ANPA 1H0MA 2F4IA 5LBQA 4YIRX 2L02A 4L18B 4LD5A 2WTEA 4M74A 4CCKA 2LRDA 3HOZJ 2LP0A 3CCVI 2HOAA 2XPWA 4EJVA 3GTOJ 1G2HA 3HPHA 1U0JA 4F3QA 4BJTA 2E60A 4A5NA 1MNEA 4CYCA 4GGGA 1ZG5A 4IRIA 5IYCJ 3L2RA 1FT9A 2W24A 3MKLA 2V9VA 1TW3A 1HKSA 1GVJA 4OIQF 4MLOA 1HW5A 4RM2A 2WAEA 1LUJB 2F48A 4PJJA 2XC7A 2G7UA 2M87A 3FKIJ 5J1RA 2HNHA 4JX6A 4A0ZA 5ICEA 1AHDP 2KPMA 3BWGA 4AC0A 5D5XB 2P6TA 2DFIA 1X4PA 4HDVA 1VQMI 2ME0A 5CQEA 1WQ2A 1ZN2A 5DCMA 5L3DA 3LHQA 2PI0A 2R5YB 2L3DA 3E6BA 1T0FC 1T6SA 3H35A 2DLLA 3IUVA 2H09A 5ILSA 1FYLA 3HTHA 3EYYA 1BC7C 5C4JJ 5KHDA 4IHVA 1P6RA 1EF4A 1EKEA 2PBXA 3D5SC 1GXQA 2H6CA 4Y7NJ 3NWTA 3G3ZA 2CJJA 3JRIA 1IDYA 1TQMA 5HLTA 2MBFA 3HTIA 4UUSA 2FQ3A 2VKHA 5CQGA 1ACIA 4XOTA 4CUGA 1Y6IA 5EZHA 4WXDA 3O60A 1UG0A 1FSEA 3FXQA 2D6YA 1X1PA 3IRRA 3VODA 1WHUA 3RI4A 1SFUA 2M7BA 4BACA 3ZOBA 3OSFA 1KU3A 3K70D 3OYBA 2WY7Q 2RV8A 3PM1A 4P5OA 1T2KA 2ZNYA 3ZN1A 3BNIA 2BZTA 1QPMA 2QKLB 2BVMA 3MFKA 3LQQA 2OI8A 1F9NA 2HS5A 3JTHA 2VB6A 4XBFA 4BBRJ 3OYLA 3NEUA 4C3IJ 4II2A 2L5QA 1GV2A 1S3JA 2AQFA 4N0BA 4Q4ZF 2NOJB 3J81Z 2R7QA 4WWCA 2EJRA 1MJ9A 5HDKA 4G9YA 2EPFA 1IRZA 3PL8A 1E17A 2Q1ZB 1TC3C 4UUVA 2K4JA 1FX7A 5E79C 1TQIA 1NTCA 3F8MA 3V8LA 1DUXC 3CESA 4Y52J 4EJTA 2DJIA 5HLIA 3GZIA 3DV8A 1KYWA 3CRJA 4HX4A 1R5ID 3JR9A 3QPHA 1OFCX 3VPRA 1R1UA 4J01A 2IEKA 4A3LJ 3GFIA 2P5VA 4DOZA 2E34A 2FMYA 3G2BA 2KDZA 1NK2P 4HNTA 1IUYA 3BJOA 4R79A 3V8JA 1LB2A 5TISC 2RC4A 2WADA 4LFUA 5ILVA 1EH7A 2D45A 1D0ZA 4IRGA 1HDPA 2BXYA 5DV5A 2LBFB 4XOPA 2MH2A 3SEQA 3TP0A 3M8EA 1S5LC 2DT7B 2R0QC 2HOEA 3HOVJ 2G0EA 3BG5A 5EEGA 3E5UA 3TW6A 4UDSA 3F0CA 1GVDA 3A01B 2JA7J 1FWZA 2R93J 2IGMA 4M3EA 1WSUA 4A3DJ 1XS9A 3AG3H 3HUGB 4IF4A 2R5YA 5J1UA 5EEAA 1T33A 3JRDA 1IDZA 1YX5A 1ETKA 3NI7A 2GENA 1O7FA 3PSFA 2KMUA 3F6VA 1P9QC 2FQ4A 2CO5A 2LH9A 1VQ7I 2V79A 3OYDA 3VVYA 2UXPA 4ZYDA 4OU0A 5CLSA 3FM3A 4Y15A 2VI6A 3ISPA 3GWZA 3LNQA 2NOGA 1E2XA 1XGSA 4B47A 3S1RJ 1K79A 1ZLKA 2EZLA 2Z16A 2B63J 3HTSB 4L0ZB 3HSEA 1I6HJ 1JXSA 1SFEA 3A0HC 2KL4A 3GLXA 2KIFA 4KICA 4I0BA 1I1SA 1PP7U 1OLTA 1B9MA 4S05A 3LWFA 3OYHA 4NNJA 3H0GJ 1KU2A 2Y75A 2L9SA 1JHHA 3F3XA 3DTKA 4EJUA 3BTLA 1LNWA 3IP4B 3OWTA 1YW7A 2L54A 4D1QA 1VNDA 3HRTA 3S16J 2FF4A 4AVZA 4XLEA 5ILUA 3PFIA 2ISZA 2GOXB 1S7AA 2ECCA 2JK3A 2WAQN 3BZ6A 4ZDPA 2G7GA 5E18F 4PZJA 2H27A 5IP7J 5J4VA 3A0BC 4DYRA 4AU7A 2H1KA 1YW8A 1IC8A 1HCRA 3LSIA 5E3MA 4NB5A 1JKRC 1P7IA 4A3IJ 2IS6A 2RVCA 2E5ZA 1YG2A 2A6TA 3I54A 4HF0A 2QBYB 3KPHA 3H3UA 4BE1A 5FLXZ 1YJNI 5GPCA 1B59A 3TL4X 1BW6A 1S29A 3CCJI 1WJ5A 5JR3A 1R23A 2JUCA 2WAQA 3WU1B 2J5OA 2KZGA 3GTGJ 3QKXA 1ZG1A 3VTIA 1A35A 2A6HF 5IP6A 3GXOA 1MH4A 2LBFA 2WAFA 1ZGAA 4BY7J 2JJ7A 2UV1A 3GF2A 4BUPA 1IRFA 1KU7A 3RSNA 2DK8A 3QPLA 2EIMH 4ZDOA 3T6NA 3HL2A 2RNJA 2DMNA 5F1RA 4ENMA 4HLXA 4HA8A 2L0KA 3VSLA 3D1NI 2VJJA 3A01A 2X85A 2DQLA 3TDZC 1XSXA 3KP6A 1RKTA 3ZQGA 2GIVA 1W36C 2V1XA 2NP3A 3HUGA 2HOSA 2K9MA 2ZFWA 4U87A 5JFRA 1YO5C 1P4AA 4RGUA 2HKXA 3OYNA 4KN7X 3V7SA 1IG7A 3KFWX 2EFNA 4GXOA 3WGGA 2XKPA 1WJFA 3NS4A 1OKRA 2R7UA 1G6NA 2KJBA 5K5QA 4IVNA 1IN8A 4L9JA 2A61A 2HFHA 3WHCA 4D9JA 4RDUA 1K4TA 3NXCA 3ROUA 3H1CA 2DJNA 5JLXA 3PPBA 3F8BA 1XMAA 1MMDA 2JN6A 5BQTA 2VXZA 2KJCA 5J47A 1SMTA 3L2QA 2FUG2 3J81K 1SEUA 2O7TA 2ZOZA 2MG4A 3FXUA 4QSHA 5CVIA 1WH5A 1VQPI 5FKNA 4BL0B 4S04A 2E5NA 3RKXA 3JRCA 1ERDA 1F36A 5KAIC 1KQ9A 4IXAA 1N25A 3HRSA 5GP9A 4YFKF 5K1YA 5D19A 4I7HA 2QQBA 5C44J 2YX4A 2Z1DA 2XSDC 3CCYA 2M1BA 3KEQA 3PQJA 3PO2J 2M3AA 3I71A 1Z7UA 2BY0A 2UXXA 2IGKA 1HQCA 2V26A 2CV0A 4PDKA 3JRAA 2DA7A 2QF7A 2CUJA 3WTSC 3IAS2 2XRNA 2PN6A 2IVMA 2FRHA 2IA1A 2QBYA 2JA6J 2OUMA 1N77A 1TQPA 4EJOA 4G94A 3OYIA 1FOYA 1XN7A 1UJ8A 2XVCA 2TCTA 2VJ4A 1JHFA 4O3MA 3GFMA 3VSKA 2MD0A 1MBFA 3G4SI 2VE9A 2A3SA 1ZTRA 2NVQJ 3GMEA 2G7HA 2DW4A 1F4KA 3ZQLA 4HSTA 4A6EA 3VW0A 3UR3C 2XAGA 3CJQB 2BBYA 1PYVA 5E1ZB 5JLWA 2NRAC 3MMYB 2MYSA 2ELKA 1OCCH 2BHYA 2DYRH 2FSWA 3FZVA 4TV7A 1VQOI 4XRMA 5BNGA 3G6EI 3M1EA 4RAYA 4ZC3A 2PJPA 3FK6A 3ZGKA 1BA5A 3ANGA 1UAAA 1B6AA 1H9GA 1QZZA 3OOPA 1WJEA 1G3SA 3BR1A 2OCCH 3H92A 3TW7A 3MN2A 2FOKA 2B7EA 2X1DA 3BC8A 3R61A 2LF7A 3OYJA 2EK5A 4LB5A 1C0WA 1IN5A 5HBUA 2DFHA 1UHMA 1PUEE 4M6VA 3A2KA 2VQLA 2K5CA 3FM5A 4CICA 4CCLA 2VPLA 4IX7A 1A6IA 4XM3A 4Q47A 1P2FA 1K83J 1T95A 4L5EA 3K4LA 1ZKGA 1D3YA 2HVRA 1CQTA 3KLNA 1IXSB 3G7RA 4AYBN 1Y0UA 2GLOA 2QUFA 2HQRA 2VBXA 3HBLA 3W6JB 4EEFG 2VQHA 2A2FX 1BIBA 2ZMEC 2YVXA 3COAC 5TGTA 2WBMA 1MNMC 1ZARA 2CSOA 2XAQA 1NHAA 3VYUB 4ZYEA 1YJ9I 4RB1A 2LD5A 4JNNA 1D1BA 5FO5A 1S9HA 3VYSB 5JHFA 2K02A 4CCJA 4KYWA 4XLFA 1ONVA 5B5EC 3F8FA 4P96A 4U0YA 3EYIA 3HOXJ 3BROA 3GLLA 3CWRA 1H88C 5FLXK 4QLCU 3JRHA 4LIVA 1I50J 5DCFA 4BH9A 3SJMA 3HC7A 1U5TC 4AYBA 4FE4A 5FRNA 4LJZF 3IH3A 5HVQC 1L3LA 3GZ6A 4E7IA 5CW8A 1QA6A 4DBRA 1IXRC 4ZH4F 9ANTA 3LAJA 3FXRA 3CQZJ 5FD5A 3ECHA 3VW2A 3BG3A 1JUPA 5D8LB 2PMHA 3BG9A 5K7HA 3QAHA 5D4SA 1DU0A 1J2XA 1LVAA 4QTRA 3OS2A 1V3FA 5LFAA 4HF2A 1IO2A 2CUEA 2X6XA 4Z2YA 4DVYP 1J0RA 2PMZN 2KT0A 5KVRA 4M9ZA 1ZAOA 3HSFA 3VFZA 2Z99A 1HW1A 2KRCA 4XLAA 3S8PA 2OU2A 4BY1J 4J19A 1O57A 4A3GJ 3JW4A 3HOYJ 3GFLA 4G6TB 3FK7A 5DTDA 3FF5A 5AIPA 5JHUA 5FD6A 3CCRI 3CC4I 1W4MA 1U78A 1O3QA 2VIXA 1D8JA 4E6KG 1T0FA 3KZ9A 3CCQI 1HLVA 2DPDA 3OY9A 2XAHA 4FX0A 5M5WJ 4A0YA 2V6CA 3W2VA 3PUBA 1VF9A 2EWNA 1QNTA 4S0HB 2DYSH 2CYYA 3JAMZ 2OZUA 4NC7A 3M9AA 4MQVA 3MKZA 5K7ZA 4CDGA 3VYTB 2WV1A 2EIKH 1G8XA 5M3FJ 1Q1HA 4LLGF 4D5FA 3M1CA 2DA5A 5AQCA 1XTAA 1E3PA 3M3YJ 2W82A 4DYQA 4MQ9F 4ITVA 3ZN0A 2ZXIA 5CXIA 2GUHA 1HKQA 1K7AA 4JYKA 4O6JA 1UELB 1E0EA 2JVHA 1BJZA 3LAPA 2ZBKA 1D5VA 3FXOA 2KIUA 3Q0VA 5F64A 2EFQA 1SD4A 2I10A 4EJWA 2ZSIB 2R4GA 5E1XA 1G3TA 3DCFA 5GAHJ 1Y1WJ 1S72I 1IRXA 3I4MJ 1Y8QB 1K4SA 3EUHC 2LK2A 4BS9A 3U1DA 5DUIA 2HDCA 4B43A 2PLYA 1SFKA 2XROA 1FBQA 2EB7A 4B48A 3N97A 5J3LA 3FMSA 3VEPA 2EFOA 2GZWA 1BIAA 1DGWY 5HLHA 1KU9A 3GYHX 2E1CA 2WB1N 4XORA 2CU7A 2ZC2A 2ELJA 1TNTA 2BY3A 4DJAA 2CQXA 3T1BA 3S2WA 3B6AA 3FDYA 2VL8A 3TP3A 4AM3A 1HSTA 2XIGA 3PNVA 5H6QA 4QIWN 2DODA 4HLYA 4B4CA 3OYEA 5F04A 2L9NA 4UV9A 4I98B 2J5PA 2FBIA 5JI6A 4DYCA 3N4MA 2PMUA 3CJNA 3QYBA 1ZG3A 4LOCA 2DMQA 2YVHA 2HR3A 2Q2EB 3ZQQA 4PGHA 5GADJ 2CW8A 3QYFA 1JTYA 3K4BA 1LE8B 4LG0B 2GQQA 1NG6A 2BY1A 2WB1A 4JX5A 3V8KA 2LF8A 1LDKB 3OS0A 3LA7A 4HX8A 4M73A 3DXJF 4XN3A 4PXIA 2W84A 2CQ7A 2A68F 3H3ZA 1APLC 2Z33A 2CV2A 1W36D 2RQQA 4K2EA 2ZXHA 2L7MP 1Z67A 2NAZA 2PEXA 3D5LA 2QSFX 4GCVA 3R6SA 3OYMA 5K7FA 4IO9F 2IS2A 1EA3A 3H5AA 2N8GA 3EQLF 1R6RA 1GV5A 1ETWA 4YEJA 3OIOA 2H94A 4E7ZA 5DS9A 5FKMA 1XB4A 3K2AA 3H5NA 2VT3A 2ESNA 3KYDB 4KWAA 1YE9A 3PO3J 1RETA 1Z3YA 2R7XA 3PSIA 3OL4A 3F21A 5J4YA 1YFHA 4RAZA 2M0MA 5LEJA 3RH2A 1TP4A 1POGA 5FFXA 4AIKA 1RI7A 2LVSA 3Q0WA 4P1WA 2DA2A 4LLNA 3DFGA 4BAYA 2W57A 5GPAA 2DBBA 5E8IA 2DI3A 3BR6A 4PSXA 4BQNA 4WF2A 2HKUA 1UG2A 2F5CA 2QQAA 3CCUI 3IAM2 1ORKA 4YELA 1HC8A 2DOEA 3ZMVA 2STTA 2EFPA 2OPTA 4L0YB 3A03A 1DU6A 1ON1A 3B6CA 4ANJA 4V2FA 5FKKA 2TRTA 5B3SH 5HS7A 2DFFA 2QSGX 4IEJA 2X6YA 4DZPA 3IKTA 2K3PA 2P5LC 1XGMA 3ZQCA 5CVVA 4IHTA 1MJAA 5IYDJ 5FLMJ 5FHPA 2R7VA 1QO0D 4N4NB 1SD5A 4PK4A 2FNPA 5EDNA 4UVAA 1ODDA 2JMWA 2Z2SB 3HOTA 4LB6B 2KKOA 2VONA 3IRQA 3MAJA 2QEXI 1I6XA 1BR2A 2K3FA 1FIAA 1K61A 2L9VA 4HNUA 4O5VA 3SWHA 1EV7A 3VW1A 4A3BJ 3VP5A 4EVIA 2G9WA 2W53A 3E7LA 1KZHA 2HYTA 2DCEA 3BJAA 2NVYJ 1KYZA 1G4DA 3ZMTA 3GTPJ 1AU7A 3HRUA 3WTZA 2Q2EA 4BGDA 4E7KA 3JAMK 1W5SA 3PUFA 2MGQA 2UWMA 1LE8A 3E6MA 4LG0A 3S17J 3I4NJ 3AG1H 1L0OC 2HU9A 2BHZA 3OYFA 3EDPA 3NRGA 3ML6A 3SYTA 2XF5A 3ASOH 1JT0A 4XNFA 4UUTA 3FXKA 3U21A 2G7SA 1U9OA 2OCEA 1FZPB 3JRGA 4AWXB 2FBQA 5J8FA 1FC3A 3S5RA 3E5XA 3WU0A 1W7PB 3LMMA 2DMUA 3COLA 1QQIA 3HOWJ 4HPQA 1JE8A 1QZEA 2M4GA 4IJAA 1WI3A 3CUOA 4KT5C 1W7PD 2E7WA 3WGHA 4RB2C 2V1UA 4G7OF 1V5GA 4DNCA 5HDNA 2QA4I 4HZFA 2NNYA 4D5CA 2HI3A 3KP2A 3LSKA 2GM4A 2LSOA 1X3WB 4UXNA 3BJBA 2KRHA 1PVEA 3LFKA 3FBIB 3QYEA 1CGPA 2UXUA 3DF8A 2YPRA 2ZMEB 3PASA 4CH7A 4I09A 2UXIA 3ABKH 2F4MB 2QKMB 3EETA 2NS7A 4RAGA 4KDPA 3GFJA 1DGRM 1WVRA 3DBRB 4XQFA 1MSFC 2DOAA 1TBXA 5FLVA 2O7OA 4KIBA 2DOFA 1VFCA 4OAZA 4M3BA 4ENKA 1FEXA 2CG4A 1U5TB 4EATA 3VOKA 1LVKA 2V7FA 3ZMUA 5C3EJ 3GVAA 2IPQX 2NNNA 2Y9YA 2DDAA 3WU2C 1XCVA 4FTHA 3V4GA 2DXIA 2OZ6A 1I5ZA 1ZHFA 2Q8KA 1MGTA 5HDGA 4M71A 3CC2I 1FPQA 3K4JA 3LSPA 5BPIA 1K6OA 2MLKA 3K1MA 1R5GA 2FJ1A 2XKOA 4F55A 1FOXA 3IKVA 3DPJA 3ABLH 2V1NA 1LFPA 2KHMA 2QQ9A 3P7NA 5M5XJ 4IHSA 4MTEA 2JA5J 4LK1F 3LSRA 1OCZH 2Z5UA 3E3VA 2E7XA 4KA4A 1O3TA 3HM5A 4IOCF 3WODF 2K27A 2LMDA 1HDDC 3CO6C 4FE7A 3J7YJ 5K58A 3L2UA 3QP6A 3TOAA 2ZJPF 2XSJC 2ECBA 1UB9A 2I5UA 2VBZA 4P55A 1YS6A 1Z0XA 2OV7A 3M07A 3PJRA 2QYOA 4EGYA 2HXIA 5CYVA 4C3HJ 3EPZA 4YG2F 3CMAI 2DPUA 2OQRA 4J00A 1AKHB 2OF7A 4XRSG 4NC8A 4CO8A 2EA2A 3RKYA 4NBQA 5CVRA 3F9KA 4R8HA 2VOPA 2W4SA 4XR6A 1MKMA 3DU5A 3U9GA 1MH3A 4JOMA 3IUOA 3C2GA 3CDLA 2YSRA 4C2MJ 4W1UA 1W7PA 2K9QA 4BQOA 3ZMZA 4KMFA 3VVXA 3CP8A 5E8GA 1S7EA 2GFNA 1S6LA 1EH8A 2A5WA 3C2HA 2IGNA 1WGXA 2MC3A 3HIFA 3OR2C 2P0WA 2XF6A 3KEYA 3V7RA 3IH2A 1SD6A 2XV4S 3H0DA 5AONA 4QPQA 2MSYA 2LY1A 3MZ8A 4BDZA 2M8GX 2HEOA 2NVTJ 1IN4A 3BCAA 3AG4H 1T39A 4BHBA 1WPKA 2ZMEA 3CCMI 3IL2A 2BYVE 5E3OA 1J75A 2O61A 1IGNA 3K4MA 3LSGA 1J5YA 3K2ZA 3PIPF 3CMYA 3CMEI 2XPUA 4V2GA 3I64A 1REPC 2QCOA 4IQJA 3F72A 3M8FA 5J6XA 2DG7A 3H9JA 4G7HF 1XDUA 1H9TA 4NHJA 2DK5A 1JI8A 4MFEA 1ETOA 1LEBA 2ZOYA 3HOUJ 2VQGA 3TGNA 1U5TA 5KAFC 4OIRF 2UUZA 3KP4A 2LTPA 4NC6A 2LREA 2V9PA 5C4YA 3IV5A 1XCBA 3HPGA 4XRSA 2ZJ2A 4E7LA 3A4CA 5EFYA 2R7OA 1HSJA 1I39A 4EM1A 2QOPA 1HA8A 2K9SA 2JPBA 2M2EA 3K6GA 1W1WE 3TO6A 2LG4A 1T38A 2DAOA 4GCTA 1H8AC 1R22A 3LSMA 2A69F 1DP3A 4RLQA 3IWZA 3G1MA 2IJLA 1V5FA 4UNOA 3TBIA 1O4XA 3K4NA 2R7RA 3QRFF 1FSHA 4BJ5C 5HNFA 4ABZA 2HYGD 5HAWA 1WJBA 3N05A 2XDNA 3OIQA 1TWAJ 3LFUA 3T0YA 3E6CC 2JUGA 4HV5A 1RUOA 4IHXA 3X2QH 2HZDA 1FP1D 1ZR2A 3MQ0A 1TT5B 4IZZA 2O9LA 3QBMA 1D1CA 2D5VA 2WGBA 3W3CA 2LKSA 2UXOA 4BBSJ 1YTYA 3UKGA 4A3MJ 3TQNA 5FKLA 2F2EA 2QVOA 3I56I 4FETA 2ZKZA 2JPCA 1OCRH 2X4HA 5FGMA 2VODA 4CGRA 1AKHA 1SMYF 1IF1A 4C9YA 4OMYA 2D1VA 3DTEA 1W0UA 2RDPA 1O7LA 3BR5A 3HHGA 3RIRA 1A31A 2PG4A 5FB2A 3DTIA 1R5HA 1Y39A 3CF2A 3PQKA 1XMKA 3LOCA 3GTLJ 2VN2A 1VQKI 4BU2A 4II3A 2VKVA 4ESFA 5F6FA 2L9RA 4CCMA 4X0GA 4I01A 3ON2A 4A5MA 3LA2A 3QOPA 2YX7A 1MBGA 3Q9VA 3WG7H 5JVGF 1VI0A 1BI1A 2EINH 2X0LA 1U9NA 2AXTC 4CSWA 1TW2A 3A1YA 3WTYC 1IW7F 5LRSA 4XSXF 1R49A 1SGMA 1GHCA 3CUQC 4HW0A 4MTDA 5BMZA 1OJLA 2ADUA 3BY6A 3CJTB 2M7AA 1MNDA 3MKWB 2ZXWH 1ETVA 5H9TA 5LGTA 2H8RA 2IA2A 1R00A 1V54H 3FXLA 5GTIC 2REKA 3K4CA 4BQAA 1RPWA 4DBQA 2F4OB 2WC2A 4M3GA 1B72B 3S3NA 3EUHA 2VC1A 2IAIA 2LOOA 2QGUA 4HYEA 4PJMA 1BL0A 2EZIA 2ZXJA 5E3LA 3DU6A 1BR1A 3ZMDA 3FXJA 3JREA 3Q0UA 1PP8F 3QOEA 4I99C 2DQRA 2VT2A 3SDBA 4E4HA 2IA0A 3JRBA 2XGXA 4JQFA 4E70A 4HX7A 4LIUA 3SDGA 3TO9A 3OYAA 2P7CB 1MSEC 3JSPA 3VB2A 3ABUA 3H5RA 1XSVA 3IC7A 3KZYA 2A5YB 4AIJA 2ZCMA 4YIIA 3WTTC 3C07A 2JRTA 1TTYA 1A6QA 2ELHA 3MEXA 1NG7A 2M4KA 3D0SA 3R60A 5TJJA 1TWFJ 3FKJA 2A6EF 1WCMJ 1BM9A 2UZKA 3ZP5A 6PAXA 1Z9CA 2CH0A 4OOIA 4A3KJ 2O8XA 5FROA 3WE3A 3QU3A 4ZTJA 2O03A 1RZ4A 1YLFA 5C4XJ 2PZ9A 2XHKA 4JKZA 3HIMA 1UFMA 3CZ6A 3C3WA 4KUMA 4KMUX 1LJ9A 4BEHA 2E2HJ 2NVXJ 4DW6A 2K86A 4EGZA 2LY9A 1BW5A 2QZ8A 2X48A 3W6VA 5B1BH 2ACJA 1WZ2A 1ZELA 2LR8A 2RKHA 2DTRA 3O8GA 1JGGA 1W0TA 2OC6A 4L62A 3KCCA 4IL6C 2F5DA 1ZGWA 5BS6A 3L2CA 4MK6A 4CCOA 3ASNH 1R7JA 2BOLA 4EM2A 2FBHA 2RASA 5EJCA 3IH4A 2QLZA 1QU3A 2R7ZJ 3V6GA 3VOEA 2IS4A 4RB3C 4L5IA 2Y48A 3MVPA 3DLAA 4CZZA 3BG7A 2ZNZA 3SFZA 4HOBA 1CF7B 2NVUB 4EQQA 3GO5A 3S14J 1JT6A 3BG6A 2JWTA 2UXNA 4Y13A 1A04A 2XUBA 4OINF 1IZ1A 1LDDA 5DEQA 1TWCJ 3WE2A 1IUFA 4AF5A 3RCOA 4G7ZF 3S1QJ 3GCMA 1IV6A 1YJWI 4CA0A 1B72A 1ENHA 2DN0A 1SFOJ 3ESWB 1FLIA 1HOMA 5H2FC 1WJAA 2DA4A 2RREA 5M3MJ 5LRRA 1Z1DA 1ZRDA 4IRHA 4GCLA 3L9FA 1MD0A 4ASNA 2FJI1 3RYRA 2HVQA 4XKBA 4P9FA 1GXPA 3H9GA 2VLAA 3S1NJ 5KCMA 3FHZA 4RBOA 3L1PA 4FT8A 4HV6A 4D0PA 4ON0A 3HB9A 5L3BA 2LKXA 1JJ8C 1BI2A 1FMWA 4HQMA 5FJ8J 4GDFA 1ETXA 1Q1VA 3OL3A 4XN0A 2QENA 1Z21A 4IRVA 2H8WA 2PMZA 4YFXF 4GFBA 4MGRA 2EQRA 4MEXF 1VZ0A 4CCNA 4F92B 2R7SA 3OR1C 4LGWA 4HQEA 1IXCA 3VOXA 1MDMB 3E7QA 4BXFA 3LSJA 2E36A 1ZGJA 5GAEJ 4ZZDA 4RGXA 3V7CA 5DD8A 1G59A 3OOUA 1YW9A 5EZGA 3RD3A 3E5QA 4CHUA 3AQSA 4XKVA 4YRVA 2R7FA 2GOMA 4LK0F 5B66C 4B3AA 5IP9J 5IPAA 4MFDA 1GT0C 5HS8A 1D0YA 3BLYA 3DKYA 4JBAA 3F8CA 2DFEA 3QP5A 2XGDA 3BT9A 2PFBA 4HAMA 1RIOH 1VQNI 2ESHA 2ZO4A 1ON2A 2VPRA 2IP2A 2IS1A 3ZXSA 4KN4X 4G8XA 4ZYAA 1T56A 3BQZA 2Q0OA 1DPRA 1J59A 3LL7A 1LEAA 1U8BA 1FTTA 3BP8A 1P4XA 1CF7A 5IYBJ 2LFBA 2QWTA 1WWXA 3DPLC 4PFPA 1FBUA 4KJZA 3F22A 2XPVA 2Y31A 1VQ4I 4Q5SF 3QU6A 3SQNA 2R7WA 1G3YA 2PBIA 3CC7I 1N78A 2EV0A 1Y8RB 2ISYA 1Z05A 3F23A 1T8IA 4I0AA 4U0VA 3ZPLA 2NP5A 3OIPA 2HTSA 4W97A 4IHYA 3BCGA 4CZCA 4JP0A 4YFNF 1RRJA 4OIOF 3G71I 3NPIA 1U2WA 2FU4A 2KDOA 1RESA 4RGRA 3K0LA 1YS7A 3TMOA 4NELA 1MBKA 2LLKA 5CVUA 1E3HA 3WHBA 3PIOF 5IY5H 4DGWB 1WFXA 1FIPA 3AAFA 2CV1A 2K85A 2XGEA 4MNUA 3OYKA 3P9TA 2CWEA 1OR7C 1X1DA 1IV8A 1R4MB 3LQRA 4LLLA 3JTGA 1ZR4A 5EYRA 1UI6A 2EA4A 4IPAA 3HKZN 2JT1A 4P9UA 3A02A 1FOWA 2VKDA 2AQEA 1SC7A 1E3OC 3ZQHA 4BQQA 2GXBA 2YS9A 3FRQA 1R71A 2E2JJ 4XLCA 2I8DA 1UI5A 4L9TA 3EUKL 5AIQA 1DP7P 2V57A 1FOKA 5A2QZ 1UMQA 3ULQB 3LA3A 2WWYA 5LEKA 3K7AJ 2R5ZB 3KKCA 4PSWA 2AXLA 5LGNA 1J7KA 2V9KA 4HKUA 2Y69H 2YU9J 1MDMA 4YZEA 2Y9ZA 3AQTA 3JSJA 1K6YA 1RC9A 3HKZA 2HYFA 4HNVA 1D0XA 3DQVC 3IWFA 3L00A 4C30A 3S3OA 5J1YA 2FE3A 4HSRA 1YYVA 4M3DA 3MNLA 2XAFA 1NH3A 4Q48A 1XMXA 3WG9A 4C2MA 1YIJI 1AWCA 1USTA 1X3UA 2OD5A 3L2VA 3J7AO 4A93J 1JUSA 5HOOA 3LWJA 2DDBA 3RZDJ 1HBXG 1QVTA 2B1EA 4ESJA 3SZGA 4M6XA 3T5XA 4B3XA 4DIQA 2ID6A 1IJWC 3C7JA 3BJ6A 4UHTA 2W25A 2OJED 2CQKA 5L3CA 2QTQA 2GAUA 2KISA 4GYGA 1KA8A 3QWLA 5KK1A 1ZRFA 3I55I 1KQ0A 3I59B 3KNWA 3CMMA 4XL9A 4V19K 3CUQB 3MZYA 4Z6YA 2L2OA 1SVOA 2YUSA 3HZJA 4L5JA 3WTWC 2M30A 5ED4A 5D4RA 4OAYA 1X1AA 2L7FP 4B09A 1MBHA 3B81A 2COBA 2P4WA 2PJRB 3OMYA 2X1CA 2EV5A 3GEUA 5DYMA 1EH6A 1BI3A 4GO1A 4FCYA 2VJIA 3V78A 2L4AA 1SD7A 3M8JA 5ICGA 2LKPA 1IAWA 2JA8J 3S1MJ 1X2MA 2EZKA 2OERA 3PNTA 4BKXA 4F93B 2JSCA 4ZZLA 3P9KA 5GTHC 1TNSA 3JCUC 3KLOA 4MO7A 4NDLA 2W1OA 2QWWA 4RMNA 1SVMA 3S2DJ 2CQQA 3HJEA 2AS5F 4XONA 4B8XA 1Y0NA 1WH7A 3BQYA 4ZYHA 3OS1A 4A3JJ 1IRGA 5LHHA 4UB6C 2R7DA 2DU9A 3V42A 4D7NA 4XLNF 4BE2A 3T8TA 2O8KA 4F91B 3BOQA 4A3FJ 2VOOA 2Y30A 2QKOA 2CFXA 5LLQA 4PJNA 1FBSA 2PFVA 2K9LA 2L7KA 5E3NA 2K9NA 4ENJA 3CJDA 3RKQA 3BZKA 2VJ5A 4LMYA 3CTAA 5TRDA 2R5ZA 1UHWA 1LKXA 2VKEA 1VQ9I 2BW3B 2FEZA 4H4KC 2DO7A 3O3KA 3H36A 1WJCA 2NS8A 2K40A 2W48A 4JL3A 3REOA 1X58A 4KIGA 1QHGA 2FOWA 2NX4A 2E19A 2IGOA 3ZQFA 5HNHA 4BYYA 1OCPA 4EV0A 3SZTA 4DZJA 1D5YA 2JRMA 1RNLA 1X1CA 3CP2A 3DEEA 2CUFA 4ACIA 1J9IA 1FMVA 3I53A 2ZB9A 1VTNC 1MMNA 1R36A 3TEDA 1F1ZA 4BJ6C 4KISA 3ERED 4ZTFA 1R58A 3QODA 2IRFG 1EJ9A 1O3SA 4ESBA 1RUNA 4BE0A 1GUUA 2L7ZA 2ZCWA 1Z3XA 4B1RA 3BR3A 4WIBA 3RKWA 3TOBA 5D1RA 3FMQA 4PUSA 1R9TJ 2YU3A 3TKYA 3DPUA 3FBNB 3W6KB 3I59A 2GXAA 3CUQA 2V1DA 4I2OA 2CW0F 5DAJA 1VQ8I 5DDGA 4BDYA 4XLHA 3VDXA 4U7DA 2F6CA 2M8EA 3P5JA 1PDNC 4GRIA 2D2WA 3CD6I 3QQAA 4NUBA 1JKQC 1YRNB 4PGGA 3KX2A 4U88A 5KNLA 3ABTA 5FRMA 4FHTA 1MBJA 5FKOA 2PJRA 1X2NA 1QRYA 4A2UA 5LHIA 3GBGA 3MZHA 4Y17A 4FQGA 2OTJI 1WI9A 2HGCA 1X1BA 4A3EJ 5FMPA 3MWMA 2BEOA 2KP6A 1I27A 4G6QA 1S8NA 4WCGA 2F5VA 3CLOA 4R1HA 1A36A 4XICA 5A2QK 1LFUP 4OWRB 2R7TA 5F1JA 4XLPF 2EILH 2Y0SN 2Y0MA 4XSZF 2C6YA 3KYCB 1WJDA 3RPUD 5BPDA 4NN1A 1XGOA 4IHWA 3HXLA 2ZY9A 1FY7A 2WV0A 2LDUA 4L9VA 3J7ZI 1P7JA 2LY2A 4FX4A 1G3WA 2LNBA 4XMYA 3H3VK 3I0TA 2FD5A 2FNAA 1YQAA 5FFZA 4XKWA 3DPTA 3SZPA 2HDDA 3J7AY 3ELKA 3I5UA 3K1NA 3CCSI 2OAZA 3DKWA 2BW3A 3BTIA 2RQPA 4IQ4A 2KQRA 1T08B 5DM7F 2YR2A 4WXHA 4RM3A 1JJ6C 2A07F 2Y0SA 1XDSA 1R1TA 2CW7A 2ZSHB 3Q9SA 3DBLB 2HZTA 5HLGA 1RR7A 2MLGA 3F6OA 3PFYA 4Y4RA 5M5YJ 5ERIA 1JTXA 1XC5A 1I3QJ 3ECOA 2G7LA 1X19A 3ONQA 3OSGA 1DDNA 1OCTC 1OPCA 2GA1A 2NXNB 3JRFA 2STWA 5FGLA 1RKWA 2LYCA 3GTMJ 3F8NA 3BPXA 2M5WA 1FTZA 4LG3A 1MW7A 1XG1A 2M9HA 1R4NB 3GUDA 4EMSA 4UVBA 3FWEA 4AC6A 1YIOA 2FMLA 2B0LA 3ZQ7A 2GXGA 2CGPA 4BNCA 4BHPA 1HF0A 1BOAA 2L4MA 2DMTA 3NWSA 3RDIA 1SVLA 3L7WA 3RQ4A 1BN5A 5F0FA 2K4BA 2K7LA 3RQIA 3IHUA 1OYIA 3HRMA 2Q24A 1I3AA 4L9NA 5E1WA 4HF1A 4X1EA 2HTJA 5D6FA 2QIBA 5L3FA 3K9TA 2XB0X 4RAFA 3KIOA 4MHGA 3ZRGA 4GFLA 4Y3OA 3SXYA 2JTVA 4N9HA 5IT3A 2E1NA 2O6GE 1YRNA 2XB5A 2OA4A 5BOXA 3HDDA 3SHFA 3CCEI 3SFIA 3K69A 1BC8C 1MMGA 1BJAA 3S32A 3B02A 2EFWA 4ZJZA 3RPQA 4D7MA 2KIMA 4FISA 2P8TA 4G6DA 4RLFA 5DUKA 2BV6A 1QPIA 2OTLI 2E1MC 3ZQIA 4BEHB 3RPUA 1MIJA 1Y1VJ 3O8HA 4NQWB 4WXCA 2ZJQF 2IXSA 4MIMA 3AL0C 2AO9A 4BHCA 2Y2ZA 3RYPA 2HWVA 3P9CA 3NQOA 5B1AH 3U2RA 4CGZA 2CUZA 1JUMA 2YVEA 5CVJA 3WTUC 1T98A 1UZCA 1YX3A 2W00A 1OQYA 3K10A 2JA2A 1O3RA 4A12A 3WTVC 3M7GA 4AIHA 2JVGA 1UHSA 1KQ8A 3CDIA 3HTJA 1TWHJ 4N4OB 1W5CC 3R0JA 1H89C 3HOSA 3C2BA 2MW8A 4HRIA 1F43A 2XF7A 2FBKA 2W7NA 2HDWA 1K78B 4RB0A 5CXGA 3DEUA 4ME9A 1ZH5A 2H6BA 5CJ9A 3KKDA 1MZBA 2V4JC 3Q5FA 3E6DA
chains in the Genus database with same CATH topology
1ETQA 4M3EA 4A3DJ 1XS9A 2LVSA 3Q0WA 4JX4A 2RHAA 2DA2A 2R5YA 5J1UA 5EEAA 1T33A 3JRDA 3S1NJ 1IDZA 1ETKA 5F0HA 3NI7A 5GPAA 4RBOA 3L1PA 2GENA 2DA6A 3BR6A 2LKXA 3HB9A 1JJ8C 3LJLA 5FJ8J 2HKUA 1UG2A 1ETXA 2FQ4A 1Q1VA 2IBDA 5IOYA 4I6ZA 2ZCXA 1ORKA 5F27A 2CRGA 3VVYA 2UXPA 4GFBA 2EQRA 1NK3P 2VI6A 2OPTA 3LNQA 2NOGA 5F0CA 3A03A 1DU6A 2G3BA 1ZK8A 3B6CA 3GTQJ 3VOXA 4AUXA 4V2FA 5FKKA 2TRTA 3S1RJ 3E7QA 3LSJA 2EZLA 2B63J 4IEJA 4XK4A 2DG8A 4DZPA 1I6HJ 1B8IB 3ZQCA 1ETYA 3M4OJ 3OOUA 5EZGA 5IYDJ 5FLMJ 5FHPA 3RD3A 3AQSA 5EDNA 4B3AA 5IP9J 5IPAA 4MFDA 1GT0C 3HTAA 2JMWA 2EBIA 2XGDA 3H0GJ 3BT9A 5D18A 3HGGA 1FIAA 1K61A 1LFBA 2X6OA 3BTLA 3VW1A 1VNDA 1JKOC 4A3BJ 3S16J 3VP5A 2VPRA 3VVZA 1T56A 3BQZA 2W53A 3E7LA 4G12A 2HYTA 1U8BA 3VIBA 1FTTA 2ECCA 2JK3A 2NVYJ 2WAQN 2G7GA 3GTPJ 5IYBJ 1AU7A 2LFBA 2QWTA 5IP7J 2MGQA 4DYRA 2XPVA 2Y31A 1LE8A 2H1KA 1IC8A 1HCRA 3S17J 5E3MA 3I4NJ 2M0CA 2HXOA 1P7IA 4A3IJ 1JKRC 3NRGA 1JT0A 2RAEA 4UUTA 2F07A 2G7SA 2NP5A 2ME6A 5GPCA 1U9OA 3BCGA 4W97A 4IHYA 5EG0B 3JRGA 4JP0A 2FBQA 1BW6A 3S5RA 3NPIA 3COLA 2DMUA 3QKXA 1RESA 3HOWJ 3GTGJ 4NELA 1MBKA 2LLKA 1WI3A 3WHBA 5IP6A 3ON4A 1MH4A 4BY7J 2JJ7A 2AHQA 1FIPA 3QPLA 4D5CA 2XGEA 3HEFA 2HI3A 3T6NA 2DMNA 2GM4A 3P9TA 3BJBA 5EGOB 2HYJA 2L0KA 3BR2A 3D1NI 4MXMA 3A01A 1ZR4A 5EYRA 2UXUA 1UI6A 1RKTA 3BTCA 3ZQGA 2NP3A 3HKZN 2IU5A 3PASA 2HOSA 2UXIA 3A02A 3F1BA 4XIDA 1E3OC 2WUIA 2NS7A 3ZQHA 2YS9A 3FRQA 1MSFC 2E2JJ 1ZQ3P 1IG7A 5FLVA 2O7OA 1UI5A 2HQ5A 1VFCA 2E1OA 3G1LA 2V57A 1UMQA 4M3BA 1FEXA 3K7AJ 4A69C 2R5ZB 3KKCA 3VOKA 5C3EJ 3WHCA 4X6AJ 4RDUA 4HKUA 2VUMJ 3NXCA 2Y9YA 2DJNA 5JLXA 4FTHA 3PPBA 2YU9J 4YZEA 2Y9ZA 3AQTA 2JN6A 5HODA 3JSJA 2O7TA 3EUPA 2ZOZA 1B8IA 2MG4A 4HNVA 4QSHA 3LSPA 1WH5A 4BXXJ 5J1YA 3MNLA 4M3DA 5FKNA 2FJ1A 3JRCA 3DPJA 2EH3A 1F36A 5M5XJ 2JA5J 3LSRA 4M3FA 4A93J 5GP9A 5D19A 1JUSA 3LWJA 3HM5A 3FISA 3RZDJ 1HDDC 1QVTA 4FE7A 2DA1A 5K58A 1MBEA 1Z77A 5C44J 2ID6A 2XSDC 3CCYA 3PO2J 3HE0A 2ECBA 1IJWC 2XGCA 3BHQA 3NARA 2QTQA 1Z0XA 2M34A 2HXIA 3JRAA 2DA7A 4C3HJ 3KNWA 2DMPA 2QF7A 2UXHA 1AKHB 2OF7A 2YUSA 4XRSG 2JA6J 2DTZA 3GTJJ 5EG0A 1PUFB 1MH3A 1JKPC 3CDLA 2L7FP 2TCTA 1MBHA 4W1UA 2COBA 4C2MJ 3B81A 2K9QA 1TWGJ 1SANA 1MBFA 5IOZA 3VVXA 3GEUA 1ZTRA 2NVQJ 1S7EA 2GFNA 4FCYA 2ID3A 3ZQLA 3V78A 1WGXA 3S1MJ 2JA8J 3VW0A 3IH2A 1X2MA 2EZKA 2E2IJ 2OERA 5JLWA 4BKXA 3VUQA 2MSYA 2ELKA 2M8GX 4MO7A 4NDLA 5EGOA 2NVTJ 3S2DJ 4XRMA 3DEWA 2CQQA 5BNGA 2X9DA 3S15J 1WPKA 3FK6A 1WH7A 1ITYA 2EZHA 3BQYA 1BA5A 4A3JJ 3ANGA 4GCKA 4CYCB 5E3OA 2R92J 3NNRA 4D7NA 1IGNA 3BR1A 3LSGA 2O8KA 2QKOA 4A3FJ 3CMYA 2Y30A 3TW7A 3MN2A 2XPUA 4V2GA 3G56A 2FX0A 2QCOA 2HOTA 3S2HJ 5HBUA 2DG7A 3EGQA 5E3NA 4M6VA 2K9NA 3CJDA 3RKQA 4MFEA 1ETOA 2P81A 2ZOYA 3HOUJ 3G1OA 1A6IA 4I76A 2R5ZA 2VKEA 1K83J 2LTPA 4L5EA 5C4YA 2NS8A 1ZKGA 3IV5A 4C3JJ 1CQTA 2K40A 2W48A 4XRSA 4JL3A 3QPSA 3G7RA 4AYBN 1X58A 3BTJA 2GLOA 5EFYA 3HBLA 3RZOJ 4A3CJ 2NX4A 2E19A 3ZQFA 4EEFG 2ZCNA 1OCPA 1D5YA 2K9SA 2M2EA 5F08A 4DZJA 1A5JA 2QOPA 5EF6A 1QVUA 4GCTA 1MNMC 1H8AC 2CUFA 4ACIA 3G1MA 2LD5A 2ZB9A 4JNNA 1O4XA 3TEDA 3GTKJ 4ABZA 5HAWA 4GFKA 2XDNA 1TWAJ 3HOXJ 4UUSB 3CWRA 1H88C 4IHXA 1GUUA 1ZR2A 3JRHA 2L7ZA 1I50J 4B1RA 3SJMA 2O9LA 2WGBA 2D5VA 3QBMA 1GDTA 3BR3A 2DA3A 4FE4A 4BBSJ 2UXOA 3IH3A 3UKGA 4ICHA 5D1RA 4A3MJ 1R9TJ 5FKLA 2GBYA 3Q3SA 3BR0A 5CW8A 3BRUA 5DAJA 9ANTA 3FIWA 4CGRA 3CQZJ 1AKHA 3VW2A 3BG3A 3HGYA 1JUPA 1W0UA 3BR5A 3BG9A 5K7HA 3QQAA 1JKQC 1PUFA 1YRNB 3NAUA 1DU0A 4QTRA 2XRLA 2CUEA 3LOCA 3GTLJ 1MBJA 2PMZN 5FKOA 2KT0A 1X2NA 2VKVA 2L9RA 1QRYA 1FJLA 3GBGA 5HSZA 3ANPA 4BY1J 4A3GJ 4J19A 3ON2A 4A3EJ 1MBGA 5FMPA 3HOYJ 3FK7A 5DTDA 1VI0A 1U9NA 3HOZJ 4XICA 1LFUP 1U78A 2LP0A 5F1JA 2HOAA 2XPWA 2Y0SN 1SGMA 3KZ9A 1HLVA 3GTOJ 1G2HA 4NN1A 4IHWA 1OJLA 5M5WJ 4CYCA 1ETVA 5H9TA 1P7JA 3H3VK 5IYCJ 2H8RA 1VF9A 2REKA 1RPWA 4S0HB 3MKLA 2FD5A 4MLOA 4M3GA 1B72B 2HDDA 5K7ZA 2IAIA 1BL0A 3FKIJ 2WV1A 5J1RA 2EZIA 5M3FJ 4JX6A 4D5FA 5E3LA 1AHDP 2DA5A 4AC0A 5AQCA 3BTIA 3JREA 3Q0UA 3M3YJ 1JJ6C 4DYQA 3JRBA 2ME0A 3SDGA 2GUHA 5CXIA 4JYKA 3LHQA 1MSEC 2R5YB 1RR7A 3IUVA 2ZCMA 5M5YJ 1BJZA 3C07A 3HTHA 1JTXA 1XC5A 1I3QJ 2G7LA 3Q0VA 1TWFJ 5C4JJ 4IHVA 2PBXA 1EF4A 3OSGA 1OCTC 4Y7NJ 2I10A 1WCMJ 3JRFA 5FGLA 2CJJA 3JRIA 3DCFA 1RKWA 1IDYA 1Y1WJ 3GTMJ 4A3KJ 3HTIA 3I4MJ 1FTZA 4UUSA 1XG1A 2LK2A 2M9HA 5EZHA 5C4XJ 4AC6A 2PZ9A 3O60A 2D6YA 4JKZA 3HIMA 5J3LA 3ZOBA 3OSFA 1HF0A 2E2HJ 2NVXJ 4DW6A 2DMTA 2LY9A 1BW5A 2X48A 3W6VA 3PM1A 2LR8A 5F0FA 3O8GA 1JGGA 3BNIA 2WB1N 3RQIA 2CU7A 1W0TA 4L62A 2Q24A 2CQXA 1ZGWA 4X1EA 2OI8A 3B6AA 4BBRJ 4MK6A 2QIBA 3TP3A 2XB0X 4C3IJ 4GFLA 2RASA 4QIWN 1GV2A 1YRNA 4B4CA 3IH4A 2XB5A 5F04A 2R7ZJ 3HDDA 3V6GA 3SFIA 4DYCA 3MVPA 1IRZA 1TC3C 4D7MA 4LOCA 2DMQA 2YVHA 4FISA 1QPIA 1JTYA 3ZQIA 1LE8B 3S14J 1NTCA 1JT6A 4JX5A 1Y1VJ 3O8HA 4Y52J 2JWTA 4MIMA 2AO9A 3GZIA 4PXIA 2Y2ZA 3CRJA 1APLC 3JR9A 1JUMA 1OFCX 3VPRA 2YVEA 2L7MP 1TWCJ 2IEKA 4A3LJ 1IUFA 4AF5A 2KDZA 1NK2P 5K7FA 3S1QJ 2N8GA 1IV6A 1GV5A 1ETWA 3OIOA 1UHSA 1B72A 5DS9A 3HTJA 1HDPA 1ENHA 3K2AA 1TWHJ 5FKMA 1H89C 2DN0A 3C2BA 2MW8A 1SFOJ 1F43A 3TP0A 4KWAA 3PO3J 2R0QC 1RETA 1HOMA 3HOVJ 2G0EA 3BG5A 5CXGA 3TW6A 4ME9A 4UDSA 2DA4A 3F0CA 1GVDA 3A01B 3KKDA 5M3MJ 2JA7J 3RH2A 1POGA 2R93J 4GCLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ETQ A;  4M3E A;  4A3D J;  1XS9 A;  2LVS A;  3Q0W A;  4JX4 A;  2RHA A;  2DA2 A;  2R5Y A;  5J1U A;  5EEA A;  1T33 A;  3JRD A;  3S1N J;  1IDZ A;  1ETK A;  5F0H A;  3NI7 A;  5GPA A;  4RBO A;  3L1P A;  2GEN A;  2DA6 A;  3BR6 A;  2LKX A;  3HB9 A;  1JJ8 C;  3LJL A;  5FJ8 J;  2HKU A;  1UG2 A;  1ETX A;  2FQ4 A;  1Q1V A;  2IBD A;  5IOY A;  4I6Z A;  2ZCX A;  1ORK A;  5F27 A;  2CRG A;  3VVY A;  2UXP A;  4GFB A;  2EQR A;  1NK3 P;  2VI6 A;  2OPT A;  3LNQ A;  2NOG A;  5F0C A;  3A03 A;  1DU6 A;  2G3B A;  1ZK8 A;  3B6C A;  3GTQ J;  3VOX A;  4AUX A;  4V2F A;  5FKK A;  2TRT A;  3S1R J;  3E7Q A;  3LSJ A;  2EZL A;  2B63 J;  4IEJ A;  4XK4 A;  2DG8 A;  4DZP A;  1I6H J;  1B8I B;  3ZQC A;  1ETY A;  3M4O J;  3OOU A;  5EZG A;  5IYD J;  5FLM J;  5FHP A;  3RD3 A;  3AQS A;  5EDN A;  4B3A A;  5IP9 J;  5IPA A;  4MFD A;  1GT0 C;  3HTA A;  2JMW A;  2EBI A;  2XGD A;  3H0G J;  3BT9 A;  5D18 A;  3HGG A;  1FIA A;  1K61 A;  1LFB A;  2X6O A;  3BTL A;  3VW1 A;  1VND A;  1JKO C;  4A3B J;  3S16 J;  3VP5 A;  2VPR A;  3VVZ A;  1T56 A;  3BQZ A;  2W53 A;  3E7L A;  4G12 A;  2HYT A;  1U8B A;  3VIB A;  1FTT A;  2ECC A;  2JK3 A;  2NVY J;  2WAQ N;  2G7G A;  3GTP J;  5IYB J;  1AU7 A;  2LFB A;  2QWT A;  5IP7 J;  2MGQ A;  4DYR A;  2XPV A;  2Y31 A;  1LE8 A;  2H1K A;  1IC8 A;  1HCR A;  3S17 J;  5E3M A;  3I4N J;  2M0C A;  2HXO A;  1P7I A;  4A3I J;  1JKR C;  3NRG A;  1JT0 A;  2RAE A;  4UUT A;  2F07 A;  2G7S A;  2NP5 A;  2ME6 A;  5GPC A;  1U9O A;  3BCG A;  4W97 A;  4IHY A;  5EG0 B;  3JRG A;  4JP0 A;  2FBQ A;  1BW6 A;  3S5R A;  3NPI A;  3COL A;  2DMU A;  3QKX A;  1RES A;  3HOW J;  3GTG J;  4NEL A;  1MBK A;  2LLK A;  1WI3 A;  3WHB A;  5IP6 A;  3ON4 A;  1MH4 A;  4BY7 J;  2JJ7 A;  2AHQ A;  1FIP A;  3QPL A;  4D5C A;  2XGE A;  3HEF A;  2HI3 A;  3T6N A;  2DMN A;  2GM4 A;  3P9T A;  3BJB A;  5EGO B;  2HYJ A;  2L0K A;  3BR2 A;  3D1N I;  4MXM A;  3A01 A;  1ZR4 A;  5EYR A;  2UXU A;  1UI6 A;  1RKT A;  3BTC A;  3ZQG A;  2NP3 A;  3HKZ N;  2IU5 A;  3PAS A;  2HOS A;  2UXI A;  3A02 A;  3F1B A;  4XID A;  1E3O C;  2WUI A;  2NS7 A;  3ZQH A;  2YS9 A;  3FRQ A;  1MSF C;  2E2J J;  1ZQ3 P;  1IG7 A;  5FLV A;  2O7O A;  1UI5 A;  2HQ5 A;  1VFC A;  2E1O A;  3G1L A;  2V57 A;  1UMQ A;  4M3B A;  1FEX A;  3K7A J;  4A69 C;  2R5Z B;  3KKC A;  3VOK A;  5C3E J;  3WHC A;  4X6A J;  4RDU A;  4HKU A;  2VUM J;  3NXC A;  2Y9Y A;  2DJN A;  5JLX A;  4FTH A;  3PPB A;  2YU9 J;  4YZE A;  2Y9Z A;  3AQT A;  2JN6 A;  5HOD A;  3JSJ A;  2O7T A;  3EUP A;  2ZOZ A;  1B8I A;  2MG4 A;  4HNV A;  4QSH A;  3LSP A;  1WH5 A;  4BXX J;  5J1Y A;  3MNL A;  4M3D A;  5FKN A;  2FJ1 A;  3JRC A;  3DPJ A;  2EH3 A;  1F36 A;  5M5X J;  2JA5 J;  3LSR A;  4M3F A;  4A93 J;  5GP9 A;  5D19 A;  1JUS A;  3LWJ A;  3HM5 A;  3FIS A;  3RZD J;  1HDD C;  1QVT A;  4FE7 A;  2DA1 A;  5K58 A;  1MBE A;  1Z77 A;  5C44 J;  2ID6 A;  2XSD C;  3CCY A;  3PO2 J;  3HE0 A;  2ECB A;  1IJW C;  2XGC A;  3BHQ A;  3NAR A;  2QTQ A;  1Z0X A;  2M34 A;  2HXI A;  3JRA A;  2DA7 A;  4C3H J;  3KNW A;  2DMP A;  2QF7 A;  2UXH A;  1AKH B;  2OF7 A;  2YUS A;  4XRS G;  2JA6 J;  2DTZ A;  3GTJ J;  5EG0 A;  1PUF B;  1MH3 A;  1JKP C;  3CDL A;  2L7F P;  2TCT A;  1MBH A;  4W1U A;  2COB A;  4C2M J;  3B81 A;  2K9Q A;  1TWG J;  1SAN A;  1MBF A;  5IOZ A;  3VVX A;  3GEU A;  1ZTR A;  2NVQ J;  1S7E A;  2GFN A;  4FCY A;  2ID3 A;  3ZQL A;  3V78 A;  1WGX A;  3S1M J;  2JA8 J;  3VW0 A;  3IH2 A;  1X2M A;  2EZK A;  2E2I J;  2OER A;  5JLW A;  4BKX A;  3VUQ A;  2MSY A;  2ELK A;  2M8G X;  4MO7 A;  4NDL A;  5EGO A;  2NVT J;  3S2D J;  4XRM A;  3DEW A;  2CQQ A;  5BNG A;  2X9D A;  3S15 J;  1WPK A;  3FK6 A;  1WH7 A;  1ITY A;  2EZH A;  3BQY A;  1BA5 A;  4A3J J;  3ANG A;  4GCK A;  4CYC B;  5E3O A;  2R92 J;  3NNR A;  4D7N A;  1IGN A;  3BR1 A;  3LSG A;  2O8K A;  2QKO A;  4A3F J;  3CMY A;  2Y30 A;  3TW7 A;  3MN2 A;  2XPU A;  4V2G A;  3G56 A;  2FX0 A;  2QCO A;  2HOT A;  3S2H J;  5HBU A;  2DG7 A;  3EGQ A;  5E3N A;  4M6V A;  2K9N A;  3CJD A;  3RKQ A;  4MFE A;  1ETO A;  2P81 A;  2ZOY A;  3HOU J;  3G1O A;  1A6I A;  4I76 A;  2R5Z A;  2VKE A;  1K83 J;  2LTP A;  4L5E A;  5C4Y A;  2NS8 A;  1ZKG A;  3IV5 A;  4C3J J;  1CQT A;  2K40 A;  2W48 A;  4XRS A;  4JL3 A;  3QPS A;  3G7R A;  4AYB N;  1X58 A;  3BTJ A;  2GLO A;  5EFY A;  3HBL A;  3RZO J;  4A3C J;  2NX4 A;  2E19 A;  3ZQF A;  4EEF G;  2ZCN A;  1OCP A;  1D5Y A;  2K9S A;  2M2E A;  5F08 A;  4DZJ A;  1A5J A;  2QOP A;  5EF6 A;  1QVU A;  4GCT A;  1MNM C;  1H8A C;  2CUF A;  4ACI A;  3G1M A;  2LD5 A;  2ZB9 A;  4JNN A;  1O4X A;  3TED A;  3GTK J;  4ABZ A;  5HAW A;  4GFK A;  2XDN A;  1TWA J;  3HOX J;  4UUS B;  3CWR A;  1H88 C;  4IHX A;  1GUU A;  1ZR2 A;  3JRH A;  2L7Z A;  1I50 J;  4B1R A;  3SJM A;  2O9L A;  2WGB A;  2D5V A;  3QBM A;  1GDT A;  3BR3 A;  2DA3 A;  4FE4 A;  4BBS J;  2UXO A;  3IH3 A;  3UKG A;  4ICH A;  5D1R A;  4A3M J;  1R9T J;  5FKL A;  2GBY A;  3Q3S A;  3BR0 A;  5CW8 A;  3BRU A;  5DAJ A;  9ANT A;  3FIW A;  4CGR A;  3CQZ J;  1AKH A;  3VW2 A;  3BG3 A;  3HGY A;  1JUP A;  1W0U A;  3BR5 A;  3BG9 A;  5K7H A;  3QQA A;  1JKQ C;  1PUF A;  1YRN B;  3NAU A;  1DU0 A;  4QTR A;  2XRL A;  2CUE A;  3LOC A;  3GTL J;  1MBJ A;  2PMZ N;  5FKO A;  2KT0 A;  1X2N A;  2VKV A;  2L9R A;  1QRY A;  1FJL A;  3GBG A;  5HSZ A;  3ANP A;  4BY1 J;  4A3G J;  4J19 A;  3ON2 A;  4A3E J;  1MBG A;  5FMP A;  3HOY J;  3FK7 A;  5DTD A;  1VI0 A;  1U9N A;  3HOZ J;  4XIC A;  1LFU P;  1U78 A;  2LP0 A;  5F1J A;  2HOA A;  2XPW A;  2Y0S N;  1SGM A;  3KZ9 A;  1HLV A;  3GTO J;  1G2H A;  4NN1 A;  4IHW A;  1OJL A;  5M5W J;  4CYC A;  1ETV A;  5H9T A;  1P7J A;  3H3V K;  5IYC J;  2H8R A;  1VF9 A;  2REK A;  1RPW A;  4S0H B;  3MKL A;  2FD5 A;  4MLO A;  4M3G A;  1B72 B;  2HDD A;  5K7Z A;  2IAI A;  1BL0 A;  3FKI J;  2WV1 A;  5J1R A;  2EZI A;  5M3F J;  4JX6 A;  4D5F A;  5E3L A;  1AHD P;  2DA5 A;  4AC0 A;  5AQC A;  3BTI A;  3JRE A;  3Q0U A;  3M3Y J;  1JJ6 C;  4DYQ A;  3JRB A;  2ME0 A;  3SDG A;  2GUH A;  5CXI A;  4JYK A;  3LHQ A;  1MSE C;  2R5Y B;  1RR7 A;  3IUV A;  2ZCM A;  5M5Y J;  1BJZ A;  3C07 A;  3HTH A;  1JTX A;  1XC5 A;  1I3Q J;  2G7L A;  3Q0V A;  1TWF J;  5C4J J;  4IHV A;  2PBX A;  1EF4 A;  3OSG A;  1OCT C;  4Y7N J;  2I10 A;  1WCM J;  3JRF A;  5FGL A;  2CJJ A;  3JRI A;  3DCF A;  1RKW A;  1IDY A;  1Y1W J;  3GTM J;  4A3K J;  3HTI A;  3I4M J;  1FTZ A;  4UUS A;  1XG1 A;  2LK2 A;  2M9H A;  5EZH A;  5C4X J;  4AC6 A;  2PZ9 A;  3O60 A;  2D6Y A;  4JKZ A;  3HIM A;  5J3L A;  3ZOB A;  3OSF A;  1HF0 A;  2E2H J;  2NVX J;  4DW6 A;  2DMT A;  2LY9 A;  1BW5 A;  2X48 A;  3W6V A;  3PM1 A;  2LR8 A;  5F0F A;  3O8G A;  1JGG A;  3BNI A;  2WB1 N;  3RQI A;  2CU7 A;  1W0T A;  4L62 A;  2Q24 A;  2CQX A;  1ZGW A;  4X1E A;  2OI8 A;  3B6A A;  4BBR J;  4MK6 A;  2QIB A;  3TP3 A;  2XB0 X;  4C3I J;  4GFL A;  2RAS A;  4QIW N;  1GV2 A;  1YRN A;  4B4C A;  3IH4 A;  2XB5 A;  5F04 A;  2R7Z J;  3HDD A;  3V6G A;  3SFI A;  4DYC A;  3MVP A;  1IRZ A;  1TC3 C;  4D7M A;  4LOC A;  2DMQ A;  2YVH A;  4FIS A;  1QPI A;  1JTY A;  3ZQI A;  1LE8 B;  3S14 J;  1NTC A;  1JT6 A;  4JX5 A;  1Y1V J;  3O8H A;  4Y52 J;  2JWT A;  4MIM A;  2AO9 A;  3GZI A;  4PXI A;  2Y2Z A;  3CRJ A;  1APL C;  3JR9 A;  1JUM A;  1OFC X;  3VPR A;  2YVE A;  2L7M P;  1TWC J;  2IEK A;  4A3L J;  1IUF A;  4AF5 A;  2KDZ A;  1NK2 P;  5K7F A;  3S1Q J;  2N8G A;  1IV6 A;  1GV5 A;  1ETW A;  3OIO A;  1UHS A;  1B72 A;  5DS9 A;  3HTJ A;  1HDP A;  1ENH A;  3K2A A;  1TWH J;  5FKM A;  1H89 C;  2DN0 A;  3C2B A;  2MW8 A;  1SFO J;  1F43 A;  3TP0 A;  4KWA A;  3PO3 J;  2R0Q C;  1RET A;  1HOM A;  3HOV J;  2G0E A;  3BG5 A;  5CXG A;  3TW6 A;  4ME9 A;  4UDS A;  2DA4 A;  3F0C A;  1GVD A;  3A01 B;  3KKD A;  5M3M J;  2JA7 J;  3RH2 A;  1POG A;  2R93 J;  4GCL A; 
#chains in the Genus database with same CATH topology
 1ETQ A;  3DBH B;  4C2U A;  3QPT A;  4IOA F;  3DLL F;  4JX4 A;  1V4R A;  2RHA A;  2LC2 A;  2RNG A;  3VWB A;  3U1K A;  5D5W B;  5F0H A;  1AOY A;  3LJL A;  2DA6 A;  2E71 A;  3L09 A;  2IW5 A;  3BPV A;  4GYI A;  3E0J B;  3K4K A;  4UV8 A;  3BZC A;  2IBD A;  5IOY A;  4UVC A;  1X4O A;  4I6Z A;  1ZRC A;  1UCR A;  4JK1 X;  2CRG A;  2H1L A;  5F27 A;  2ZCX A;  2L01 A;  1NK3 P;  2ICW G;  5F0C A;  3ZR8 X;  1DQU A;  1DPU A;  5GAG J;  3FMR A;  2G3B A;  1ZK8 A;  2FXA A;  3GTQ J;  4AID A;  3CJR B;  4AUX A;  1QBJ A;  2NS0 A;  2DG8 A;  1IN6 A;  4XK4 A;  4KIT B;  4YIF A;  1B8I B;  1ETY A;  3M4O J;  2VAS A;  3GZ5 A;  5E20 A;  1WRJ A;  4UY8 I;  3KZZ A;  2BY2 A;  2V6E A;  3K8P C;  2QM3 A;  1SFX A;  4B44 A;  3J80 Z;  4E7J A;  4U9L A;  1Z6R A;  3HTA A;  1N75 A;  1STZ A;  2KZV A;  2KFD A;  3LST A;  2EBI A;  2MC4 A;  4M9X A;  4RS8 A;  5CPR B;  4CXF A;  5D18 A;  3HGG A;  1TZL A;  2PQ8 A;  2VBW A;  1LFB A;  2X6O A;  4RA2 A;  4AD9 A;  1JKO C;  2CQN A;  3VVZ A;  1XSD A;  2X6W A;  1MJB A;  4G12 A;  3VIB A;  1Z6T A;  3W2W A;  4F52 A;  2JZY A;  2HQA A;  2X1E A;  3K70 C;  4PFO A;  1B4A A;  1OR7 A;  2JSP A;  4WX9 A;  1FP2 A;  5IT9 Z;  1HKT A;  5LHG A;  2MFZ A;  3GEZ A;  1ZYR F;  4NQW A;  3OYG A;  3GX4 X;  2M0C A;  3NRV A;  2HXO A;  3C1D A;  2HQN A;  2RAE A;  3ZCO A;  1VQL I;  1W5T A;  2F07 A;  2HPM A;  3FXM A;  2ME6 A;  2VC0 A;  3I4P A;  4RGS A;  5EG0 B;  3R0A A;  5L3E A;  1OYY A;  1XD7 A;  1JGS A;  3B73 A;  4LIT A;  5H20 A;  1I1G A;  4XKC A;  2GWR A;  2DT5 A;  3ZMS A;  1YOV B;  3KYL A;  3E97 A;  1TL8 A;  4BXU A;  1ZRE A;  1KON A;  1Z91 A;  4U7B A;  3ON4 A;  2ETH A;  2AHQ A;  4HEA 2;  3E1S A;  3TDU C;  2QQ8 A;  4MEY F;  3HEF A;  5J8C A;  1K78 A;  3I9V 2;  5EGO B;  2HYJ A;  2MD5 A;  3BR2 A;  3GW2 A;  2R3S A;  3WTX C;  5LD2 C;  1BBY A;  2NYX A;  4MXM A;  3KP5 A;  3CO7 C;  4U9N A;  3R4K A;  1VQ5 I;  3BTC A;  2IU5 A;  1HXD A;  3FHN A;  3OYC A;  3HHH A;  3F1B A;  4XID A;  3O6B B;  2WUI A;  1TLH B;  1BI0 A;  3KET A;  4OMZ A;  1OMI A;  2KIQ A;  4N9I A;  1U6G A;  2COM A;  1ZQ3 P;  2E35 A;  1B9N A;  1OCO H;  2HQ5 A;  4M72 A;  2E1O A;  3G1L A;  4C2T A;  4PJ0 C;  3RTR A;  5ICF A;  4CYD A;  1V5E A;  1S7O A;  3EUA A;  4A69 C;  4X6A J;  4Y33 A;  4H0E A;  2O3F A;  3HSR A;  1Z7L A;  2VUM J;  2VBY A;  2VXD A;  3O2P E;  3WGI A;  3T8R A;  2F5E A;  1B1B A;  3LSH A;  1FNN A;  3UNG C;  5HOD A;  3EUP A;  2EIJ H;  1B8I A;  2BGC A;  3KP3 A;  4BXX J;  2RN7 A;  1J09 A;  2B9S A;  2HVS A;  4EM0 B;  3KZI C;  2EH3 A;  3KE2 A;  3S93 A;  1OYW A;  5DM6 F;  1GLN A;  2HPI A;  2W85 A;  2CS3 A;  4M3F A;  5H6R A;  4PJL A;  3OV8 A;  3FIS A;  5EEH A;  1XX5 A;  3RJP A;  1RR8 C;  1Y56 A;  1SAX A;  4E7S A;  1FYK A;  2DA1 A;  5L3G A;  1MBE A;  1XPX A;  1Z77 A;  1MMA A;  3HE0 A;  2XGC A;  4HG2 A;  3BHQ A;  4WK8 F;  3JSO A;  3NAR A;  4ZDL A;  4A0X A;  5ICC A;  2M34 A;  4OD4 A;  1BOB A;  3ERM A;  2DMP A;  3ABM H;  2JQ7 A;  2UXH A;  3HYI A;  4QPO A;  4PCQ A;  2GIZ A;  2WA0 A;  2KLO A;  1M1E B;  1ZLJ A;  1V55 H;  1LPQ A;  2DT6 A;  4KIF A;  1X3Z B;  5DD4 A;  5D8K B;  1U8R A;  1XGN A;  1QZY A;  2DTZ A;  5K5R A;  3GTJ J;  1LDJ A;  3AFH A;  4DQ2 A;  1U3E M;  2WY8 Q;  5EG0 A;  1PUF B;  1JKP C;  3VYR B;  4HDU A;  2BXZ A;  3I58 A;  2P7V B;  1P92 A;  1QHH D;  1SAN A;  1TWG J;  2D1H A;  2OQG A;  2VE8 A;  5JVT A;  5IOZ A;  1USS A;  3D5R C;  2A05 A;  2XAS A;  2ID3 A;  2P5K A;  3DWL E;  3MCZ A;  3PNY A;  2E2I J;  2PX9 A;  2OBP A;  3VUQ A;  5EGO A;  2Z3Y A;  2ZFU A;  3MKY B;  1KGS A;  2TDX A;  3DEW A;  2X9D A;  3S15 J;  4OD5 A;  2RGV A;  1IN7 A;  1ITY A;  2M45 A;  2XAU A;  2EZH A;  3HG9 A;  4KT6 A;  4IKF A;  3DKX A;  4GCK A;  4CYC B;  2BVL A;  2R92 J;  3NNR A;  2CFO A;  3H9Q A;  1VQ6 I;  4OIP F;  3CF5 F;  2GA2 A;  1YI2 I;  3L2W A;  3G56 A;  2FX0 A;  2HOT A;  3S2H J;  5D5U B;  4A6D A;  3EGQ A;  4I02 A;  3J80 K;  1PJR A;  1FYM A;  2Z9O A;  2P81 A;  3G1O A;  4I76 A;  4UB8 C;  3C18 A;  4ENN A;  1P4W A;  3CCL I;  1YHQ I;  4AVP A;  4C3J J;  4KNY A;  2XAJ A;  3QPS A;  1QGP A;  3BTJ A;  3DP7 A;  5DCM B;  5K5O A;  2KRF A;  3K1P A;  2O5R A;  3RZO J;  4A3C J;  1BR4 A;  2ZCN A;  2O0Y A;  3KEO A;  4FAS D;  1A5J A;  5F08 A;  2VQC A;  1HW2 A;  5EF6 A;  1QVU A;  2FA5 A;  5HS9 A;  2MH9 A;  3AKZ A;  3BDD A;  5D5V B;  4M9S A;  5IT9 K;  1MMS A;  4QWQ A;  2BE5 F;  4U0W A;  2X51 A;  4HBL A;  3HTU A;  4KFC A;  3CLQ A;  3GTK J;  5LGU A;  2QSH X;  2EV6 A;  4GFK A;  2F5F A;  3S3M A;  2CMP A;  4UUS B;  3AG2 H;  3P9I A;  3KP7 A;  1OIS A;  1GDT A;  5J40 A;  3G73 A;  2MA3 A;  4M6Y A;  2DA3 A;  2E1M B;  1SAU A;  4ICH A;  4ZYG A;  2ZJR F;  3FX3 A;  2GBY A;  3AL0 B;  3GZN B;  3Q3S A;  1AA7 A;  3BR0 A;  4XRF A;  1LQ1 A;  3BRU A;  4ETS A;  5E17 F;  3FIW A;  2HKO A;  3TO7 A;  1R1V A;  3MD2 A;  3W2A A;  3HGY A;  3I3L A;  3SEZ A;  1D1A A;  4F7Z A;  5CKT A;  1PUF A;  3NAU A;  1YIT I;  1WKM A;  3BCB A;  2IT0 A;  2XRL A;  2MAB A;  1ULY A;  2P6S A;  1D8K A;  1TT0 A;  2XDV A;  3CDH A;  5D6E A;  4E7H A;  1FJL A;  2B3W A;  1F5T A;  5HSZ A;  3ANP A;  1H0M A;  2F4I A;  5LBQ A;  4YIR X;  2L02 A;  4L18 B;  4LD5 A;  2WTE A;  4M74 A;  4CCK A;  2LRD A;  3HOZ J;  2LP0 A;  3CCV I;  2HOA A;  2XPW A;  4EJV A;  3GTO J;  1G2H A;  3HPH A;  1U0J A;  4F3Q A;  4BJT A;  2E60 A;  4A5N A;  1MNE A;  4CYC A;  4GGG A;  1ZG5 A;  4IRI A;  5IYC J;  3L2R A;  1FT9 A;  2W24 A;  3MKL A;  2V9V A;  1TW3 A;  1HKS A;  1GVJ A;  4OIQ F;  4MLO A;  1HW5 A;  4RM2 A;  2WAE A;  1LUJ B;  2F48 A;  4PJJ A;  2XC7 A;  2G7U A;  2M87 A;  3FKI J;  5J1R A;  2HNH A;  4JX6 A;  4A0Z A;  5ICE A;  1AHD P;  2KPM A;  3BWG A;  4AC0 A;  5D5X B;  2P6T A;  2DFI A;  1X4P A;  4HDV A;  1VQM I;  2ME0 A;  5CQE A;  1WQ2 A;  1ZN2 A;  5DCM A;  5L3D A;  3LHQ A;  2PI0 A;  2R5Y B;  2L3D A;  3E6B A;  1T0F C;  1T6S A;  3H35 A;  2DLL A;  3IUV A;  2H09 A;  5ILS A;  1FYL A;  3HTH A;  3EYY A;  1BC7 C;  5C4J J;  5KHD A;  4IHV A;  1P6R A;  1EF4 A;  1EKE A;  2PBX A;  3D5S C;  1GXQ A;  2H6C A;  4Y7N J;  3NWT A;  3G3Z A;  2CJJ A;  3JRI A;  1IDY A;  1TQM A;  5HLT A;  2MBF A;  3HTI A;  4UUS A;  2FQ3 A;  2VKH A;  5CQG A;  1ACI A;  4XOT A;  4CUG A;  1Y6I A;  5EZH A;  4WXD A;  3O60 A;  1UG0 A;  1FSE A;  3FXQ A;  2D6Y A;  1X1P A;  3IRR A;  3VOD A;  1WHU A;  3RI4 A;  1SFU A;  2M7B A;  4BAC A;  3ZOB A;  3OSF A;  1KU3 A;  3K70 D;  3OYB A;  2WY7 Q;  2RV8 A;  3PM1 A;  4P5O A;  1T2K A;  2ZNY A;  3ZN1 A;  3BNI A;  2BZT A;  1QPM A;  2QKL B;  2BVM A;  3MFK A;  3LQQ A;  2OI8 A;  1F9N A;  2HS5 A;  3JTH A;  2VB6 A;  4XBF A;  4BBR J;  3OYL A;  3NEU A;  4C3I J;  4II2 A;  2L5Q A;  1GV2 A;  1S3J A;  2AQF A;  4N0B A;  4Q4Z F;  2NOJ B;  3J81 Z;  2R7Q A;  4WWC A;  2EJR A;  1MJ9 A;  5HDK A;  4G9Y A;  2EPF A;  1IRZ A;  3PL8 A;  1E17 A;  2Q1Z B;  1TC3 C;  4UUV A;  2K4J A;  1FX7 A;  5E79 C;  1TQI A;  1NTC A;  3F8M A;  3V8L A;  1DUX C;  3CES A;  4Y52 J;  4EJT A;  2DJI A;  5HLI A;  3GZI A;  3DV8 A;  1KYW A;  3CRJ A;  4HX4 A;  1R5I D;  3JR9 A;  3QPH A;  1OFC X;  3VPR A;  1R1U A;  4J01 A;  2IEK A;  4A3L J;  3GFI A;  2P5V A;  4DOZ A;  2E34 A;  2FMY A;  3G2B A;  2KDZ A;  1NK2 P;  4HNT A;  1IUY A;  3BJO A;  4R79 A;  3V8J A;  1LB2 A;  5TIS C;  2RC4 A;  2WAD A;  4LFU A;  5ILV A;  1EH7 A;  2D45 A;  1D0Z A;  4IRG A;  1HDP A;  2BXY A;  5DV5 A;  2LBF B;  4XOP A;  2MH2 A;  3SEQ A;  3TP0 A;  3M8E A;  1S5L C;  2DT7 B;  2R0Q C;  2HOE A;  3HOV J;  2G0E A;  3BG5 A;  5EEG A;  3E5U A;  3TW6 A;  4UDS A;  3F0C A;  1GVD A;  3A01 B;  2JA7 J;  1FWZ A;  2R93 J;  2IGM A;  4M3E A;  1WSU A;  4A3D J;  1XS9 A;  3AG3 H;  3HUG B;  4IF4 A;  2R5Y A;  5J1U A;  5EEA A;  1T33 A;  3JRD A;  1IDZ A;  1YX5 A;  1ETK A;  3NI7 A;  2GEN A;  1O7F A;  3PSF A;  2KMU A;  3F6V A;  1P9Q C;  2FQ4 A;  2CO5 A;  2LH9 A;  1VQ7 I;  2V79 A;  3OYD A;  3VVY A;  2UXP A;  4ZYD A;  4OU0 A;  5CLS A;  3FM3 A;  4Y15 A;  2VI6 A;  3ISP A;  3GWZ A;  3LNQ A;  2NOG A;  1E2X A;  1XGS A;  4B47 A;  3S1R J;  1K79 A;  1ZLK A;  2EZL A;  2Z16 A;  2B63 J;  3HTS B;  4L0Z B;  3HSE A;  1I6H J;  1JXS A;  1SFE A;  3A0H C;  2KL4 A;  3GLX A;  2KIF A;  4KIC A;  4I0B A;  1I1S A;  1PP7 U;  1OLT A;  1B9M A;  4S05 A;  3LWF A;  3OYH A;  4NNJ A;  3H0G J;  1KU2 A;  2Y75 A;  2L9S A;  1JHH A;  3F3X A;  3DTK A;  4EJU A;  3BTL A;  1LNW A;  3IP4 B;  3OWT A;  1YW7 A;  2L54 A;  4D1Q A;  1VND A;  3HRT A;  3S16 J;  2FF4 A;  4AVZ A;  4XLE A;  5ILU A;  3PFI A;  2ISZ A;  2GOX B;  1S7A A;  2ECC A;  2JK3 A;  2WAQ N;  3BZ6 A;  4ZDP A;  2G7G A;  5E18 F;  4PZJ A;  2H27 A;  5IP7 J;  5J4V A;  3A0B C;  4DYR A;  4AU7 A;  2H1K A;  1YW8 A;  1IC8 A;  1HCR A;  3LSI A;  5E3M A;  4NB5 A;  1JKR C;  1P7I A;  4A3I J;  2IS6 A;  2RVC A;  2E5Z A;  1YG2 A;  2A6T A;  3I54 A;  4HF0 A;  2QBY B;  3KPH A;  3H3U A;  4BE1 A;  5FLX Z;  1YJN I;  5GPC A;  1B59 A;  3TL4 X;  1BW6 A;  1S29 A;  3CCJ I;  1WJ5 A;  5JR3 A;  1R23 A;  2JUC A;  2WAQ A;  3WU1 B;  2J5O A;  2KZG A;  3GTG J;  3QKX A;  1ZG1 A;  3VTI A;  1A35 A;  2A6H F;  5IP6 A;  3GXO A;  1MH4 A;  2LBF A;  2WAF A;  1ZGA A;  4BY7 J;  2JJ7 A;  2UV1 A;  3GF2 A;  4BUP A;  1IRF A;  1KU7 A;  3RSN A;  2DK8 A;  3QPL A;  2EIM H;  4ZDO A;  3T6N A;  3HL2 A;  2RNJ A;  2DMN A;  5F1R A;  4ENM A;  4HLX A;  4HA8 A;  2L0K A;  3VSL A;  3D1N I;  2VJJ A;  3A01 A;  2X85 A;  2DQL A;  3TDZ C;  1XSX A;  3KP6 A;  1RKT A;  3ZQG A;  2GIV A;  1W36 C;  2V1X A;  2NP3 A;  3HUG A;  2HOS A;  2K9M A;  2ZFW A;  4U87 A;  5JFR A;  1YO5 C;  1P4A A;  4RGU A;  2HKX A;  3OYN A;  4KN7 X;  3V7S A;  1IG7 A;  3KFW X;  2EFN A;  4GXO A;  3WGG A;  2XKP A;  1WJF A;  3NS4 A;  1OKR A;  2R7U A;  1G6N A;  2KJB A;  5K5Q A;  4IVN A;  1IN8 A;  4L9J A;  2A61 A;  2HFH A;  3WHC A;  4D9J A;  4RDU A;  1K4T A;  3NXC A;  3ROU A;  3H1C A;  2DJN A;  5JLX A;  3PPB A;  3F8B A;  1XMA A;  1MMD A;  2JN6 A;  5BQT A;  2VXZ A;  2KJC A;  5J47 A;  1SMT A;  3L2Q A;  2FUG 2;  3J81 K;  1SEU A;  2O7T A;  2ZOZ A;  2MG4 A;  3FXU A;  4QSH A;  5CVI A;  1WH5 A;  1VQP I;  5FKN A;  4BL0 B;  4S04 A;  2E5N A;  3RKX A;  3JRC A;  1ERD A;  1F36 A;  5KAI C;  1KQ9 A;  4IXA A;  1N25 A;  3HRS A;  5GP9 A;  4YFK F;  5K1Y A;  5D19 A;  4I7H A;  2QQB A;  5C44 J;  2YX4 A;  2Z1D A;  2XSD C;  3CCY A;  2M1B A;  3KEQ A;  3PQJ A;  3PO2 J;  2M3A A;  3I71 A;  1Z7U A;  2BY0 A;  2UXX A;  2IGK A;  1HQC A;  2V26 A;  2CV0 A;  4PDK A;  3JRA A;  2DA7 A;  2QF7 A;  2CUJ A;  3WTS C;  3IAS 2;  2XRN A;  2PN6 A;  2IVM A;  2FRH A;  2IA1 A;  2QBY A;  2JA6 J;  2OUM A;  1N77 A;  1TQP A;  4EJO A;  4G94 A;  3OYI A;  1FOY A;  1XN7 A;  1UJ8 A;  2XVC A;  2TCT A;  2VJ4 A;  1JHF A;  4O3M A;  3GFM A;  3VSK A;  2MD0 A;  1MBF A;  3G4S I;  2VE9 A;  2A3S A;  1ZTR A;  2NVQ J;  3GME A;  2G7H A;  2DW4 A;  1F4K A;  3ZQL A;  4HST A;  4A6E A;  3VW0 A;  3UR3 C;  2XAG A;  3CJQ B;  2BBY A;  1PYV A;  5E1Z B;  5JLW A;  2NRA C;  3MMY B;  2MYS A;  2ELK A;  1OCC H;  2BHY A;  2DYR H;  2FSW A;  3FZV A;  4TV7 A;  1VQO I;  4XRM A;  5BNG A;  3G6E I;  3M1E A;  4RAY A;  4ZC3 A;  2PJP A;  3FK6 A;  3ZGK A;  1BA5 A;  3ANG A;  1UAA A;  1B6A A;  1H9G A;  1QZZ A;  3OOP A;  1WJE A;  1G3S A;  3BR1 A;  2OCC H;  3H92 A;  3TW7 A;  3MN2 A;  2FOK A;  2B7E A;  2X1D A;  3BC8 A;  3R61 A;  2LF7 A;  3OYJ A;  2EK5 A;  4LB5 A;  1C0W A;  1IN5 A;  5HBU A;  2DFH A;  1UHM A;  1PUE E;  4M6V A;  3A2K A;  2VQL A;  2K5C A;  3FM5 A;  4CIC A;  4CCL A;  2VPL A;  4IX7 A;  1A6I A;  4XM3 A;  4Q47 A;  1P2F A;  1K83 J;  1T95 A;  4L5E A;  3K4L A;  1ZKG A;  1D3Y A;  2HVR A;  1CQT A;  3KLN A;  1IXS B;  3G7R A;  4AYB N;  1Y0U A;  2GLO A;  2QUF A;  2HQR A;  2VBX A;  3HBL A;  3W6J B;  4EEF G;  2VQH A;  2A2F X;  1BIB A;  2ZME C;  2YVX A;  3COA C;  5TGT A;  2WBM A;  1MNM C;  1ZAR A;  2CSO A;  2XAQ A;  1NHA A;  3VYU B;  4ZYE A;  1YJ9 I;  4RB1 A;  2LD5 A;  4JNN A;  1D1B A;  5FO5 A;  1S9H A;  3VYS B;  5JHF A;  2K02 A;  4CCJ A;  4KYW A;  4XLF A;  1ONV A;  5B5E C;  3F8F A;  4P96 A;  4U0Y A;  3EYI A;  3HOX J;  3BRO A;  3GLL A;  3CWR A;  1H88 C;  5FLX K;  4QLC U;  3JRH A;  4LIV A;  1I50 J;  5DCF A;  4BH9 A;  3SJM A;  3HC7 A;  1U5T C;  4AYB A;  4FE4 A;  5FRN A;  4LJZ F;  3IH3 A;  5HVQ C;  1L3L A;  3GZ6 A;  4E7I A;  5CW8 A;  1QA6 A;  4DBR A;  1IXR C;  4ZH4 F;  9ANT A;  3LAJ A;  3FXR A;  3CQZ J;  5FD5 A;  3ECH A;  3VW2 A;  3BG3 A;  1JUP A;  5D8L B;  2PMH A;  3BG9 A;  5K7H A;  3QAH A;  5D4S A;  1DU0 A;  1J2X A;  1LVA A;  4QTR A;  3OS2 A;  1V3F A;  5LFA A;  4HF2 A;  1IO2 A;  2CUE A;  2X6X A;  4Z2Y A;  4DVY P;  1J0R A;  2PMZ N;  2KT0 A;  5KVR A;  4M9Z A;  1ZAO A;  3HSF A;  3VFZ A;  2Z99 A;  1HW1 A;  2KRC A;  4XLA A;  3S8P A;  2OU2 A;  4BY1 J;  4J19 A;  1O57 A;  4A3G J;  3JW4 A;  3HOY J;  3GFL A;  4G6T B;  3FK7 A;  5DTD A;  3FF5 A;  5AIP A;  5JHU A;  5FD6 A;  3CCR I;  3CC4 I;  1W4M A;  1U78 A;  1O3Q A;  2VIX A;  1D8J A;  4E6K G;  1T0F A;  3KZ9 A;  3CCQ I;  1HLV A;  2DPD A;  3OY9 A;  2XAH A;  4FX0 A;  5M5W J;  4A0Y A;  2V6C A;  3W2V A;  3PUB A;  1VF9 A;  2EWN A;  1QNT A;  4S0H B;  2DYS H;  2CYY A;  3JAM Z;  2OZU A;  4NC7 A;  3M9A A;  4MQV A;  3MKZ A;  5K7Z A;  4CDG A;  3VYT B;  2WV1 A;  2EIK H;  1G8X A;  5M3F J;  1Q1H A;  4LLG F;  4D5F A;  3M1C A;  2DA5 A;  5AQC A;  1XTA A;  1E3P A;  3M3Y J;  2W82 A;  4DYQ A;  4MQ9 F;  4ITV A;  3ZN0 A;  2ZXI A;  5CXI A;  2GUH A;  1HKQ A;  1K7A A;  4JYK A;  4O6J A;  1UEL B;  1E0E A;  2JVH A;  1BJZ A;  3LAP A;  2ZBK A;  1D5V A;  3FXO A;  2KIU A;  3Q0V A;  5F64 A;  2EFQ A;  1SD4 A;  2I10 A;  4EJW A;  2ZSI B;  2R4G A;  5E1X A;  1G3T A;  3DCF A;  5GAH J;  1Y1W J;  1S72 I;  1IRX A;  3I4M J;  1Y8Q B;  1K4S A;  3EUH C;  2LK2 A;  4BS9 A;  3U1D A;  5DUI A;  2HDC A;  4B43 A;  2PLY A;  1SFK A;  2XRO A;  1FBQ A;  2EB7 A;  4B48 A;  3N97 A;  5J3L A;  3FMS A;  3VEP A;  2EFO A;  2GZW A;  1BIA A;  1DGW Y;  5HLH A;  1KU9 A;  3GYH X;  2E1C A;  2WB1 N;  4XOR A;  2CU7 A;  2ZC2 A;  2ELJ A;  1TNT A;  2BY3 A;  4DJA A;  2CQX A;  3T1B A;  3S2W A;  3B6A A;  3FDY A;  2VL8 A;  3TP3 A;  4AM3 A;  1HST A;  2XIG A;  3PNV A;  5H6Q A;  4QIW N;  2DOD A;  4HLY A;  4B4C A;  3OYE A;  5F04 A;  2L9N A;  4UV9 A;  4I98 B;  2J5P A;  2FBI A;  5JI6 A;  4DYC A;  3N4M A;  2PMU A;  3CJN A;  3QYB A;  1ZG3 A;  4LOC A;  2DMQ A;  2YVH A;  2HR3 A;  2Q2E B;  3ZQQ A;  4PGH A;  5GAD J;  2CW8 A;  3QYF A;  1JTY A;  3K4B A;  1LE8 B;  4LG0 B;  2GQQ A;  1NG6 A;  2BY1 A;  2WB1 A;  4JX5 A;  3V8K A;  2LF8 A;  1LDK B;  3OS0 A;  3LA7 A;  4HX8 A;  4M73 A;  3DXJ F;  4XN3 A;  4PXI A;  2W84 A;  2CQ7 A;  2A68 F;  3H3Z A;  1APL C;  2Z33 A;  2CV2 A;  1W36 D;  2RQQ A;  4K2E A;  2ZXH A;  2L7M P;  1Z67 A;  2NAZ A;  2PEX A;  3D5L A;  2QSF X;  4GCV A;  3R6S A;  3OYM A;  5K7F A;  4IO9 F;  2IS2 A;  1EA3 A;  3H5A A;  2N8G A;  3EQL F;  1R6R A;  1GV5 A;  1ETW A;  4YEJ A;  3OIO A;  2H94 A;  4E7Z A;  5DS9 A;  5FKM A;  1XB4 A;  3K2A A;  3H5N A;  2VT3 A;  2ESN A;  3KYD B;  4KWA A;  1YE9 A;  3PO3 J;  1RET A;  1Z3Y A;  2R7X A;  3PSI A;  3OL4 A;  3F21 A;  5J4Y A;  1YFH A;  4RAZ A;  2M0M A;  5LEJ A;  3RH2 A;  1TP4 A;  1POG A;  5FFX A;  4AIK A;  1RI7 A;  2LVS A;  3Q0W A;  4P1W A;  2DA2 A;  4LLN A;  3DFG A;  4BAY A;  2W57 A;  5GPA A;  2DBB A;  5E8I A;  2DI3 A;  3BR6 A;  4PSX A;  4BQN A;  4WF2 A;  2HKU A;  1UG2 A;  2F5C A;  2QQA A;  3CCU I;  3IAM 2;  1ORK A;  4YEL A;  1HC8 A;  2DOE A;  3ZMV A;  2STT A;  2EFP A;  2OPT A;  4L0Y B;  3A03 A;  1DU6 A;  1ON1 A;  3B6C A;  4ANJ A;  4V2F A;  5FKK A;  2TRT A;  5B3S H;  5HS7 A;  2DFF A;  2QSG X;  4IEJ A;  2X6Y A;  4DZP A;  3IKT A;  2K3P A;  2P5L C;  1XGM A;  3ZQC A;  5CVV A;  4IHT A;  1MJA A;  5IYD J;  5FLM J;  5FHP A;  2R7V A;  1QO0 D;  4N4N B;  1SD5 A;  4PK4 A;  2FNP A;  5EDN A;  4UVA A;  1ODD A;  2JMW A;  2Z2S B;  3HOT A;  4LB6 B;  2KKO A;  2VON A;  3IRQ A;  3MAJ A;  2QEX I;  1I6X A;  1BR2 A;  2K3F A;  1FIA A;  1K61 A;  2L9V A;  4HNU A;  4O5V A;  3SWH A;  1EV7 A;  3VW1 A;  4A3B J;  3VP5 A;  4EVI A;  2G9W A;  2W53 A;  3E7L A;  1KZH A;  2HYT A;  2DCE A;  3BJA A;  2NVY J;  1KYZ A;  1G4D A;  3ZMT A;  3GTP J;  1AU7 A;  3HRU A;  3WTZ A;  2Q2E A;  4BGD A;  4E7K A;  3JAM K;  1W5S A;  3PUF A;  2MGQ A;  2UWM A;  1LE8 A;  3E6M A;  4LG0 A;  3S17 J;  3I4N J;  3AG1 H;  1L0O C;  2HU9 A;  2BHZ A;  3OYF A;  3EDP A;  3NRG A;  3ML6 A;  3SYT A;  2XF5 A;  3ASO H;  1JT0 A;  4XNF A;  4UUT A;  3FXK A;  3U21 A;  2G7S A;  1U9O A;  2OCE A;  1FZP B;  3JRG A;  4AWX B;  2FBQ A;  5J8F A;  1FC3 A;  3S5R A;  3E5X A;  3WU0 A;  1W7P B;  3LMM A;  2DMU A;  3COL A;  1QQI A;  3HOW J;  4HPQ A;  1JE8 A;  1QZE A;  2M4G A;  4IJA A;  1WI3 A;  3CUO A;  4KT5 C;  1W7P D;  2E7W A;  3WGH A;  4RB2 C;  2V1U A;  4G7O F;  1V5G A;  4DNC A;  5HDN A;  2QA4 I;  4HZF A;  2NNY A;  4D5C A;  2HI3 A;  3KP2 A;  3LSK A;  2GM4 A;  2LSO A;  1X3W B;  4UXN A;  3BJB A;  2KRH A;  1PVE A;  3LFK A;  3FBI B;  3QYE A;  1CGP A;  2UXU A;  3DF8 A;  2YPR A;  2ZME B;  3PAS A;  4CH7 A;  4I09 A;  2UXI A;  3ABK H;  2F4M B;  2QKM B;  3EET A;  2NS7 A;  4RAG A;  4KDP A;  3GFJ A;  1DGR M;  1WVR A;  3DBR B;  4XQF A;  1MSF C;  2DOA A;  1TBX A;  5FLV A;  2O7O A;  4KIB A;  2DOF A;  1VFC A;  4OAZ A;  4M3B A;  4ENK A;  1FEX A;  2CG4 A;  1U5T B;  4EAT A;  3VOK A;  1LVK A;  2V7F A;  3ZMU A;  5C3E J;  3GVA A;  2IPQ X;  2NNN A;  2Y9Y A;  2DDA A;  3WU2 C;  1XCV A;  4FTH A;  3V4G A;  2DXI A;  2OZ6 A;  1I5Z A;  1ZHF A;  2Q8K A;  1MGT A;  5HDG A;  4M71 A;  3CC2 I;  1FPQ A;  3K4J A;  3LSP A;  5BPI A;  1K6O A;  2MLK A;  3K1M A;  1R5G A;  2FJ1 A;  2XKO A;  4F55 A;  1FOX A;  3IKV A;  3DPJ A;  3ABL H;  2V1N A;  1LFP A;  2KHM A;  2QQ9 A;  3P7N A;  5M5X J;  4IHS A;  4MTE A;  2JA5 J;  4LK1 F;  3LSR A;  1OCZ H;  2Z5U A;  3E3V A;  2E7X A;  4KA4 A;  1O3T A;  3HM5 A;  4IOC F;  3WOD F;  2K27 A;  2LMD A;  1HDD C;  3CO6 C;  4FE7 A;  3J7Y J;  5K58 A;  3L2U A;  3QP6 A;  3TOA A;  2ZJP F;  2XSJ C;  2ECB A;  1UB9 A;  2I5U A;  2VBZ A;  4P55 A;  1YS6 A;  1Z0X A;  2OV7 A;  3M07 A;  3PJR A;  2QYO A;  4EGY A;  2HXI A;  5CYV A;  4C3H J;  3EPZ A;  4YG2 F;  3CMA I;  2DPU A;  2OQR A;  4J00 A;  1AKH B;  2OF7 A;  4XRS G;  4NC8 A;  4CO8 A;  2EA2 A;  3RKY A;  4NBQ A;  5CVR A;  3F9K A;  4R8H A;  2VOP A;  2W4S A;  4XR6 A;  1MKM A;  3DU5 A;  3U9G A;  1MH3 A;  4JOM A;  3IUO A;  3C2G A;  3CDL A;  2YSR A;  4C2M J;  4W1U A;  1W7P A;  2K9Q A;  4BQO A;  3ZMZ A;  4KMF A;  3VVX A;  3CP8 A;  5E8G A;  1S7E A;  2GFN A;  1S6L A;  1EH8 A;  2A5W A;  3C2H A;  2IGN A;  1WGX A;  2MC3 A;  3HIF A;  3OR2 C;  2P0W A;  2XF6 A;  3KEY A;  3V7R A;  3IH2 A;  1SD6 A;  2XV4 S;  3H0D A;  5AON A;  4QPQ A;  2MSY A;  2LY1 A;  3MZ8 A;  4BDZ A;  2M8G X;  2HEO A;  2NVT J;  1IN4 A;  3BCA A;  3AG4 H;  1T39 A;  4BHB A;  1WPK A;  2ZME A;  3CCM I;  3IL2 A;  2BYV E;  5E3O A;  1J75 A;  2O61 A;  1IGN A;  3K4M A;  3LSG A;  1J5Y A;  3K2Z A;  3PIP F;  3CMY A;  3CME I;  2XPU A;  4V2G A;  3I64 A;  1REP C;  2QCO A;  4IQJ A;  3F72 A;  3M8F A;  5J6X A;  2DG7 A;  3H9J A;  4G7H F;  1XDU A;  1H9T A;  4NHJ A;  2DK5 A;  1JI8 A;  4MFE A;  1ETO A;  1LEB A;  2ZOY A;  3HOU J;  2VQG A;  3TGN A;  1U5T A;  5KAF C;  4OIR F;  2UUZ A;  3KP4 A;  2LTP A;  4NC6 A;  2LRE A;  2V9P A;  5C4Y A;  3IV5 A;  1XCB A;  3HPG A;  4XRS A;  2ZJ2 A;  4E7L A;  3A4C A;  5EFY A;  2R7O A;  1HSJ A;  1I39 A;  4EM1 A;  2QOP A;  1HA8 A;  2K9S A;  2JPB A;  2M2E A;  3K6G A;  1W1W E;  3TO6 A;  2LG4 A;  1T38 A;  2DAO A;  4GCT A;  1H8A C;  1R22 A;  3LSM A;  2A69 F;  1DP3 A;  4RLQ A;  3IWZ A;  3G1M A;  2IJL A;  1V5F A;  4UNO A;  3TBI A;  1O4X A;  3K4N A;  2R7R A;  3QRF F;  1FSH A;  4BJ5 C;  5HNF A;  4ABZ A;  2HYG D;  5HAW A;  1WJB A;  3N05 A;  2XDN A;  3OIQ A;  1TWA J;  3LFU A;  3T0Y A;  3E6C C;  2JUG A;  4HV5 A;  1RUO A;  4IHX A;  3X2Q H;  2HZD A;  1FP1 D;  1ZR2 A;  3MQ0 A;  1TT5 B;  4IZZ A;  2O9L A;  3QBM A;  1D1C A;  2D5V A;  2WGB A;  3W3C A;  2LKS A;  2UXO A;  4BBS J;  1YTY A;  3UKG A;  4A3M J;  3TQN A;  5FKL A;  2F2E A;  2QVO A;  3I56 I;  4FET A;  2ZKZ A;  2JPC A;  1OCR H;  2X4H A;  5FGM A;  2VOD A;  4CGR A;  1AKH A;  1SMY F;  1IF1 A;  4C9Y A;  4OMY A;  2D1V A;  3DTE A;  1W0U A;  2RDP A;  1O7L A;  3BR5 A;  3HHG A;  3RIR A;  1A31 A;  2PG4 A;  5FB2 A;  3DTI A;  1R5H A;  1Y39 A;  3CF2 A;  3PQK A;  1XMK A;  3LOC A;  3GTL J;  2VN2 A;  1VQK I;  4BU2 A;  4II3 A;  2VKV A;  4ESF A;  5F6F A;  2L9R A;  4CCM A;  4X0G A;  4I01 A;  3ON2 A;  4A5M A;  3LA2 A;  3QOP A;  2YX7 A;  1MBG A;  3Q9V A;  3WG7 H;  5JVG F;  1VI0 A;  1BI1 A;  2EIN H;  2X0L A;  1U9N A;  2AXT C;  4CSW A;  1TW2 A;  3A1Y A;  3WTY C;  1IW7 F;  5LRS A;  4XSX F;  1R49 A;  1SGM A;  1GHC A;  3CUQ C;  4HW0 A;  4MTD A;  5BMZ A;  1OJL A;  2ADU A;  3BY6 A;  3CJT B;  2M7A A;  1MND A;  3MKW B;  2ZXW H;  1ETV A;  5H9T A;  5LGT A;  2H8R A;  2IA2 A;  1R00 A;  1V54 H;  3FXL A;  5GTI C;  2REK A;  3K4C A;  4BQA A;  1RPW A;  4DBQ A;  2F4O B;  2WC2 A;  4M3G A;  1B72 B;  3S3N A;  3EUH A;  2VC1 A;  2IAI A;  2LOO A;  2QGU A;  4HYE A;  4PJM A;  1BL0 A;  2EZI A;  2ZXJ A;  5E3L A;  3DU6 A;  1BR1 A;  3ZMD A;  3FXJ A;  3JRE A;  3Q0U A;  1PP8 F;  3QOE A;  4I99 C;  2DQR A;  2VT2 A;  3SDB A;  4E4H A;  2IA0 A;  3JRB A;  2XGX A;  4JQF A;  4E70 A;  4HX7 A;  4LIU A;  3SDG A;  3TO9 A;  3OYA A;  2P7C B;  1MSE C;  3JSP A;  3VB2 A;  3ABU A;  3H5R A;  1XSV A;  3IC7 A;  3KZY A;  2A5Y B;  4AIJ A;  2ZCM A;  4YII A;  3WTT C;  3C07 A;  2JRT A;  1TTY A;  1A6Q A;  2ELH A;  3MEX A;  1NG7 A;  2M4K A;  3D0S A;  3R60 A;  5TJJ A;  1TWF J;  3FKJ A;  2A6E F;  1WCM J;  1BM9 A;  2UZK A;  3ZP5 A;  6PAX A;  1Z9C A;  2CH0 A;  4OOI A;  4A3K J;  2O8X A;  5FRO A;  3WE3 A;  3QU3 A;  4ZTJ A;  2O03 A;  1RZ4 A;  1YLF A;  5C4X J;  2PZ9 A;  2XHK A;  4JKZ A;  3HIM A;  1UFM A;  3CZ6 A;  3C3W A;  4KUM A;  4KMU X;  1LJ9 A;  4BEH A;  2E2H J;  2NVX J;  4DW6 A;  2K86 A;  4EGZ A;  2LY9 A;  1BW5 A;  2QZ8 A;  2X48 A;  3W6V A;  5B1B H;  2ACJ A;  1WZ2 A;  1ZEL A;  2LR8 A;  2RKH A;  2DTR A;  3O8G A;  1JGG A;  1W0T A;  2OC6 A;  4L62 A;  3KCC A;  4IL6 C;  2F5D A;  1ZGW A;  5BS6 A;  3L2C A;  4MK6 A;  4CCO A;  3ASN H;  1R7J A;  2BOL A;  4EM2 A;  2FBH A;  2RAS A;  5EJC A;  3IH4 A;  2QLZ A;  1QU3 A;  2R7Z J;  3V6G A;  3VOE A;  2IS4 A;  4RB3 C;  4L5I A;  2Y48 A;  3MVP A;  3DLA A;  4CZZ A;  3BG7 A;  2ZNZ A;  3SFZ A;  4HOB A;  1CF7 B;  2NVU B;  4EQQ A;  3GO5 A;  3S14 J;  1JT6 A;  3BG6 A;  2JWT A;  2UXN A;  4Y13 A;  1A04 A;  2XUB A;  4OIN F;  1IZ1 A;  1LDD A;  5DEQ A;  1TWC J;  3WE2 A;  1IUF A;  4AF5 A;  3RCO A;  4G7Z F;  3S1Q J;  3GCM A;  1IV6 A;  1YJW I;  4CA0 A;  1B72 A;  1ENH A;  2DN0 A;  1SFO J;  3ESW B;  1FLI A;  1HOM A;  5H2F C;  1WJA A;  2DA4 A;  2RRE A;  5M3M J;  5LRR A;  1Z1D A;  1ZRD A;  4IRH A;  4GCL A;  3L9F A;  1MD0 A;  4ASN A;  2FJI 1;  3RYR A;  2HVQ A;  4XKB A;  4P9F A;  1GXP A;  3H9G A;  2VLA A;  3S1N J;  5KCM A;  3FHZ A;  4RBO A;  3L1P A;  4FT8 A;  4HV6 A;  4D0P A;  4ON0 A;  3HB9 A;  5L3B A;  2LKX A;  1JJ8 C;  1BI2 A;  1FMW A;  4HQM A;  5FJ8 J;  4GDF A;  1ETX A;  1Q1V A;  3OL3 A;  4XN0 A;  2QEN A;  1Z21 A;  4IRV A;  2H8W A;  2PMZ A;  4YFX F;  4GFB A;  4MGR A;  2EQR A;  4MEX F;  1VZ0 A;  4CCN A;  4F92 B;  2R7S A;  3OR1 C;  4LGW A;  4HQE A;  1IXC A;  3VOX A;  1MDM B;  3E7Q A;  4BXF A;  3LSJ A;  2E36 A;  1ZGJ A;  5GAE J;  4ZZD A;  4RGX A;  3V7C A;  5DD8 A;  1G59 A;  3OOU A;  1YW9 A;  5EZG A;  3RD3 A;  3E5Q A;  4CHU A;  3AQS A;  4XKV A;  4YRV A;  2R7F A;  2GOM A;  4LK0 F;  5B66 C;  4B3A A;  5IP9 J;  5IPA A;  4MFD A;  1GT0 C;  5HS8 A;  1D0Y A;  3BLY A;  3DKY A;  4JBA A;  3F8C A;  2DFE A;  3QP5 A;  2XGD A;  3BT9 A;  2PFB A;  4HAM A;  1RIO H;  1VQN I;  2ESH A;  2ZO4 A;  1ON2 A;  2VPR A;  2IP2 A;  2IS1 A;  3ZXS A;  4KN4 X;  4G8X A;  4ZYA A;  1T56 A;  3BQZ A;  2Q0O A;  1DPR A;  1J59 A;  3LL7 A;  1LEA A;  1U8B A;  1FTT A;  3BP8 A;  1P4X A;  1CF7 A;  5IYB J;  2LFB A;  2QWT A;  1WWX A;  3DPL C;  4PFP A;  1FBU A;  4KJZ A;  3F22 A;  2XPV A;  2Y31 A;  1VQ4 I;  4Q5S F;  3QU6 A;  3SQN A;  2R7W A;  1G3Y A;  2PBI A;  3CC7 I;  1N78 A;  2EV0 A;  1Y8R B;  2ISY A;  1Z05 A;  3F23 A;  1T8I A;  4I0A A;  4U0V A;  3ZPL A;  2NP5 A;  3OIP A;  2HTS A;  4W97 A;  4IHY A;  3BCG A;  4CZC A;  4JP0 A;  4YFN F;  1RRJ A;  4OIO F;  3G71 I;  3NPI A;  1U2W A;  2FU4 A;  2KDO A;  1RES A;  4RGR A;  3K0L A;  1YS7 A;  3TMO A;  4NEL A;  1MBK A;  2LLK A;  5CVU A;  1E3H A;  3WHB A;  3PIO F;  5IY5 H;  4DGW B;  1WFX A;  1FIP A;  3AAF A;  2CV1 A;  2K85 A;  2XGE A;  4MNU A;  3OYK A;  3P9T A;  2CWE A;  1OR7 C;  1X1D A;  1IV8 A;  1R4M B;  3LQR A;  4LLL A;  3JTG A;  1ZR4 A;  5EYR A;  1UI6 A;  2EA4 A;  4IPA A;  3HKZ N;  2JT1 A;  4P9U A;  3A02 A;  1FOW A;  2VKD A;  2AQE A;  1SC7 A;  1E3O C;  3ZQH A;  4BQQ A;  2GXB A;  2YS9 A;  3FRQ A;  1R71 A;  2E2J J;  4XLC A;  2I8D A;  1UI5 A;  4L9T A;  3EUK L;  5AIQ A;  1DP7 P;  2V57 A;  1FOK A;  5A2Q Z;  1UMQ A;  3ULQ B;  3LA3 A;  2WWY A;  5LEK A;  3K7A J;  2R5Z B;  3KKC A;  4PSW A;  2AXL A;  5LGN A;  1J7K A;  2V9K A;  4HKU A;  2Y69 H;  2YU9 J;  1MDM A;  4YZE A;  2Y9Z A;  3AQT A;  3JSJ A;  1K6Y A;  1RC9 A;  3HKZ A;  2HYF A;  4HNV A;  1D0X A;  3DQV C;  3IWF A;  3L00 A;  4C30 A;  3S3O A;  5J1Y A;  2FE3 A;  4HSR A;  1YYV A;  4M3D A;  3MNL A;  2XAF A;  1NH3 A;  4Q48 A;  1XMX A;  3WG9 A;  4C2M A;  1YIJ I;  1AWC A;  1UST A;  1X3U A;  2OD5 A;  3L2V A;  3J7A O;  4A93 J;  1JUS A;  5HOO A;  3LWJ A;  2DDB A;  3RZD J;  1HBX G;  1QVT A;  2B1E A;  4ESJ A;  3SZG A;  4M6X A;  3T5X A;  4B3X A;  4DIQ A;  2ID6 A;  1IJW C;  3C7J A;  3BJ6 A;  4UHT A;  2W25 A;  2OJE D;  2CQK A;  5L3C A;  2QTQ A;  2GAU A;  2KIS A;  4GYG A;  1KA8 A;  3QWL A;  5KK1 A;  1ZRF A;  3I55 I;  1KQ0 A;  3I59 B;  3KNW A;  3CMM A;  4XL9 A;  4V19 K;  3CUQ B;  3MZY A;  4Z6Y A;  2L2O A;  1SVO A;  2YUS A;  3HZJ A;  4L5J A;  3WTW C;  2M30 A;  5ED4 A;  5D4R A;  4OAY A;  1X1A A;  2L7F P;  4B09 A;  1MBH A;  3B81 A;  2COB A;  2P4W A;  2PJR B;  3OMY A;  2X1C A;  2EV5 A;  3GEU A;  5DYM A;  1EH6 A;  1BI3 A;  4GO1 A;  4FCY A;  2VJI A;  3V78 A;  2L4A A;  1SD7 A;  3M8J A;  5ICG A;  2LKP A;  1IAW A;  2JA8 J;  3S1M J;  1X2M A;  2EZK A;  2OER A;  3PNT A;  4BKX A;  4F93 B;  2JSC A;  4ZZL A;  3P9K A;  5GTH C;  1TNS A;  3JCU C;  3KLO A;  4MO7 A;  4NDL A;  2W1O A;  2QWW A;  4RMN A;  1SVM A;  3S2D J;  2CQQ A;  3HJE A;  2AS5 F;  4XON A;  4B8X A;  1Y0N A;  1WH7 A;  3BQY A;  4ZYH A;  3OS1 A;  4A3J J;  1IRG A;  5LHH A;  4UB6 C;  2R7D A;  2DU9 A;  3V42 A;  4D7N A;  4XLN F;  4BE2 A;  3T8T A;  2O8K A;  4F91 B;  3BOQ A;  4A3F J;  2VOO A;  2Y30 A;  2QKO A;  2CFX A;  5LLQ A;  4PJN A;  1FBS A;  2PFV A;  2K9L A;  2L7K A;  5E3N A;  2K9N A;  4ENJ A;  3CJD A;  3RKQ A;  3BZK A;  2VJ5 A;  4LMY A;  3CTA A;  5TRD A;  2R5Z A;  1UHW A;  1LKX A;  2VKE A;  1VQ9 I;  2BW3 B;  2FEZ A;  4H4K C;  2DO7 A;  3O3K A;  3H36 A;  1WJC A;  2NS8 A;  2K40 A;  2W48 A;  4JL3 A;  3REO A;  1X58 A;  4KIG A;  1QHG A;  2FOW A;  2NX4 A;  2E19 A;  2IGO A;  3ZQF A;  5HNH A;  4BYY A;  1OCP A;  4EV0 A;  3SZT A;  4DZJ A;  1D5Y A;  2JRM A;  1RNL A;  1X1C A;  3CP2 A;  3DEE A;  2CUF A;  4ACI A;  1J9I A;  1FMV A;  3I53 A;  2ZB9 A;  1VTN C;  1MMN A;  1R36 A;  3TED A;  1F1Z A;  4BJ6 C;  4KIS A;  3ERE D;  4ZTF A;  1R58 A;  3QOD A;  2IRF G;  1EJ9 A;  1O3S A;  4ESB A;  1RUN A;  4BE0 A;  1GUU A;  2L7Z A;  2ZCW A;  1Z3X A;  4B1R A;  3BR3 A;  4WIB A;  3RKW A;  3TOB A;  5D1R A;  3FMQ A;  4PUS A;  1R9T J;  2YU3 A;  3TKY A;  3DPU A;  3FBN B;  3W6K B;  3I59 A;  2GXA A;  3CUQ A;  2V1D A;  4I2O A;  2CW0 F;  5DAJ A;  1VQ8 I;  5DDG A;  4BDY A;  4XLH A;  3VDX A;  4U7D A;  2F6C A;  2M8E A;  3P5J A;  1PDN C;  4GRI A;  2D2W A;  3CD6 I;  3QQA A;  4NUB A;  1JKQ C;  1YRN B;  4PGG A;  3KX2 A;  4U88 A;  5KNL A;  3ABT A;  5FRM A;  4FHT A;  1MBJ A;  5FKO A;  2PJR A;  1X2N A;  1QRY A;  4A2U A;  5LHI A;  3GBG A;  3MZH A;  4Y17 A;  4FQG A;  2OTJ I;  1WI9 A;  2HGC A;  1X1B A;  4A3E J;  5FMP A;  3MWM A;  2BEO A;  2KP6 A;  1I27 A;  4G6Q A;  1S8N A;  4WCG A;  2F5V A;  3CLO A;  4R1H A;  1A36 A;  4XIC A;  5A2Q K;  1LFU P;  4OWR B;  2R7T A;  5F1J A;  4XLP F;  2EIL H;  2Y0S N;  2Y0M A;  4XSZ F;  2C6Y A;  3KYC B;  1WJD A;  3RPU D;  5BPD A;  4NN1 A;  1XGO A;  4IHW A;  3HXL A;  2ZY9 A;  1FY7 A;  2WV0 A;  2LDU A;  4L9V A;  3J7Z I;  1P7J A;  2LY2 A;  4FX4 A;  1G3W A;  2LNB A;  4XMY A;  3H3V K;  3I0T A;  2FD5 A;  2FNA A;  1YQA A;  5FFZ A;  4XKW A;  3DPT A;  3SZP A;  2HDD A;  3J7A Y;  3ELK A;  3I5U A;  3K1N A;  3CCS I;  2OAZ A;  3DKW A;  2BW3 A;  3BTI A;  2RQP A;  4IQ4 A;  2KQR A;  1T08 B;  5DM7 F;  2YR2 A;  4WXH A;  4RM3 A;  1JJ6 C;  2A07 F;  2Y0S A;  1XDS A;  1R1T A;  2CW7 A;  2ZSH B;  3Q9S A;  3DBL B;  2HZT A;  5HLG A;  1RR7 A;  2MLG A;  3F6O A;  3PFY A;  4Y4R A;  5M5Y J;  5ERI A;  1JTX A;  1XC5 A;  1I3Q J;  3ECO A;  2G7L A;  1X19 A;  3ONQ A;  3OSG A;  1DDN A;  1OCT C;  1OPC A;  2GA1 A;  2NXN B;  3JRF A;  2STW A;  5FGL A;  1RKW A;  2LYC A;  3GTM J;  3F8N A;  3BPX A;  2M5W A;  1FTZ A;  4LG3 A;  1MW7 A;  1XG1 A;  2M9H A;  1R4N B;  3GUD A;  4EMS A;  4UVB A;  3FWE A;  4AC6 A;  1YIO A;  2FML A;  2B0L A;  3ZQ7 A;  2GXG A;  2CGP A;  4BNC A;  4BHP A;  1HF0 A;  1BOA A;  2L4M A;  2DMT A;  3NWS A;  3RDI A;  1SVL A;  3L7W A;  3RQ4 A;  1BN5 A;  5F0F A;  2K4B A;  2K7L A;  3RQI A;  3IHU A;  1OYI A;  3HRM A;  2Q24 A;  1I3A A;  4L9N A;  5E1W A;  4HF1 A;  4X1E A;  2HTJ A;  5D6F A;  2QIB A;  5L3F A;  3K9T A;  2XB0 X;  4RAF A;  3KIO A;  4MHG A;  3ZRG A;  4GFL A;  4Y3O A;  3SXY A;  2JTV A;  4N9H A;  5IT3 A;  2E1N A;  2O6G E;  1YRN A;  2XB5 A;  2OA4 A;  5BOX A;  3HDD A;  3SHF A;  3CCE I;  3SFI A;  3K69 A;  1BC8 C;  1MMG A;  1BJA A;  3S32 A;  3B02 A;  2EFW A;  4ZJZ A;  3RPQ A;  4D7M A;  2KIM A;  4FIS A;  2P8T A;  4G6D A;  4RLF A;  5DUK A;  2BV6 A;  1QPI A;  2OTL I;  2E1M C;  3ZQI A;  4BEH B;  3RPU A;  1MIJ A;  1Y1V J;  3O8H A;  4NQW B;  4WXC A;  2ZJQ F;  2IXS A;  4MIM A;  3AL0 C;  2AO9 A;  4BHC A;  2Y2Z A;  3RYP A;  2HWV A;  3P9C A;  3NQO A;  5B1A H;  3U2R A;  4CGZ A;  2CUZ A;  1JUM A;  2YVE A;  5CVJ A;  3WTU C;  1T98 A;  1UZC A;  1YX3 A;  2W00 A;  1OQY A;  3K10 A;  2JA2 A;  1O3R A;  4A12 A;  3WTV C;  3M7G A;  4AIH A;  2JVG A;  1UHS A;  1KQ8 A;  3CDI A;  3HTJ A;  1TWH J;  4N4O B;  1W5C C;  3R0J A;  1H89 C;  3HOS A;  3C2B A;  2MW8 A;  4HRI A;  1F43 A;  2XF7 A;  2FBK A;  2W7N A;  2HDW A;  1K78 B;  4RB0 A;  5CXG A;  3DEU A;  4ME9 A;  1ZH5 A;  2H6B A;  5CJ9 A;  3KKD A;  1MZB A;  2V4J C;  3Q5F A;  3E6D A; 
#chains in the Genus database with same CATH homology
 1ETQ A;  4M3E A;  4A3D J;  1XS9 A;  2LVS A;  3Q0W A;  4JX4 A;  2RHA A;  2DA2 A;  2R5Y A;  5J1U A;  5EEA A;  1T33 A;  3JRD A;  3S1N J;  1IDZ A;  1ETK A;  5F0H A;  3NI7 A;  5GPA A;  4RBO A;  3L1P A;  2GEN A;  2DA6 A;  3BR6 A;  2LKX A;  3HB9 A;  1JJ8 C;  3LJL A;  5FJ8 J;  2HKU A;  1UG2 A;  1ETX A;  2FQ4 A;  1Q1V A;  2IBD A;  5IOY A;  4I6Z A;  2ZCX A;  1ORK A;  5F27 A;  2CRG A;  3VVY A;  2UXP A;  4GFB A;  2EQR A;  1NK3 P;  2VI6 A;  2OPT A;  3LNQ A;  2NOG A;  5F0C A;  3A03 A;  1DU6 A;  2G3B A;  1ZK8 A;  3B6C A;  3GTQ J;  3VOX A;  4AUX A;  4V2F A;  5FKK A;  2TRT A;  3S1R J;  3E7Q A;  3LSJ A;  2EZL A;  2B63 J;  4IEJ A;  4XK4 A;  2DG8 A;  4DZP A;  1I6H J;  1B8I B;  3ZQC A;  1ETY A;  3M4O J;  3OOU A;  5EZG A;  5IYD J;  5FLM J;  5FHP A;  3RD3 A;  3AQS A;  5EDN A;  4B3A A;  5IP9 J;  5IPA A;  4MFD A;  1GT0 C;  3HTA A;  2JMW A;  2EBI A;  2XGD A;  3H0G J;  3BT9 A;  5D18 A;  3HGG A;  1FIA A;  1K61 A;  1LFB A;  2X6O A;  3BTL A;  3VW1 A;  1VND A;  1JKO C;  4A3B J;  3S16 J;  3VP5 A;  2VPR A;  3VVZ A;  1T56 A;  3BQZ A;  2W53 A;  3E7L A;  4G12 A;  2HYT A;  1U8B A;  3VIB A;  1FTT A;  2ECC A;  2JK3 A;  2NVY J;  2WAQ N;  2G7G A;  3GTP J;  5IYB J;  1AU7 A;  2LFB A;  2QWT A;  5IP7 J;  2MGQ A;  4DYR A;  2XPV A;  2Y31 A;  1LE8 A;  2H1K A;  1IC8 A;  1HCR A;  3S17 J;  5E3M A;  3I4N J;  2M0C A;  2HXO A;  1P7I A;  4A3I J;  1JKR C;  3NRG A;  1JT0 A;  2RAE A;  4UUT A;  2F07 A;  2G7S A;  2NP5 A;  2ME6 A;  5GPC A;  1U9O A;  3BCG A;  4W97 A;  4IHY A;  5EG0 B;  3JRG A;  4JP0 A;  2FBQ A;  1BW6 A;  3S5R A;  3NPI A;  3COL A;  2DMU A;  3QKX A;  1RES A;  3HOW J;  3GTG J;  4NEL A;  1MBK A;  2LLK A;  1WI3 A;  3WHB A;  5IP6 A;  3ON4 A;  1MH4 A;  4BY7 J;  2JJ7 A;  2AHQ A;  1FIP A;  3QPL A;  4D5C A;  2XGE A;  3HEF A;  2HI3 A;  3T6N A;  2DMN A;  2GM4 A;  3P9T A;  3BJB A;  5EGO B;  2HYJ A;  2L0K A;  3BR2 A;  3D1N I;  4MXM A;  3A01 A;  1ZR4 A;  5EYR A;  2UXU A;  1UI6 A;  1RKT A;  3BTC A;  3ZQG A;  2NP3 A;  3HKZ N;  2IU5 A;  3PAS A;  2HOS A;  2UXI A;  3A02 A;  3F1B A;  4XID A;  1E3O C;  2WUI A;  2NS7 A;  3ZQH A;  2YS9 A;  3FRQ A;  1MSF C;  2E2J J;  1ZQ3 P;  1IG7 A;  5FLV A;  2O7O A;  1UI5 A;  2HQ5 A;  1VFC A;  2E1O A;  3G1L A;  2V57 A;  1UMQ A;  4M3B A;  1FEX A;  3K7A J;  4A69 C;  2R5Z B;  3KKC A;  3VOK A;  5C3E J;  3WHC A;  4X6A J;  4RDU A;  4HKU A;  2VUM J;  3NXC A;  2Y9Y A;  2DJN A;  5JLX A;  4FTH A;  3PPB A;  2YU9 J;  4YZE A;  2Y9Z A;  3AQT A;  2JN6 A;  5HOD A;  3JSJ A;  2O7T A;  3EUP A;  2ZOZ A;  1B8I A;  2MG4 A;  4HNV A;  4QSH A;  3LSP A;  1WH5 A;  4BXX J;  5J1Y A;  3MNL A;  4M3D A;  5FKN A;  2FJ1 A;  3JRC A;  3DPJ A;  2EH3 A;  1F36 A;  5M5X J;  2JA5 J;  3LSR A;  4M3F A;  4A93 J;  5GP9 A;  5D19 A;  1JUS A;  3LWJ A;  3HM5 A;  3FIS A;  3RZD J;  1HDD C;  1QVT A;  4FE7 A;  2DA1 A;  5K58 A;  1MBE A;  1Z77 A;  5C44 J;  2ID6 A;  2XSD C;  3CCY A;  3PO2 J;  3HE0 A;  2ECB A;  1IJW C;  2XGC A;  3BHQ A;  3NAR A;  2QTQ A;  1Z0X A;  2M34 A;  2HXI A;  3JRA A;  2DA7 A;  4C3H J;  3KNW A;  2DMP A;  2QF7 A;  2UXH A;  1AKH B;  2OF7 A;  2YUS A;  4XRS G;  2JA6 J;  2DTZ A;  3GTJ J;  5EG0 A;  1PUF B;  1MH3 A;  1JKP C;  3CDL A;  2L7F P;  2TCT A;  1MBH A;  4W1U A;  2COB A;  4C2M J;  3B81 A;  2K9Q A;  1TWG J;  1SAN A;  1MBF A;  5IOZ A;  3VVX A;  3GEU A;  1ZTR A;  2NVQ J;  1S7E A;  2GFN A;  4FCY A;  2ID3 A;  3ZQL A;  3V78 A;  1WGX A;  3S1M J;  2JA8 J;  3VW0 A;  3IH2 A;  1X2M A;  2EZK A;  2E2I J;  2OER A;  5JLW A;  4BKX A;  3VUQ A;  2MSY A;  2ELK A;  2M8G X;  4MO7 A;  4NDL A;  5EGO A;  2NVT J;  3S2D J;  4XRM A;  3DEW A;  2CQQ A;  5BNG A;  2X9D A;  3S15 J;  1WPK A;  3FK6 A;  1WH7 A;  1ITY A;  2EZH A;  3BQY A;  1BA5 A;  4A3J J;  3ANG A;  4GCK A;  4CYC B;  5E3O A;  2R92 J;  3NNR A;  4D7N A;  1IGN A;  3BR1 A;  3LSG A;  2O8K A;  2QKO A;  4A3F J;  3CMY A;  2Y30 A;  3TW7 A;  3MN2 A;  2XPU A;  4V2G A;  3G56 A;  2FX0 A;  2QCO A;  2HOT A;  3S2H J;  5HBU A;  2DG7 A;  3EGQ A;  5E3N A;  4M6V A;  2K9N A;  3CJD A;  3RKQ A;  4MFE A;  1ETO A;  2P81 A;  2ZOY A;  3HOU J;  3G1O A;  1A6I A;  4I76 A;  2R5Z A;  2VKE A;  1K83 J;  2LTP A;  4L5E A;  5C4Y A;  2NS8 A;  1ZKG A;  3IV5 A;  4C3J J;  1CQT A;  2K40 A;  2W48 A;  4XRS A;  4JL3 A;  3QPS A;  3G7R A;  4AYB N;  1X58 A;  3BTJ A;  2GLO A;  5EFY A;  3HBL A;  3RZO J;  4A3C J;  2NX4 A;  2E19 A;  3ZQF A;  4EEF G;  2ZCN A;  1OCP A;  1D5Y A;  2K9S A;  2M2E A;  5F08 A;  4DZJ A;  1A5J A;  2QOP A;  5EF6 A;  1QVU A;  4GCT A;  1MNM C;  1H8A C;  2CUF A;  4ACI A;  3G1M A;  2LD5 A;  2ZB9 A;  4JNN A;  1O4X A;  3TED A;  3GTK J;  4ABZ A;  5HAW A;  4GFK A;  2XDN A;  1TWA J;  3HOX J;  4UUS B;  3CWR A;  1H88 C;  4IHX A;  1GUU A;  1ZR2 A;  3JRH A;  2L7Z A;  1I50 J;  4B1R A;  3SJM A;  2O9L A;  2WGB A;  2D5V A;  3QBM A;  1GDT A;  3BR3 A;  2DA3 A;  4FE4 A;  4BBS J;  2UXO A;  3IH3 A;  3UKG A;  4ICH A;  5D1R A;  4A3M J;  1R9T J;  5FKL A;  2GBY A;  3Q3S A;  3BR0 A;  5CW8 A;  3BRU A;  5DAJ A;  9ANT A;  3FIW A;  4CGR A;  3CQZ J;  1AKH A;  3VW2 A;  3BG3 A;  3HGY A;  1JUP A;  1W0U A;  3BR5 A;  3BG9 A;  5K7H A;  3QQA A;  1JKQ C;  1PUF A;  1YRN B;  3NAU A;  1DU0 A;  4QTR A;  2XRL A;  2CUE A;  3LOC A;  3GTL J;  1MBJ A;  2PMZ N;  5FKO A;  2KT0 A;  1X2N A;  2VKV A;  2L9R A;  1QRY A;  1FJL A;  3GBG A;  5HSZ A;  3ANP A;  4BY1 J;  4A3G J;  4J19 A;  3ON2 A;  4A3E J;  1MBG A;  5FMP A;  3HOY J;  3FK7 A;  5DTD A;  1VI0 A;  1U9N A;  3HOZ J;  4XIC A;  1LFU P;  1U78 A;  2LP0 A;  5F1J A;  2HOA A;  2XPW A;  2Y0S N;  1SGM A;  3KZ9 A;  1HLV A;  3GTO J;  1G2H A;  4NN1 A;  4IHW A;  1OJL A;  5M5W J;  4CYC A;  1ETV A;  5H9T A;  1P7J A;  3H3V K;  5IYC J;  2H8R A;  1VF9 A;  2REK A;  1RPW A;  4S0H B;  3MKL A;  2FD5 A;  4MLO A;  4M3G A;  1B72 B;  2HDD A;  5K7Z A;  2IAI A;  1BL0 A;  3FKI J;  2WV1 A;  5J1R A;  2EZI A;  5M3F J;  4JX6 A;  4D5F A;  5E3L A;  1AHD P;  2DA5 A;  4AC0 A;  5AQC A;  3BTI A;  3JRE A;  3Q0U A;  3M3Y J;  1JJ6 C;  4DYQ A;  3JRB A;  2ME0 A;  3SDG A;  2GUH A;  5CXI A;  4JYK A;  3LHQ A;  1MSE C;  2R5Y B;  1RR7 A;  3IUV A;  2ZCM A;  5M5Y J;  1BJZ A;  3C07 A;  3HTH A;  1JTX A;  1XC5 A;  1I3Q J;  2G7L A;  3Q0V A;  1TWF J;  5C4J J;  4IHV A;  2PBX A;  1EF4 A;  3OSG A;  1OCT C;  4Y7N J;  2I10 A;  1WCM J;  3JRF A;  5FGL A;  2CJJ A;  3JRI A;  3DCF A;  1RKW A;  1IDY A;  1Y1W J;  3GTM J;  4A3K J;  3HTI A;  3I4M J;  1FTZ A;  4UUS A;  1XG1 A;  2LK2 A;  2M9H A;  5EZH A;  5C4X J;  4AC6 A;  2PZ9 A;  3O60 A;  2D6Y A;  4JKZ A;  3HIM A;  5J3L A;  3ZOB A;  3OSF A;  1HF0 A;  2E2H J;  2NVX J;  4DW6 A;  2DMT A;  2LY9 A;  1BW5 A;  2X48 A;  3W6V A;  3PM1 A;  2LR8 A;  5F0F A;  3O8G A;  1JGG A;  3BNI A;  2WB1 N;  3RQI A;  2CU7 A;  1W0T A;  4L62 A;  2Q24 A;  2CQX A;  1ZGW A;  4X1E A;  2OI8 A;  3B6A A;  4BBR J;  4MK6 A;  2QIB A;  3TP3 A;  2XB0 X;  4C3I J;  4GFL A;  2RAS A;  4QIW N;  1GV2 A;  1YRN A;  4B4C A;  3IH4 A;  2XB5 A;  5F04 A;  2R7Z J;  3HDD A;  3V6G A;  3SFI A;  4DYC A;  3MVP A;  1IRZ A;  1TC3 C;  4D7M A;  4LOC A;  2DMQ A;  2YVH A;  4FIS A;  1QPI A;  1JTY A;  3ZQI A;  1LE8 B;  3S14 J;  1NTC A;  1JT6 A;  4JX5 A;  1Y1V J;  3O8H A;  4Y52 J;  2JWT A;  4MIM A;  2AO9 A;  3GZI A;  4PXI A;  2Y2Z A;  3CRJ A;  1APL C;  3JR9 A;  1JUM A;  1OFC X;  3VPR A;  2YVE A;  2L7M P;  1TWC J;  2IEK A;  4A3L J;  1IUF A;  4AF5 A;  2KDZ A;  1NK2 P;  5K7F A;  3S1Q J;  2N8G A;  1IV6 A;  1GV5 A;  1ETW A;  3OIO A;  1UHS A;  1B72 A;  5DS9 A;  3HTJ A;  1HDP A;  1ENH A;  3K2A A;  1TWH J;  5FKM A;  1H89 C;  2DN0 A;  3C2B A;  2MW8 A;  1SFO J;  1F43 A;  3TP0 A;  4KWA A;  3PO3 J;  2R0Q C;  1RET A;  1HOM A;  3HOV J;  2G0E A;  3BG5 A;  5CXG A;  3TW6 A;  4ME9 A;  4UDS A;  2DA4 A;  3F0C A;  1GVD A;  3A01 B;  3KKD A;  5M3M J;  2JA7 J;  3RH2 A;  1POG A;  2R93 J;  4GCL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...