3BR5A

Crystal structure of the complex of rhodamine 6g bound to qacr(e90q), a mutant of a multidrug binding transcriptional repressor
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
186
structure length
184
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKSEQIKCKTNREKFYLYNELSLTTQYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Formal electrostatic interactions do not govern QacR-cation affinity
rcsb
source organism Staphylococcus aureus
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator qacR
total genus 77
structure length 184
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2007-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3br5A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3br5A02
3HOWJ 5CW8A 2N8GA 3KNWA 3HOXJ 1S7EA 1ETVA 2G7LA 4W1UA 2XPWA 1QRYA 1RKWA 4DW6A 3JRAA 2L7FP 3GTKJ 2HKUA 3S1MJ 4DYRA 1HLVA 1H88C 1JUPA 1OCPA 4ME9A 3JRBA 4JYKA 3BT9A 5IP7J 3HE0A 5D18A 4UUSA 1UMQA 5FLMJ 5EEAA 2DJNA 3BTCA 3F0CA 3JRHA 3IH4A 2JN6A 4XK4A 1ETOA 3A02A 1AU7A 2L0KA 2AHQA 1O4XA 3QPLA 2G3BA 1MNMC 2IEKA 2ME0A 1FTTA 5H9TA 3Q0WA 3BQZA 1WCMJ 2VI6A 4M3DA 2HOTA 2HDDA 2Q24A 3PASA 2PBXA 5EG0A 2E2IJ 2Y9ZA 4G12A 1XG1A 2X6OA 2R7ZJ 2KDZA 1PUFA 2HOSA 2GLOA 4AC6A 3JR9A 1MSFC 4ACIA 4Y52J 4HNVA 2YVEA 2XRLA 2MG4A 3VVZA 5C4YA 2XSDC 1ENHA 1JGGA 4MO7A 1ZR2A 1AKHA 2DMPA 1JKOC 2E2HJ 4UUTA 2NOGA 2NX4A 3I4MJ 1RPWA 2CQXA 2ZCXA 4NELA 3RZOJ 3ZQGA 4MFDA 2R5ZA 3S16J 1TWHJ 5J1YA 2DA5A 1K83J 2V57A 2QWTA 1DU0A 2FD5A 3IV5A 3RQIA 2OI8A 2YU9J 4AUXA 1MBHA 3O60A 5F0CA 5F0HA 1BL0A 2M9HA 1UHSA 2HXOA 4GCLA 4A3DJ 3PM1A 1MBGA 1LE8A 2K9SA 1T33A 2CQQA 2R0QC 1HDPA 1JKRC 3QQAA 2DTZA 1ZR4A 1YRNB 3LWJA 3VOKA 2PMZN 5C44J 5IYBJ 3F1BA 3TP3A 2P81A 3RH2A 4BBSJ 2XGDA 2FX0A 4LOCA 3A01B 1JKPC 4BY7J 1IDYA 2XGEA 2GUHA 2QIBA 2EQRA 2XDNA 3HIMA 1HOMA 1JT6A 3SFIA 4XRSG 1RR7A 2X48A 1IUFA 2CU7A 3M4OJ 1OFCX 3GTJJ 2EZLA 3GEUA 5FKLA 4DYQA 5FLVA 2F07A 2QTQA 5GP9A 4JL3A 1LFUP 5DS9A 3K2AA 1B8IA 3VW2A 4FTHA 2LTPA 3CWRA 4GFLA 1ETYA 3HM5A 3JRCA 4A3LJ 4MLOA 5EGOB 5FKMA 5HBUA 4QIWN 1IRZA 1BJZA 2LLKA 5GPCA 2LY9A 3Q0VA 3FRQA 2K40A 4CYCA 2R5ZB 1PUFB 3HTJA 4C3JJ 3BCGA 2FJ1A 1POGA 1APLC 3HGYA 2NVYJ 3PO2J 1RETA 2COBA 3W6VA 3QKXA 1SFOJ 3LJLA 5HAWA 2B63J 2CJJA 4A3BJ 3BJBA 1GVDA 2R5YA 3BR6A 4JP0A 1Q1VA 4B1RA 1X2MA 1I50J 3H3VK 1ETXA 1OJLA 4JX4A 5IOZA 1GV2A 2E19A 4FE7A 4JX5A 1LE8B 1D5YA 5IP9J 1HDDC 3KKDA 1H89C 3ANGA 1SGMA 1UI5A 2LR8A 4DZPA 1ZGWA 3GTGJ 3MVPA 2JJ7A 3AQSA 2LP0A 2FBQA 1JKQC 5K58A 1FTZA 5E3NA 1Y1VJ 2GM4A 1F36A 3HOYJ 2I10A 2UXOA 3VPRA 1U8BA 1JTXA 3BG9A 4D5CA 4M6VA 1IJWC 1AKHB 4YZEA 2DN0A 4JKZA 5FJ8J 2JA7J 3S17J 2VKVA 1A5JA 4FCYA 2LKXA 1TWGJ 1ZTRA 3VP5A 3V6GA 4L5EA 1VF9A 3NAUA 1JUSA 3QPSA 1UI6A 4HKUA 1GDTA 1EF4A 1TWCJ 5CXIA 2XGCA 5IPAA 2M8GX 3OSGA 2JA5J 3M3YJ 4BKXA 4RBOA 3NXCA 3BG3A 3BR3A 4BXXJ 1X58A 2NVQJ 5M5YJ 2HI3A 1FIPA 5BNGA 1BW5A 3IUVA 1MBJA 1X2NA 1W0TA 3CCYA 5K7HA 2JMWA 3LSGA 4GFKA 1HCRA 4MXMA 2XPUA 2W48A 2AO9A 3HB9A 5HSZA 5JLXA 4AF5A 2QF7A 3PPBA 3KKCA 4UUSB 2DMUA 4M3FA 3BR2A 1LFBA 4RDUA 4PXIA 3A03A 2D5VA 1MH4A 1U9NA 3HOVJ 2E2JJ 1XC5A 3H0GJ 1TWAJ 2ECBA 1NK2P 2NS8A 4GFBA 5F1JA 1G2HA 3NARA 2IAIA 2E1OA 5EF6A 1W0UA 3VOXA 3GTQJ 5EZHA 3BHQA 3NRGA 3NI7A 3S1QJ 2WAQN 3A01A 2D6YA 5DAJA 2K9NA 1F43A 2VUMJ 3GBGA 2OPTA 1SANA 1WPKA 4NN1A 2ME6A 2K9QA 2Y30A 2EH3A 3Q3SA 3BQYA 1OCTC 2X9DA 4XRMA 3CQZJ 3JREA 2MGQA 1IV6A 4Y7NJ 1JJ6C 1MBEA 3VVYA 2G7SA 1P7JA 5D19A 1WGXA 1A6IA 2EBIA 3O8GA 3OOUA 2DA6A 3FIWA 4NDLA 5E3LA 3O8HA 5K7ZA 3VW1A 1WH7A 1YRNA 4I6ZA 5EGOA 1U78A 3BTLA 2HYJA 5K7FA 3DEWA 5C3EJ 4AYBN 3FK6A 3JRFA 2L7MP 5FKKA 1IGNA 5JLWA 3ZQFA 3COLA 5E3OA 3KZ9A 4X6AJ 4ABZA 5FHPA 1UG2A 5M5XJ 4A3CJ 3ZQHA 1ZKGA 5GPAA 2L9RA 2G0EA 4FISA 5EDNA 2R92J 2WGBA 5IYCJ 4DYCA 2NVTJ 3OSFA 9ANTA 3B6CA 3G1LA 1BW6A 1MBFA 1VI0A 2FQ4A 3BR0A 3HBLA 1MSEC 2DMNA 3C2BA 3WHBA 4A3GJ 2ZCMA 2NP5A 4XRSA 2DA2A 3ZQCA 2G7GA 2ID6A 4IHWA 3I4NJ 4MK6A 2VKEA 2MW8A 4A93J 3QBMA 5HODA 3S2HJ 4A3MJ 3B6AA 3E7LA 2JA6J 3OIOA 3G56A 2QOPA 4XIDA 3JRDA 3LNQA 2RAEA 5C4XJ 3HGGA 4J19A 3LSRA 4A3FJ 1U9OA 1T56A 2GFNA 5J3LA 2DA7A 4UDSA 3HKZN 3VIBA 4IEJA 1ZQ3P 3EUPA 1WH5A 2M0CA 1B72A 1TC3C 4AC0A 1FEXA 1Z0XA 1ETWA 3C07A 1IC8A 4ICHA 2OF7A 3T6NA 1GV5A 2ZB9A 2IBDA 2M2EA 3HOUJ 2UXPA 1JJ8C 2NP3A 3S1RJ 3S14J 2Y9YA 3ANPA 2Y0SN 3S5RA 4JX6A 2OERA 3S1NJ 4A3JJ 3LSPA 3S2DJ 4QTRA 5FKNA 2PZ9A 3CJDA 3TW6A 3PO3J 4GCKA 2XB0X 2KT0A 3K7AJ 4EEFG 3LOCA 3IH3A 1WI3A 1GUUA 3CDLA 1ITYA 4QSHA 3ZQIA 4KWAA 1QVTA 4DZJA 1Y1WJ 2QKOA 3HEFA 3ON4A 1QVUA 4V2GA 3LHQA 2HXIA 5F27A 3RZDJ 2YUSA 1H8AC 3FISA 2CRGA 5FKOA 4S0HB 4BY1J 3WHCA 3G1OA 4XICA 4A69C 2WB1N 2W53A 3SJMA 4C3HJ 3BTJA 1B72B 1NK3P 5M3MJ 3MN2A 2REKA 3RD3A 2QCOA 5FMPA 2RHAA 4CYCB 3AQTA 3BG5A 4W97A 1FJLA 1MBKA 3B81A 2DMQA 3VVXA 2RASA 3DPJA 4B3AA 3ZOBA 1IG7A 3VUQA 4IHVA 4V2FA 5IOYA 3NNRA 2UXHA 2UXIA 3GTLJ 2DMTA 1GT0C 2Y2ZA 3ZQLA 3EGQA 4BBRJ 4GCTA 3Q0UA 4A3IJ 1RKTA 4B4CA 2H8RA 2UXUA 2ZOYA 3CRJA 3D1NI 1VFCA 4M3BA 3CMYA 3L1PA 2LK2A 2M34A 4I76A 2LFBA 2TRTA 3HTHA 2CUEA 3V78A 2JA8J 5CXGA 2DG8A 2GENA 5IYDJ 2DA1A 3P9TA 1JT0A 5FGLA 5EFYA 3JRIA 1XS9A 3BTIA 3G7RA 2MSYA 1FIAA 3ON2A 3NPIA 5AQCA 4FE4A 5DTDA 1CQTA 3IH2A 2H1KA 2DA3A 4MFEA 2HYTA 5J1UA 3BR5A 3HOZJ 2XB5A 5EZGA 1I6HJ 1R9TJ 4A3EJ 1HF0A 2EZHA 2GBYA 5EG0B 3JRGA 2DG7A 2EZIA 5F0FA 3SDGA 3BRUA 3E7QA 3TW7A 5F08A 3G1MA 2HOAA 1MH3A 2JWTA 2Y31A 3TEDA 1K61A 1IDZA 4JNNA 4D7MA 1JUMA 1JTYA 3BNIA 3GZIA 3GTPJ 5IP6A 1NTCA 1QPIA 3UKGA 1ETQA 2VPRA 5M3FJ 5M5WJ 5E3MA 2YS9A 2ZCNA 4D7NA 3FK7A 2O7TA 3HDDA 4IHXA 3DCFA 2ZOZA 2ELKA 3GTMJ 2CUFA 5F04A 2WUIA 2LVSA 1RESA 2JK3A 1AHDP 2ID3A 3TP0A 3GTOJ 5J1RA 2O8KA 1E3OC 2WV1A 5C4JJ 3MKLA 4IHYA 4M3GA 4C3IJ 1B8IB 2R5YB 3HTIA 1I3QJ 3VW0A 2L7ZA 1ETKA 4MIMA 4CGRA 2ECCA 1VNDA 2IU5A 3HTAA 3BR1A 1P7IA 2XPVA 5D1RA 1TWFJ 2LD5A 4D5FA 2NS7A 2O7OA 2TCTA 3FKIJ 5EYRA 2NVXJ 4C2MJ 3RKQA 1BA5A 2DA4A 4X1EA 2YVHA 2HQ5A 1DU6A 4L62A 3JSJA 4M3EA 2R93J 3MNLA 2EZKA 3LSJA 2O9LA 1Z77A 4A3KJ 3S15J 1ORKA 1ZK8A
chains in the Genus database with same CATH superfamily
3GMEA 1D3YA 2RKHA 2M5WA 2PG4A 3NQOA 3HOXJ 2IA2A 3M8JA 2IA1A 1ETVA 2DCEA 5GAGJ 2G7LA 3KP3A 5LLQA 1RKWA 1OQYA 3W2VA 2VXDA 4ZYGA 5ICEA 3S1MJ 2LOOA 2P5KA 3DEEA 4OD5A 1STZA 1YX3A 3MFKA 1LUJB 3HHHA 2DT7B 3HZJA 3CP2A 1UZCA 4JYKA 2EV6A 4HDVA 1DP3A 4UUSA 5E17F 5EEAA 1XMAA 5FFZA 4CCOA 1OR7A 2JN6A 1ETOA 2ZFUA 2KDOA 4PDKA 2L0KA 1O4XA 1FX7A 3FWEA 2F5FA 3ZMTA 3RYPA 3Q0WA 3BQZA 4XORA 1VZ0A 3I3LA 2R7DA 2Q24A 2B1EA 5ILVA 2DYSH 1S9HA 3WTVC 3HPGA 4EJOA 2X6OA 5B3SH 2KDZA 3I53A 2A3SA 3DTEA 1PUFA 4NC7A 1WJAA 4HF1A 3TO9A 2RVCA 1WHUA 2MG4A 2IT0A 2CQ7A 1MDMB 3O2PE 1FYMA 2XSDC 3KX2A 1ZR2A 1JKOC 1D0YA 4UUTA 1ZG3A 4KICA 5LRRA 2NOGA 4L9TA 1AWCA 3I4MJ 2ZCXA 5ILSA 1KZHA 3VTIA 2KISA 1R5ID 1B9NA 2DA5A 1CF7A 1K83J 2BYVE 4MEYF 5ED4A 1ZG1A 1DU0A 2FD5A 3RDIA 4IX7A 3WU1B 1LEBA 2H27A 3HHGA 4LK1F 2FEZA 2HEOA 3NS4A 2UXNA 4KT5C 4II2A 3LSHA 3QP6A 3U2RA 4YFKF 2V9PA 1FBUA 1HDPA 3OYIA 2H8WA 4BE2A 4G8XA 4Y3OA 1YW7A 2Q1ZB 5IYBJ 1P9QC 5L3GA 1UCRA 3DWLE 3RH2A 2W1OA 1IRGA 2GUHA 1Z3YA 1L3LA 3LQRA 2BVLA 2CO5A 2E1MB 5CVUA 2VQGA 4XKCA 1HOMA 3SFIA 2ZJPF 4EJTA 4XRSG 1IUFA 3M4OJ 3L2UA 2OUMA 4XLPF 1OFCX 3S32A 5HLTA 3PSFA 1BOBA 2F07A 4CGZA 3ZMZA 2W85A 1LFUP 5DS9A 3K2AA 1SFEA 1XPXA 3VW2A 4FTHA 2LTPA 2M87A 5E1ZB 1X1AA 3HM5A 3JRCA 2OBPA 1IAWA 2FOKA 4MLOA 3ULQB 1G59A 5EGOB 4QIWN 2WB1A 2ZJQF 2LREA 1IRZA 5GPCA 4KA4A 1K78B 3OMYA 3HTJA 3QRFF 1D8JA 3BCGA 3FKJA 4O6JA 2FJ1A 2QKLB 1G6NA 3I58A 3HGYA 2NVYJ 2V9KA 1BR1A 2GA2A 3ASNH 3DPTA 3K4CA 3CZ6A 1EJ9A 4LB5A 1SFOJ 3QKXA 3LJLA 2B63J 3HRMA 4A3BJ 5L3FA 3BJBA 2R5YA 3GCMA 3BR6A 1R1UA 1AOYA 5DD4A 2XVCA 1TZLA 3IHUA 3PUFA 2HPIA 3GFJA 3H3VK 1OJLA 2XAUA 3P9IA 3GWZA 3AAFA 2E19A 3I0TA 4FE7A 3HUGB 1LE8B 5IP9J 2X4HA 1R71A 1T0FC 4DZPA 3GTGJ 3MVPA 3CMAI 2L7KA 2JJ7A 3F23A 2K3PA 2LP0A 1BM9A 1Z21A 5K58A 2DODA 3PNVA 4BEHB 5CYVA 2A68F 3OY9A 2FOWA 1Q1HA 2B9SA 4CCMA 3LMMA 3OYHA 2LBFB 2X51A 2IS4A 1QZYA 5LGTA 4YZEA 4XM3A 2DN0A 1EV7A 3KYCB 2ZFWA 4U9LA 3QODA 5FJ8J 1A36A 4FCYA 2BW3B 3CJQB 1Y6IA 2GIZA 2LYCA 4XNFA 3F21A 3KYDB 4I99C 4L5EA 1JUSA 1ZYRF 3GZNB 5D5WB 1GDTA 2KMUA 1KYWA 2E35A 2Z3YA 2JT1A 1EF4A 2XGCA 1ZGAA 2JA5J 1I5ZA 1B6AA 2E5NA 3DEUA 4BXXJ 1X3WB 2PMZA 4CCKA 1Y0UA 3G2BA 2HU9A 1S8NA 1XMXA 1BW5A 1FY7A 2Q0OA 3IUVA 2LY1A 4OIQF 1MBJA 1X2NA 3KCCA 1K79A 3LSGA 3MZ8A 4ZYDA 4DVYP 4U9NA 4MEXF 3OS0A 4Q4ZF 4HLXA 2XKPA 2MLKA 4CO8A 3DBLB 1TTYA 4UVCA 2VC0A 2DYRH 4HA8A 1RRJA 4M3FA 1D1CA 3BR2A 2HKXA 2GQQA 2R7QA 3GZ6A 1VQKI 3H9QA 2E2JJ 3ERED 4HOBA 2NS8A 1BI1A 2IAIA 1W0UA 2ZKZA 3OYBA 2W84A 1SD4A 1Z91A 2XF7A 2NAZA 1K4TA 2A5YB 2VC1A 3BHQA 3NRGA 3S1QJ 4B48A 3A01A 2K9NA 2DOAA 4L0YB 1F43A 2VUMJ 1REPC 2CV1A 5EEHA 4D9JA 4CCLA 1G3WA 2ME6A 3JTHA 3P5JA 1D1AA 1UG0A 2WY7Q 1G3YA 3ABUA 4KIGA 5FD6A 1IO2A 4Y7NJ 4RMNA 1ZREA 5K7ZA 4P9UA 3VW1A 3UR3C 3SXYA 1OCCH 3BTLA 3DLAA 3BC8A 2JSPA 1YJ9I 3JRFA 3BZCA 3COLA 1X4PA 5E3OA 1Y0NA 4BQAA 4X6AJ 2QLZA 4LLLA 2ZBKA 1O7FA 2DTRA 5IT9K 1J0RA 4CZCA 1ZH5A 3KZYA 4NBQA 3B73A 4PJLA 5GADJ 1PP7U 5GPAA 1BBYA 3QU3A 2KIMA 2EPFA 2G0EA 3KZZA 2X1DA 1P4XA 4OMZA 3WTYC 2IS6A 5IYCJ 4PK4A 1WSUA 1VQ5I 5H6QA 2DPDA 5ILUA 1N25A 2KJCA 3OYGA 2RREA 3RKYA 2E7WA 1MSEC 2DMNA 3WHBA 5FB2A 4HV5A 1X1DA 4A3GJ 5B66C 1TNSA 5TISC 2NP5A 2DJIA 3HRUA 2DA2A 3S93A 5H6RA 3IUOA 4U0YA 2KQRA 1R49A 1VQ9I 3E6MA 3QBMA 5HS9A 3KP4A 3B6AA 5LRSA 3L2RA 1ZRDA 1TQPA 4ZDLA 1ZG5A 1T95A 2BXYA 3LNQA 2RAEA 4A3FJ 3I55I 2A61A 1T56A 5D6FA 3CC7I 1IN5A 2C6YA 4UDSA 1ZQ3P 3EUPA 1WH5A 2JVGA 4CICA 1FEXA 1Z0XA 3GFLA 1ETWA 4S04A 2VJIA 3C3WA 1IC8A 2QSGX 3QP5A 2IBDA 2QYOA 1T8IA 2UXPA 2DLLA 1NH3A 2Y9YA 2Y0SN 1Z7LA 4JX6A 1N77A 2OERA 4A3JJ 2JSCA 4Q48A 3FXOA 2HTJA 5J4YA 4GCKA 3VDXA 2XB0X 3BROA 2KT0A 2VQLA 5JVGF 2DDBA 4O3MA 3PFYA 3LOCA 3H92A 1FPQA 3KETA 3DKYA 2HNHA 4KFCA 2ZXJA 4QSHA 3ZQIA 1Y1WJ 3RYRA 2RNJA 1QVUA 4F93B 3LHQA 5F27A 4LGWA 3RZDJ 2D45A 4K2EA 2E34A 2R7OA 4AVPA 4S0HB 2ZC2A 4YFXF 2P8TA 3CCLI 4BY1J 3G1OA 2PX9A 4IRIA 4XICA 2DAOA 2LF7A 2AXTC 2Z9OA 1SAXA 3K69A 2PLYA 1LVAA 3SJMA 2FXAA 4OAYA 4C3HJ 5M3MJ 5CVJA 3HOTA 4RGRA 2OTJI 5FD5A 3BG5A 2A6EF 2HQRA 2K4BA 3KEOA 1USTA 4XKWA 4C2UA 2RASA 1IRFA 4B3AA 2RV8A 3SWHA 4V2FA 2JUGA 3CMMA 1QHHD 2O0YA 3OIQA 4E70A 3FF5A 3Q0UA 4A3IJ 4BUPA 2UXUA 3CUOA 5F6FA 1V5FA 1NHAA 3RKWA 1VFCA 2E1NA 4EMSA 2PEXA 3L1PA 1OISA 4I76A 2LFBA 3V78A 3A0BC 2DG8A 3MKWB 1HBXG 2F4OB 1R4NB 3D5LA 1QZZA 3K4LA 5EFYA 3JRIA 4OINF 3BTIA 3H3UA 3OYLA 1FIAA 3QPHA 3T8RA 2ACJA 3J7AY 5AQCA 2AQFA 3W3CA 3IH2A 2DA3A 4MFEA 3AG4H 1F1ZA 3RQ4A 3BR5A 4CDGA 2M4GA 4A3EJ 3S2WA 4IOCF 1KU3A 5F08A 3CCEI 1ONVA 4HBLA 4NHJA 5L3EA 3DU5A 3K6GA 2H6CA 1JTYA 3AG1H 1HKTA 1JHFA 3U9GA 5IP6A 3JSPA 1QPIA 2M7BA 3IAS2 3PL8A 3HRSA 2BXZA 2YS9A 3OR2C 5J4VA 4PJJA 3F6VA 3IWZA 4IHXA 1LJ9A 4NC6A 1YS6A 2RNGA 1OKRA 2JK3A 4UB8C 3TP0A 2OCEA 3OS2A 1WQ2A 3KEYA 3F3XA 2K7LA 2DK8A 1B8IB 4OAZA 2R5YB 3VW0A 4DGWB 4AM3A 2L7ZA 4UNOA 2ZMEC 2CQKA 4MIMA 4CGRA 2KZGA 1VNDA 1YIOA 2MC3A 3CUQA 3I59A 2OZUA 3BR1A 3ZR8X 2LD5A 3HTSB 2IXSA 4D5FA 1ULYA 5GTIC 2NS7A 2O7OA 2TCTA 4UVBA 3O6BB 1TLHB 2DA4A 4X1EA 2K9MA 2HQ5A 1TT5B 2ETHA 1K4SA 2FU4A 2O9LA 2XROA 3S15J 1ZGJA 2NOJB 2HYFA 4RS8A 2JVHA 2VODA 4UXNA 2PJRB 2VOOA 1FNNA 3K4BA 3FX3A 3I54A 4AIHA 3JRAA 2VBZA 5KAIC 3K8PC 4DYRA 2HQNA 2JUCA 4NQWB 3MKZA 1T39A 2O3FA 4L18B 1I1GA 3JCUC 2HVSA 3NWTA 1UMQA 2ZNZA 2DJNA 4N9HA 3V8LA 3BTCA 3JRHA 1QGPA 3FMRA 3IH4A 3MEXA 4CH7A 2GAUA 2F6CA 4XK4A 3CC2I 2KJBA 3A4CA 2UZKA 1FTTA 4EQQA 5H9TA 3EUHA 1WCMJ 2HOTA 3GZ5A 1ZAOA 2PBXA 4U0VA 5EG0A 3ECOA 4YEJA 1W36D 2R7RA 3SHFA 1Y56A 4Y33A 3ZN0A 2E2IJ 2Y9ZA 1U3EM 2XHKA 2RGVA 3VWBA 2OAZA 3T1BA 3JR9A 4AC6A 4HNVA 2XRLA 3VVZA 3VYRB 3KEQA 3LSTA 1AKHA 2DMPA 2TDXA 5J8CA 2NX4A 3COAC 4NELA 4ZJZA 1TBXA 5LEKA 2R5ZA 4CA0A 4PSXA 4D0PA 3CF5F 3S3MA 2E1CA 1VQNI 3S16J 1S6LA 5B1BH 4BS9A 1SVLA 2YU9J 3O60A 4BEHA 2M9HA 1UHSA 1PUEE 4GCLA 2F5DA 3J7YJ 3CJRB 4A3DJ 1UHWA 1LE8A 2BBYA 2V1XA 1IN4A 2R0QC 1JKRC 3GEZA 3G73A 3QWLA 3QQAA 1GVJA 2HGCA 1XB4A 4ZYEA 4YRVA 1QHGA 1ZR4A 1YIJI 2YR2A 2ICWG 3SZGA 2FX0A 4YFNF 3PNYA 2XGEA 2QIBA 1QNTA 3HIMA 2IW5A 1RR7A 1QO0D 2X48A 2CU7A 5JHFA 3FHNA 5FKLA 1MJAA 1S3JA 2VASA 2QTQA 5GP9A 2VN2A 1GHCA 4RB3C 3E6BA 1I27A 1B8IA 1BIAA 3CJTB 3HC7A 3J80K 3X2QH 3ZRGA 1WJ5A 2RQPA 1ETYA 3Q9SA 1T6SA 1FP2A 2P6SA 3FXRA 2GA1A 4G6QA 4A3LJ 4DOZA 2IPQX 4F52A 1OPCA 4BJ6C 5HLIA 2LY9A 3H9GA 3FRQA 3IKTA 4LITA 1PUFB 4C3JJ 5A2QK 3AFHA 3FM5A 1APLC 3OL4A 4A5NA 5HVQC 3WGHA 2MYSA 5HAWA 1GVDA 4RA2A 4JP0A 1Q1VA 4B1RA 1X2MA 3QU6A 3FXLA 4ITVA 5CVIA 2CV0A 1I50J 4ZDOA 4JX4A 3FMSA 3KP2A 4HG2A 5IOZA 1HDDC 1XGSA 1D5YA 3DFGA 4R79A 3E0JB 3S3OA 4UVAA 3ABKH 2PFBA 4FT8A 4HNTA 4S05A 2FRHA 1BIBA 1MZBA 3EYYA 1Y1VJ 1SFXA 4BH9A 1FMWA 2EINH 5KNLA 2I10A 2UXOA 1J09A 1U8BA 4D5CA 1V55H 1IJWC 1IF1A 2XAGA 4JKZA 4ESBA 2EJRA 1Z6TA 2VKVA 1A5JA 1J9IA 2J5OA 3O3KA 4RGSA 3OL3A 4BGDA 3GYHX 3DLLF 2L9NA 3GW2A 3HOSA 5LD2C 2XF6A 4HKUA 2F2EA 2K02A 1YE9A 1TWCJ 5CXIA 2DOFA 5IPAA 3UNGC 3P9KA 3M3YJ 1K7AA 4HX7A 3NXCA 3BR3A 2VQCA 1EH7A 2MBFA 2P6TA 3OYDA 4ON0A 3ZMSA 5HLHA 4GXOA 2OZ6A 4LK0F 5BNGA 2EA2A 2XF5A 4XMYA 2KPMA 3CCYA 1ERDA 4PFPA 3K1MA 1R22A 2VBYA 5BPIA 3C1DA 3HB9A 5JLXA 5DUIA 2DT6A 3ZGKA 4LG0B 4OIRF 4E7HA 1YFHA 3WE3A 4UUSB 2XAFA 3ERMA 2W00A 4I01A 4RAGA 2KIUA 3T5XA 3TO7A 1MH4A 1RC9A 4PXIA 2QVOA 1P6RA 3H0GJ 2ECBA 1NK2P 4KIFA 1I1SA 2WV0A 2XASA 3W2WA 3WTZA 4RAZA 2W4SA 5F1JA 4EM2A 2L01A 3VSKA 1S7OA 2IP2A 2X6XA 4U88A 2EILH 3GTQJ 5EZHA 1YO5C 2BEOA 3M1EA 2WAQN 4BDYA 3NEUA 4M9XA 5FGMA 4B44A 4P55A 2AQEA 5DAJA 3PIPF 1W5TA 3GBGA 2OPTA 3ABTA 1G3SA 3KYLA 1KU2A 1SANA 1WPKA 3CCMI 1E0EA 2K9QA 3ZMUA 1FSEA 1Y8RB 3GUDA 3Q3SA 2BY2A 3BQYA 3IAM2 2HZDA 2X9DA 2OQRA 1OCTC 2EA4A 3DKWA 2QA4I 2BE5F 1JJ6C 1MBEA 2CQNA 3FXMA 4L9VA 1P7JA 1WGXA 3OOUA 3O8GA 5FO5A 2DA6A 2HS5A 4NDLA 4P1WA 3O8HA 2LNBA 4CUGA 4HRIA 1WH7A 3CCUI 2GXAA 1P4WA 4I6ZA 1U78A 1W7PB 1NG6A 5K7FA 4XL9A 1OCOH 4G94A 3J80Z 3PSIA 3SYTA 3BG7A 4WF2A 1QPMA 5JLWA 1QBJA 3KZ9A 4Z6YA 4PSWA 2BY1A 3FXKA 3HKZA 3VYSB 1YLFA 5GAEJ 1ZKGA 3A0HC 2A69F 2CUJA 2BW3A 2L9RA 4C30A 1D0XA 2QBYB 3GFIA 3RSNA 2OCCH 1VQ6I 6PAXA 1Z9CA 2G9WA 4I98B 4II3A 4RGXA 2PI0A 2DOEA 9ANTA 2KRFA 3B6CA 3G1LA 2JPBA 3ZN1A 3JAMK 1BW6A 1MBFA 1WJEA 3BR0A 5L3BA 1XDSA 3C2BA 3LSMA 2ZCMA 2I5UA 4B3XA 3FBNB 2M30A 2QZ8A 1TW2A 2UXXA 2STWA 3VSLA 1XSXA 5L3DA 3AL0C 5EJCA 2ID6A 4IHWA 2VXZA 3AG2H 1PP8F 2Z5UA 4WXDA 2EIKH 1U5TC 2V4JC 2EB7A 3VFZA 1YTYA 3S2HJ 1SAUA 3I59B 2GXGA 3LQQA 2DFFA 3HTUA 3G3ZA 5F64A 3QOPA 2R7XA 2XUBA 3JW4A 3OIOA 2HVQA 2QOPA 4XIDA 2JQ7A 1ZRFA 3JRDA 4J19A 4B43A 1U9OA 2MA3A 2X6WA 2CUZA 2DA7A 4IEJA 2QQBA 3DQVC 1ZLKA 3K9TA 4PGHA 3JAMZ 4AC0A 1TC3C 3E1SA 4Q47A 2KRHA 4PJ0C 4ICHA 1TL8A 1XMKA 5D4SA 2X85A 3IL2A 2H6BA 2M2EA 3EUKL 3E5UA 4HAMA 1JJ8C 1PVEA 2LDUA 3S1RJ 3S14J 3CO6C 2L54A 3GLXA 2UUZA 2XGXA 5FRMA 4CCNA 1DPRA 2BZTA 5DM7F 1FWZA 4QTRA 3S2DJ 3H0DA 2WWYA 4HNUA 3FBIB 3C2HA 3RKXA 3CDHA 4OWRB 2V26A 4RLFA 5E8IA 5FLXZ 3WTUC 1HW1A 3CC4I 1WI3A 5JR3A 2EWNA 1GUUA 3CDLA 1ITYA 2VJJA 2B3WA 2OC6A 2IRFG 4HSTA 1VQPI 5AONA 4E7JA 2VKHA 2LY2A 4V2GA 1IW7F 2DPUA 4RAFA 2ZXHA 4UV9A 1H8AC 2YUSA 2CRGA 4OOIA 1YI2I 2DDAA 3EUAA 4XONA 4KMFA 2ZJRF 1T0FA 3DF8A 3LA7A 1V5EA 2YX4A 3BTJA 4HQEA 1B72B 3U1KA 4M6YA 2LRDA 4F55A 3DKXA 2BHYA 4XLHA 3S8PA 3CCVI 4P96A 3SDBA 1IG7A 3MCZA 2IS2A 3NNRA 4MQ9F 3GTLJ 3MKYB 2DMTA 1OMIA 3ZQLA 2VIXA 1BR2A 5J8FA 2YPRA 3HUGA 1RKTA 4B09A 4B4CA 4N4OB 3HL2A 2H8RA 4WK8F 4KNYA 2ZOYA 1R00A 2F5EA 4E4HA 1K6OA 1S72I 2Y75A 3D1NI 3GO5A 3CD6I 5K5QA 3TDUC 2IGMA 3H5RA 4EATA 1WRJA 2FE3A 1MDMA 4ZC3A 1O57A 5CXGA 2GENA 3SEQA 1XGOA 2DA1A 4BQOA 3P9TA 2B0LA 4R1HA 1XS9A 3G7RA 2MSYA 2DFIA 3NPIA 1CQTA 5DTDA 1G3TA 2HYTA 3L2CA 1WWXA 5J1UA 3QYBA 1FOKA 5CVRA 2GBYA 2DG7A 5D6EA 5F0FA 3G1MA 5K5RA 2JWTA 1MH3A 2Y31A 5IT3A 3LWFA 3TEDA 2Y0SA 5E1XA 1OLTA 4KDPA 1GXPA 2PJRA 4ZZLA 3V7SA 3ABMH 3GTPJ 1ZHFA 4L5IA 1LFPA 3CESA 2QQ8A 5E79C 4H4KC 5M5WJ 5E3MA 3WODF 2L4MA 2O7TA 1O3TA 2X1CA 3KE2A 4HQMA 2ZOZA 3QYEA 4EVIA 3GTMJ 4BDZA 1RESA 3GTOJ 1R5GA 2F5VA 1T2KA 2O8KA 2WV1A 5C4JJ 3ZP5A 4IHYA 4M9SA 4N0BA 4C3IJ 2H09A 4IPAA 2Z2SB 5FRNA 5CLSA 1XGNA 3IP4B 1SFUA 4EM1A 2IU5A 2HVRA 2O8XA 1XN7A 4ENNA 5D1RA 2HTSA 2W57A 2OJED 1XSVA 3M8EA 3FHZA 2M45A 3D5SC 2CFOA 3VODA 4IQJA 4ZTFA 1DU6A 4M3EA 3ZQQA 2EZKA 2VKDA 1ORKA 3CRJA 4U87A 5DCMB 3F8BA 1W36C 3L2VA 2N8GA 3KNWA 1TW3A 4KYWA 1S7EA 2Z33A 4W1UA 2OQGA 3K70C 2L7FP 2XIGA 3QPTA 5K5OA 2HKUA 1YW8A 2EFWA 2CFXA 4N4NB 2ZMEA 1BI2A 5KAFC 1HLVA 1JUPA 2HOEA 1OCPA 1UFMA 4ME9A 3JRBA 3DU6A 3BT9A 3C18A 4F7ZA 4U7DA 5FLMJ 5LGNA 3HSEA 3R0JA 4DBRA 2W25A 1MJBA 2KL4A 2IJLA 1U5TA 4L0ZB 3CUQB 4A6EA 2AHQA 3QPLA 2DQRA 2IEKA 2NNNA 3I9V2 3L9FA 2QM3A 2DO7A 3V7RA 3TOBA 4MHGA 4LB6B 2HDDA 3DP7A 1YW9A 1SVMA 1BI0A 3DTIA 4KN7X 4G12A 3W2AA 2R7ZJ 1HSJA 5H20A 2HOSA 4CSWA 1LNWA 4RB2C 2GLOA 1MSFC 2VQHA 4ACIA 4WXHA 2R4GA 4OIPF 5GAHJ 2YVEA 4L9JA 4OU0A 1LPQA 1OCZH 1S7AA 1ENHA 2VJ5A 2RDPA 2OU2A 2XC7A 2E2HJ 3L2QA 2L9SA 1J75A 4DIQA 5JI6A 3L2WA 1RR8C 3ZQGA 1IZ1A 4MFDA 3RZOJ 2HPMA 2R7FA 1FZPB 1TWHJ 4XR6A 5HS7A 1I3AA 2Z1DA 4GYIA 3BY6A 3IV5A 3RQIA 1X4OA 2OI8A 1RI7A 5B5EC 4AUXA 3TMOA 1MBHA 2KHMA 5F0HA 1BL0A 2HWVA 4A0ZA 2HXOA 3PUBA 1MBGA 4EM0B 4KISA 2CQQA 3FXUA 3N05A 4L5JA 4U7BA 3E97A 4P5OA 3LWJA 2DTZA 4O5VA 4Y13A 2DFHA 1VQMI 2PMZN 5C44J 3F1BA 3TP3A 2P81A 1R58A 1F5TA 1J5YA 3F8MA 2BY3A 4EJWA 1JKPC 1C0WA 2J5PA 2XDNA 4IF4A 2IGOA 3FZVA 4A0YA 5JVTA 1LDDA 5CQEA 4V19K 4GCVA 2EV0A 2EFNA 2MD5A 4LIVA 3GEUA 1S5LC 2A2FX 5FLVA 4HF0A 4CZZA 4JL3A 4B8XA 1KONA 3LFKA 1MMSA 3MMYB 1T98A 2CGPA 4CHUA 3CWRA 3K10A 3FXJA 2FNPA 2ZXIA 4GFLA 4OD4A 1B1BA 2O03A 1HA8A 1FP1D 1MNEA 3MQ0A 4YIFA 2PN6A 5LEJA 3LAPA 2LC2A 3RPQA 4CYCA 4HX8A 2B7EA 5J6XA 3CUQC 3FDYA 3P9CA 3R0AA 4FX0A 3PO2J 1W1WE 4LMYA 2F5CA 3W6VA 3AL0B 1VQ4I 1KGSA 1F9NA 2CJJA 2P7VB 2V6EA 2QWWA 4N9IA 3HSFA 1ZELA 2P0WA 4G9YA 3GFMA 1GV2A 4JX5A 3KKDA 1M1EB 2RQQA 3HXLA 3ANGA 1SGMA 4AIKA 3AQSA 1X3UA 3HG9A 5GTHC 4BQQA 2ZSHB 4G7ZF 1JKQC 1MMDA 5IY5H 4IJAA 5AIPA 5E3NA 2FBHA 4HX4A 2GM4A 4MGRA 2V79A 1AKHB 2CG4A 3BG9A 2A05A 4M6VA 2LKPA 1TWGJ 2Q2EA 1JE8A 1VF9A 2KP6A 3V4GA 3QPSA 1UI6A 3BJ6A 2FF4A 3GLLA 3J7ZI 1XCBA 3QAHA 1W7PA 1TQMA 3S3NA 2BOLA 3OSGA 3P7NA 4BKXA 4RBOA 4HYEA 3BG3A 4QWQA 3H5AA 1BC8C 2OTLI 3F9KA 1USSA 3HIFA 2NVQJ 1TT0A 2HI3A 1FIPA 4E6KG 4E7KA 1FBSA 2YU3A 1F4KA 1V5GA 2JMWA 4MXMA 1HCRA 4XKVA 4XLEA 3SZTA 2IGKA 5HSZA 1O3RA 2PMHA 4AF5A 1N75A 2QF7A 1IN8A 1N78A 3PPBA 3E6DA 1FBQA 4Y17A 2AXLA 5AIQA 1LFBA 3A03A 1U9NA 3LAJA 2E7XA 1XC5A 1TWAJ 4EGYA 2EV5A 2QSHX 3H1CA 4CCJA 2HDCA 4GFBA 1FYLA 1G2HA 3I64A 4IOAF 3NARA 4ZYAA 2O5RA 3H9JA 3VOXA 1SD6A 1R6RA 1R1VA 2K86A 1EH6A 3U1DA 4DBQA 3NI7A 1E3HA 3CTAA 3V8KA 3TBIA 2L9VA 2CW0F 3DXJF 2D6YA 4DQ2A 2D1HA 3MWMA 3KP6A 3ZPLA 2JZYA 2Y30A 4BAYA 4JOMA 4BQNA 4F92B 2WY8Q 4JK1X 4XRMA 2MGQA 1IV6A 2F4MB 2FSWA 4HEA2 2FBIA 3TL4X 2WADA 4L9NA 4BHPA 5D19A 4ENJA 1HSTA 3LSIA 4XLFA 3Q9VA 3RCOA 3FIWA 3OYJA 4PJNA 3TOAA 1YQAA 1YRNA 3KLOA 2QSFX 4IXAA 1FOWA 3FK6A 3OYKA 2VT2A 1D1BA 2DW4A 5FKKA 3ZQFA 5M5XJ 4A3CJ 1JHHA 3ZQHA 4XOPA 5A2QZ 3TDZC 2R92J 2KIQA 2ZXWH 3C7JA 3VB2A 5EDNA 3KLNA 1H9GA 2WGBA 2GIVA 3I4PA 3G71I 5BQTA 2NVTJ 1EKEA 2BGCA 4M72A 3OSFA 2LBFA 2K85A 2QQ9A 2FQ4A 4NB5A 4LG0A 2CH0A 3HBLA 2KKOA 3WTSC 5J47A 1HC8A 2Q2EB 4I0BA 4MTDA 1WZ2A 1YHQI 1A31A 3ZQCA 3ZQ7A 3W6KB 2Y69H 4IRHA 3F72A 4UHTA 2QQAA 2Y48A 3K70D 3I4NJ 1Z67A 1IRXA 4R8HA 1MMGA 4XN3A 2WAEA 4A93J 2L5QA 5E1WA 5HODA 4A3MJ 4AWXB 2X1EA 3E7LA 2ZY9A 2L02A 2JA6J 2OD5A 1LKXA 3Q5FA 3G56A 3WGIA 3OYAA 2ELJA 1D0ZA 5C4XJ 3CLQA 3CP8A 4KUMA 3CCRI 3F8NA 4IZZA 3KP7A 4ZH4F 3OIPA 3BDDA 2M0CA 3F6OA 1B72A 1I6XA 1H9TA 4FASD 4ZYHA 3C07A 2WBMA 2H1LA 3T6NA 1UAAA 4QLCU 2ZB9A 2NP3A 1E2XA 4AVZA 3ANPA 3S5RA 4EV0A 5DD8A 3LA2A 1XSDA 2UWMA 5LHIA 1OR7C 3S1NJ 4TV7A 3LSPA 2PZ9A 1BR4A 5FKNA 4EJUA 5DEQA 3CJDA 4XKBA 2LG4A 1VQ7I 3K7AJ 2G7UA 4I2OA 2R7UA 4HSRA 4PUSA 2MH2A 5D5XB 3G4SI 4GGGA 1QVTA 3K2ZA 1R7JA 5J40A 5FKOA 2EFOA 2M0MA 1U6GA 1NG7A 3OOPA 1S29A 4A69C 3IC7A 3D5RC 2RN7A 4UB6C 2W53A 3NWSA 3ECHA 3CJNA 3M8FA 1QZEA 2MC4A 3ML6A 3MN2A 1NK3P 1I39A 2QCOA 2MFZA 3AQTA 4W97A 1FJLA 2R7WA 1MBKA 2ESHA 3BWGA 3TGNA 4BYYA 1VTNC 3WU0A 4RAYA 3VUQA 2UXHA 3OR1C 1V54H 3WTWC 1BN5A 3BPVA 2Y2ZA 2VLAA 3EGQA 4E7SA 4M9ZA 4ANJA 3LFUA 1IV8A 1W5CC 3PQJA 1A04A 4BHBA 4M3BA 2M34A 1XX5A 1CGPA 5D8KB 5DDGA 2TRTA 4M6XA 2CUEA 1XD7A 1Z05A 2ELHA 4G6TB 1X3ZB 5FGLA 1P92A 3ASOH 1JT0A 3EUHC 4GDFA 4AD9A 1B4AA 1YYVA 5LFAA 3OWTA 2ZJ2A 4FE4A 2COMA 2HQAA 1V3FA 1DQUA 3HOZJ 2DXIA 2XB5A 5D8LB 5EZGA 4UUVA 3BZKA 4G6DA 3F8FA 2PBIA 2NVUB 3J81K 1Z7UA 2JPCA 1R9TJ 1I6HJ 3L7WA 3JRGA 2X6YA 2EZIA 4BXUA 4GRIA 3SDGA 1Y39A 3TW7A 1K78A 3E7QA 2HOAA 2DT5A 1FLIA 1K61A 1IDZA 3BCBA 4D7MA 1HKSA 3A1YA 5E8GA 2QENA 5KCMA 2HR3A 1U5TB 1NTCA 3GXOA 2QBYA 3UKGA 1X1BA 1ETQA 2VPRA 1A6QA 5M3FJ 2ZCNA 4D7NA 3FK7A 4EGZA 4PZJA 3DCFA 3PQKA 1UELB 2ELKA 3ZCOA 4G7OF 2PJPA 3RTRA 5F04A 2WUIA 2LVSA 2VE8A 2Y0MA 2FMLA 3VOEA 3CLOA 1KU7A 1YX5A 1D5VA 4AU7A 2GZWA 4XBFA 3MZYA 3IRQA 2HFHA 2CS3A 2Z99A 3PJRA 5HNFA 1ETKA 1SVOA 1XCVA 4I09A 3KIOA 1YS7A 3HYIA 4ESJA 1WJCA 2CWEA 2W82A 4FHTA 4NNJA 5KHDA 4ASNA 3HTAA 1P7IA 2ADUA 4KT6A 4MQVA 2CYYA 3BCAA 3H36A 4GO1A 1Y8QB 2VBXA 2CV2A 4IHTA 2DI3A 1YITI 1WJDA 5EYRA 4IO9F 2WC2A 1HW5A 4C2MJ 2NVXJ 1BA5A 4L62A 1ZLJA 5D4RA 1UB9A 4WCGA 4HLYA 3M07A 5TJJA 2IA0A 3N97A 2VOPA 3H35A 1Z77A 3M9AA 4XLCA 5E20A 3HRTA 3BG6A 1ZK8A 4A3KJ 3BZ6A 3AKZA 4OIOF 3HOWJ 5CW8A 4ZTJA 4BJTA 1FOXA 3RJPA 4KJZA 4C2TA 3BJOA 2MABA 3I5UA 1KQ0A 3LSKA 5F1RA 2XPWA 1QRYA 4XSZF 4XN0A 4DW6A 2R7VA 2L2OA 3GTKJ 2NS0A 5HS8A 1H88C 3J7AO 5H2FC 4IL6C 5BOXA 3HSRA 1MIJA 1MMNA 3DBHB 5IP7J 5D18A 3HE0A 4LLGF 2XKOA 2R3SA 5EEGA 2DFEA 2XDVA 3F0CA 4KMUX 3OS1A 3A02A 2XAQA 2CMPA 4BE0A 1O3SA 1AU7A 2KIFA 3AG3H 2G3BA 1MNMC 2ME0A 4E7IA 3K1PA 1BOAA 2VI6A 3BJAA 4M3DA 1JI8A 1GXQA 2GWRA 2EIMH 3PASA 5B1AH 1XDUA 1P4AA 1ODDA 1XG1A 3QOEA 4CXFA 1SMTA 1AA7A 5CPRB 2ISZA 3RPUD 3A2KA 4Y52J 1OYYA 2IVMA 1DP7P 2JRTA 5C4YA 1JGGA 4MO7A 1RNLA 3EQLF 3ONQA 3ZXSA 1DGRM 2V1DA 1RPWA 2CQXA 2OA4A 4HV6A 1SC7A 1J2XA 3SEZA 4LLNA 1HXDA 3IWFA 3K1NA 5J1YA 1YOVB 2M3AA 2V57A 2A07F 2A5WA 2QWTA 3EYIA 1HQCA 2DQLA 3WTTC 5BS6A 1LDKB 1B9MA 5F0CA 2V9VA 1OYIA 3HJEA 4C9YA 3VYTB 3PM1A 2DK5A 2K9SA 1T33A 3GX4X 1U2WA 4IRVA 3R61A 4IRGA 3I71A 3VOKA 3M1CA 1YRNB 1JGSA 1LVKA 3K4JA 4RLQA 4ZDPA 5LHGA 4P9FA 1PDNC 3REOA 3KZIC 3LA3A 4BBSJ 2XGDA 4LOCA 4KITB 2GOMA 3A01B 4BY7J 1IN7A 2RC4A 1IDYA 2ESNA 2STTA 2EQRA 1SD5A 2EK5A 3SFZA 4A6DA 1JT6A 2QUFA 4M74A 2K3FA 2H94A 3GTJJ 2EZLA 5DCMA 4DYQA 3IRRA 3CDIA 1TP4A 2ISYA 3DPUA 1R5HA 2HYGD 3SZPA 2LH9A 4QPOA 3RIRA 1DPUA 2FA5A 4RM3A 4A2UA 4J00A 1WJFA 2NNYA 2G7HA 5FKMA 1R36A 3GVAA 3W6JB 1YJWI 5HBUA 1BJZA 2LLKA 3Q0VA 1O7LA 2K40A 3J81Z 2R5ZB 4LG3A 2KLOA 5KVRA 5ERIA 1POGA 3MZHA 2DBBA 1RETA 2COBA 3CCJI 1HKQA 4RGUA 2FMYA 2WTEA 2P4WA 4KIBA 1J59A 5FROA 3DBRB 2NYXA 2BVMA 2LF8A 2W7NA 3FM3A 1MMAA 1ETXA 2GXBA 4QPQA 2X0LA 1R4MB 2XV4S 1H89C 1L0OC 1IXRC 1UI5A 2LR8A 1ZGWA 1A35A 2BY0A 1WVRA 4EJVA 2FBQA 2L3DA 3R60A 1FTZA 1KQ9A 1BJAA 5ICFA 1ZARA 4I7HA 5LGUA 1F36A 3HOYJ 2FNAA 4BE1A 1X1PA 3VPRA 2KZVA 1JTXA 3G6EI 2JA7J 3S17J 2LKXA 1ZTRA 3VP5A 3V6GA 2V7FA 3NAUA 1J7KA 1RUNA 2HDWA 4G7HF 2K27A 2M8GX 1BI3A 1EH8A 2E5ZA 4Y4RA 2M8EA 3QYFA 4PGGA 4H0EA 1G4DA 4XOTA 1KQ8A 2VJ4A 1X58A 2Q8KA 1YJNI 2VONA 5M5YJ 4MTEA 3C2GA 3FXQA 1W0TA 5K7HA 4GFKA 3RI4A 2ZNYA 3BPXA 2E71A 4F3QA 2BHZA 1E3PA 2O61A 2V6CA 2XPUA 2W48A 2AO9A 3PIOF 3V7CA 4ETSA 4DJAA 3KKCA 3DV8A 2DMUA 4RDUA 2YVXA 2ZMEB 4F91B 2D5VA 3HOVJ 1K6YA 2WAQA 5HLGA 4HPQA 1JXSA 1RZ4A 3TKYA 2QKMB 5ICGA 3F8CA 2MD0A 4M71A 1RIOH 2E1OA 5EF6A 2WA0A 3MD2A 4WXCA 4M73A 2P5VA 2VBWA 1OYWA 3EDPA 3JSOA 2NXNB 3HPHA 1WKMA 1ON1A 1X19A 1TNTA 2I8DA 2EIJH 4NN1A 2EH3A 4UY8I 2LKSA 4BACA 3CQZJ 3JREA 3WG7H 5TRDA 4D1QA 2CSOA 2HZTA 4E7LA 1MD0A 1SD7A 2PQ8A 3K4MA 4XRFA 5CJ9A 1FC3A 1Z1DA 2G7SA 3VVYA 3H5NA 3OV8A 1A6IA 2EBIA 1DGWY 4FQGA 4XSXF 5E3LA 2P5LC 2FUG2 1CF7B 2XRNA 5CQGA 5FFXA 5EGOA 2HYJA 2A6HF 3DEWA 3MAJA 4AYBN 1EA3A 3BP8A 2ZSIB 5C3EJ 2V1UA 2L7MP 2O6GE 3KFWX 1IXCA 1IGNA 1H0MA 1XTAA 4ABZA 1WI9A 5FHPA 3OYNA 1UG2A 2MH9A 1MJ9A 3V8JA 4WX9A 3L00A 3KPHA 1VQ8I 1T38A 2D1VA 2IGNA 4FISA 3T0YA 3ABLH 4DYCA 1FYKA 4J01A 1D8KA 3U21A 1RUOA 5D5VB 1VI0A 5HDGA 4RB0A 2F4IA 4Z2YA 2WAFA 2D2WA 3WTXC 4IQ4A 4XRSA 5K1YA 4BXFA 2JRMA 2YX7A 2G7GA 2GOXB 1QA6A 4JQFA 3N4MA 5DCFA 1VQLI 2VL8A 4MK6A 1IXSB 2R7SA 2VKEA 2MW8A 2VE9A 1IN6A 3K4KA 4FX4A 4YELA 2K9LA 5TGTA 1SEUA 4UV8A 2W24A 1UJ8A 2IS1A 3TO6A 5BPDA 5D5UB 4AIJA 3B02A 2HKOA 3R4KA 3L09A 3HGGA 2PMUA 3LSRA 2GFNA 5J3LA 4BHCA 3VIBA 3HKZN 3R6SA 3WGGA 3OYMA 1QU3A 5FLXK 5LBQA 2XAHA 4YIRX 1KYZA 2CW7A 1MKMA 1SMYF 1Z6RA 2OF7A 1GV5A 3KP5A 4PJMA 2E1MC 1ZN2A 3HOUJ 1MGTA 4IVNA 4IKFA 4E7ZA 5JHUA 3NRVA 2LSOA 3VEPA 1B59A 1ACIA 3TW6A 3PO3J 4NC8A 5CKTA 1W4MA 2QEXI 3CMEI 4HZFA 4KN4X 4NUBA 4EEFG 1XGMA 3IH3A 3DTKA 4XLAA 2F48A 2AS5F 1G8XA 3K0LA 1LB2A 4OMYA 1IUYA 2K5CA 3GF2A 3E3VA 4DZJA 4AYBA 2P7CB 2QKOA 3HEFA 3ON4A 4KWAA 4JBAA 2HXIA 3FMQA 3FISA 2M7AA 4I0AA 2QGUA 5HOOA 1V4RA 1KU9A 3WHCA 4HW0A 4A0XA 1LEAA 1FSHA 4Y15A 4WWCA 2WB1N 3TQNA 3BOQA 2M4KA 1SFKA 4IHSA 2REKA 3RD3A 5FMPA 4LFUA 1FMVA 2RHAA 5ICCA 4CYCB 3M7GA 2LMDA 2MLGA 3BLYA 3ZMVA 2R7TA 2JTVA 5KK1A 4YG2F 3B81A 3K4NA 4A5MA 3EPZA 2DMQA 3VYUB 4A12A 3VVXA 4WIBA 3DPJA 3ZOBA 1ZRCA 3ISPA 2UV1A 1FOYA 2VT3A 4IHVA 2L4AA 5IOYA 4I02A 4HF2A 3ROUA 2VB6A 5LHHA 4BL0B 3CF2A 3CCQI 5CVVA 2UXIA 5E18F 4XLNF 1GT0C 1T08B 2JA2A 1MW7A 3IKVA 5DYMA 4BBRJ 4GCTA 4ENMA 2Z16A 2NRAC 4U0WA 1PYVA 4CYDA 3CMYA 2K4JA 5DM6F 2LK2A 4AIDA 1LQ1A 2V1NA 4BJ5C 3HTHA 3I56I 2JA8J 4PFOA 3D0SA 3T8TA 2OV7A 4BU2A 5IYDJ 3E6CC 1U0JA 3OYEA 3CO7C 2EFPA 4LD5A 1FT9A 3ON2A 2FJI1 1WFXA 2YSRA 2H1KA 5BMZA 3JTGA 4Q5SF 5HDKA 2XAJA 2ZO4A 1PJRA 3ESWB 2CW8A 1HF0A 2EZHA 4PCQA 1R23A 5EG0B 3BRUA 4C2MA 3WE2A 4YIIA 1KA8A 4X0GA 1U8RA 1LDJA 1Z3XA 4JNNA 4RM2A 1JUMA 1VQOI 5DV5A 1R1TA 2E36A 3PNTA 4MNUA 4DNCA 4XQFA 5DUKA 3F22A 2FBKA 4HDUA 3BNIA 3GZIA 1QQIA 2ZCWA 3E5QA 1O3QA 1P2FA 4LIUA 4NQWA 1E17A 1OCRH 5IT9Z 1TQIA 5L3CA 4GYGA 3HDDA 3E5XA 3DPLC 2CUFA 1AHDP 3WG9A 2ID3A 4ESFA 5J1RA 3ELKA 3EETA 1E3OC 1MNDA 3MKLA 3ZMDA 1X1CA 4ENKA 4M3GA 3OYCA 2DU9A 1HW2A 2PFVA 1I3QJ 1UHMA 3OYFA 4BNCA 3HTIA 1DDNA 1YG2A 2KRCA 3H3ZA 1WJBA 2ECCA 3WU2C 2FQ3A 3CCSI 1BC7C 1ON2A 2XPVA 4B47A 1GLNA 1W7PD 4FETA 1TWFJ 2XSJC 4RB1A 2A6TA 3FKIJ 5HNHA 1W5SA 4ZZDA 2BV6A 3RKQA 2YVHA 3LL7A 2E60A 2KFDA 3RPUA 3JSJA 3PFIA 5HDNA 2VPLA 2R93J 3MNLA 2M1BA 4LJZF 2EFQA 3SQNA 3LSJA 1DUXC 5JFRA 3V42A
chains in the Genus database with same CATH topology
3HOWJ 5CW8A 2N8GA 3KNWA 3HOXJ 1S7EA 1ETVA 2G7LA 4W1UA 2XPWA 1QRYA 1RKWA 4DW6A 3JRAA 2L7FP 3GTKJ 2HKUA 3S1MJ 4DYRA 1HLVA 1H88C 1JUPA 1OCPA 4ME9A 3JRBA 4JYKA 3BT9A 5IP7J 3HE0A 5D18A 4UUSA 1UMQA 5FLMJ 5EEAA 2DJNA 3BTCA 3F0CA 3JRHA 3IH4A 2JN6A 4XK4A 1ETOA 3A02A 1AU7A 2L0KA 2AHQA 1O4XA 3QPLA 2G3BA 1MNMC 2IEKA 2ME0A 1FTTA 5H9TA 3Q0WA 3BQZA 1WCMJ 2VI6A 4M3DA 2HOTA 2HDDA 2Q24A 3PASA 2PBXA 5EG0A 2E2IJ 2Y9ZA 4G12A 1XG1A 2X6OA 2R7ZJ 2KDZA 1PUFA 2HOSA 2GLOA 4AC6A 3JR9A 1MSFC 4ACIA 4Y52J 4HNVA 2YVEA 2XRLA 2MG4A 3VVZA 5C4YA 2XSDC 1ENHA 1JGGA 4MO7A 1ZR2A 1AKHA 2DMPA 1JKOC 2E2HJ 4UUTA 2NOGA 2NX4A 3I4MJ 1RPWA 2CQXA 2ZCXA 4NELA 3RZOJ 3ZQGA 4MFDA 2R5ZA 3S16J 1TWHJ 5J1YA 2DA5A 1K83J 2V57A 2QWTA 1DU0A 2FD5A 3IV5A 3RQIA 2OI8A 2YU9J 4AUXA 1MBHA 3O60A 5F0CA 5F0HA 1BL0A 2M9HA 1UHSA 2HXOA 4GCLA 4A3DJ 3PM1A 1MBGA 1LE8A 2K9SA 1T33A 2CQQA 2R0QC 1HDPA 1JKRC 3QQAA 2DTZA 1ZR4A 1YRNB 3LWJA 3VOKA 2PMZN 5C44J 5IYBJ 3F1BA 3TP3A 2P81A 3RH2A 4BBSJ 2XGDA 2FX0A 4LOCA 3A01B 1JKPC 4BY7J 1IDYA 2XGEA 2GUHA 2QIBA 2EQRA 2XDNA 3HIMA 1HOMA 1JT6A 3SFIA 4XRSG 1RR7A 2X48A 1IUFA 2CU7A 3M4OJ 1OFCX 3GTJJ 2EZLA 3GEUA 5FKLA 4DYQA 5FLVA 2F07A 2QTQA 5GP9A 4JL3A 1LFUP 5DS9A 3K2AA 1B8IA 3VW2A 4FTHA 2LTPA 3CWRA 4GFLA 1ETYA 3HM5A 3JRCA 4A3LJ 4MLOA 5EGOB 5FKMA 5HBUA 4QIWN 1IRZA 1BJZA 2LLKA 5GPCA 2LY9A 3Q0VA 3FRQA 2K40A 4CYCA 2R5ZB 1PUFB 3HTJA 4C3JJ 3BCGA 2FJ1A 1POGA 1APLC 3HGYA 2NVYJ 3PO2J 1RETA 2COBA 3W6VA 3QKXA 1SFOJ 3LJLA 5HAWA 2B63J 2CJJA 4A3BJ 3BJBA 1GVDA 2R5YA 3BR6A 4JP0A 1Q1VA 4B1RA 1X2MA 1I50J 3H3VK 1ETXA 1OJLA 4JX4A 5IOZA 1GV2A 2E19A 4FE7A 4JX5A 1LE8B 1D5YA 5IP9J 1HDDC 3KKDA 1H89C 3ANGA 1SGMA 1UI5A 2LR8A 4DZPA 1ZGWA 3GTGJ 3MVPA 2JJ7A 3AQSA 2LP0A 2FBQA 1JKQC 5K58A 1FTZA 5E3NA 1Y1VJ 2GM4A 1F36A 3HOYJ 2I10A 2UXOA 3VPRA 1U8BA 1JTXA 3BG9A 4D5CA 4M6VA 1IJWC 1AKHB 4YZEA 2DN0A 4JKZA 5FJ8J 2JA7J 3S17J 2VKVA 1A5JA 4FCYA 2LKXA 1TWGJ 1ZTRA 3VP5A 3V6GA 4L5EA 1VF9A 3NAUA 1JUSA 3QPSA 1UI6A 4HKUA 1GDTA 1EF4A 1TWCJ 5CXIA 2XGCA 5IPAA 2M8GX 3OSGA 2JA5J 3M3YJ 4BKXA 4RBOA 3NXCA 3BG3A 3BR3A 4BXXJ 1X58A 2NVQJ 5M5YJ 2HI3A 1FIPA 5BNGA 1BW5A 3IUVA 1MBJA 1X2NA 1W0TA 3CCYA 5K7HA 2JMWA 3LSGA 4GFKA 1HCRA 4MXMA 2XPUA 2W48A 2AO9A 3HB9A 5HSZA 5JLXA 4AF5A 2QF7A 3PPBA 3KKCA 4UUSB 2DMUA 4M3FA 3BR2A 1LFBA 4RDUA 4PXIA 3A03A 2D5VA 1MH4A 1U9NA 3HOVJ 2E2JJ 1XC5A 3H0GJ 1TWAJ 2ECBA 1NK2P 2NS8A 4GFBA 5F1JA 1G2HA 3NARA 2IAIA 2E1OA 5EF6A 1W0UA 3VOXA 3GTQJ 5EZHA 3BHQA 3NRGA 3NI7A 3S1QJ 2WAQN 3A01A 2D6YA 5DAJA 2K9NA 1F43A 2VUMJ 3GBGA 2OPTA 1SANA 1WPKA 4NN1A 2ME6A 2K9QA 2Y30A 2EH3A 3Q3SA 3BQYA 1OCTC 2X9DA 4XRMA 3CQZJ 3JREA 2MGQA 1IV6A 4Y7NJ 1JJ6C 1MBEA 3VVYA 2G7SA 1P7JA 5D19A 1WGXA 1A6IA 2EBIA 3O8GA 3OOUA 2DA6A 3FIWA 4NDLA 5E3LA 3O8HA 5K7ZA 3VW1A 1WH7A 1YRNA 4I6ZA 5EGOA 1U78A 3BTLA 2HYJA 5K7FA 3DEWA 5C3EJ 4AYBN 3FK6A 3JRFA 2L7MP 5FKKA 1IGNA 5JLWA 3ZQFA 3COLA 5E3OA 3KZ9A 4X6AJ 4ABZA 5FHPA 1UG2A 5M5XJ 4A3CJ 3ZQHA 1ZKGA 5GPAA 2L9RA 2G0EA 4FISA 5EDNA 2R92J 2WGBA 5IYCJ 4DYCA 2NVTJ 3OSFA 9ANTA 3B6CA 3G1LA 1BW6A 1MBFA 1VI0A 2FQ4A 3BR0A 3HBLA 1MSEC 2DMNA 3C2BA 3WHBA 4A3GJ 2ZCMA 2NP5A 4XRSA 2DA2A 3ZQCA 2G7GA 2ID6A 4IHWA 3I4NJ 4MK6A 2VKEA 2MW8A 4A93J 3QBMA 5HODA 3S2HJ 4A3MJ 3B6AA 3E7LA 2JA6J 3OIOA 3G56A 2QOPA 4XIDA 3JRDA 3LNQA 2RAEA 5C4XJ 3HGGA 4J19A 3LSRA 4A3FJ 1U9OA 1T56A 2GFNA 5J3LA 2DA7A 4UDSA 3HKZN 3VIBA 4IEJA 1ZQ3P 3EUPA 1WH5A 2M0CA 1B72A 1TC3C 4AC0A 1FEXA 1Z0XA 1ETWA 3C07A 1IC8A 4ICHA 2OF7A 3T6NA 1GV5A 2ZB9A 2IBDA 2M2EA 3HOUJ 2UXPA 1JJ8C 2NP3A 3S1RJ 3S14J 2Y9YA 3ANPA 2Y0SN 3S5RA 4JX6A 2OERA 3S1NJ 4A3JJ 3LSPA 3S2DJ 4QTRA 5FKNA 2PZ9A 3CJDA 3TW6A 3PO3J 4GCKA 2XB0X 2KT0A 3K7AJ 4EEFG 3LOCA 3IH3A 1WI3A 1GUUA 3CDLA 1ITYA 4QSHA 3ZQIA 4KWAA 1QVTA 4DZJA 1Y1WJ 2QKOA 3HEFA 3ON4A 1QVUA 4V2GA 3LHQA 2HXIA 5F27A 3RZDJ 2YUSA 1H8AC 3FISA 2CRGA 5FKOA 4S0HB 4BY1J 3WHCA 3G1OA 4XICA 4A69C 2WB1N 2W53A 3SJMA 4C3HJ 3BTJA 1B72B 1NK3P 5M3MJ 3MN2A 2REKA 3RD3A 2QCOA 5FMPA 2RHAA 4CYCB 3AQTA 3BG5A 4W97A 1FJLA 1MBKA 3B81A 2DMQA 3VVXA 2RASA 3DPJA 4B3AA 3ZOBA 1IG7A 3VUQA 4IHVA 4V2FA 5IOYA 3NNRA 2UXHA 2UXIA 3GTLJ 2DMTA 1GT0C 2Y2ZA 3ZQLA 3EGQA 4BBRJ 4GCTA 3Q0UA 4A3IJ 1RKTA 4B4CA 2H8RA 2UXUA 2ZOYA 3CRJA 3D1NI 1VFCA 4M3BA 3CMYA 3L1PA 2LK2A 2M34A 4I76A 2LFBA 2TRTA 3HTHA 2CUEA 3V78A 2JA8J 5CXGA 2DG8A 2GENA 5IYDJ 2DA1A 3P9TA 1JT0A 5FGLA 5EFYA 3JRIA 1XS9A 3BTIA 3G7RA 2MSYA 1FIAA 3ON2A 3NPIA 5AQCA 4FE4A 5DTDA 1CQTA 3IH2A 2H1KA 2DA3A 4MFEA 2HYTA 5J1UA 3BR5A 3HOZJ 2XB5A 5EZGA 1I6HJ 1R9TJ 4A3EJ 1HF0A 2EZHA 2GBYA 5EG0B 3JRGA 2DG7A 2EZIA 5F0FA 3SDGA 3BRUA 3E7QA 3TW7A 5F08A 3G1MA 2HOAA 1MH3A 2JWTA 2Y31A 3TEDA 1K61A 1IDZA 4JNNA 4D7MA 1JUMA 1JTYA 3BNIA 3GZIA 3GTPJ 5IP6A 1NTCA 1QPIA 3UKGA 1ETQA 2VPRA 5M3FJ 5M5WJ 5E3MA 2YS9A 2ZCNA 4D7NA 3FK7A 2O7TA 3HDDA 4IHXA 3DCFA 2ZOZA 2ELKA 3GTMJ 2CUFA 5F04A 2WUIA 2LVSA 1RESA 2JK3A 1AHDP 2ID3A 3TP0A 3GTOJ 5J1RA 2O8KA 1E3OC 2WV1A 5C4JJ 3MKLA 4IHYA 4M3GA 4C3IJ 1B8IB 2R5YB 3HTIA 1I3QJ 3VW0A 2L7ZA 1ETKA 4MIMA 4CGRA 2ECCA 1VNDA 2IU5A 3HTAA 3BR1A 1P7IA 2XPVA 5D1RA 1TWFJ 2LD5A 4D5FA 2NS7A 2O7OA 2TCTA 3FKIJ 5EYRA 2NVXJ 4C2MJ 3RKQA 1BA5A 2DA4A 4X1EA 2YVHA 2HQ5A 1DU6A 4L62A 3JSJA 4M3EA 2R93J 3MNLA 2EZKA 3LSJA 2O9LA 1Z77A 4A3KJ 3S15J 1ORKA 1ZK8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOW J;  5CW8 A;  2N8G A;  3KNW A;  3HOX J;  1S7E A;  1ETV A;  2G7L A;  4W1U A;  2XPW A;  1QRY A;  1RKW A;  4DW6 A;  3JRA A;  2L7F P;  3GTK J;  2HKU A;  3S1M J;  4DYR A;  1HLV A;  1H88 C;  1JUP A;  1OCP A;  4ME9 A;  3JRB A;  4JYK A;  3BT9 A;  5IP7 J;  3HE0 A;  5D18 A;  4UUS A;  1UMQ A;  5FLM J;  5EEA A;  2DJN A;  3BTC A;  3F0C A;  3JRH A;  3IH4 A;  2JN6 A;  4XK4 A;  1ETO A;  3A02 A;  1AU7 A;  2L0K A;  2AHQ A;  1O4X A;  3QPL A;  2G3B A;  1MNM C;  2IEK A;  2ME0 A;  1FTT A;  5H9T A;  3Q0W A;  3BQZ A;  1WCM J;  2VI6 A;  4M3D A;  2HOT A;  2HDD A;  2Q24 A;  3PAS A;  2PBX A;  5EG0 A;  2E2I J;  2Y9Z A;  4G12 A;  1XG1 A;  2X6O A;  2R7Z J;  2KDZ A;  1PUF A;  2HOS A;  2GLO A;  4AC6 A;  3JR9 A;  1MSF C;  4ACI A;  4Y52 J;  4HNV A;  2YVE A;  2XRL A;  2MG4 A;  3VVZ A;  5C4Y A;  2XSD C;  1ENH A;  1JGG A;  4MO7 A;  1ZR2 A;  1AKH A;  2DMP A;  1JKO C;  2E2H J;  4UUT A;  2NOG A;  2NX4 A;  3I4M J;  1RPW A;  2CQX A;  2ZCX A;  4NEL A;  3RZO J;  3ZQG A;  4MFD A;  2R5Z A;  3S16 J;  1TWH J;  5J1Y A;  2DA5 A;  1K83 J;  2V57 A;  2QWT A;  1DU0 A;  2FD5 A;  3IV5 A;  3RQI A;  2OI8 A;  2YU9 J;  4AUX A;  1MBH A;  3O60 A;  5F0C A;  5F0H A;  1BL0 A;  2M9H A;  1UHS A;  2HXO A;  4GCL A;  4A3D J;  3PM1 A;  1MBG A;  1LE8 A;  2K9S A;  1T33 A;  2CQQ A;  2R0Q C;  1HDP A;  1JKR C;  3QQA A;  2DTZ A;  1ZR4 A;  1YRN B;  3LWJ A;  3VOK A;  2PMZ N;  5C44 J;  5IYB J;  3F1B A;  3TP3 A;  2P81 A;  3RH2 A;  4BBS J;  2XGD A;  2FX0 A;  4LOC A;  3A01 B;  1JKP C;  4BY7 J;  1IDY A;  2XGE A;  2GUH A;  2QIB A;  2EQR A;  2XDN A;  3HIM A;  1HOM A;  1JT6 A;  3SFI A;  4XRS G;  1RR7 A;  2X48 A;  1IUF A;  2CU7 A;  3M4O J;  1OFC X;  3GTJ J;  2EZL A;  3GEU A;  5FKL A;  4DYQ A;  5FLV A;  2F07 A;  2QTQ A;  5GP9 A;  4JL3 A;  1LFU P;  5DS9 A;  3K2A A;  1B8I A;  3VW2 A;  4FTH A;  2LTP A;  3CWR A;  4GFL A;  1ETY A;  3HM5 A;  3JRC A;  4A3L J;  4MLO A;  5EGO B;  5FKM A;  5HBU A;  4QIW N;  1IRZ A;  1BJZ A;  2LLK A;  5GPC A;  2LY9 A;  3Q0V A;  3FRQ A;  2K40 A;  4CYC A;  2R5Z B;  1PUF B;  3HTJ A;  4C3J J;  3BCG A;  2FJ1 A;  1POG A;  1APL C;  3HGY A;  2NVY J;  3PO2 J;  1RET A;  2COB A;  3W6V A;  3QKX A;  1SFO J;  3LJL A;  5HAW A;  2B63 J;  2CJJ A;  4A3B J;  3BJB A;  1GVD A;  2R5Y A;  3BR6 A;  4JP0 A;  1Q1V A;  4B1R A;  1X2M A;  1I50 J;  3H3V K;  1ETX A;  1OJL A;  4JX4 A;  5IOZ A;  1GV2 A;  2E19 A;  4FE7 A;  4JX5 A;  1LE8 B;  1D5Y A;  5IP9 J;  1HDD C;  3KKD A;  1H89 C;  3ANG A;  1SGM A;  1UI5 A;  2LR8 A;  4DZP A;  1ZGW A;  3GTG J;  3MVP A;  2JJ7 A;  3AQS A;  2LP0 A;  2FBQ A;  1JKQ C;  5K58 A;  1FTZ A;  5E3N A;  1Y1V J;  2GM4 A;  1F36 A;  3HOY J;  2I10 A;  2UXO A;  3VPR A;  1U8B A;  1JTX A;  3BG9 A;  4D5C A;  4M6V A;  1IJW C;  1AKH B;  4YZE A;  2DN0 A;  4JKZ A;  5FJ8 J;  2JA7 J;  3S17 J;  2VKV A;  1A5J A;  4FCY A;  2LKX A;  1TWG J;  1ZTR A;  3VP5 A;  3V6G A;  4L5E A;  1VF9 A;  3NAU A;  1JUS A;  3QPS A;  1UI6 A;  4HKU A;  1GDT A;  1EF4 A;  1TWC J;  5CXI A;  2XGC A;  5IPA A;  2M8G X;  3OSG A;  2JA5 J;  3M3Y J;  4BKX A;  4RBO A;  3NXC A;  3BG3 A;  3BR3 A;  4BXX J;  1X58 A;  2NVQ J;  5M5Y J;  2HI3 A;  1FIP A;  5BNG A;  1BW5 A;  3IUV A;  1MBJ A;  1X2N A;  1W0T A;  3CCY A;  5K7H A;  2JMW A;  3LSG A;  4GFK A;  1HCR A;  4MXM A;  2XPU A;  2W48 A;  2AO9 A;  3HB9 A;  5HSZ A;  5JLX A;  4AF5 A;  2QF7 A;  3PPB A;  3KKC A;  4UUS B;  2DMU A;  4M3F A;  3BR2 A;  1LFB A;  4RDU A;  4PXI A;  3A03 A;  2D5V A;  1MH4 A;  1U9N A;  3HOV J;  2E2J J;  1XC5 A;  3H0G J;  1TWA J;  2ECB A;  1NK2 P;  2NS8 A;  4GFB A;  5F1J A;  1G2H A;  3NAR A;  2IAI A;  2E1O A;  5EF6 A;  1W0U A;  3VOX A;  3GTQ J;  5EZH A;  3BHQ A;  3NRG A;  3NI7 A;  3S1Q J;  2WAQ N;  3A01 A;  2D6Y A;  5DAJ A;  2K9N A;  1F43 A;  2VUM J;  3GBG A;  2OPT A;  1SAN A;  1WPK A;  4NN1 A;  2ME6 A;  2K9Q A;  2Y30 A;  2EH3 A;  3Q3S A;  3BQY A;  1OCT C;  2X9D A;  4XRM A;  3CQZ J;  3JRE A;  2MGQ A;  1IV6 A;  4Y7N J;  1JJ6 C;  1MBE A;  3VVY A;  2G7S A;  1P7J A;  5D19 A;  1WGX A;  1A6I A;  2EBI A;  3O8G A;  3OOU A;  2DA6 A;  3FIW A;  4NDL A;  5E3L A;  3O8H A;  5K7Z A;  3VW1 A;  1WH7 A;  1YRN A;  4I6Z A;  5EGO A;  1U78 A;  3BTL A;  2HYJ A;  5K7F A;  3DEW A;  5C3E J;  4AYB N;  3FK6 A;  3JRF A;  2L7M P;  5FKK A;  1IGN A;  5JLW A;  3ZQF A;  3COL A;  5E3O A;  3KZ9 A;  4X6A J;  4ABZ A;  5FHP A;  1UG2 A;  5M5X J;  4A3C J;  3ZQH A;  1ZKG A;  5GPA A;  2L9R A;  2G0E A;  4FIS A;  5EDN A;  2R92 J;  2WGB A;  5IYC J;  4DYC A;  2NVT J;  3OSF A;  9ANT A;  3B6C A;  3G1L A;  1BW6 A;  1MBF A;  1VI0 A;  2FQ4 A;  3BR0 A;  3HBL A;  1MSE C;  2DMN A;  3C2B A;  3WHB A;  4A3G J;  2ZCM A;  2NP5 A;  4XRS A;  2DA2 A;  3ZQC A;  2G7G A;  2ID6 A;  4IHW A;  3I4N J;  4MK6 A;  2VKE A;  2MW8 A;  4A93 J;  3QBM A;  5HOD A;  3S2H J;  4A3M J;  3B6A A;  3E7L A;  2JA6 J;  3OIO A;  3G56 A;  2QOP A;  4XID A;  3JRD A;  3LNQ A;  2RAE A;  5C4X J;  3HGG A;  4J19 A;  3LSR A;  4A3F J;  1U9O A;  1T56 A;  2GFN A;  5J3L A;  2DA7 A;  4UDS A;  3HKZ N;  3VIB A;  4IEJ A;  1ZQ3 P;  3EUP A;  1WH5 A;  2M0C A;  1B72 A;  1TC3 C;  4AC0 A;  1FEX A;  1Z0X A;  1ETW A;  3C07 A;  1IC8 A;  4ICH A;  2OF7 A;  3T6N A;  1GV5 A;  2ZB9 A;  2IBD A;  2M2E A;  3HOU J;  2UXP A;  1JJ8 C;  2NP3 A;  3S1R J;  3S14 J;  2Y9Y A;  3ANP A;  2Y0S N;  3S5R A;  4JX6 A;  2OER A;  3S1N J;  4A3J J;  3LSP A;  3S2D J;  4QTR A;  5FKN A;  2PZ9 A;  3CJD A;  3TW6 A;  3PO3 J;  4GCK A;  2XB0 X;  2KT0 A;  3K7A J;  4EEF G;  3LOC A;  3IH3 A;  1WI3 A;  1GUU A;  3CDL A;  1ITY A;  4QSH A;  3ZQI A;  4KWA A;  1QVT A;  4DZJ A;  1Y1W J;  2QKO A;  3HEF A;  3ON4 A;  1QVU A;  4V2G A;  3LHQ A;  2HXI A;  5F27 A;  3RZD J;  2YUS A;  1H8A C;  3FIS A;  2CRG A;  5FKO A;  4S0H B;  4BY1 J;  3WHC A;  3G1O A;  4XIC A;  4A69 C;  2WB1 N;  2W53 A;  3SJM A;  4C3H J;  3BTJ A;  1B72 B;  1NK3 P;  5M3M J;  3MN2 A;  2REK A;  3RD3 A;  2QCO A;  5FMP A;  2RHA A;  4CYC B;  3AQT A;  3BG5 A;  4W97 A;  1FJL A;  1MBK A;  3B81 A;  2DMQ A;  3VVX A;  2RAS A;  3DPJ A;  4B3A A;  3ZOB A;  1IG7 A;  3VUQ A;  4IHV A;  4V2F A;  5IOY A;  3NNR A;  2UXH A;  2UXI A;  3GTL J;  2DMT A;  1GT0 C;  2Y2Z A;  3ZQL A;  3EGQ A;  4BBR J;  4GCT A;  3Q0U A;  4A3I J;  1RKT A;  4B4C A;  2H8R A;  2UXU A;  2ZOY A;  3CRJ A;  3D1N I;  1VFC A;  4M3B A;  3CMY A;  3L1P A;  2LK2 A;  2M34 A;  4I76 A;  2LFB A;  2TRT A;  3HTH A;  2CUE A;  3V78 A;  2JA8 J;  5CXG A;  2DG8 A;  2GEN A;  5IYD J;  2DA1 A;  3P9T A;  1JT0 A;  5FGL A;  5EFY A;  3JRI A;  1XS9 A;  3BTI A;  3G7R A;  2MSY A;  1FIA A;  3ON2 A;  3NPI A;  5AQC A;  4FE4 A;  5DTD A;  1CQT A;  3IH2 A;  2H1K A;  2DA3 A;  4MFE A;  2HYT A;  5J1U A;  3BR5 A;  3HOZ J;  2XB5 A;  5EZG A;  1I6H J;  1R9T J;  4A3E J;  1HF0 A;  2EZH A;  2GBY A;  5EG0 B;  3JRG A;  2DG7 A;  2EZI A;  5F0F A;  3SDG A;  3BRU A;  3E7Q A;  3TW7 A;  5F08 A;  3G1M A;  2HOA A;  1MH3 A;  2JWT A;  2Y31 A;  3TED A;  1K61 A;  1IDZ A;  4JNN A;  4D7M A;  1JUM A;  1JTY A;  3BNI A;  3GZI A;  3GTP J;  5IP6 A;  1NTC A;  1QPI A;  3UKG A;  1ETQ A;  2VPR A;  5M3F J;  5M5W J;  5E3M A;  2YS9 A;  2ZCN A;  4D7N A;  3FK7 A;  2O7T A;  3HDD A;  4IHX A;  3DCF A;  2ZOZ A;  2ELK A;  3GTM J;  2CUF A;  5F04 A;  2WUI A;  2LVS A;  1RES A;  2JK3 A;  1AHD P;  2ID3 A;  3TP0 A;  3GTO J;  5J1R A;  2O8K A;  1E3O C;  2WV1 A;  5C4J J;  3MKL A;  4IHY A;  4M3G A;  4C3I J;  1B8I B;  2R5Y B;  3HTI A;  1I3Q J;  3VW0 A;  2L7Z A;  1ETK A;  4MIM A;  4CGR A;  2ECC A;  1VND A;  2IU5 A;  3HTA A;  3BR1 A;  1P7I A;  2XPV A;  5D1R A;  1TWF J;  2LD5 A;  4D5F A;  2NS7 A;  2O7O A;  2TCT A;  3FKI J;  5EYR A;  2NVX J;  4C2M J;  3RKQ A;  1BA5 A;  2DA4 A;  4X1E A;  2YVH A;  2HQ5 A;  1DU6 A;  4L62 A;  3JSJ A;  4M3E A;  2R93 J;  3MNL A;  2EZK A;  3LSJ A;  2O9L A;  1Z77 A;  4A3K J;  3S15 J;  1ORK A;  1ZK8 A; 
#chains in the Genus database with same CATH topology
 3GME A;  1D3Y A;  2RKH A;  2M5W A;  2PG4 A;  3NQO A;  3HOX J;  2IA2 A;  3M8J A;  2IA1 A;  1ETV A;  2DCE A;  5GAG J;  2G7L A;  3KP3 A;  5LLQ A;  1RKW A;  1OQY A;  3W2V A;  2VXD A;  4ZYG A;  5ICE A;  3S1M J;  2LOO A;  2P5K A;  3DEE A;  4OD5 A;  1STZ A;  1YX3 A;  3MFK A;  1LUJ B;  3HHH A;  2DT7 B;  3HZJ A;  3CP2 A;  1UZC A;  4JYK A;  2EV6 A;  4HDV A;  1DP3 A;  4UUS A;  5E17 F;  5EEA A;  1XMA A;  5FFZ A;  4CCO A;  1OR7 A;  2JN6 A;  1ETO A;  2ZFU A;  2KDO A;  4PDK A;  2L0K A;  1O4X A;  1FX7 A;  3FWE A;  2F5F A;  3ZMT A;  3RYP A;  3Q0W A;  3BQZ A;  4XOR A;  1VZ0 A;  3I3L A;  2R7D A;  2Q24 A;  2B1E A;  5ILV A;  2DYS H;  1S9H A;  3WTV C;  3HPG A;  4EJO A;  2X6O A;  5B3S H;  2KDZ A;  3I53 A;  2A3S A;  3DTE A;  1PUF A;  4NC7 A;  1WJA A;  4HF1 A;  3TO9 A;  2RVC A;  1WHU A;  2MG4 A;  2IT0 A;  2CQ7 A;  1MDM B;  3O2P E;  1FYM A;  2XSD C;  3KX2 A;  1ZR2 A;  1JKO C;  1D0Y A;  4UUT A;  1ZG3 A;  4KIC A;  5LRR A;  2NOG A;  4L9T A;  1AWC A;  3I4M J;  2ZCX A;  5ILS A;  1KZH A;  3VTI A;  2KIS A;  1R5I D;  1B9N A;  2DA5 A;  1CF7 A;  1K83 J;  2BYV E;  4MEY F;  5ED4 A;  1ZG1 A;  1DU0 A;  2FD5 A;  3RDI A;  4IX7 A;  3WU1 B;  1LEB A;  2H27 A;  3HHG A;  4LK1 F;  2FEZ A;  2HEO A;  3NS4 A;  2UXN A;  4KT5 C;  4II2 A;  3LSH A;  3QP6 A;  3U2R A;  4YFK F;  2V9P A;  1FBU A;  1HDP A;  3OYI A;  2H8W A;  4BE2 A;  4G8X A;  4Y3O A;  1YW7 A;  2Q1Z B;  5IYB J;  1P9Q C;  5L3G A;  1UCR A;  3DWL E;  3RH2 A;  2W1O A;  1IRG A;  2GUH A;  1Z3Y A;  1L3L A;  3LQR A;  2BVL A;  2CO5 A;  2E1M B;  5CVU A;  2VQG A;  4XKC A;  1HOM A;  3SFI A;  2ZJP F;  4EJT A;  4XRS G;  1IUF A;  3M4O J;  3L2U A;  2OUM A;  4XLP F;  1OFC X;  3S32 A;  5HLT A;  3PSF A;  1BOB A;  2F07 A;  4CGZ A;  3ZMZ A;  2W85 A;  1LFU P;  5DS9 A;  3K2A A;  1SFE A;  1XPX A;  3VW2 A;  4FTH A;  2LTP A;  2M87 A;  5E1Z B;  1X1A A;  3HM5 A;  3JRC A;  2OBP A;  1IAW A;  2FOK A;  4MLO A;  3ULQ B;  1G59 A;  5EGO B;  4QIW N;  2WB1 A;  2ZJQ F;  2LRE A;  1IRZ A;  5GPC A;  4KA4 A;  1K78 B;  3OMY A;  3HTJ A;  3QRF F;  1D8J A;  3BCG A;  3FKJ A;  4O6J A;  2FJ1 A;  2QKL B;  1G6N A;  3I58 A;  3HGY A;  2NVY J;  2V9K A;  1BR1 A;  2GA2 A;  3ASN H;  3DPT A;  3K4C A;  3CZ6 A;  1EJ9 A;  4LB5 A;  1SFO J;  3QKX A;  3LJL A;  2B63 J;  3HRM A;  4A3B J;  5L3F A;  3BJB A;  2R5Y A;  3GCM A;  3BR6 A;  1R1U A;  1AOY A;  5DD4 A;  2XVC A;  1TZL A;  3IHU A;  3PUF A;  2HPI A;  3GFJ A;  3H3V K;  1OJL A;  2XAU A;  3P9I A;  3GWZ A;  3AAF A;  2E19 A;  3I0T A;  4FE7 A;  3HUG B;  1LE8 B;  5IP9 J;  2X4H A;  1R71 A;  1T0F C;  4DZP A;  3GTG J;  3MVP A;  3CMA I;  2L7K A;  2JJ7 A;  3F23 A;  2K3P A;  2LP0 A;  1BM9 A;  1Z21 A;  5K58 A;  2DOD A;  3PNV A;  4BEH B;  5CYV A;  2A68 F;  3OY9 A;  2FOW A;  1Q1H A;  2B9S A;  4CCM A;  3LMM A;  3OYH A;  2LBF B;  2X51 A;  2IS4 A;  1QZY A;  5LGT A;  4YZE A;  4XM3 A;  2DN0 A;  1EV7 A;  3KYC B;  2ZFW A;  4U9L A;  3QOD A;  5FJ8 J;  1A36 A;  4FCY A;  2BW3 B;  3CJQ B;  1Y6I A;  2GIZ A;  2LYC A;  4XNF A;  3F21 A;  3KYD B;  4I99 C;  4L5E A;  1JUS A;  1ZYR F;  3GZN B;  5D5W B;  1GDT A;  2KMU A;  1KYW A;  2E35 A;  2Z3Y A;  2JT1 A;  1EF4 A;  2XGC A;  1ZGA A;  2JA5 J;  1I5Z A;  1B6A A;  2E5N A;  3DEU A;  4BXX J;  1X3W B;  2PMZ A;  4CCK A;  1Y0U A;  3G2B A;  2HU9 A;  1S8N A;  1XMX A;  1BW5 A;  1FY7 A;  2Q0O A;  3IUV A;  2LY1 A;  4OIQ F;  1MBJ A;  1X2N A;  3KCC A;  1K79 A;  3LSG A;  3MZ8 A;  4ZYD A;  4DVY P;  4U9N A;  4MEX F;  3OS0 A;  4Q4Z F;  4HLX A;  2XKP A;  2MLK A;  4CO8 A;  3DBL B;  1TTY A;  4UVC A;  2VC0 A;  2DYR H;  4HA8 A;  1RRJ A;  4M3F A;  1D1C A;  3BR2 A;  2HKX A;  2GQQ A;  2R7Q A;  3GZ6 A;  1VQK I;  3H9Q A;  2E2J J;  3ERE D;  4HOB A;  2NS8 A;  1BI1 A;  2IAI A;  1W0U A;  2ZKZ A;  3OYB A;  2W84 A;  1SD4 A;  1Z91 A;  2XF7 A;  2NAZ A;  1K4T A;  2A5Y B;  2VC1 A;  3BHQ A;  3NRG A;  3S1Q J;  4B48 A;  3A01 A;  2K9N A;  2DOA A;  4L0Y B;  1F43 A;  2VUM J;  1REP C;  2CV1 A;  5EEH A;  4D9J A;  4CCL A;  1G3W A;  2ME6 A;  3JTH A;  3P5J A;  1D1A A;  1UG0 A;  2WY7 Q;  1G3Y A;  3ABU A;  4KIG A;  5FD6 A;  1IO2 A;  4Y7N J;  4RMN A;  1ZRE A;  5K7Z A;  4P9U A;  3VW1 A;  3UR3 C;  3SXY A;  1OCC H;  3BTL A;  3DLA A;  3BC8 A;  2JSP A;  1YJ9 I;  3JRF A;  3BZC A;  3COL A;  1X4P A;  5E3O A;  1Y0N A;  4BQA A;  4X6A J;  2QLZ A;  4LLL A;  2ZBK A;  1O7F A;  2DTR A;  5IT9 K;  1J0R A;  4CZC A;  1ZH5 A;  3KZY A;  4NBQ A;  3B73 A;  4PJL A;  5GAD J;  1PP7 U;  5GPA A;  1BBY A;  3QU3 A;  2KIM A;  2EPF A;  2G0E A;  3KZZ A;  2X1D A;  1P4X A;  4OMZ A;  3WTY C;  2IS6 A;  5IYC J;  4PK4 A;  1WSU A;  1VQ5 I;  5H6Q A;  2DPD A;  5ILU A;  1N25 A;  2KJC A;  3OYG A;  2RRE A;  3RKY A;  2E7W A;  1MSE C;  2DMN A;  3WHB A;  5FB2 A;  4HV5 A;  1X1D A;  4A3G J;  5B66 C;  1TNS A;  5TIS C;  2NP5 A;  2DJI A;  3HRU A;  2DA2 A;  3S93 A;  5H6R A;  3IUO A;  4U0Y A;  2KQR A;  1R49 A;  1VQ9 I;  3E6M A;  3QBM A;  5HS9 A;  3KP4 A;  3B6A A;  5LRS A;  3L2R A;  1ZRD A;  1TQP A;  4ZDL A;  1ZG5 A;  1T95 A;  2BXY A;  3LNQ A;  2RAE A;  4A3F J;  3I55 I;  2A61 A;  1T56 A;  5D6F A;  3CC7 I;  1IN5 A;  2C6Y A;  4UDS A;  1ZQ3 P;  3EUP A;  1WH5 A;  2JVG A;  4CIC A;  1FEX A;  1Z0X A;  3GFL A;  1ETW A;  4S04 A;  2VJI A;  3C3W A;  1IC8 A;  2QSG X;  3QP5 A;  2IBD A;  2QYO A;  1T8I A;  2UXP A;  2DLL A;  1NH3 A;  2Y9Y A;  2Y0S N;  1Z7L A;  4JX6 A;  1N77 A;  2OER A;  4A3J J;  2JSC A;  4Q48 A;  3FXO A;  2HTJ A;  5J4Y A;  4GCK A;  3VDX A;  2XB0 X;  3BRO A;  2KT0 A;  2VQL A;  5JVG F;  2DDB A;  4O3M A;  3PFY A;  3LOC A;  3H92 A;  1FPQ A;  3KET A;  3DKY A;  2HNH A;  4KFC A;  2ZXJ A;  4QSH A;  3ZQI A;  1Y1W J;  3RYR A;  2RNJ A;  1QVU A;  4F93 B;  3LHQ A;  5F27 A;  4LGW A;  3RZD J;  2D45 A;  4K2E A;  2E34 A;  2R7O A;  4AVP A;  4S0H B;  2ZC2 A;  4YFX F;  2P8T A;  3CCL I;  4BY1 J;  3G1O A;  2PX9 A;  4IRI A;  4XIC A;  2DAO A;  2LF7 A;  2AXT C;  2Z9O A;  1SAX A;  3K69 A;  2PLY A;  1LVA A;  3SJM A;  2FXA A;  4OAY A;  4C3H J;  5M3M J;  5CVJ A;  3HOT A;  4RGR A;  2OTJ I;  5FD5 A;  3BG5 A;  2A6E F;  2HQR A;  2K4B A;  3KEO A;  1UST A;  4XKW A;  4C2U A;  2RAS A;  1IRF A;  4B3A A;  2RV8 A;  3SWH A;  4V2F A;  2JUG A;  3CMM A;  1QHH D;  2O0Y A;  3OIQ A;  4E70 A;  3FF5 A;  3Q0U A;  4A3I J;  4BUP A;  2UXU A;  3CUO A;  5F6F A;  1V5F A;  1NHA A;  3RKW A;  1VFC A;  2E1N A;  4EMS A;  2PEX A;  3L1P A;  1OIS A;  4I76 A;  2LFB A;  3V78 A;  3A0B C;  2DG8 A;  3MKW B;  1HBX G;  2F4O B;  1R4N B;  3D5L A;  1QZZ A;  3K4L A;  5EFY A;  3JRI A;  4OIN F;  3BTI A;  3H3U A;  3OYL A;  1FIA A;  3QPH A;  3T8R A;  2ACJ A;  3J7A Y;  5AQC A;  2AQF A;  3W3C A;  3IH2 A;  2DA3 A;  4MFE A;  3AG4 H;  1F1Z A;  3RQ4 A;  3BR5 A;  4CDG A;  2M4G A;  4A3E J;  3S2W A;  4IOC F;  1KU3 A;  5F08 A;  3CCE I;  1ONV A;  4HBL A;  4NHJ A;  5L3E A;  3DU5 A;  3K6G A;  2H6C A;  1JTY A;  3AG1 H;  1HKT A;  1JHF A;  3U9G A;  5IP6 A;  3JSP A;  1QPI A;  2M7B A;  3IAS 2;  3PL8 A;  3HRS A;  2BXZ A;  2YS9 A;  3OR2 C;  5J4V A;  4PJJ A;  3F6V A;  3IWZ A;  4IHX A;  1LJ9 A;  4NC6 A;  1YS6 A;  2RNG A;  1OKR A;  2JK3 A;  4UB8 C;  3TP0 A;  2OCE A;  3OS2 A;  1WQ2 A;  3KEY A;  3F3X A;  2K7L A;  2DK8 A;  1B8I B;  4OAZ A;  2R5Y B;  3VW0 A;  4DGW B;  4AM3 A;  2L7Z A;  4UNO A;  2ZME C;  2CQK A;  4MIM A;  4CGR A;  2KZG A;  1VND A;  1YIO A;  2MC3 A;  3CUQ A;  3I59 A;  2OZU A;  3BR1 A;  3ZR8 X;  2LD5 A;  3HTS B;  2IXS A;  4D5F A;  1ULY A;  5GTI C;  2NS7 A;  2O7O A;  2TCT A;  4UVB A;  3O6B B;  1TLH B;  2DA4 A;  4X1E A;  2K9M A;  2HQ5 A;  1TT5 B;  2ETH A;  1K4S A;  2FU4 A;  2O9L A;  2XRO A;  3S15 J;  1ZGJ A;  2NOJ B;  2HYF A;  4RS8 A;  2JVH A;  2VOD A;  4UXN A;  2PJR B;  2VOO A;  1FNN A;  3K4B A;  3FX3 A;  3I54 A;  4AIH A;  3JRA A;  2VBZ A;  5KAI C;  3K8P C;  4DYR A;  2HQN A;  2JUC A;  4NQW B;  3MKZ A;  1T39 A;  2O3F A;  4L18 B;  1I1G A;  3JCU C;  2HVS A;  3NWT A;  1UMQ A;  2ZNZ A;  2DJN A;  4N9H A;  3V8L A;  3BTC A;  3JRH A;  1QGP A;  3FMR A;  3IH4 A;  3MEX A;  4CH7 A;  2GAU A;  2F6C A;  4XK4 A;  3CC2 I;  2KJB A;  3A4C A;  2UZK A;  1FTT A;  4EQQ A;  5H9T A;  3EUH A;  1WCM J;  2HOT A;  3GZ5 A;  1ZAO A;  2PBX A;  4U0V A;  5EG0 A;  3ECO A;  4YEJ A;  1W36 D;  2R7R A;  3SHF A;  1Y56 A;  4Y33 A;  3ZN0 A;  2E2I J;  2Y9Z A;  1U3E M;  2XHK A;  2RGV A;  3VWB A;  2OAZ A;  3T1B A;  3JR9 A;  4AC6 A;  4HNV A;  2XRL A;  3VVZ A;  3VYR B;  3KEQ A;  3LST A;  1AKH A;  2DMP A;  2TDX A;  5J8C A;  2NX4 A;  3COA C;  4NEL A;  4ZJZ A;  1TBX A;  5LEK A;  2R5Z A;  4CA0 A;  4PSX A;  4D0P A;  3CF5 F;  3S3M A;  2E1C A;  1VQN I;  3S16 J;  1S6L A;  5B1B H;  4BS9 A;  1SVL A;  2YU9 J;  3O60 A;  4BEH A;  2M9H A;  1UHS A;  1PUE E;  4GCL A;  2F5D A;  3J7Y J;  3CJR B;  4A3D J;  1UHW A;  1LE8 A;  2BBY A;  2V1X A;  1IN4 A;  2R0Q C;  1JKR C;  3GEZ A;  3G73 A;  3QWL A;  3QQA A;  1GVJ A;  2HGC A;  1XB4 A;  4ZYE A;  4YRV A;  1QHG A;  1ZR4 A;  1YIJ I;  2YR2 A;  2ICW G;  3SZG A;  2FX0 A;  4YFN F;  3PNY A;  2XGE A;  2QIB A;  1QNT A;  3HIM A;  2IW5 A;  1RR7 A;  1QO0 D;  2X48 A;  2CU7 A;  5JHF A;  3FHN A;  5FKL A;  1MJA A;  1S3J A;  2VAS A;  2QTQ A;  5GP9 A;  2VN2 A;  1GHC A;  4RB3 C;  3E6B A;  1I27 A;  1B8I A;  1BIA A;  3CJT B;  3HC7 A;  3J80 K;  3X2Q H;  3ZRG A;  1WJ5 A;  2RQP A;  1ETY A;  3Q9S A;  1T6S A;  1FP2 A;  2P6S A;  3FXR A;  2GA1 A;  4G6Q A;  4A3L J;  4DOZ A;  2IPQ X;  4F52 A;  1OPC A;  4BJ6 C;  5HLI A;  2LY9 A;  3H9G A;  3FRQ A;  3IKT A;  4LIT A;  1PUF B;  4C3J J;  5A2Q K;  3AFH A;  3FM5 A;  1APL C;  3OL4 A;  4A5N A;  5HVQ C;  3WGH A;  2MYS A;  5HAW A;  1GVD A;  4RA2 A;  4JP0 A;  1Q1V A;  4B1R A;  1X2M A;  3QU6 A;  3FXL A;  4ITV A;  5CVI A;  2CV0 A;  1I50 J;  4ZDO A;  4JX4 A;  3FMS A;  3KP2 A;  4HG2 A;  5IOZ A;  1HDD C;  1XGS A;  1D5Y A;  3DFG A;  4R79 A;  3E0J B;  3S3O A;  4UVA A;  3ABK H;  2PFB A;  4FT8 A;  4HNT A;  4S05 A;  2FRH A;  1BIB A;  1MZB A;  3EYY A;  1Y1V J;  1SFX A;  4BH9 A;  1FMW A;  2EIN H;  5KNL A;  2I10 A;  2UXO A;  1J09 A;  1U8B A;  4D5C A;  1V55 H;  1IJW C;  1IF1 A;  2XAG A;  4JKZ A;  4ESB A;  2EJR A;  1Z6T A;  2VKV A;  1A5J A;  1J9I A;  2J5O A;  3O3K A;  4RGS A;  3OL3 A;  4BGD A;  3GYH X;  3DLL F;  2L9N A;  3GW2 A;  3HOS A;  5LD2 C;  2XF6 A;  4HKU A;  2F2E A;  2K02 A;  1YE9 A;  1TWC J;  5CXI A;  2DOF A;  5IPA A;  3UNG C;  3P9K A;  3M3Y J;  1K7A A;  4HX7 A;  3NXC A;  3BR3 A;  2VQC A;  1EH7 A;  2MBF A;  2P6T A;  3OYD A;  4ON0 A;  3ZMS A;  5HLH A;  4GXO A;  2OZ6 A;  4LK0 F;  5BNG A;  2EA2 A;  2XF5 A;  4XMY A;  2KPM A;  3CCY A;  1ERD A;  4PFP A;  3K1M A;  1R22 A;  2VBY A;  5BPI A;  3C1D A;  3HB9 A;  5JLX A;  5DUI A;  2DT6 A;  3ZGK A;  4LG0 B;  4OIR F;  4E7H A;  1YFH A;  3WE3 A;  4UUS B;  2XAF A;  3ERM A;  2W00 A;  4I01 A;  4RAG A;  2KIU A;  3T5X A;  3TO7 A;  1MH4 A;  1RC9 A;  4PXI A;  2QVO A;  1P6R A;  3H0G J;  2ECB A;  1NK2 P;  4KIF A;  1I1S A;  2WV0 A;  2XAS A;  3W2W A;  3WTZ A;  4RAZ A;  2W4S A;  5F1J A;  4EM2 A;  2L01 A;  3VSK A;  1S7O A;  2IP2 A;  2X6X A;  4U88 A;  2EIL H;  3GTQ J;  5EZH A;  1YO5 C;  2BEO A;  3M1E A;  2WAQ N;  4BDY A;  3NEU A;  4M9X A;  5FGM A;  4B44 A;  4P55 A;  2AQE A;  5DAJ A;  3PIP F;  1W5T A;  3GBG A;  2OPT A;  3ABT A;  1G3S A;  3KYL A;  1KU2 A;  1SAN A;  1WPK A;  3CCM I;  1E0E A;  2K9Q A;  3ZMU A;  1FSE A;  1Y8R B;  3GUD A;  3Q3S A;  2BY2 A;  3BQY A;  3IAM 2;  2HZD A;  2X9D A;  2OQR A;  1OCT C;  2EA4 A;  3DKW A;  2QA4 I;  2BE5 F;  1JJ6 C;  1MBE A;  2CQN A;  3FXM A;  4L9V A;  1P7J A;  1WGX A;  3OOU A;  3O8G A;  5FO5 A;  2DA6 A;  2HS5 A;  4NDL A;  4P1W A;  3O8H A;  2LNB A;  4CUG A;  4HRI A;  1WH7 A;  3CCU I;  2GXA A;  1P4W A;  4I6Z A;  1U78 A;  1W7P B;  1NG6 A;  5K7F A;  4XL9 A;  1OCO H;  4G94 A;  3J80 Z;  3PSI A;  3SYT A;  3BG7 A;  4WF2 A;  1QPM A;  5JLW A;  1QBJ A;  3KZ9 A;  4Z6Y A;  4PSW A;  2BY1 A;  3FXK A;  3HKZ A;  3VYS B;  1YLF A;  5GAE J;  1ZKG A;  3A0H C;  2A69 F;  2CUJ A;  2BW3 A;  2L9R A;  4C30 A;  1D0X A;  2QBY B;  3GFI A;  3RSN A;  2OCC H;  1VQ6 I;  6PAX A;  1Z9C A;  2G9W A;  4I98 B;  4II3 A;  4RGX A;  2PI0 A;  2DOE A;  9ANT A;  2KRF A;  3B6C A;  3G1L A;  2JPB A;  3ZN1 A;  3JAM K;  1BW6 A;  1MBF A;  1WJE A;  3BR0 A;  5L3B A;  1XDS A;  3C2B A;  3LSM A;  2ZCM A;  2I5U A;  4B3X A;  3FBN B;  2M30 A;  2QZ8 A;  1TW2 A;  2UXX A;  2STW A;  3VSL A;  1XSX A;  5L3D A;  3AL0 C;  5EJC A;  2ID6 A;  4IHW A;  2VXZ A;  3AG2 H;  1PP8 F;  2Z5U A;  4WXD A;  2EIK H;  1U5T C;  2V4J C;  2EB7 A;  3VFZ A;  1YTY A;  3S2H J;  1SAU A;  3I59 B;  2GXG A;  3LQQ A;  2DFF A;  3HTU A;  3G3Z A;  5F64 A;  3QOP A;  2R7X A;  2XUB A;  3JW4 A;  3OIO A;  2HVQ A;  2QOP A;  4XID A;  2JQ7 A;  1ZRF A;  3JRD A;  4J19 A;  4B43 A;  1U9O A;  2MA3 A;  2X6W A;  2CUZ A;  2DA7 A;  4IEJ A;  2QQB A;  3DQV C;  1ZLK A;  3K9T A;  4PGH A;  3JAM Z;  4AC0 A;  1TC3 C;  3E1S A;  4Q47 A;  2KRH A;  4PJ0 C;  4ICH A;  1TL8 A;  1XMK A;  5D4S A;  2X85 A;  3IL2 A;  2H6B A;  2M2E A;  3EUK L;  3E5U A;  4HAM A;  1JJ8 C;  1PVE A;  2LDU A;  3S1R J;  3S14 J;  3CO6 C;  2L54 A;  3GLX A;  2UUZ A;  2XGX A;  5FRM A;  4CCN A;  1DPR A;  2BZT A;  5DM7 F;  1FWZ A;  4QTR A;  3S2D J;  3H0D A;  2WWY A;  4HNU A;  3FBI B;  3C2H A;  3RKX A;  3CDH A;  4OWR B;  2V26 A;  4RLF A;  5E8I A;  5FLX Z;  3WTU C;  1HW1 A;  3CC4 I;  1WI3 A;  5JR3 A;  2EWN A;  1GUU A;  3CDL A;  1ITY A;  2VJJ A;  2B3W A;  2OC6 A;  2IRF G;  4HST A;  1VQP I;  5AON A;  4E7J A;  2VKH A;  2LY2 A;  4V2G A;  1IW7 F;  2DPU A;  4RAF A;  2ZXH A;  4UV9 A;  1H8A C;  2YUS A;  2CRG A;  4OOI A;  1YI2 I;  2DDA A;  3EUA A;  4XON A;  4KMF A;  2ZJR F;  1T0F A;  3DF8 A;  3LA7 A;  1V5E A;  2YX4 A;  3BTJ A;  4HQE A;  1B72 B;  3U1K A;  4M6Y A;  2LRD A;  4F55 A;  3DKX A;  2BHY A;  4XLH A;  3S8P A;  3CCV I;  4P96 A;  3SDB A;  1IG7 A;  3MCZ A;  2IS2 A;  3NNR A;  4MQ9 F;  3GTL J;  3MKY B;  2DMT A;  1OMI A;  3ZQL A;  2VIX A;  1BR2 A;  5J8F A;  2YPR A;  3HUG A;  1RKT A;  4B09 A;  4B4C A;  4N4O B;  3HL2 A;  2H8R A;  4WK8 F;  4KNY A;  2ZOY A;  1R00 A;  2F5E A;  4E4H A;  1K6O A;  1S72 I;  2Y75 A;  3D1N I;  3GO5 A;  3CD6 I;  5K5Q A;  3TDU C;  2IGM A;  3H5R A;  4EAT A;  1WRJ A;  2FE3 A;  1MDM A;  4ZC3 A;  1O57 A;  5CXG A;  2GEN A;  3SEQ A;  1XGO A;  2DA1 A;  4BQO A;  3P9T A;  2B0L A;  4R1H A;  1XS9 A;  3G7R A;  2MSY A;  2DFI A;  3NPI A;  1CQT A;  5DTD A;  1G3T A;  2HYT A;  3L2C A;  1WWX A;  5J1U A;  3QYB A;  1FOK A;  5CVR A;  2GBY A;  2DG7 A;  5D6E A;  5F0F A;  3G1M A;  5K5R A;  2JWT A;  1MH3 A;  2Y31 A;  5IT3 A;  3LWF A;  3TED A;  2Y0S A;  5E1X A;  1OLT A;  4KDP A;  1GXP A;  2PJR A;  4ZZL A;  3V7S A;  3ABM H;  3GTP J;  1ZHF A;  4L5I A;  1LFP A;  3CES A;  2QQ8 A;  5E79 C;  4H4K C;  5M5W J;  5E3M A;  3WOD F;  2L4M A;  2O7T A;  1O3T A;  2X1C A;  3KE2 A;  4HQM A;  2ZOZ A;  3QYE A;  4EVI A;  3GTM J;  4BDZ A;  1RES A;  3GTO J;  1R5G A;  2F5V A;  1T2K A;  2O8K A;  2WV1 A;  5C4J J;  3ZP5 A;  4IHY A;  4M9S A;  4N0B A;  4C3I J;  2H09 A;  4IPA A;  2Z2S B;  5FRN A;  5CLS A;  1XGN A;  3IP4 B;  1SFU A;  4EM1 A;  2IU5 A;  2HVR A;  2O8X A;  1XN7 A;  4ENN A;  5D1R A;  2HTS A;  2W57 A;  2OJE D;  1XSV A;  3M8E A;  3FHZ A;  2M45 A;  3D5S C;  2CFO A;  3VOD A;  4IQJ A;  4ZTF A;  1DU6 A;  4M3E A;  3ZQQ A;  2EZK A;  2VKD A;  1ORK A;  3CRJ A;  4U87 A;  5DCM B;  3F8B A;  1W36 C;  3L2V A;  2N8G A;  3KNW A;  1TW3 A;  4KYW A;  1S7E A;  2Z33 A;  4W1U A;  2OQG A;  3K70 C;  2L7F P;  2XIG A;  3QPT A;  5K5O A;  2HKU A;  1YW8 A;  2EFW A;  2CFX A;  4N4N B;  2ZME A;  1BI2 A;  5KAF C;  1HLV A;  1JUP A;  2HOE A;  1OCP A;  1UFM A;  4ME9 A;  3JRB A;  3DU6 A;  3BT9 A;  3C18 A;  4F7Z A;  4U7D A;  5FLM J;  5LGN A;  3HSE A;  3R0J A;  4DBR A;  2W25 A;  1MJB A;  2KL4 A;  2IJL A;  1U5T A;  4L0Z B;  3CUQ B;  4A6E A;  2AHQ A;  3QPL A;  2DQR A;  2IEK A;  2NNN A;  3I9V 2;  3L9F A;  2QM3 A;  2DO7 A;  3V7R A;  3TOB A;  4MHG A;  4LB6 B;  2HDD A;  3DP7 A;  1YW9 A;  1SVM A;  1BI0 A;  3DTI A;  4KN7 X;  4G12 A;  3W2A A;  2R7Z J;  1HSJ A;  5H20 A;  2HOS A;  4CSW A;  1LNW A;  4RB2 C;  2GLO A;  1MSF C;  2VQH A;  4ACI A;  4WXH A;  2R4G A;  4OIP F;  5GAH J;  2YVE A;  4L9J A;  4OU0 A;  1LPQ A;  1OCZ H;  1S7A A;  1ENH A;  2VJ5 A;  2RDP A;  2OU2 A;  2XC7 A;  2E2H J;  3L2Q A;  2L9S A;  1J75 A;  4DIQ A;  5JI6 A;  3L2W A;  1RR8 C;  3ZQG A;  1IZ1 A;  4MFD A;  3RZO J;  2HPM A;  2R7F A;  1FZP B;  1TWH J;  4XR6 A;  5HS7 A;  1I3A A;  2Z1D A;  4GYI A;  3BY6 A;  3IV5 A;  3RQI A;  1X4O A;  2OI8 A;  1RI7 A;  5B5E C;  4AUX A;  3TMO A;  1MBH A;  2KHM A;  5F0H A;  1BL0 A;  2HWV A;  4A0Z A;  2HXO A;  3PUB A;  1MBG A;  4EM0 B;  4KIS A;  2CQQ A;  3FXU A;  3N05 A;  4L5J A;  4U7B A;  3E97 A;  4P5O A;  3LWJ A;  2DTZ A;  4O5V A;  4Y13 A;  2DFH A;  1VQM I;  2PMZ N;  5C44 J;  3F1B A;  3TP3 A;  2P81 A;  1R58 A;  1F5T A;  1J5Y A;  3F8M A;  2BY3 A;  4EJW A;  1JKP C;  1C0W A;  2J5P A;  2XDN A;  4IF4 A;  2IGO A;  3FZV A;  4A0Y A;  5JVT A;  1LDD A;  5CQE A;  4V19 K;  4GCV A;  2EV0 A;  2EFN A;  2MD5 A;  4LIV A;  3GEU A;  1S5L C;  2A2F X;  5FLV A;  4HF0 A;  4CZZ A;  4JL3 A;  4B8X A;  1KON A;  3LFK A;  1MMS A;  3MMY B;  1T98 A;  2CGP A;  4CHU A;  3CWR A;  3K10 A;  3FXJ A;  2FNP A;  2ZXI A;  4GFL A;  4OD4 A;  1B1B A;  2O03 A;  1HA8 A;  1FP1 D;  1MNE A;  3MQ0 A;  4YIF A;  2PN6 A;  5LEJ A;  3LAP A;  2LC2 A;  3RPQ A;  4CYC A;  4HX8 A;  2B7E A;  5J6X A;  3CUQ C;  3FDY A;  3P9C A;  3R0A A;  4FX0 A;  3PO2 J;  1W1W E;  4LMY A;  2F5C A;  3W6V A;  3AL0 B;  1VQ4 I;  1KGS A;  1F9N A;  2CJJ A;  2P7V B;  2V6E A;  2QWW A;  4N9I A;  3HSF A;  1ZEL A;  2P0W A;  4G9Y A;  3GFM A;  1GV2 A;  4JX5 A;  3KKD A;  1M1E B;  2RQQ A;  3HXL A;  3ANG A;  1SGM A;  4AIK A;  3AQS A;  1X3U A;  3HG9 A;  5GTH C;  4BQQ A;  2ZSH B;  4G7Z F;  1JKQ C;  1MMD A;  5IY5 H;  4IJA A;  5AIP A;  5E3N A;  2FBH A;  4HX4 A;  2GM4 A;  4MGR A;  2V79 A;  1AKH B;  2CG4 A;  3BG9 A;  2A05 A;  4M6V A;  2LKP A;  1TWG J;  2Q2E A;  1JE8 A;  1VF9 A;  2KP6 A;  3V4G A;  3QPS A;  1UI6 A;  3BJ6 A;  2FF4 A;  3GLL A;  3J7Z I;  1XCB A;  3QAH A;  1W7P A;  1TQM A;  3S3N A;  2BOL A;  3OSG A;  3P7N A;  4BKX A;  4RBO A;  4HYE A;  3BG3 A;  4QWQ A;  3H5A A;  1BC8 C;  2OTL I;  3F9K A;  1USS A;  3HIF A;  2NVQ J;  1TT0 A;  2HI3 A;  1FIP A;  4E6K G;  4E7K A;  1FBS A;  2YU3 A;  1F4K A;  1V5G A;  2JMW A;  4MXM A;  1HCR A;  4XKV A;  4XLE A;  3SZT A;  2IGK A;  5HSZ A;  1O3R A;  2PMH A;  4AF5 A;  1N75 A;  2QF7 A;  1IN8 A;  1N78 A;  3PPB A;  3E6D A;  1FBQ A;  4Y17 A;  2AXL A;  5AIQ A;  1LFB A;  3A03 A;  1U9N A;  3LAJ A;  2E7X A;  1XC5 A;  1TWA J;  4EGY A;  2EV5 A;  2QSH X;  3H1C A;  4CCJ A;  2HDC A;  4GFB A;  1FYL A;  1G2H A;  3I64 A;  4IOA F;  3NAR A;  4ZYA A;  2O5R A;  3H9J A;  3VOX A;  1SD6 A;  1R6R A;  1R1V A;  2K86 A;  1EH6 A;  3U1D A;  4DBQ A;  3NI7 A;  1E3H A;  3CTA A;  3V8K A;  3TBI A;  2L9V A;  2CW0 F;  3DXJ F;  2D6Y A;  4DQ2 A;  2D1H A;  3MWM A;  3KP6 A;  3ZPL A;  2JZY A;  2Y30 A;  4BAY A;  4JOM A;  4BQN A;  4F92 B;  2WY8 Q;  4JK1 X;  4XRM A;  2MGQ A;  1IV6 A;  2F4M B;  2FSW A;  4HEA 2;  2FBI A;  3TL4 X;  2WAD A;  4L9N A;  4BHP A;  5D19 A;  4ENJ A;  1HST A;  3LSI A;  4XLF A;  3Q9V A;  3RCO A;  3FIW A;  3OYJ A;  4PJN A;  3TOA A;  1YQA A;  1YRN A;  3KLO A;  2QSF X;  4IXA A;  1FOW A;  3FK6 A;  3OYK A;  2VT2 A;  1D1B A;  2DW4 A;  5FKK A;  3ZQF A;  5M5X J;  4A3C J;  1JHH A;  3ZQH A;  4XOP A;  5A2Q Z;  3TDZ C;  2R92 J;  2KIQ A;  2ZXW H;  3C7J A;  3VB2 A;  5EDN A;  3KLN A;  1H9G A;  2WGB A;  2GIV A;  3I4P A;  3G71 I;  5BQT A;  2NVT J;  1EKE A;  2BGC A;  4M72 A;  3OSF A;  2LBF A;  2K85 A;  2QQ9 A;  2FQ4 A;  4NB5 A;  4LG0 A;  2CH0 A;  3HBL A;  2KKO A;  3WTS C;  5J47 A;  1HC8 A;  2Q2E B;  4I0B A;  4MTD A;  1WZ2 A;  1YHQ I;  1A31 A;  3ZQC A;  3ZQ7 A;  3W6K B;  2Y69 H;  4IRH A;  3F72 A;  4UHT A;  2QQA A;  2Y48 A;  3K70 D;  3I4N J;  1Z67 A;  1IRX A;  4R8H A;  1MMG A;  4XN3 A;  2WAE A;  4A93 J;  2L5Q A;  5E1W A;  5HOD A;  4A3M J;  4AWX B;  2X1E A;  3E7L A;  2ZY9 A;  2L02 A;  2JA6 J;  2OD5 A;  1LKX A;  3Q5F A;  3G56 A;  3WGI A;  3OYA A;  2ELJ A;  1D0Z A;  5C4X J;  3CLQ A;  3CP8 A;  4KUM A;  3CCR I;  3F8N A;  4IZZ A;  3KP7 A;  4ZH4 F;  3OIP A;  3BDD A;  2M0C A;  3F6O A;  1B72 A;  1I6X A;  1H9T A;  4FAS D;  4ZYH A;  3C07 A;  2WBM A;  2H1L A;  3T6N A;  1UAA A;  4QLC U;  2ZB9 A;  2NP3 A;  1E2X A;  4AVZ A;  3ANP A;  3S5R A;  4EV0 A;  5DD8 A;  3LA2 A;  1XSD A;  2UWM A;  5LHI A;  1OR7 C;  3S1N J;  4TV7 A;  3LSP A;  2PZ9 A;  1BR4 A;  5FKN A;  4EJU A;  5DEQ A;  3CJD A;  4XKB A;  2LG4 A;  1VQ7 I;  3K7A J;  2G7U A;  4I2O A;  2R7U A;  4HSR A;  4PUS A;  2MH2 A;  5D5X B;  3G4S I;  4GGG A;  1QVT A;  3K2Z A;  1R7J A;  5J40 A;  5FKO A;  2EFO A;  2M0M A;  1U6G A;  1NG7 A;  3OOP A;  1S29 A;  4A69 C;  3IC7 A;  3D5R C;  2RN7 A;  4UB6 C;  2W53 A;  3NWS A;  3ECH A;  3CJN A;  3M8F A;  1QZE A;  2MC4 A;  3ML6 A;  3MN2 A;  1NK3 P;  1I39 A;  2QCO A;  2MFZ A;  3AQT A;  4W97 A;  1FJL A;  2R7W A;  1MBK A;  2ESH A;  3BWG A;  3TGN A;  4BYY A;  1VTN C;  3WU0 A;  4RAY A;  3VUQ A;  2UXH A;  3OR1 C;  1V54 H;  3WTW C;  1BN5 A;  3BPV A;  2Y2Z A;  2VLA A;  3EGQ A;  4E7S A;  4M9Z A;  4ANJ A;  3LFU A;  1IV8 A;  1W5C C;  3PQJ A;  1A04 A;  4BHB A;  4M3B A;  2M34 A;  1XX5 A;  1CGP A;  5D8K B;  5DDG A;  2TRT A;  4M6X A;  2CUE A;  1XD7 A;  1Z05 A;  2ELH A;  4G6T B;  1X3Z B;  5FGL A;  1P92 A;  3ASO H;  1JT0 A;  3EUH C;  4GDF A;  4AD9 A;  1B4A A;  1YYV A;  5LFA A;  3OWT A;  2ZJ2 A;  4FE4 A;  2COM A;  2HQA A;  1V3F A;  1DQU A;  3HOZ J;  2DXI A;  2XB5 A;  5D8L B;  5EZG A;  4UUV A;  3BZK A;  4G6D A;  3F8F A;  2PBI A;  2NVU B;  3J81 K;  1Z7U A;  2JPC A;  1R9T J;  1I6H J;  3L7W A;  3JRG A;  2X6Y A;  2EZI A;  4BXU A;  4GRI A;  3SDG A;  1Y39 A;  3TW7 A;  1K78 A;  3E7Q A;  2HOA A;  2DT5 A;  1FLI A;  1K61 A;  1IDZ A;  3BCB A;  4D7M A;  1HKS A;  3A1Y A;  5E8G A;  2QEN A;  5KCM A;  2HR3 A;  1U5T B;  1NTC A;  3GXO A;  2QBY A;  3UKG A;  1X1B A;  1ETQ A;  2VPR A;  1A6Q A;  5M3F J;  2ZCN A;  4D7N A;  3FK7 A;  4EGZ A;  4PZJ A;  3DCF A;  3PQK A;  1UEL B;  2ELK A;  3ZCO A;  4G7O F;  2PJP A;  3RTR A;  5F04 A;  2WUI A;  2LVS A;  2VE8 A;  2Y0M A;  2FML A;  3VOE A;  3CLO A;  1KU7 A;  1YX5 A;  1D5V A;  4AU7 A;  2GZW A;  4XBF A;  3MZY A;  3IRQ A;  2HFH A;  2CS3 A;  2Z99 A;  3PJR A;  5HNF A;  1ETK A;  1SVO A;  1XCV A;  4I09 A;  3KIO A;  1YS7 A;  3HYI A;  4ESJ A;  1WJC A;  2CWE A;  2W82 A;  4FHT A;  4NNJ A;  5KHD A;  4ASN A;  3HTA A;  1P7I A;  2ADU A;  4KT6 A;  4MQV A;  2CYY A;  3BCA A;  3H36 A;  4GO1 A;  1Y8Q B;  2VBX A;  2CV2 A;  4IHT A;  2DI3 A;  1YIT I;  1WJD A;  5EYR A;  4IO9 F;  2WC2 A;  1HW5 A;  4C2M J;  2NVX J;  1BA5 A;  4L62 A;  1ZLJ A;  5D4R A;  1UB9 A;  4WCG A;  4HLY A;  3M07 A;  5TJJ A;  2IA0 A;  3N97 A;  2VOP A;  3H35 A;  1Z77 A;  3M9A A;  4XLC A;  5E20 A;  3HRT A;  3BG6 A;  1ZK8 A;  4A3K J;  3BZ6 A;  3AKZ A;  4OIO F;  3HOW J;  5CW8 A;  4ZTJ A;  4BJT A;  1FOX A;  3RJP A;  4KJZ A;  4C2T A;  3BJO A;  2MAB A;  3I5U A;  1KQ0 A;  3LSK A;  5F1R A;  2XPW A;  1QRY A;  4XSZ F;  4XN0 A;  4DW6 A;  2R7V A;  2L2O A;  3GTK J;  2NS0 A;  5HS8 A;  1H88 C;  3J7A O;  5H2F C;  4IL6 C;  5BOX A;  3HSR A;  1MIJ A;  1MMN A;  3DBH B;  5IP7 J;  5D18 A;  3HE0 A;  4LLG F;  2XKO A;  2R3S A;  5EEG A;  2DFE A;  2XDV A;  3F0C A;  4KMU X;  3OS1 A;  3A02 A;  2XAQ A;  2CMP A;  4BE0 A;  1O3S A;  1AU7 A;  2KIF A;  3AG3 H;  2G3B A;  1MNM C;  2ME0 A;  4E7I A;  3K1P A;  1BOA A;  2VI6 A;  3BJA A;  4M3D A;  1JI8 A;  1GXQ A;  2GWR A;  2EIM H;  3PAS A;  5B1A H;  1XDU A;  1P4A A;  1ODD A;  1XG1 A;  3QOE A;  4CXF A;  1SMT A;  1AA7 A;  5CPR B;  2ISZ A;  3RPU D;  3A2K A;  4Y52 J;  1OYY A;  2IVM A;  1DP7 P;  2JRT A;  5C4Y A;  1JGG A;  4MO7 A;  1RNL A;  3EQL F;  3ONQ A;  3ZXS A;  1DGR M;  2V1D A;  1RPW A;  2CQX A;  2OA4 A;  4HV6 A;  1SC7 A;  1J2X A;  3SEZ A;  4LLN A;  1HXD A;  3IWF A;  3K1N A;  5J1Y A;  1YOV B;  2M3A A;  2V57 A;  2A07 F;  2A5W A;  2QWT A;  3EYI A;  1HQC A;  2DQL A;  3WTT C;  5BS6 A;  1LDK B;  1B9M A;  5F0C A;  2V9V A;  1OYI A;  3HJE A;  4C9Y A;  3VYT B;  3PM1 A;  2DK5 A;  2K9S A;  1T33 A;  3GX4 X;  1U2W A;  4IRV A;  3R61 A;  4IRG A;  3I71 A;  3VOK A;  3M1C A;  1YRN B;  1JGS A;  1LVK A;  3K4J A;  4RLQ A;  4ZDP A;  5LHG A;  4P9F A;  1PDN C;  3REO A;  3KZI C;  3LA3 A;  4BBS J;  2XGD A;  4LOC A;  4KIT B;  2GOM A;  3A01 B;  4BY7 J;  1IN7 A;  2RC4 A;  1IDY A;  2ESN A;  2STT A;  2EQR A;  1SD5 A;  2EK5 A;  3SFZ A;  4A6D A;  1JT6 A;  2QUF A;  4M74 A;  2K3F A;  2H94 A;  3GTJ J;  2EZL A;  5DCM A;  4DYQ A;  3IRR A;  3CDI A;  1TP4 A;  2ISY A;  3DPU A;  1R5H A;  2HYG D;  3SZP A;  2LH9 A;  4QPO A;  3RIR A;  1DPU A;  2FA5 A;  4RM3 A;  4A2U A;  4J00 A;  1WJF A;  2NNY A;  2G7H A;  5FKM A;  1R36 A;  3GVA A;  3W6J B;  1YJW I;  5HBU A;  1BJZ A;  2LLK A;  3Q0V A;  1O7L A;  2K40 A;  3J81 Z;  2R5Z B;  4LG3 A;  2KLO A;  5KVR A;  5ERI A;  1POG A;  3MZH A;  2DBB A;  1RET A;  2COB A;  3CCJ I;  1HKQ A;  4RGU A;  2FMY A;  2WTE A;  2P4W A;  4KIB A;  1J59 A;  5FRO A;  3DBR B;  2NYX A;  2BVM A;  2LF8 A;  2W7N A;  3FM3 A;  1MMA A;  1ETX A;  2GXB A;  4QPQ A;  2X0L A;  1R4M B;  2XV4 S;  1H89 C;  1L0O C;  1IXR C;  1UI5 A;  2LR8 A;  1ZGW A;  1A35 A;  2BY0 A;  1WVR A;  4EJV A;  2FBQ A;  2L3D A;  3R60 A;  1FTZ A;  1KQ9 A;  1BJA A;  5ICF A;  1ZAR A;  4I7H A;  5LGU A;  1F36 A;  3HOY J;  2FNA A;  4BE1 A;  1X1P A;  3VPR A;  2KZV A;  1JTX A;  3G6E I;  2JA7 J;  3S17 J;  2LKX A;  1ZTR A;  3VP5 A;  3V6G A;  2V7F A;  3NAU A;  1J7K A;  1RUN A;  2HDW A;  4G7H F;  2K27 A;  2M8G X;  1BI3 A;  1EH8 A;  2E5Z A;  4Y4R A;  2M8E A;  3QYF A;  4PGG A;  4H0E A;  1G4D A;  4XOT A;  1KQ8 A;  2VJ4 A;  1X58 A;  2Q8K A;  1YJN I;  2VON A;  5M5Y J;  4MTE A;  3C2G A;  3FXQ A;  1W0T A;  5K7H A;  4GFK A;  3RI4 A;  2ZNY A;  3BPX A;  2E71 A;  4F3Q A;  2BHZ A;  1E3P A;  2O61 A;  2V6C A;  2XPU A;  2W48 A;  2AO9 A;  3PIO F;  3V7C A;  4ETS A;  4DJA A;  3KKC A;  3DV8 A;  2DMU A;  4RDU A;  2YVX A;  2ZME B;  4F91 B;  2D5V A;  3HOV J;  1K6Y A;  2WAQ A;  5HLG A;  4HPQ A;  1JXS A;  1RZ4 A;  3TKY A;  2QKM B;  5ICG A;  3F8C A;  2MD0 A;  4M71 A;  1RIO H;  2E1O A;  5EF6 A;  2WA0 A;  3MD2 A;  4WXC A;  4M73 A;  2P5V A;  2VBW A;  1OYW A;  3EDP A;  3JSO A;  2NXN B;  3HPH A;  1WKM A;  1ON1 A;  1X19 A;  1TNT A;  2I8D A;  2EIJ H;  4NN1 A;  2EH3 A;  4UY8 I;  2LKS A;  4BAC A;  3CQZ J;  3JRE A;  3WG7 H;  5TRD A;  4D1Q A;  2CSO A;  2HZT A;  4E7L A;  1MD0 A;  1SD7 A;  2PQ8 A;  3K4M A;  4XRF A;  5CJ9 A;  1FC3 A;  1Z1D A;  2G7S A;  3VVY A;  3H5N A;  3OV8 A;  1A6I A;  2EBI A;  1DGW Y;  4FQG A;  4XSX F;  5E3L A;  2P5L C;  2FUG 2;  1CF7 B;  2XRN A;  5CQG A;  5FFX A;  5EGO A;  2HYJ A;  2A6H F;  3DEW A;  3MAJ A;  4AYB N;  1EA3 A;  3BP8 A;  2ZSI B;  5C3E J;  2V1U A;  2L7M P;  2O6G E;  3KFW X;  1IXC A;  1IGN A;  1H0M A;  1XTA A;  4ABZ A;  1WI9 A;  5FHP A;  3OYN A;  1UG2 A;  2MH9 A;  1MJ9 A;  3V8J A;  4WX9 A;  3L00 A;  3KPH A;  1VQ8 I;  1T38 A;  2D1V A;  2IGN A;  4FIS A;  3T0Y A;  3ABL H;  4DYC A;  1FYK A;  4J01 A;  1D8K A;  3U21 A;  1RUO A;  5D5V B;  1VI0 A;  5HDG A;  4RB0 A;  2F4I A;  4Z2Y A;  2WAF A;  2D2W A;  3WTX C;  4IQ4 A;  4XRS A;  5K1Y A;  4BXF A;  2JRM A;  2YX7 A;  2G7G A;  2GOX B;  1QA6 A;  4JQF A;  3N4M A;  5DCF A;  1VQL I;  2VL8 A;  4MK6 A;  1IXS B;  2R7S A;  2VKE A;  2MW8 A;  2VE9 A;  1IN6 A;  3K4K A;  4FX4 A;  4YEL A;  2K9L A;  5TGT A;  1SEU A;  4UV8 A;  2W24 A;  1UJ8 A;  2IS1 A;  3TO6 A;  5BPD A;  5D5U B;  4AIJ A;  3B02 A;  2HKO A;  3R4K A;  3L09 A;  3HGG A;  2PMU A;  3LSR A;  2GFN A;  5J3L A;  4BHC A;  3VIB A;  3HKZ N;  3R6S A;  3WGG A;  3OYM A;  1QU3 A;  5FLX K;  5LBQ A;  2XAH A;  4YIR X;  1KYZ A;  2CW7 A;  1MKM A;  1SMY F;  1Z6R A;  2OF7 A;  1GV5 A;  3KP5 A;  4PJM A;  2E1M C;  1ZN2 A;  3HOU J;  1MGT A;  4IVN A;  4IKF A;  4E7Z A;  5JHU A;  3NRV A;  2LSO A;  3VEP A;  1B59 A;  1ACI A;  3TW6 A;  3PO3 J;  4NC8 A;  5CKT A;  1W4M A;  2QEX I;  3CME I;  4HZF A;  4KN4 X;  4NUB A;  4EEF G;  1XGM A;  3IH3 A;  3DTK A;  4XLA A;  2F48 A;  2AS5 F;  1G8X A;  3K0L A;  1LB2 A;  4OMY A;  1IUY A;  2K5C A;  3GF2 A;  3E3V A;  4DZJ A;  4AYB A;  2P7C B;  2QKO A;  3HEF A;  3ON4 A;  4KWA A;  4JBA A;  2HXI A;  3FMQ A;  3FIS A;  2M7A A;  4I0A A;  2QGU A;  5HOO A;  1V4R A;  1KU9 A;  3WHC A;  4HW0 A;  4A0X A;  1LEA A;  1FSH A;  4Y15 A;  4WWC A;  2WB1 N;  3TQN A;  3BOQ A;  2M4K A;  1SFK A;  4IHS A;  2REK A;  3RD3 A;  5FMP A;  4LFU A;  1FMV A;  2RHA A;  5ICC A;  4CYC B;  3M7G A;  2LMD A;  2MLG A;  3BLY A;  3ZMV A;  2R7T A;  2JTV A;  5KK1 A;  4YG2 F;  3B81 A;  3K4N A;  4A5M A;  3EPZ A;  2DMQ A;  3VYU B;  4A12 A;  3VVX A;  4WIB A;  3DPJ A;  3ZOB A;  1ZRC A;  3ISP A;  2UV1 A;  1FOY A;  2VT3 A;  4IHV A;  2L4A A;  5IOY A;  4I02 A;  4HF2 A;  3ROU A;  2VB6 A;  5LHH A;  4BL0 B;  3CF2 A;  3CCQ I;  5CVV A;  2UXI A;  5E18 F;  4XLN F;  1GT0 C;  1T08 B;  2JA2 A;  1MW7 A;  3IKV A;  5DYM A;  4BBR J;  4GCT A;  4ENM A;  2Z16 A;  2NRA C;  4U0W A;  1PYV A;  4CYD A;  3CMY A;  2K4J A;  5DM6 F;  2LK2 A;  4AID A;  1LQ1 A;  2V1N A;  4BJ5 C;  3HTH A;  3I56 I;  2JA8 J;  4PFO A;  3D0S A;  3T8T A;  2OV7 A;  4BU2 A;  5IYD J;  3E6C C;  1U0J A;  3OYE A;  3CO7 C;  2EFP A;  4LD5 A;  1FT9 A;  3ON2 A;  2FJI 1;  1WFX A;  2YSR A;  2H1K A;  5BMZ A;  3JTG A;  4Q5S F;  5HDK A;  2XAJ A;  2ZO4 A;  1PJR A;  3ESW B;  2CW8 A;  1HF0 A;  2EZH A;  4PCQ A;  1R23 A;  5EG0 B;  3BRU A;  4C2M A;  3WE2 A;  4YII A;  1KA8 A;  4X0G A;  1U8R A;  1LDJ A;  1Z3X A;  4JNN A;  4RM2 A;  1JUM A;  1VQO I;  5DV5 A;  1R1T A;  2E36 A;  3PNT A;  4MNU A;  4DNC A;  4XQF A;  5DUK A;  3F22 A;  2FBK A;  4HDU A;  3BNI A;  3GZI A;  1QQI A;  2ZCW A;  3E5Q A;  1O3Q A;  1P2F A;  4LIU A;  4NQW A;  1E17 A;  1OCR H;  5IT9 Z;  1TQI A;  5L3C A;  4GYG A;  3HDD A;  3E5X A;  3DPL C;  2CUF A;  1AHD P;  3WG9 A;  2ID3 A;  4ESF A;  5J1R A;  3ELK A;  3EET A;  1E3O C;  1MND A;  3MKL A;  3ZMD A;  1X1C A;  4ENK A;  4M3G A;  3OYC A;  2DU9 A;  1HW2 A;  2PFV A;  1I3Q J;  1UHM A;  3OYF A;  4BNC A;  3HTI A;  1DDN A;  1YG2 A;  2KRC A;  3H3Z A;  1WJB A;  2ECC A;  3WU2 C;  2FQ3 A;  3CCS I;  1BC7 C;  1ON2 A;  2XPV A;  4B47 A;  1GLN A;  1W7P D;  4FET A;  1TWF J;  2XSJ C;  4RB1 A;  2A6T A;  3FKI J;  5HNH A;  1W5S A;  4ZZD A;  2BV6 A;  3RKQ A;  2YVH A;  3LL7 A;  2E60 A;  2KFD A;  3RPU A;  3JSJ A;  3PFI A;  5HDN A;  2VPL A;  2R93 J;  3MNL A;  2M1B A;  4LJZ F;  2EFQ A;  3SQN A;  3LSJ A;  1DUX C;  5JFR A;  3V42 A; 
#chains in the Genus database with same CATH homology
 3HOW J;  5CW8 A;  2N8G A;  3KNW A;  3HOX J;  1S7E A;  1ETV A;  2G7L A;  4W1U A;  2XPW A;  1QRY A;  1RKW A;  4DW6 A;  3JRA A;  2L7F P;  3GTK J;  2HKU A;  3S1M J;  4DYR A;  1HLV A;  1H88 C;  1JUP A;  1OCP A;  4ME9 A;  3JRB A;  4JYK A;  3BT9 A;  5IP7 J;  3HE0 A;  5D18 A;  4UUS A;  1UMQ A;  5FLM J;  5EEA A;  2DJN A;  3BTC A;  3F0C A;  3JRH A;  3IH4 A;  2JN6 A;  4XK4 A;  1ETO A;  3A02 A;  1AU7 A;  2L0K A;  2AHQ A;  1O4X A;  3QPL A;  2G3B A;  1MNM C;  2IEK A;  2ME0 A;  1FTT A;  5H9T A;  3Q0W A;  3BQZ A;  1WCM J;  2VI6 A;  4M3D A;  2HOT A;  2HDD A;  2Q24 A;  3PAS A;  2PBX A;  5EG0 A;  2E2I J;  2Y9Z A;  4G12 A;  1XG1 A;  2X6O A;  2R7Z J;  2KDZ A;  1PUF A;  2HOS A;  2GLO A;  4AC6 A;  3JR9 A;  1MSF C;  4ACI A;  4Y52 J;  4HNV A;  2YVE A;  2XRL A;  2MG4 A;  3VVZ A;  5C4Y A;  2XSD C;  1ENH A;  1JGG A;  4MO7 A;  1ZR2 A;  1AKH A;  2DMP A;  1JKO C;  2E2H J;  4UUT A;  2NOG A;  2NX4 A;  3I4M J;  1RPW A;  2CQX A;  2ZCX A;  4NEL A;  3RZO J;  3ZQG A;  4MFD A;  2R5Z A;  3S16 J;  1TWH J;  5J1Y A;  2DA5 A;  1K83 J;  2V57 A;  2QWT A;  1DU0 A;  2FD5 A;  3IV5 A;  3RQI A;  2OI8 A;  2YU9 J;  4AUX A;  1MBH A;  3O60 A;  5F0C A;  5F0H A;  1BL0 A;  2M9H A;  1UHS A;  2HXO A;  4GCL A;  4A3D J;  3PM1 A;  1MBG A;  1LE8 A;  2K9S A;  1T33 A;  2CQQ A;  2R0Q C;  1HDP A;  1JKR C;  3QQA A;  2DTZ A;  1ZR4 A;  1YRN B;  3LWJ A;  3VOK A;  2PMZ N;  5C44 J;  5IYB J;  3F1B A;  3TP3 A;  2P81 A;  3RH2 A;  4BBS J;  2XGD A;  2FX0 A;  4LOC A;  3A01 B;  1JKP C;  4BY7 J;  1IDY A;  2XGE A;  2GUH A;  2QIB A;  2EQR A;  2XDN A;  3HIM A;  1HOM A;  1JT6 A;  3SFI A;  4XRS G;  1RR7 A;  2X48 A;  1IUF A;  2CU7 A;  3M4O J;  1OFC X;  3GTJ J;  2EZL A;  3GEU A;  5FKL A;  4DYQ A;  5FLV A;  2F07 A;  2QTQ A;  5GP9 A;  4JL3 A;  1LFU P;  5DS9 A;  3K2A A;  1B8I A;  3VW2 A;  4FTH A;  2LTP A;  3CWR A;  4GFL A;  1ETY A;  3HM5 A;  3JRC A;  4A3L J;  4MLO A;  5EGO B;  5FKM A;  5HBU A;  4QIW N;  1IRZ A;  1BJZ A;  2LLK A;  5GPC A;  2LY9 A;  3Q0V A;  3FRQ A;  2K40 A;  4CYC A;  2R5Z B;  1PUF B;  3HTJ A;  4C3J J;  3BCG A;  2FJ1 A;  1POG A;  1APL C;  3HGY A;  2NVY J;  3PO2 J;  1RET A;  2COB A;  3W6V A;  3QKX A;  1SFO J;  3LJL A;  5HAW A;  2B63 J;  2CJJ A;  4A3B J;  3BJB A;  1GVD A;  2R5Y A;  3BR6 A;  4JP0 A;  1Q1V A;  4B1R A;  1X2M A;  1I50 J;  3H3V K;  1ETX A;  1OJL A;  4JX4 A;  5IOZ A;  1GV2 A;  2E19 A;  4FE7 A;  4JX5 A;  1LE8 B;  1D5Y A;  5IP9 J;  1HDD C;  3KKD A;  1H89 C;  3ANG A;  1SGM A;  1UI5 A;  2LR8 A;  4DZP A;  1ZGW A;  3GTG J;  3MVP A;  2JJ7 A;  3AQS A;  2LP0 A;  2FBQ A;  1JKQ C;  5K58 A;  1FTZ A;  5E3N A;  1Y1V J;  2GM4 A;  1F36 A;  3HOY J;  2I10 A;  2UXO A;  3VPR A;  1U8B A;  1JTX A;  3BG9 A;  4D5C A;  4M6V A;  1IJW C;  1AKH B;  4YZE A;  2DN0 A;  4JKZ A;  5FJ8 J;  2JA7 J;  3S17 J;  2VKV A;  1A5J A;  4FCY A;  2LKX A;  1TWG J;  1ZTR A;  3VP5 A;  3V6G A;  4L5E A;  1VF9 A;  3NAU A;  1JUS A;  3QPS A;  1UI6 A;  4HKU A;  1GDT A;  1EF4 A;  1TWC J;  5CXI A;  2XGC A;  5IPA A;  2M8G X;  3OSG A;  2JA5 J;  3M3Y J;  4BKX A;  4RBO A;  3NXC A;  3BG3 A;  3BR3 A;  4BXX J;  1X58 A;  2NVQ J;  5M5Y J;  2HI3 A;  1FIP A;  5BNG A;  1BW5 A;  3IUV A;  1MBJ A;  1X2N A;  1W0T A;  3CCY A;  5K7H A;  2JMW A;  3LSG A;  4GFK A;  1HCR A;  4MXM A;  2XPU A;  2W48 A;  2AO9 A;  3HB9 A;  5HSZ A;  5JLX A;  4AF5 A;  2QF7 A;  3PPB A;  3KKC A;  4UUS B;  2DMU A;  4M3F A;  3BR2 A;  1LFB A;  4RDU A;  4PXI A;  3A03 A;  2D5V A;  1MH4 A;  1U9N A;  3HOV J;  2E2J J;  1XC5 A;  3H0G J;  1TWA J;  2ECB A;  1NK2 P;  2NS8 A;  4GFB A;  5F1J A;  1G2H A;  3NAR A;  2IAI A;  2E1O A;  5EF6 A;  1W0U A;  3VOX A;  3GTQ J;  5EZH A;  3BHQ A;  3NRG A;  3NI7 A;  3S1Q J;  2WAQ N;  3A01 A;  2D6Y A;  5DAJ A;  2K9N A;  1F43 A;  2VUM J;  3GBG A;  2OPT A;  1SAN A;  1WPK A;  4NN1 A;  2ME6 A;  2K9Q A;  2Y30 A;  2EH3 A;  3Q3S A;  3BQY A;  1OCT C;  2X9D A;  4XRM A;  3CQZ J;  3JRE A;  2MGQ A;  1IV6 A;  4Y7N J;  1JJ6 C;  1MBE A;  3VVY A;  2G7S A;  1P7J A;  5D19 A;  1WGX A;  1A6I A;  2EBI A;  3O8G A;  3OOU A;  2DA6 A;  3FIW A;  4NDL A;  5E3L A;  3O8H A;  5K7Z A;  3VW1 A;  1WH7 A;  1YRN A;  4I6Z A;  5EGO A;  1U78 A;  3BTL A;  2HYJ A;  5K7F A;  3DEW A;  5C3E J;  4AYB N;  3FK6 A;  3JRF A;  2L7M P;  5FKK A;  1IGN A;  5JLW A;  3ZQF A;  3COL A;  5E3O A;  3KZ9 A;  4X6A J;  4ABZ A;  5FHP A;  1UG2 A;  5M5X J;  4A3C J;  3ZQH A;  1ZKG A;  5GPA A;  2L9R A;  2G0E A;  4FIS A;  5EDN A;  2R92 J;  2WGB A;  5IYC J;  4DYC A;  2NVT J;  3OSF A;  9ANT A;  3B6C A;  3G1L A;  1BW6 A;  1MBF A;  1VI0 A;  2FQ4 A;  3BR0 A;  3HBL A;  1MSE C;  2DMN A;  3C2B A;  3WHB A;  4A3G J;  2ZCM A;  2NP5 A;  4XRS A;  2DA2 A;  3ZQC A;  2G7G A;  2ID6 A;  4IHW A;  3I4N J;  4MK6 A;  2VKE A;  2MW8 A;  4A93 J;  3QBM A;  5HOD A;  3S2H J;  4A3M J;  3B6A A;  3E7L A;  2JA6 J;  3OIO A;  3G56 A;  2QOP A;  4XID A;  3JRD A;  3LNQ A;  2RAE A;  5C4X J;  3HGG A;  4J19 A;  3LSR A;  4A3F J;  1U9O A;  1T56 A;  2GFN A;  5J3L A;  2DA7 A;  4UDS A;  3HKZ N;  3VIB A;  4IEJ A;  1ZQ3 P;  3EUP A;  1WH5 A;  2M0C A;  1B72 A;  1TC3 C;  4AC0 A;  1FEX A;  1Z0X A;  1ETW A;  3C07 A;  1IC8 A;  4ICH A;  2OF7 A;  3T6N A;  1GV5 A;  2ZB9 A;  2IBD A;  2M2E A;  3HOU J;  2UXP A;  1JJ8 C;  2NP3 A;  3S1R J;  3S14 J;  2Y9Y A;  3ANP A;  2Y0S N;  3S5R A;  4JX6 A;  2OER A;  3S1N J;  4A3J J;  3LSP A;  3S2D J;  4QTR A;  5FKN A;  2PZ9 A;  3CJD A;  3TW6 A;  3PO3 J;  4GCK A;  2XB0 X;  2KT0 A;  3K7A J;  4EEF G;  3LOC A;  3IH3 A;  1WI3 A;  1GUU A;  3CDL A;  1ITY A;  4QSH A;  3ZQI A;  4KWA A;  1QVT A;  4DZJ A;  1Y1W J;  2QKO A;  3HEF A;  3ON4 A;  1QVU A;  4V2G A;  3LHQ A;  2HXI A;  5F27 A;  3RZD J;  2YUS A;  1H8A C;  3FIS A;  2CRG A;  5FKO A;  4S0H B;  4BY1 J;  3WHC A;  3G1O A;  4XIC A;  4A69 C;  2WB1 N;  2W53 A;  3SJM A;  4C3H J;  3BTJ A;  1B72 B;  1NK3 P;  5M3M J;  3MN2 A;  2REK A;  3RD3 A;  2QCO A;  5FMP A;  2RHA A;  4CYC B;  3AQT A;  3BG5 A;  4W97 A;  1FJL A;  1MBK A;  3B81 A;  2DMQ A;  3VVX A;  2RAS A;  3DPJ A;  4B3A A;  3ZOB A;  1IG7 A;  3VUQ A;  4IHV A;  4V2F A;  5IOY A;  3NNR A;  2UXH A;  2UXI A;  3GTL J;  2DMT A;  1GT0 C;  2Y2Z A;  3ZQL A;  3EGQ A;  4BBR J;  4GCT A;  3Q0U A;  4A3I J;  1RKT A;  4B4C A;  2H8R A;  2UXU A;  2ZOY A;  3CRJ A;  3D1N I;  1VFC A;  4M3B A;  3CMY A;  3L1P A;  2LK2 A;  2M34 A;  4I76 A;  2LFB A;  2TRT A;  3HTH A;  2CUE A;  3V78 A;  2JA8 J;  5CXG A;  2DG8 A;  2GEN A;  5IYD J;  2DA1 A;  3P9T A;  1JT0 A;  5FGL A;  5EFY A;  3JRI A;  1XS9 A;  3BTI A;  3G7R A;  2MSY A;  1FIA A;  3ON2 A;  3NPI A;  5AQC A;  4FE4 A;  5DTD A;  1CQT A;  3IH2 A;  2H1K A;  2DA3 A;  4MFE A;  2HYT A;  5J1U A;  3BR5 A;  3HOZ J;  2XB5 A;  5EZG A;  1I6H J;  1R9T J;  4A3E J;  1HF0 A;  2EZH A;  2GBY A;  5EG0 B;  3JRG A;  2DG7 A;  2EZI A;  5F0F A;  3SDG A;  3BRU A;  3E7Q A;  3TW7 A;  5F08 A;  3G1M A;  2HOA A;  1MH3 A;  2JWT A;  2Y31 A;  3TED A;  1K61 A;  1IDZ A;  4JNN A;  4D7M A;  1JUM A;  1JTY A;  3BNI A;  3GZI A;  3GTP J;  5IP6 A;  1NTC A;  1QPI A;  3UKG A;  1ETQ A;  2VPR A;  5M3F J;  5M5W J;  5E3M A;  2YS9 A;  2ZCN A;  4D7N A;  3FK7 A;  2O7T A;  3HDD A;  4IHX A;  3DCF A;  2ZOZ A;  2ELK A;  3GTM J;  2CUF A;  5F04 A;  2WUI A;  2LVS A;  1RES A;  2JK3 A;  1AHD P;  2ID3 A;  3TP0 A;  3GTO J;  5J1R A;  2O8K A;  1E3O C;  2WV1 A;  5C4J J;  3MKL A;  4IHY A;  4M3G A;  4C3I J;  1B8I B;  2R5Y B;  3HTI A;  1I3Q J;  3VW0 A;  2L7Z A;  1ETK A;  4MIM A;  4CGR A;  2ECC A;  1VND A;  2IU5 A;  3HTA A;  3BR1 A;  1P7I A;  2XPV A;  5D1R A;  1TWF J;  2LD5 A;  4D5F A;  2NS7 A;  2O7O A;  2TCT A;  3FKI J;  5EYR A;  2NVX J;  4C2M J;  3RKQ A;  1BA5 A;  2DA4 A;  4X1E A;  2YVH A;  2HQ5 A;  1DU6 A;  4L62 A;  3JSJ A;  4M3E A;  2R93 J;  3MNL A;  2EZK A;  3LSJ A;  2O9L A;  1Z77 A;  4A3K J;  3S15 J;  1ORK A;  1ZK8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...