3BR5A

Crystal structure of the complex of rhodamine 6g bound to qacr(e90q), a mutant of a multidrug binding transcriptional repressor
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
186
structure length
184
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKSEQIKCKTNREKFYLYNELSLTTQYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator qacR
publication title Formal electrostatic interactions do not govern QacR-cation affinity
rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 77
structure length 184
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2007-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3br5A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3br5A02
3DPJA 2XGDA 4A3IJ 3BQYA 3GTMJ 5M3FJ 4JL3A 2R0QC 4BXXJ 4XICA 3EUPA 2HQ5A 2MW8A 2KT0A 3LHQA 1RETA 2FX0A 2R7ZJ 1IV6A 4LOCA 5F27A 3JRDA 1X2MA 2XB0X 3OIOA 2LFBA 3HE0A 5FHPA 3GTLJ 1QPIA 4ICHA 2XPVA 1W0TA 2PMZN 3O60A 4L5EA 2G3BA 5J1UA 3BTLA 2R5YB 4X6AJ 5HAWA 2XRLA 3CWRA 1ETOA 3ON4A 2M8GX 1BL0A 1MNMC 3D1NI 2D5VA 1SANA 3RZOJ 2NX4A 3VOKA 2L9RA 1TWGJ 3A02A 4I76A 1ZKGA 2LK2A 1NTCA 2XGCA 3LSGA 3OSFA 1RKTA 3RZDJ 2DA3A 3ZQIA 4XIDA 1LE8A 3LSRA 2LKXA 2UXPA 4A3FJ 3TP3A 5JLWA 3IH3A 3LSJA 3B81A 4A3GJ 3S1NJ 3JRBA 1P7IA 2Y9ZA 1FIAA 1OJLA 1HOMA 3S1MJ 2NVYJ 1T56A 3VIBA 2DMTA 2K9NA 3SJMA 3HM5A 3CJDA 1FTZA 3CDLA 2OF7A 3Q0UA 1ETWA 3MN2A 3CMYA 3M3YJ 2MSYA 1TWHJ 4HNVA 5IP9J 3HKZN 4XRSA 1BW6A 4ME9A 1Y1VJ 3BRUA 1ZK8A 1JJ6C 2XPWA 5HBUA 1K83J 3O8GA 4M3DA 3LOCA 1A5JA 5CW8A 4GCKA 2DA6A 2CU7A 5JLXA 3PM1A 3ZQCA 5C4XJ 2EQRA 9ANTA 3KKDA 1TWCJ 3DEWA 3G1OA 4JYKA 4JX5A 1Z77A 3ZQGA 1B72A 3BTCA 3T6NA 1R9TJ 1ZR4A 3TEDA 2G7SA 4M3BA 2R5YA 3G1MA 1MBFA 2LVSA 1JGGA 2JA6J 3HTHA 3JRFA 1U9OA 2EH3A 1G2HA 2L7FP 4A93J 3CCYA 3E7QA 3JRIA 2YUSA 1DU6A 2HDDA 3VVXA 3GTKJ 1I50J 3S5RA 2COBA 5EDNA 1O4XA 3RQIA 1OCTC 3FK7A 3PPBA 5CXGA 2ECBA 5FGLA 2YVEA 3H0GJ 3JRGA 2NOGA 3OSGA 5EF6A 4AF5A 4MLOA 3HDDA 2F07A 1IDZA 2DJNA 4D7NA 2AHQA 4FCYA 3AQTA 5E3MA 1VF9A 3BG3A 2KDZA 3S1RJ 3V6GA 3BR3A 3VVZA 3OOUA 3S17J 2TRTA 2VPRA 2WAQN 2CJJA 5HSZA 5J1YA 5F04A 4DYRA 1FEXA 3FK6A 1AKHA 3KKCA 3ON2A 2EBIA 3G1LA 1JUSA 2EZLA 3QPLA 1Y1WJ 2QTQA 2LR8A 2XSDC 5BNGA 5DTDA 5IOZA 2Y30A 3TW6A 3S2DJ 2IU5A 4PXIA 1UG2A 1QVUA 2ZB9A 1E3OC 1LE8B 1IUFA 3K2AA 1JUPA 2ECCA 4DYCA 2JA7J 5DAJA 2NVXJ 2QCOA 2ZCMA 3BG5A 3PO2J 2G0EA 2H1KA 2HYTA 2ID3A 5FKNA 3GTPJ 3RD3A 2JA5J 5EEAA 3HTJA 1IJWC 2DMPA 2FBQA 2CRGA 2GUHA 3G7RA 5M5WJ 1HDDC 2Y31A 5F1JA 2E19A 4G12A 4QSHA 4B4CA 1RKWA 5IOYA 2HXOA 4B3AA 3F0CA 4IHXA 1FTTA 3VW2A 4C3JJ 3NPIA 2DA2A 2LY9A 2X6OA 2V57A 2E2HJ 3Q0WA 3IV5A 3NARA 1JKQC 2WB1N 2X9DA 1Z0XA 2WGBA 3QPSA 2DMQA 3HGYA 1B72B 1PUFA 4FTHA 1VI0A 4AC0A 3SFIA 3NAUA 5CXIA 1MBHA 4ABZA 2JN6A 3VPRA 5D19A 3S16J 1TWFJ 4JX4A 5M5YJ 1YRNB 5FLVA 5C4YA 5HODA 5FKOA 1H8AC 4IHVA 3WHBA 5J1RA 1JTXA 5K7ZA 5IYDJ 3IUVA 4M3EA 5D1RA 1QRYA 4UDSA 2AO9A 3LJLA 2HI3A 3B6AA 5EG0A 4GCLA 5EYRA 2EZHA 4I6ZA 3HOVJ 2ZOYA 2DMUA 4CGRA 2Y2ZA 2CQQA 4JKZA 1WH7A 3DCFA 3LWJA 4M3FA 3BR1A 4W1UA 1ZGWA 3O8HA 4MXMA 2JMWA 2XDNA 3BTIA 1P7JA 1AKHB 2JWTA 4RBOA 4MIMA 1HDPA 3JRHA 4BY1J 3VVYA 3EGQA 3FIWA 2RHAA 2Q24A 1I6HJ 2GLOA 4XRMA 1K61A 2DA5A 4NELA 2LP0A 2D6YA 1RESA 5DS9A 1JT0A 2JA8J 3BNIA 3K7AJ 4DW6A 4GFLA 2XPUA 3VOXA 2PBXA 2B63J 2DG8A 4MK6A 2G7GA 4GFBA 1WGXA 5IPAA 1BJZA 3B6CA 2XGEA 2QOPA 3I4MJ 1JKRC 3JSJA 4KWAA 5F0FA 2REKA 2QWTA 3LSPA 1ZR2A 5AQCA 2Y0SN 1SFOJ 1MH4A 2HOTA 1YRNA 1JT6A 2FD5A 3S2HJ 1ZTRA 2K9QA 3BTJA 1B8IA 2VKEA 2RAEA 1LFUP 1D5YA 2NVQJ 2MGQA 1GVDA 2CUFA 4AUXA 3QKXA 5GP9A 4NDLA 4DZPA 1PUFB 1GT0C 2HYJA 3VW0A 1U8BA 2ZCXA 2M34A 5C4JJ 2E1OA 1ETXA 2ID6A 3MKLA 3ZQFA 4C3HJ 2RASA 3VW1A 1SGMA 3S14J 2R5ZA 1ENHA 4UUTA 2IEKA 2DMNA 4JP0A 4C3IJ 4EEFG 2UXIA 2L0KA 1JKOC 4S0HB 1DU0A 3NNRA 1WPKA 3HOUJ 5IYBJ 1AU7A 1BA5A 2VUMJ 4AC6A 3I4NJ 1RPWA 3HGGA 3FRQA 4X1EA 5EG0B 2DN0A 2O8KA 1APLC 5IP7J 1VFCA 1MSFC 1X58A 1OCPA 2JK3A 3A01B 2E2IJ 2OI8A 1HLVA 4V2GA 4MFDA 3E7LA 3S1QJ 5IP6A 2O7TA 4FISA 1UI6A 2ZOZA 3V78A 2GFNA 3ZOBA 1FIPA 5K7HA 3HOXJ 3UKGA 2NVTJ 5E3OA 1HF0A 4B1RA 2O9LA 1AHDP 2HOSA 1A6IA 1F36A 2VKVA 3AQSA 2LD5A 5F0HA 4A3KJ 2NP5A 3GTOJ 4A3DJ 3G56A 3HB9A 1JKPC 4D5CA 3QQAA 2DG7A 2ELKA 4A3CJ 1ETYA 2MG4A 3ZQLA 1XG1A 2K40A 1LFBA 3C07A 2W48A 5EZHA 2IAIA 5EGOB 2QIBA 3NRGA 1ETKA 1ETVA 2HOAA 4FE7A 1UMQA 2QF7A 4NN1A 2NS8A 1ITYA 5E3NA 3MNLA 4MFEA 5C3EJ 3ZQHA 3JRCA 3RKQA 3CQZJ 3F1BA 3BR0A 4XRSG 3FKIJ 2PZ9A 3NI7A 2DA7A 3P9TA 3GZIA 2OPTA 1GUUA 3HTAA 4AYBN 3WHCA 2OERA 4JNNA 2DA1A 2FJ1A 3LNQA 4GCTA 3KZ9A 5C44J 4A3BJ 5D18A 2Y9YA 1B8IB 5FLMJ 3MVPA 2XB5A 4V2FA 3TW7A 1IRZA 2WUIA 4L62A 3BR2A 3BJBA 3A01A 2L7MP 1HCRA 2LTPA 1U78A 5GPAA 4BKXA 3H3VK 2WV1A 3VUQA 3IH2A 4CYCA 2R5ZB 3HOZJ 3HOYJ 1S7EA 5FKMA 1U9NA 3L1PA 3BT9A 5GPCA 2P81A 1UI5A 2ME0A 4YZEA 1ETQA 1RR7A 3COLA 2JJ7A 1IDYA 4C2MJ 1TWAJ 1MBKA 2IBDA 2G7LA 1FJLA 4XK4A 3QBMA 3BR5A 5F0CA 1I3QJ 2R93J 4MO7A 2YS9A 4ACIA 2I10A 1MBGA 2O7OA 4Y52J 1T33A 4A3MJ 1UHSA 3HTIA 1JTYA 2GM4A 3IH4A 3PASA 2UXHA 5EGOA 5IYCJ 3RH2A 3BQZA 3TP0A 5FMPA 4RDUA 4IEJA 3HEFA 1X2NA 1MBJA 4IHWA 1BW5A 2M0CA 1MSEC 1H88C 2NP3A 2YU9J 4QIWN 1POGA 2EZIA 4W97A 3NXCA 4UUSB 1ORKA 2K9SA 3Q0VA 4IHYA 1WI3A 3JR9A 1NK2P 4A3LJ 3GTJJ 1MBEA 5EFYA 1XS9A 2FQ4A 2NS7A 1H89C 5M3MJ 1CQTA 2GENA 5FKKA 2M2EA 1JJ8C 4HKUA 2TCTA 3ANPA 5K7FA 2ZCNA 1ZQ3P 3BCGA 3VP5A 2H8RA 2N8GA 4FE4A 4A69C 4D5FA 4QTRA 3JREA 4J19A 3HIMA 5FJ8J 1IG7A 2UXOA 3ANGA 5H9TA 1F43A 1EF4A 3GBGA 4Y7NJ 5M5XJ 2QKOA 1WH5A 5FKLA 4A3EJ 4M3GA 5K58A 1MH3A 4BBRJ 1WCMJ 5EZGA 3BHQA 4GFKA 1XC5A 2L7ZA 3KNWA 1IGNA 2W53A 2EZKA 2X48A 1NK3P 3GTQJ 1VNDA 5J3LA 1IC8A 3GTGJ 1W0UA 1GV2A 1QVTA 2E2JJ 2R92J 1GDTA 3A03A 2DA4A 2LLKA 2CQXA 3FISA 4CYCB 4DZJA 3CRJA 4BBSJ 2CUEA 4BY7J 2ME6A 3W6VA 3BR6A 1GV5A 2GBYA 2YVHA 3SDGA 4D7MA 4DYQA 1JUMA 4UUSA 3BG9A 4M6VA 1OFCX 2DTZA 4JX6A 3HBLA 3GEUA 5E3LA 1TC3C 2HKUA 3M4OJ 2UXUA 2M9HA 3C2BA 3HOWJ 4A3JJ 3PO3J 1Q1VA 2VI6A 5F08A 3JRAA 3S15J 2HXIA 3Q3SA
chains in the Genus database with same CATH superfamily
1M1EB 3DPJA 2XGDA 4A3IJ 3CJQB 2DQRA 4Y15A 2R0QC 3AL0C 3I64A 4IXAA 2KT0A 1J7KA 2R7ZJ 5CJ9A 2BVMA 1EV7A 3QOEA 5H20A 2NOJB 5DM6F 1KQ8A 2BOLA 1FOXA 5FHPA 2EFPA 4U0VA 4P9FA 3MZHA 4KIFA 3OS0A 4L5EA 4XLPF 2OJED 5J1UA 4CO8A 4ASNA 5HAWA 4AU7A 4I0AA 2K4BA 3K4NA 1F4KA 1MNMC 1MJAA 2M7AA 2D5VA 4RGXA 1JGSA 3ASNH 1MKMA 4ZDPA 1ZRFA 5HS7A 3MMYB 2EWNA 2X0LA 4M9ZA 5D4RA 1GXQA 2XGCA 4CCMA 3OYCA 3OSFA 4XIDA 3RKXA 3VOEA 2BXYA 2X1DA 4KA4A 3MCZA 3TBIA 2E34A 4IRHA 3TP3A 5KNLA 3JTHA 1WZ2A 2DYRH 4A3GJ 3S1NJ 1OJLA 3T1BA 1XMAA 4LGWA 1X19A 1T56A 4MHGA 1FZPB 2DT6A 2DMTA 1EH6A 4Z6YA 2AS5F 2E71A 2E1MC 5FRNA 4GYGA 4IRVA 3CDLA 3HSRA 3WODF 3S93A 2R7DA 4EM2A 3EYYA 5AIPA 2F6CA 3EQLF 4RM2A 4XRSA 3BLYA 5F1RA 1R1VA 1JJ6C 1ZGJA 3KEQA 2Y0MA 1K83J 5HBUA 1S7OA 1FLIA 3PM1A 3LMMA 3H92A 3G2BA 2EQRA 3V8KA 4LITA 3G1OA 3DEWA 4JYKA 1UB9A 3M1CA 1OR7C 1R36A 1Z77A 2WAFA 3M8JA 1O3TA 2JA6J 4LMYA 2ICWG 1U9OA 3I56I 2EH3A 2L7FP 1IN6A 3CCYA 1E0EA 4OMYA 3F6OA 4B8XA 1UZCA 4FX0A 5TISC 2JQ7A 3VVXA 4CUGA 4ZYGA 1ERDA 1HBXG 3T8TA 3P5JA 1YLFA 5FGMA 2B3WA 2RKHA 3KETA 2D2WA 1TZLA 1Q1HA 1ZLKA 3MD2A 5FGLA 2YVEA 2OBPA 5K5OA 1XX5A 2JRTA 3H0GJ 4LLLA 1IN4A 3HDDA 3ECOA 2F07A 3WTXC 2AHQA 2FBHA 2MABA 3LSMA 3AQTA 1V3FA 1VF9A 3U21A 5E3MA 2MLGA 2KDZA 2P5KA 2VPRA 2KIFA 2XIGA 3OOPA 4HV5A 2ZXWH 2OCCH 5J1YA 4KNYA 2L9VA 2KJCA 2HVQA 5F04A 5KCMA 4DYRA 3F23A 1YS7A 1N77A 1AKHA 4EVIA 1FEXA 5LGTA 2EBIA 4KN4X 4KITB 1JUSA 3SZTA 3ZR8X 2DFIA 1YYVA 2QTQA 3V7RA 1ZG1A 3VSKA 1ZARA 1R1UA 1Y8RB 2L9SA 3S2DJ 4PXIA 1XGOA 2WV0A 2ZB9A 3K2ZA 1FBQA 2KP6A 1IUFA 2FE3A 2L4AA 4DYCA 2JA7J 2NVXJ 1UCRA 1JE8A 3RPQA 5LEKA 3PO2J 2G0EA 4G7HF 2HYTA 2A6EF 2L54A 1TNTA 5K1YA 1IRXA 1IJWC 3C18A 2ZO4A 1P6RA 1W5SA 3G7RA 3RYRA 1LVAA 4LD5A 5F1JA 5LHHA 4YG2F 5IOYA 4DBRA 5E1ZB 4KIBA 2CUJA 1QO0D 2H09A 3AFHA 2DA2A 2K4JA 1RI7A 4F93B 3Q0WA 5AIQA 3N05A 4EJOA 3CLOA 4P5OA 3VFZA 3HL2A 4M71A 2K5CA 1R4NB 2E5NA 3HGYA 3T8RA 2PBIA 3SFIA 5HLTA 3PNVA 1X4OA 2Q1ZB 4RAGA 1HW2A 3NAUA 1X4PA 4XKWA 5CXIA 2F5VA 2RREA 3EPZA 2WBMA 4A6EA 3F22A 1DDNA 5HSZA 2UUZA 4M73A 3N4MA 4ETSA 3S16J 2VJJA 2H8WA 2KDOA 5D5XB 1N78A 3I0TA 5C4YA 5HODA 1IAWA 2UXNA 1HC8A 4RLFA 4XKVA 3E6BA 2IA0A 5EG0A 4ZDOA 3LJLA 2LREA 2DBBA 3HOVJ 2O8XA 1BR1A 2FOWA 3A1YA 2DMUA 4ZTJA 3QODA 1HKSA 4PCQA 1WH7A 1WJCA 3ELKA 3BR1A 4M3FA 1ZGWA 4BHCA 1E3HA 1I1SA 2L5QA 1AKHB 4U7BA 2VQCA 2P7VB 4MIMA 4YIRX 4FASD 2UZKA 1ONVA 3E5QA 1I6HJ 4AVPA 3KX2A 1RC9A 3E1SA 3TO9A 4PGHA 1H9GA 1FNNA 1BM9A 2JA8J 1OYWA 3C2HA 1WJEA 3TDUC 4GFLA 2XPUA 1MNEA 4PK4A 3VYTB 3GFMA 2PBXA 1T95A 4XLCA 2WY8Q 2Y75A 4IX7A 2VJ5A 2KRCA 3LQRA 3QPTA 5H6QA 2PEXA 1YE9A 1ZAOA 2QOPA 2KRHA 3JSJA 4KWAA 4TV7A 3U1KA 4A2UA 5DD4A 5DV5A 3CMAI 1ZR2A 2F48A 3REOA 2GOXB 2LF7A 2ELJA 4BYYA 5J6XA 1QZEA 1D0YA 4N9IA 2K9QA 1W7PB 4AWXB 1O3RA 5JVTA 1P4XA 2ZBKA 5FB2A 2PMUA 1HKTA 3PUBA 1GVDA 3RTRA 4E7JA 4ZDLA 4NDLA 2HYJA 3TGNA 4QWQA 4BJTA 4BL0B 3OIQA 3GYHX 1ETXA 2ID6A 1TQPA 1YG2A 3ZQFA 3QRFF 3H0DA 1SGMA 2R5ZA 1ENHA 4UUTA 3J80K 4WX9A 4CZZA 3RPUD 2CV1A 2Y0SA 1CGPA 4IRGA 5E17F 3MKYB 2UXIA 3P9KA 6PAXA 4S0HB 3NNRA 2B7EA 3CP2A 1SD4A 3OR1C 1FOKA 3MWMA 3F72A 1RPWA 3HGGA 4OU0A 5EG0B 3IWZA 1GLNA 1QGPA 5DUKA 3FXKA 2LG4A 3DEEA 3A01B 1OCPA 5HOOA 3FZVA 3DQVC 1HLVA 1O7LA 2ZOZA 2O7TA 4FISA 5ICCA 3RSNA 3V78A 2EB7A 3LSKA 1FIPA 2DPUA 3HOXJ 1IN5A 2ZCWA 5A2QZ 1OLTA 4II3A 4AIKA 3ZRGA 4BE2A 3WU2C 2BZTA 1XSDA 2HOSA 3CC2I 2LD5A 2NP5A 4ESBA 3GTOJ 3HB9A 3F3XA 1YS6A 1VQ4I 1KYZA 1SFKA 3PL8A 3QQAA 4B09A 5HS9A 2DG7A 2IW5A 3IKTA 5D5VB 3DKXA 4A3CJ 1ETYA 1IXCA 2MG4A 3ZQLA 1XG1A 3NWSA 5EZHA 2IAIA 4MQVA 1X1BA 1QZYA 1V4RA 2QF7A 4O6JA 1FSHA 4RGRA 3HTUA 5E3NA 3M8FA 2MH2A 1Z91A 3RKYA 1S7AA 4PUSA 4ANJA 1K7AA 1I5ZA 4XKBA 3GZIA 3WTVC 2DPDA 1GUUA 3HTAA 2AQEA 4JNNA 4GCTA 1OCZH 2IT0A 3KZ9A 3H5RA 3TMOA 3FHZA 5FLMJ 4A5MA 4L0YB 4BS9A 2XB5A 3G71I 3W3CA 1W36C 2FMLA 2KIMA 3TW7A 2WUIA 2XF6A 3HG9A 2LTPA 4RB1A 1LVKA 5GPAA 2OTJI 2VC0A 2K3FA 4S05A 3H3VK 3LA3A 1ZH5A 4WIBA 3IH2A 1K4TA 2R5ZB 1D1AA 1X3UA 3ASOH 3K4CA 1U9NA 4U7DA 1RR7A 3W2AA 4AYBA 3D5SC 4LG3A 3T5XA 3FKJA 2G7LA 3I53A 1J5YA 2A05A 3QBMA 1VQOI 2R93J 3J81Z 4CXFA 2VL8A 2HQAA 1T38A 4CCJA 1A36A 2K27A 2ZSHB 3LA7A 2AXTC 2GM4A 3ZN1A 2UXHA 5IYCJ 3BQZA 3L2VA 4HQEA 5HVQC 3MAJA 1SFEA 3E6MA 2OU2A 4BQNA 4HSTA 3AKZA 4FX4A 3BJAA 1MSEC 1W1WE 3OYKA 1R5HA 3IUOA 3NXCA 4IVNA 1HQCA 1ORKA 2HYFA 4OMZA 1V54H 1TTYA 3Q0VA 3DU6A 4UV8A 1FYLA 4UY8I 4PGGA 1QHGA 2QYOA 4HX7A 2EIMH 3CC4I 2EFWA 3L2UA 2YVXA 2FQ4A 2NS7A 4G6QA 5BS6A 2W57A 1X3ZB 4MNUA 3GVAA 2XGXA 4IPAA 4QPOA 2GENA 1Z6RA 1E2XA 2M2EA 4HKUA 4P1WA 4C30A 4BHPA 3ANPA 2V1UA 5DEQA 2ZCNA 2ZMEA 2GIZA 1ZQ3P 3S3OA 1RZ4A 3FXJA 4F52A 2XC7A 3BCGA 5CVUA 1OPCA 3PSFA 4J19A 4FE4A 4A69C 1VQ9I 4ZH4F 1U5TC 4P96A 3DTIA 5KHDA 5LBQA 5FKLA 4M3GA 2XAFA 3TKYA 5EZGA 4GFKA 3KLOA 1XC5A 3QU6A 2JVGA 3DWLE 2CQKA 1KQ9A 2A3SA 1NK3P 1VNDA 2V4JC 5HDGA 1J59A 1YOVB 2E2JJ 2BE5F 5CKTA 1GDTA 1UHWA 3F8BA 1KZHA 4CSWA 4YIFA 3CRJA 1KONA 4BY7J 3GFIA 2W00A 3KFWX 4D7MA 3DF8A 3ZMSA 1JUMA 4UUSA 3BG9A 4M6VA 2V1DA 2P8TA 5LHGA 1XGMA 3RDIA 4MTEA 3KP2A 5E3LA 1AA7A 4J00A 3WG7H 3AAFA 2IS6A 4A12A 3OL4A 3HUGB 3VB2A 1YW7A 4A3JJ 1S9HA 3PNYA 5TRDA 4ZYDA 3Q3SA 1VQ7I 2XRNA 1Z3XA 5L3DA 4QPQA 4JL3A 1CF7A 4ZC3A 3QYBA 4XICA 2HEOA 3CJNA 3LHQA 2FX0A 3FXMA 3DPTA 3IAS2 1WFXA 3JRDA 3ESWB 3R6SA 4N0BA 3OIOA 1B59A 4D0PA 3HE0A 2O5RA 3GUDA 1UELB 2DTRA 2GIVA 3QP6A 4EM1A 1W0TA 3CTAA 3K6GA 1WKMA 3U1DA 3O60A 3KP4A 1DQUA 1Z67A 2W25A 2O6GE 4CCNA 4L9TA 2NRAC 4HDUA 2R5YB 4II2A 4NHJA 4X6AJ 1ETOA 4LLGF 3ON4A 4WXHA 4L0ZB 4G7OF 2K85A 4E7HA 1BL0A 2QQBA 3HZJA 2ZMEB 3D1NI 4GCVA 2NX4A 3AG1H 3VOKA 4PFPA 2IS4A 2GA2A 1RIOH 3D5LA 4B3XA 4I76A 3RZDJ 2W1OA 3CDHA 2DA3A 3ZQIA 1OR7A 2EFOA 2GXGA 3HXLA 3LSJA 3B81A 4CGZA 1FIAA 3S32A 5DM7F 1O3QA 5L3BA 3AL0B 2V9PA 1BOBA 1Y56A 3SJMA 2A5WA 3PQKA 4NB5A 3HM5A 3CJDA 1KU3A 2LF8A 2XDVA 2M7BA 2VOPA 5LLQA 1SVOA 2E36A 1BR4A 2MSYA 4XLNF 2WY7Q 1ZK8A 2ZXJA 2XPWA 5J4YA 3GEZA 4G9YA 3V42A 1BN5A 1S6LA 3O8GA 3OYHA 1YITI 3LOCA 3FHNA 2LNBA 4LJZF 5CW8A 2HNHA 5JLXA 4KISA 3GX4X 4N9HA 1EH7A 9ANTA 3KKDA 3JCUC 1P4WA 2E1NA 1PP7U 5HS8A 3TO7A 3BTCA 2CQ7A 3H35A 3DU5A 2LVSA 3BCBA 4BE1A 1JGGA 2LY2A 3JRFA 3EYIA 5LGUA 3PQJA 1CF7B 2DOEA 3QOPA 3GTKJ 4R79A 3HSEA 1O4XA 3PPBA 1R5GA 4BXUA 2R7RA 2V26A 3K4BA 1XD7A 3DLAA 2NOGA 3PFIA 4YRVA 3OSGA 4AF5A 1IDZA 4AVZA 2STWA 3BG6A 1J0RA 2XVCA 4FT8A 3BG3A 3BR3A 1P2FA 5KK1A 4XL9A 2HPIA 1TW3A 4A0ZA 1Y0UA 3GW2A 3KKCA 2L02A 2LKPA 3MZ8A 1Y1WJ 1B1BA 5AONA 2XSDC 3F8CA 3KEYA 1ON2A 4RB2C 1S3JA 2ZMEC 5E18F 2K02A 4XONA 1UG2A 1E3OC 4NNJA 1U8RA 3O3KA 1JUPA 2K9LA 2L7KA 1V55H 2W24A 2CV0A 3FM3A 2AXLA 1BI0A 3SDBA 4PJJA 5F6FA 2H1KA 4EQQA 1EJ9A 1REPC 1L0OC 5EEAA 2CRGA 2GQQA 3J7AO 1FC3A 1HDDC 2IP2A 2P7CB 2E19A 4HRIA 1RKWA 2CW8A 4HEA2 3LSIA 5H6RA 1GHCA 4U0YA 1FTTA 4C3JJ 4OIRF 2LY9A 2DU9A 3D0SA 2DI3A 3K8PC 2E2HJ 3KLNA 2E7XA 1ZG3A 2WB1N 2X9DA 2DT5A 3CF2A 3K4JA 3L9FA 3CMEI 1ZYRF 3FMSA 2DMQA 3SYTA 3HRUA 4AC0A 2YX4A 3DKWA 2RV8A 2GZWA 1R4MB 2BY3A 4ENMA 1U3EM 2XSJC 3AG4H 1YX5A 5J4VA 4G6TB 2HFHA 2B0LA 3OS2A 4XLFA 5IYDJ 5J1RA 2RNGA 5IT9Z 3FF5A 2HZTA 4M3EA 5D1RA 1QRYA 1SAUA 4GCLA 5DDGA 3B6AA 1X1AA 2Y69H 3ML6A 4O5VA 5EYRA 3JSOA 4XN3A 5L3GA 3JAMZ 4PSXA 1OMIA 1U6GA 4IZZA 4HQMA 2NS0A 2OD5A 3ZMDA 3LWJA 4H0EA 3HSFA 4ZJZA 4M6XA 3GMEA 5BOXA 3BTIA 1E17A 1P7JA 2HOEA 2ISZA 3BG7A 3QAHA 4O3MA 1FBUA 3IHUA 2MFZA 3UNGC 4RA2A 2A07F 2I8DA 1R1TA 1Z1DA 2FQ3A 3L2RA 2RHAA 2A6TA 3O2PE 2CV2A 2Q8KA 3K9TA 1BC7C 3GLXA 1Z21A 2FEZA 4XRMA 1K61A 2IA1A 2DA5A 3HYIA 4KUMA 1G59A 2RGVA 3B73A 1RRJA 2DT7B 4I99C 5DS9A 1TT0A 4G7ZF 1Y39A 1JT0A 4DW6A 4WF2A 2BY1A 2B1EA 1IXRC 1ZN2A 1XSXA 2DG8A 3COAC 1D0XA 3CF5F 5L3CA 2G7GA 1SD7A 2OAZA 1WWXA 1BJZA 2OV7A 3HTSB 2KL4A 2HYGD 2FBIA 2Q0OA 3VSLA 1Y6IA 3F9KA 5F0FA 2REKA 3LAJA 3BCAA 2R7QA 2Y0SN 1MH4A 2YSRA 1SFOJ 2M87A 3S2HJ 4HBLA 2M0MA 4HAMA 1B8IA 3DP7A 1G8XA 2VKEA 4ZYHA 2X6WA 5F64A 5ED4A 1SFUA 1D5YA 2NVQJ 3L2CA 3I5UA 2ZJ2A 1XGNA 5GP9A 4DZPA 4BE0A 3S3NA 1GT0C 3QKXA 4F92B 1U8BA 2ZCXA 1WRJA 2M34A 2XKOA 2LBFA 2QUFA 2E1OA 4XM3A 5C4JJ 1ZG5A 3D5RC 3S14J 3ONQA 1XB4A 2CO5A 1A35A 3ISPA 4CHUA 2KRFA 2ACJA 1MD0A 2L0KA 1JKOC 4HG2A 3W2VA 1DU0A 1WPKA 1P4AA 3HOUJ 1F1ZA 1BA5A 2VUMJ 4I01A 4AC6A 4IKFA 2J5OA 2ZFWA 1XSVA 2FU4A 3W2WA 4I09A 1APLC 1VFCA 1MSFC 2FBKA 5JR3A 2IRFG 4BJ5C 3A2KA 1BC8C 3ZCOA 3R61A 2HWVA 2DK5A 5DD8A 3ZOBA 2GFNA 3EETA 1RR8C 1VQ5I 1FPQA 3UKGA 2NVTJ 3K0LA 1I6XA 4Y13A 3LQQA 1T39A 1AHDP 1F36A 3IRQA 2VKVA 2QZ8A 4A3DJ 2IS2A 3LFKA 4GYIA 1JKPC 2GAUA 1W7PA 2JVHA 2BVLA 3C2GA 4L9VA 1B4AA 4OIPF 3K4LA 5A2QK 2K40A 3TO6A 4C2UA 3C07A 2V9VA 4EJVA 2VKDA 1OCCH 5EGOB 4N4NB 3NRGA 2W84A 2MH9A 4ZZLA 2BBYA 2HOAA 3K69A 3WU1B 1UMQA 1H9TA 4N4OB 2XV4S 1LEAA 4A0XA 3MNLA 4MFEA 4OIQF 3ZQHA 4L5JA 3JRCA 3RKQA 3CQZJ 3F1BA 3FKIJ 4DIQA 2DA7A 3P9TA 2OPTA 3KCCA 5BQTA 3SZGA 4AYBN 2JSPA 2OERA 2DA1A 2D45A 4XR6A 4AM3A 2WB1A 3RKWA 2Y9YA 1B8IB 3VWBA 2KQRA 2QLZA 4L62A 2ELHA 1G4DA 2VXDA 3A01A 3J7ZI 2OUMA 1X3WB 3DV8A 3PSIA 3I54A 2LBFB 2MA3A 2IVMA 4UV9A 2WV1A 1K4SA 3VUQA 5TJJA 4RMNA 3SQNA 2HU9A 4G6DA 4HOBA 2A6HF 1Z7UA 3BT9A 5GPCA 1SVMA 2P81A 4YZEA 1ETQA 4C2MJ 1IDYA 1MBKA 3S2WA 1ULYA 2QENA 3WE3A 1FJLA 4XK4A 2CMPA 5FFXA 1HKQA 3BR5A 3MEXA 4HX4A 4GXOA 2YS9A 2PLYA 4ACIA 3MKZA 5E8GA 3KP7A 2L3DA 4A3MJ 1I3AA 5TGTA 3FXOA 2EV6A 1KA8A 3LSTA 4BGDA 2ZSIB 5HDNA 5DUIA 3EDPA 1R5ID 4RDUA 4IEJA 1U5TA 3HEFA 5HLHA 3J81K 2I5UA 1BW5A 2BHZA 4H4KC 1K78A 2K86A 1H88C 3ZN0A 1NH3A 1VTNC 1POGA 4LK1F 4KMFA 3ERMA 4IHYA 4GO1A 1WI3A 3M7GA 1YW9A 1IXSB 2FJI1 4EJWA 3BROA 3PFYA 3RI4A 1SVLA 1U0JA 3TQNA 4G94A 2EK5A 1C0WA 1CQTA 4XLHA 4MEXF 1S29A 2TCTA 4DGWB 2M3AA 2PMHA 3GF2A 1T98A 1V5FA 2JUCA 2N8GA 3JREA 3PUFA 1TBXA 5FJ8J 1IG7A 3F6VA 1F43A 2QKOA 4Y7NJ 5M5XJ 1WH5A 3T0YA 2R7OA 4CCOA 4A3EJ 5ERIA 2V79A 3F8NA 3FXUA 2E1CA 4U87A 4XSXF 4BACA 2EV5A 1IGNA 4FETA 2X1CA 2QKLB 2A2FX 2W53A 3H9QA 4G8XA 4HZFA 2D1VA 1J2XA 2P6TA 1W0UA 4E4HA 3CC7I 2VT2A 5LHIA 1TQIA 4BQQA 3A03A 4I7HA 2LLKA 1XMXA 2GXBA 2DDBA 2FXAA 2XF7A 3BJ6A 3FBIB 2CUEA 2ME6A 3BR6A 1GV5A 5HNFA 3WU0A 3ZQQA 3OS1A 1ODDA 2K9MA 3HBLA 1BIBA 2XAUA 1NHAA 3C7JA 2HKUA 2M8EA 3P9IA 1LNWA 4I98B 2YU3A 2KPMA 1VQKI 1MGTA 1T0FC 2DOFA 1FX7A 3PO3J 3ZGKA 2E5ZA 2HXIA 1I1GA 2F2EA 1L3LA 4CYDA 4EATA 1U5TB 2LH9A 3KYDB 3BQYA 2W82A 4BEHB 4BXXJ 1K78B 4MGRA 2ZJPF 1G3YA 1RETA 5GADJ 3BWGA 4UNOA 4LOCA 5F27A 1X2MA 2XB0X 3K4KA 4U0WA 3I55I 3PNTA 3MFKA 2NXNB 4DOZA 4BUPA 3NQOA 4ICHA 1G3SA 2DK8A 2EA2A 4AIHA 2OQRA 2XPVA 2M1BA 5FD6A 5K5QA 2A68F 1R7JA 2M45A 3HOTA 1XN7A 3LSHA 2VQLA 2XRLA 4UXNA 4UB6C 2M8GX 1BBYA 1ZLJA 3IP4B 2VPLA 1SANA 2C6YA 1PP8F 1DPUA 5DCMA 3DPLC 3NRVA 1ZHFA 1LDDA 2RVCA 4JBAA 1YIJI 3A02A 1ZKGA 2LK2A 3LSGA 3K10A 2ZJRF 1RKTA 3K70D 2KMUA 1HW5A 1LE8A 3LSRA 5FD5A 2FF4A 2QQAA 5FRMA 2UXPA 2PMZA 2H1LA 2VBZA 4A3FJ 3QU3A 2ESHA 2IJLA 3IH3A 5FFZA 5JLWA 4IRIA 3JRBA 1P7IA 2R3SA 2Y9ZA 2OZ6A 1HOMA 3IAM2 3Q5FA 2DCEA 2NVYJ 4XRFA 3G6EI 3WTYC 3HUGA 3ERED 2ZJQF 1QHHD 1R23A 1F9NA 2K9NA 4ENNA 2MD5A 3QYFA 4HSRA 1ZRCA 5GAGJ 2KHMA 2QM3A 2QKMB 2OF7A 3Q0UA 4XQFA 3DFGA 1KU2A 3MN2A 3CMYA 1X1PA 3M3YJ 1TWHJ 4HNVA 4WXCA 1BW6A 1YIOA 3WGHA 4ME9A 1FYKA 1ON1A 3BDDA 4KFCA 1PYVA 1BI3A 4M3DA 1A5JA 4GCKA 3CD6I 2DA6A 1S72I 2LRDA 2GWRA 5C4XJ 1TWCJ 1J75A 1B72A 2GOMA 3PJRA 3R4KA 4M3BA 2R5YA 4B44A 3HTHA 2XASA 2VE8A 3E7QA 3HKZA 2ZKZA 4Q48A 5H2FC 3I59B 3PIOF 4FQGA 1BI2A 2COBA 3S5RA 3OYLA 1OCTC 3FK7A 2XKPA 5CXGA 2E35A 5KVRA 4HV6A 3ABTA 3GZ6A 2HKXA 3OR2C 1GXPA 2CWEA 1HSJA 1MMGA 2KZVA 4MLOA 2VXZA 4XKCA 1BIAA 2KKOA 1J9IA 1A31A 2FMYA 1X1CA 4OAYA 3S1RJ 3VVZA 1J09A 5L3FA 3RJPA 1ZELA 3NS4A 5LGNA 3BP8A 2CJJA 1RUNA 1MMSA 4XLAA 2Y48A 3JTGA 3FK6A 3WTTC 3BOQA 5D8LB 1X1DA 5DCMB 3OL3A 3G1LA 5CVIA 2ZNYA 2EZLA 1JXSA 3ON2A 5CPRB 4DBQA 4S04A 4B47A 2LR8A 4I0BA 4ZYAA 1D3YA 2Y30A 4F3QA 2R7VA 1A6QA 1QVUA 4C9YA 4IHTA 2G7UA 1YJWI 1LE8B 2PG4A 4RAZA 1B9NA 1D1CA 3W6JB 4OD4A 2QCOA 2ZCMA 3BG5A 4RB3C 2ID3A 3GTPJ 3RD3A 2WAQA 2DMPA 1QA6A 4UUVA 3BZCA 4IJAA 3ECHA 3WGGA 1V5EA 4IO9F 3FXQA 5E8IA 4LIUA 3HPGA 5CVVA 2V9KA 4UVBA 4B4CA 5BMZA 2HXOA 3B02A 4DVYP 4IQJA 4B3AA 5D5WB 4IHXA 5JFRA 2JT1A 4IOAF 3ABKH 3NPIA 4CZCA 4NC6A 3NARA 2PFBA 1W4MA 4IHSA 1R58A 2HVSA 1Z0XA 4XORA 5EEHA 3HRMA 3QPSA 1B72B 2A61A 3CCQI 1PUFA 4FTHA 1VI0A 2F4MB 3E3VA 2KIUA 3CMMA 2QSGX 1H0MA 3GWZA 2OQGA 2F5FA 3TDZC 1G3TA 2ZNZA 1FWZA 3ABUA 3ULQB 2H6BA 1SMTA 1YJ9I 3VPRA 5D19A 3ZQ7A 1YRNB 1HSTA 3KP3A 4F91B 4ESFA 2R7SA 1OCRH 4ITVA 1IZ1A 1ZGAA 2RQQA 1LKXA 3IUVA 4UDSA 1SAXA 3M8EA 4I6ZA 1R00A 4BU2A 1T2KA 4CGRA 2BGCA 2XAJA 3FMRA 5HNHA 3Q9SA 2RQPA 3EUAA 2XAQA 1YFHA 4W1UA 3LAPA 1SEUA 3O8HA 4MQ9F 5IT9K 2L2OA 3V7SA 2ISYA 2XDNA 3NEUA 1FSEA 2JWTA 4RBOA 1HDPA 4D9JA 3JRHA 3VVYA 5E1WA 3JAMK 4MEYF 1WI9A 2ETHA 1RESA 2E7WA 3QWLA 1TLHB 1VZ0A 3VOXA 3K1MA 1VQNI 2B63J 3CZ6A 3VEPA 2YPRA 2Z1DA 4MK6A 5E79C 3GXOA 5J8CA 1JHFA 1LUJB 1WGXA 2XHKA 3BZKA 2R7UA 3B6CA 2XGEA 1RNLA 3ZP5A 2E60A 2STTA 3I4MJ 1JKRC 1QNTA 3SZPA 4BXFA 5AQCA 4P55A 1SD6A 1JT6A 1ZTRA 3BTJA 4PDKA 2IPQX 2KIQA 3H3ZA 1ZREA 1DPRA 4KJZA 5FLXZ 2RAEA 1LFUP 2FRHA 3JW4A 1IN8A 2MGQA 2CUFA 5ILVA 2HVRA 2LKSA 1PUFB 2AQFA 5LD2C 2EJRA 1XCBA 4XN0A 5KAIC 3H36A 4PJLA 5FROA 4C3HJ 3MKLA 3HC7A 2RASA 2X1EA 3AG3H 1P9QC 3UR3C 2KZGA 2ZFUA 2IEKA 4JP0A 4C3IJ 3CCUI 4EMSA 3X2QH 4EEFG 3GZ5A 2PJRA 4EV0A 3DXJF 3OYEA 1AU7A 1TW2A 3I4NJ 2VODA 3FRQA 1XCVA 2DLLA 2DN0A 2O8KA 5IP7J 3E97A 4M72A 2DW4A 1WJFA 4LFUA 2E2IJ 3KYLA 4V2GA 4MFDA 3S1QJ 5IP6A 3CJRB 3VYUB 2ZXHA 1Z3YA 5CQEA 3HPHA 4UHTA 2W4SA 5GTHC 2WAEA 3H9GA 4B1RA 3I9V2 4GRIA 3G4SI 1A6IA 2BXZA 2FNAA 1UHMA 3AQSA 2PX9A 5F0HA 3G56A 3HIFA 2VONA 1ACIA 2ELKA 2F5EA 1YW8A 1OKRA 2R7XA 1LFBA 3GO5A 1OQYA 4ZZDA 4A6DA 2QIBA 3H3UA 4FE7A 4NN1A 3HHHA 2BV6A 2DDAA 3LFUA 4WXDA 2NS8A 3J7YJ 5C3EJ 4BDZA 3ZPLA 1YQAA 2X51A 3OIPA 1WVRA 2A5YB 1MDMB 4XRSG 3TOAA 4I2OA 2XF5A 4AD9A 2CW0F 3FX3A 3WHCA 2FJ1A 3LNQA 2M4KA 4KIGA 4LG0B 4A3BJ 2JRMA 1EKEA 4E7SA 4LB5A 4XMYA 3DPUA 2EIJH 3FMQA 3QP5A 2Z9OA 1BR2A 3BR2A 3ZMUA 3BJBA 2L7MP 2QVOA 3HRTA 3CCEI 3NWTA 1QZZA 3VDXA 1U78A 3OMYA 3LL7A 2XAGA 1LEBA 1S5LC 2EIKH 2PI0A 4CYCA 3ABLH 3L1PA 4EJTA 1UI5A 1V5GA 2VLAA 2IXSA 2VT3A 3RCOA 1LDKB 2GXAA 3COLA 1TWAJ 2PJRB 1I27A 1R6RA 2IBDA 4I02A 3L7WA 3MQ0A 2DQLA 1K6OA 2ZC2A 3L00A 2O7OA 4Y52J 3OYDA 1VQ6I 1UHSA 2F5CA 3BY6A 1T08B 2QEXI 1DUXC 1JTYA 3CUQB 2O0YA 3IH4A 3WTWC 5EGOA 1YTYA 5B3SH 3GCMA 3TP0A 1N25A 4WWCA 2O61A 3E5XA 2BW3B 1WJDA 3RIRA 3KZIC 4NBQA 1X2NA 4LK0F 1MBJA 2M0CA 1UG0A 4R1HA 2RNJA 4QIWN 3SFZA 2EZIA 1R22A 4CDGA 2VC1A 2K9SA 4LIVA 4HDVA 4HLYA 1LDJA 1FMVA 3FDYA 1FT9A 2WC2A 1WJ5A 4KICA 4ESJA 4BH9A 4U9LA 1YJNI 5M3MJ 2HQNA 2DXIA 2HGCA 2PQ8A 2NNYA 1XMKA 3HHGA 2EILH 3N97A 4UVAA 4HLXA 4KN7X 5FKKA 5BPIA 2HDWA 5K7FA 3E0JB 2VQGA 2BHYA 2J5PA 3U9GA 4E7ZA 1WSUA 2H8RA 3TOBA 4QTRA 3HIMA 3SXYA 4IOCF 4C2MA 1B6AA 3WG9A 1QQIA 3LA2A 1T0FA 4L9JA 5K58A 1MH3A 5K5RA 1WCMJ 4KDPA 3BHQA 3TL4X 3SHFA 2L7ZA 3WGIA 2EZKA 3IRRA 3EUKL 1R71A 1HW1A 1I39A 2H27A 3GTQJ 2V7FA 5J3LA 1IC8A 2EA4A 3ZMTA 2P5VA 1USTA 3DTEA 4BHBA 1F5TA 1HA8A 1TL8A 2R92J 2DA4A 2Z3YA 4EGZA 2CQXA 1KU9A 3FISA 4CYCB 1UFMA 4RM3A 3ROUA 1XTAA 1STZA 2L4MA 4Q5SF 4WK8F 2HTJA 3RYPA 4CH7A 2YVHA 2CFXA 3SDGA 4DYQA 4HX8A 1OFCX 4JX6A 2VKHA 5ICFA 5D6FA 4HA8A 2HR3A 4JOMA 1IUYA 2NVUB 3RPUA 2UXUA 1EH8A 2M9HA 4MTDA 3C2BA 2XUBA 3H5AA 2VI6A 5F08A 3DBLB 1A04A 4PJNA 3ZMVA 3S15J 2H94A 2FUG2 3GTMJ 5M3FJ 3CUQC 2PJPA 3OYIA 2HQ5A 4CA0A 2MW8A 3IWFA 3EUPA 3K1PA 1FOYA 4Y3OA 1IV6A 5DCFA 3BPVA 3DEUA 3QYEA 2PFVA 3EUHC 3IL2A 1T6SA 2YX7A 2LFBA 3GTLJ 3WE2A 1QPIA 3K1NA 2YR2A 4BJ6C 1NG7A 4PJ0C 3CCMI 4EGYA 1FP2A 2PMZN 1MZBA 4YFNF 2VE9A 2G3BA 1Z05A 2G7HA 1YO5C 3BTLA 3R60A 3CWRA 3C1DA 4PSWA 2DOAA 3CCRI 1DP3A 1PUEE 4R8HA 3KE2A 4KT6A 3RZOJ 2DO7A 4KT5C 2L9RA 1TWGJ 2EV0A 1WJBA 5J40A 1NTCA 1UAAA 1KGSA 2OZUA 4DNCA 4NQWA 3OY9A 2LKXA 1WHUA 1BJAA 2KFDA 1MW7A 3BPXA 4EJUA 5HDKA 4XSZF 3VODA 3I4PA 3S1MJ 1YX3A 4Q47A 4F55A 3VIBA 4OD5A 1VQLI 1FTZA 1ETWA 1TP4A 3KIOA 4BEHA 1QU3A 2F5DA 3KZYA 4PZJA 2VBWA 3HKZN 3ZXSA 5IP9J 1Y1VJ 2L9NA 2VN2A 2MC4A 3BRUA 2VJ4A 3DKYA 2JUGA 1W5CC 3OYGA 1K6YA 2JZYA 1MMNA 2CU7A 1G3WA 3ZQCA 1LQ1A 2CH0A 3K4MA 5ICGA 2P5LC 3DLLF 4JX5A 3ZQGA 4YFKF 4CICA 1IRFA 3S8PA 2LSOA 1R9TJ 3IKVA 2R7TA 1ZR4A 4RAYA 3TEDA 3T6NA 2G7SA 2TDXA 3G1MA 1MBFA 4BQAA 1G2HA 4A93J 3JRIA 4U88A 1FP1D 2YUSA 4HF1A 1DU6A 2HDDA 2ZXIA 1I50J 2M4GA 5EDNA 2L01A 4E7KA 3RQIA 5JHFA 5ILSA 3CO7C 5LFAA 2ECBA 3H9JA 2LMDA 3JRGA 3OWTA 1EA3A 2QQ9A 5EF6A 2M30A 1KU7A 3E6DA 4LB6B 2DJNA 5LRRA 4D7NA 4FCYA 2HKOA 2MBFA 2MYSA 4BQOA 2VOOA 3GFLA 3V6GA 3OOUA 3S17J 2TRTA 2WAQN 4ZYEA 1W36D 3P9CA 1FMWA 1W7PD 4XLEA 1TT5B 3QPLA 5GAEJ 1WJAA 2HDCA 2BY0A 2IA2A 3RQ4A 5BNGA 2IGMA 3CCLI 1LPQA 3L09A 5DTDA 5IOZA 3TW6A 2IU5A 1YHQI 2CW7A 2R4GA 3F8FA 5CVRA 2UWMA 3CESA 2W85A 4L5IA 3K2AA 4NQWB 4XBFA 3BC8A 2ECCA 4EM0B 1Z7LA 3O6BB 5DAJA 2BYVE 2VJIA 4HW0A 4Y33A 2QSFX 5FKNA 4AIJA 2LDUA 3KPHA 5E20A 1O3SA 2JA5J 2CUZA 2FBQA 5B66C 1BI1A 3HTJA 2GUHA 2OTLI 5M5WJ 3E6CC 3OV8A 2Y31A 1SFXA 1JI8A 3H5NA 2CG4A 2UXXA 5FO5A 4G12A 4QSHA 4DJAA 1OYYA 4NC8A 3W6KB 2GA1A 1KYWA 3F0CA 3MZYA 3I59A 4RB0A 2WTEA 1JHHA 3VW2A 2CFOA 2WWYA 2D1HA 2VASA 3F21A 3G3ZA 2DFHA 2ESNA 1PDNC 3M9AA 1KQ0A 2X6OA 1LJ9A 1OISA 2V57A 2NAZA 3QPHA 5KAFC 3IV5A 2FSWA 2JPBA 1JKQC 3OYAA 1VQMI 2WGBA 4OWRB 1R49A 5D6EA 1XGSA 3CDIA 3I58A 1VQPI 2LYCA 2BEOA 1IF1A 3GLLA 4HYEA 4ENKA 3CCJI 1FOWA 2BY2A 3R0AA 3DBHB 1MBHA 4ABZA 1Y0NA 2K7LA 2JN6A 2JA2A 4BNCA 3CCSI 2CYYA 4HF2A 2PN6A 3HJEA 3S3MA 1TWFJ 2IGOA 1SD5A 4JX4A 5M5YJ 1QPMA 5FLVA 5FKOA 1H8AC 4IHVA 3WHBA 1JTXA 2EFNA 4A0YA 5K7ZA 2X85A 5D5UB 5LRSA 3A0HC 2AO9A 2HI3A 4FHTA 2EZHA 3P7NA 4M6YA 4RGUA 5EJCA 2RDPA 2FA5A 3M1EA 2ZOYA 2JSCA 2P6SA 2Y2ZA 4E6KG 5LEJA 3L2WA 2CQQA 4JKZA 3DCFA 2VB6A 5IT3A 4HF0A 4MXMA 2JMWA 2KISA 1D5VA 3HOSA 3A4CA 1D0ZA 4M9SA 2JTVA 4BY1J 5EEGA 3EGQA 4BDYA 3FIWA 5ILUA 4A5NA 4P9UA 2O3FA 4ON0A 2Q24A 3ZMZA 2DJIA 2GLOA 4V19K 1TQMA 4F7ZA 2X6YA 2VQHA 2LP0A 4NELA 4E7IA 4CCLA 2VBYA 1SMYF 2D6YA 2B9SA 4J01A 3BNIA 2EPFA 3WTZA 2A69F 1B9MA 2V1XA 3K7AJ 3OYFA 4M9XA 2V6CA 3FWEA 2QBYA 3C3WA 3GFJA 4GFBA 1P92A 3H1CA 5IPAA 1D1BA 1OYIA 3DTKA 2LY1A 3I3LA 3CO6C 2V1NA 1NG6A 4NC7A 5J47A 4RAFA 4YFXF 2HPMA 2QWTA 4L9NA 3LSPA 2CSOA 3A0BC 4PJMA 2HOTA 4ZTFA 1YRNA 2FD5A 3LWFA 4YEJA 2P0WA 2H6CA 2K3PA 4IF4A 4JK1X 1D8KA 3Q9VA 3J80Z 1MJBA 4AUXA 4C2TA 4Y4RA 4D1QA 3VW0A 1MMDA 2Z5UA 4E70A 4HPQA 4Z2YA 3WTUC 2Q2EA 4IQ4A 2XAHA 3VW1A 3V8JA 1MIJA 3R0JA 3GZNB 2Z2SB 1O7FA 3K70C 2DMNA 1RUOA 5GAHJ 5FLXK 2RN7A 3DBRB 2IGNA 1PJRA 2NYXA 3M07A 1DGWY 1E3PA 1GVJA 2V6EA 3SWHA 1IV8A 1LB2A 5IYBJ 3CLQA 3CUOA 1K79A 2F4OB 4X1EA 4ENJA 3F8MA 1IRGA 2LC2A 1QBJA 1XDUA 2IS1A 1X58A 2JK3A 2OI8A 4KYWA 3E7LA 1UI6A 2LOOA 2O03A 2Z99A 1LFPA 5K7HA 5E3OA 3I71A 2QWWA 3VYSB 1HF0A 1IO2A 1VQ8I 2HQRA 2O9LA 1UJ8A 1N75A 3SEQA 2Z33A 1Z9CA 4OIOF 3WTSC 5J8FA 1HXDA 4DQ2A 5JHUA 4A3KJ 4PFOA 4D5CA 3CCVI 2RC4A 2CS3A 1TNSA 3V8LA 2X6XA 3BJOA 2W48A 2QBYB 1ETKA 1ETVA 4L18B 1U2WA 5B5EC 3PIPF 1ITYA 1D8JA 3MKWB 4KMUX 3V4GA 4NUBA 1Y8QB 4E7LA 4Y17A 3BR0A 1S8NA 2PZ9A 3NI7A 1MJ9A 2OC6A 2KLOA 3OYMA 2CQNA 4B48A 3J7AY 1T8IA 3E5UA 4RS8A 3SEZA 5HLIA 4YIIA 5C44J 5D18A 3MVPA 5CVJA 3FBNB 4M74A 4V2FA 2FOKA 2M5WA 3KYCB 4OOIA 5B1AH 1WQ2A 2ADUA 4QLCU 1IRZA 1HCRA 2Q2EB 2MD0A 4BKXA 1Z6TA 3HRSA 2DYSH 3KP6A 4RGSA 3HOZJ 4XNFA 3HOYJ 2EINH 1S7EA 5FKMA 3VTIA 3FM5A 2ME0A 1DGRM 2QQ8A 2JJ7A 4JQFA 2VBXA 4K2EA 5CLSA 2VIXA 4GGGA 5F0CA 1I3QJ 4MO7A 4Q4ZF 1FY7A 3JSPA 2I10A 1MBGA 1T33A 5ICEA 3IC7A 3BZ6A 5JVGF 2OA4A 2X4HA 3OYBA 3HTIA 3PASA 4YELA 3RH2A 4U9NA 1MNDA 2XROA 3OYNA 2MC3A 5FMPA 4IL6C 2DAOA 3CP8A 2DFFA 2JPCA 5B1BH 1IW7F 4IHWA 2NP3A 2Z16A 2YU9J 2R7FA 2CGPA 1MDMA 4W97A 4X0GA 1SC7A 4OINF 3KEOA 4UUSB 2F4IA 5CQGA 1USSA 1MMAA 2HTSA 2WADA 1G6NA 3JR9A 3G73A 2COMA 4LG0A 3KP5A 1OCOH 4XOPA 1NK2P 4A3LJ 3GTJJ 1MBEA 5EFYA 1XS9A 2P4WA 1H89C 1PVEA 3KZZA 3AG2H 2OCEA 3U2RA 1XPXA 1JJ8C 1W5TA 2ZY9A 4WCGA 3V7CA 3VP5A 2DODA 2NNNA 4D5FA 2FNPA 2UXOA 3ANGA 5H9TA 1EF4A 5DYMA 2UV1A 3GBGA 3ABMH 5HLGA 1BOAA 3CJTB 1DP7P 2QA4I 2HZDA 4BBRJ 3OYJA 2IGKA 3KNWA 2E1MB 5CYVA 4HNTA 2QSHX 2X48A 1O57A 3GTGJ 3CUQA 4AIDA 5D8KB 4CCKA 2WA0A 1GV2A 2HS5A 5L3EA 3L2QA 1QVTA 2BW3A 2EFQA 5IY5H 2KJBA 3VYRB 2G9WA 1ZRDA 4DZJA 5E1XA 3EUHA 4UVCA 4LLNA 4BBSJ 3W6VA 5BPDA 2GBYA 1AOYA 1XDSA 4UB8C 4OAZA 1YI2I 1IN7A 2DTZA 3GEUA 5JI6A 4HNUA 3FXLA 4BAYA 2DFEA 1TC3C 2R7WA 1AWCA 3M4OJ 4GDFA 3FXRA 4B43A 1FBSA 4XOTA 3HOWJ 2MLKA 5GTIC 2W7NA 5D4SA 1Q1VA 3JRAA 4RLQA 2QGUA 1FYMA
chains in the Genus database with same CATH topology
3DPJA 2XGDA 4A3IJ 3BQYA 3GTMJ 5M3FJ 4JL3A 2R0QC 4BXXJ 4XICA 3EUPA 2HQ5A 2MW8A 2KT0A 3LHQA 1RETA 2FX0A 2R7ZJ 1IV6A 4LOCA 5F27A 3JRDA 1X2MA 2XB0X 3OIOA 2LFBA 3HE0A 5FHPA 3GTLJ 1QPIA 4ICHA 2XPVA 1W0TA 2PMZN 3O60A 4L5EA 2G3BA 5J1UA 3BTLA 2R5YB 4X6AJ 5HAWA 2XRLA 3CWRA 1ETOA 3ON4A 2M8GX 1BL0A 1MNMC 3D1NI 2D5VA 1SANA 3RZOJ 2NX4A 3VOKA 2L9RA 1TWGJ 3A02A 4I76A 1ZKGA 2LK2A 1NTCA 2XGCA 3LSGA 3OSFA 1RKTA 3RZDJ 2DA3A 3ZQIA 4XIDA 1LE8A 3LSRA 2LKXA 2UXPA 4A3FJ 3TP3A 5JLWA 3IH3A 3LSJA 3B81A 4A3GJ 3S1NJ 3JRBA 1P7IA 2Y9ZA 1FIAA 1OJLA 1HOMA 3S1MJ 2NVYJ 1T56A 3VIBA 2DMTA 2K9NA 3SJMA 3HM5A 3CJDA 1FTZA 3CDLA 2OF7A 3Q0UA 1ETWA 3MN2A 3CMYA 3M3YJ 2MSYA 1TWHJ 4HNVA 5IP9J 3HKZN 4XRSA 1BW6A 4ME9A 1Y1VJ 3BRUA 1ZK8A 1JJ6C 2XPWA 5HBUA 1K83J 3O8GA 4M3DA 3LOCA 1A5JA 5CW8A 4GCKA 2DA6A 2CU7A 5JLXA 3PM1A 3ZQCA 5C4XJ 2EQRA 9ANTA 3KKDA 1TWCJ 3DEWA 3G1OA 4JYKA 4JX5A 1Z77A 3ZQGA 1B72A 3BTCA 3T6NA 1R9TJ 1ZR4A 3TEDA 2G7SA 4M3BA 2R5YA 3G1MA 1MBFA 2LVSA 1JGGA 2JA6J 3HTHA 3JRFA 1U9OA 2EH3A 1G2HA 2L7FP 4A93J 3CCYA 3E7QA 3JRIA 2YUSA 1DU6A 2HDDA 3VVXA 3GTKJ 1I50J 3S5RA 2COBA 5EDNA 1O4XA 3RQIA 1OCTC 3FK7A 3PPBA 5CXGA 2ECBA 5FGLA 2YVEA 3H0GJ 3JRGA 2NOGA 3OSGA 5EF6A 4AF5A 4MLOA 3HDDA 2F07A 1IDZA 2DJNA 4D7NA 2AHQA 4FCYA 3AQTA 5E3MA 1VF9A 3BG3A 2KDZA 3S1RJ 3V6GA 3BR3A 3VVZA 3OOUA 3S17J 2TRTA 2VPRA 2WAQN 2CJJA 5HSZA 5J1YA 5F04A 4DYRA 1FEXA 3FK6A 1AKHA 3KKCA 3ON2A 2EBIA 3G1LA 1JUSA 2EZLA 3QPLA 1Y1WJ 2QTQA 2LR8A 2XSDC 5BNGA 5DTDA 5IOZA 2Y30A 3TW6A 3S2DJ 2IU5A 4PXIA 1UG2A 1QVUA 2ZB9A 1E3OC 1LE8B 1IUFA 3K2AA 1JUPA 2ECCA 4DYCA 2JA7J 5DAJA 2NVXJ 2QCOA 2ZCMA 3BG5A 3PO2J 2G0EA 2H1KA 2HYTA 2ID3A 5FKNA 3GTPJ 3RD3A 2JA5J 5EEAA 3HTJA 1IJWC 2DMPA 2FBQA 2CRGA 2GUHA 3G7RA 5M5WJ 1HDDC 2Y31A 5F1JA 2E19A 4G12A 4QSHA 4B4CA 1RKWA 5IOYA 2HXOA 4B3AA 3F0CA 4IHXA 1FTTA 3VW2A 4C3JJ 3NPIA 2DA2A 2LY9A 2X6OA 2V57A 2E2HJ 3Q0WA 3IV5A 3NARA 1JKQC 2WB1N 2X9DA 1Z0XA 2WGBA 3QPSA 2DMQA 3HGYA 1B72B 1PUFA 4FTHA 1VI0A 4AC0A 3SFIA 3NAUA 5CXIA 1MBHA 4ABZA 2JN6A 3VPRA 5D19A 3S16J 1TWFJ 4JX4A 5M5YJ 1YRNB 5FLVA 5C4YA 5HODA 5FKOA 1H8AC 4IHVA 3WHBA 5J1RA 1JTXA 5K7ZA 5IYDJ 3IUVA 4M3EA 5D1RA 1QRYA 4UDSA 2AO9A 3LJLA 2HI3A 3B6AA 5EG0A 4GCLA 5EYRA 2EZHA 4I6ZA 3HOVJ 2ZOYA 2DMUA 4CGRA 2Y2ZA 2CQQA 4JKZA 1WH7A 3DCFA 3LWJA 4M3FA 3BR1A 4W1UA 1ZGWA 3O8HA 4MXMA 2JMWA 2XDNA 3BTIA 1P7JA 1AKHB 2JWTA 4RBOA 4MIMA 1HDPA 3JRHA 4BY1J 3VVYA 3EGQA 3FIWA 2RHAA 2Q24A 1I6HJ 2GLOA 4XRMA 1K61A 2DA5A 4NELA 2LP0A 2D6YA 1RESA 5DS9A 1JT0A 2JA8J 3BNIA 3K7AJ 4DW6A 4GFLA 2XPUA 3VOXA 2PBXA 2B63J 2DG8A 4MK6A 2G7GA 4GFBA 1WGXA 5IPAA 1BJZA 3B6CA 2XGEA 2QOPA 3I4MJ 1JKRC 3JSJA 4KWAA 5F0FA 2REKA 2QWTA 3LSPA 1ZR2A 5AQCA 2Y0SN 1SFOJ 1MH4A 2HOTA 1YRNA 1JT6A 2FD5A 3S2HJ 1ZTRA 2K9QA 3BTJA 1B8IA 2VKEA 2RAEA 1LFUP 1D5YA 2NVQJ 2MGQA 1GVDA 2CUFA 4AUXA 3QKXA 5GP9A 4NDLA 4DZPA 1PUFB 1GT0C 2HYJA 3VW0A 1U8BA 2ZCXA 2M34A 5C4JJ 2E1OA 1ETXA 2ID6A 3MKLA 3ZQFA 4C3HJ 2RASA 3VW1A 1SGMA 3S14J 2R5ZA 1ENHA 4UUTA 2IEKA 2DMNA 4JP0A 4C3IJ 4EEFG 2UXIA 2L0KA 1JKOC 4S0HB 1DU0A 3NNRA 1WPKA 3HOUJ 5IYBJ 1AU7A 1BA5A 2VUMJ 4AC6A 3I4NJ 1RPWA 3HGGA 3FRQA 4X1EA 5EG0B 2DN0A 2O8KA 1APLC 5IP7J 1VFCA 1MSFC 1X58A 1OCPA 2JK3A 3A01B 2E2IJ 2OI8A 1HLVA 4V2GA 4MFDA 3E7LA 3S1QJ 5IP6A 2O7TA 4FISA 1UI6A 2ZOZA 3V78A 2GFNA 3ZOBA 1FIPA 5K7HA 3HOXJ 3UKGA 2NVTJ 5E3OA 1HF0A 4B1RA 2O9LA 1AHDP 2HOSA 1A6IA 1F36A 2VKVA 3AQSA 2LD5A 5F0HA 4A3KJ 2NP5A 3GTOJ 4A3DJ 3G56A 3HB9A 1JKPC 4D5CA 3QQAA 2DG7A 2ELKA 4A3CJ 1ETYA 2MG4A 3ZQLA 1XG1A 2K40A 1LFBA 3C07A 2W48A 5EZHA 2IAIA 5EGOB 2QIBA 3NRGA 1ETKA 1ETVA 2HOAA 4FE7A 1UMQA 2QF7A 4NN1A 2NS8A 1ITYA 5E3NA 3MNLA 4MFEA 5C3EJ 3ZQHA 3JRCA 3RKQA 3CQZJ 3F1BA 3BR0A 4XRSG 3FKIJ 2PZ9A 3NI7A 2DA7A 3P9TA 3GZIA 2OPTA 1GUUA 3HTAA 4AYBN 3WHCA 2OERA 4JNNA 2DA1A 2FJ1A 3LNQA 4GCTA 3KZ9A 5C44J 4A3BJ 5D18A 2Y9YA 1B8IB 5FLMJ 3MVPA 2XB5A 4V2FA 3TW7A 1IRZA 2WUIA 4L62A 3BR2A 3BJBA 3A01A 2L7MP 1HCRA 2LTPA 1U78A 5GPAA 4BKXA 3H3VK 2WV1A 3VUQA 3IH2A 4CYCA 2R5ZB 3HOZJ 3HOYJ 1S7EA 5FKMA 1U9NA 3L1PA 3BT9A 5GPCA 2P81A 1UI5A 2ME0A 4YZEA 1ETQA 1RR7A 3COLA 2JJ7A 1IDYA 4C2MJ 1TWAJ 1MBKA 2IBDA 2G7LA 1FJLA 4XK4A 3QBMA 3BR5A 5F0CA 1I3QJ 2R93J 4MO7A 2YS9A 4ACIA 2I10A 1MBGA 2O7OA 4Y52J 1T33A 4A3MJ 1UHSA 3HTIA 1JTYA 2GM4A 3IH4A 3PASA 2UXHA 5EGOA 5IYCJ 3RH2A 3BQZA 3TP0A 5FMPA 4RDUA 4IEJA 3HEFA 1X2NA 1MBJA 4IHWA 1BW5A 2M0CA 1MSEC 1H88C 2NP3A 2YU9J 4QIWN 1POGA 2EZIA 4W97A 3NXCA 4UUSB 1ORKA 2K9SA 3Q0VA 4IHYA 1WI3A 3JR9A 1NK2P 4A3LJ 3GTJJ 1MBEA 5EFYA 1XS9A 2FQ4A 2NS7A 1H89C 5M3MJ 1CQTA 2GENA 5FKKA 2M2EA 1JJ8C 4HKUA 2TCTA 3ANPA 5K7FA 2ZCNA 1ZQ3P 3BCGA 3VP5A 2H8RA 2N8GA 4FE4A 4A69C 4D5FA 4QTRA 3JREA 4J19A 3HIMA 5FJ8J 1IG7A 2UXOA 3ANGA 5H9TA 1F43A 1EF4A 3GBGA 4Y7NJ 5M5XJ 2QKOA 1WH5A 5FKLA 4A3EJ 4M3GA 5K58A 1MH3A 4BBRJ 1WCMJ 5EZGA 3BHQA 4GFKA 1XC5A 2L7ZA 3KNWA 1IGNA 2W53A 2EZKA 2X48A 1NK3P 3GTQJ 1VNDA 5J3LA 1IC8A 3GTGJ 1W0UA 1GV2A 1QVTA 2E2JJ 2R92J 1GDTA 3A03A 2DA4A 2LLKA 2CQXA 3FISA 4CYCB 4DZJA 3CRJA 4BBSJ 2CUEA 4BY7J 2ME6A 3W6VA 3BR6A 1GV5A 2GBYA 2YVHA 3SDGA 4D7MA 4DYQA 1JUMA 4UUSA 3BG9A 4M6VA 1OFCX 2DTZA 4JX6A 3HBLA 3GEUA 5E3LA 1TC3C 2HKUA 3M4OJ 2UXUA 2M9HA 3C2BA 3HOWJ 4A3JJ 3PO3J 1Q1VA 2VI6A 5F08A 3JRAA 3S15J 2HXIA 3Q3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DPJ A;  2XGD A;  4A3I J;  3BQY A;  3GTM J;  5M3F J;  4JL3 A;  2R0Q C;  4BXX J;  4XIC A;  3EUP A;  2HQ5 A;  2MW8 A;  2KT0 A;  3LHQ A;  1RET A;  2FX0 A;  2R7Z J;  1IV6 A;  4LOC A;  5F27 A;  3JRD A;  1X2M A;  2XB0 X;  3OIO A;  2LFB A;  3HE0 A;  5FHP A;  3GTL J;  1QPI A;  4ICH A;  2XPV A;  1W0T A;  2PMZ N;  3O60 A;  4L5E A;  2G3B A;  5J1U A;  3BTL A;  2R5Y B;  4X6A J;  5HAW A;  2XRL A;  3CWR A;  1ETO A;  3ON4 A;  2M8G X;  1BL0 A;  1MNM C;  3D1N I;  2D5V A;  1SAN A;  3RZO J;  2NX4 A;  3VOK A;  2L9R A;  1TWG J;  3A02 A;  4I76 A;  1ZKG A;  2LK2 A;  1NTC A;  2XGC A;  3LSG A;  3OSF A;  1RKT A;  3RZD J;  2DA3 A;  3ZQI A;  4XID A;  1LE8 A;  3LSR A;  2LKX A;  2UXP A;  4A3F J;  3TP3 A;  5JLW A;  3IH3 A;  3LSJ A;  3B81 A;  4A3G J;  3S1N J;  3JRB A;  1P7I A;  2Y9Z A;  1FIA A;  1OJL A;  1HOM A;  3S1M J;  2NVY J;  1T56 A;  3VIB A;  2DMT A;  2K9N A;  3SJM A;  3HM5 A;  3CJD A;  1FTZ A;  3CDL A;  2OF7 A;  3Q0U A;  1ETW A;  3MN2 A;  3CMY A;  3M3Y J;  2MSY A;  1TWH J;  4HNV A;  5IP9 J;  3HKZ N;  4XRS A;  1BW6 A;  4ME9 A;  1Y1V J;  3BRU A;  1ZK8 A;  1JJ6 C;  2XPW A;  5HBU A;  1K83 J;  3O8G A;  4M3D A;  3LOC A;  1A5J A;  5CW8 A;  4GCK A;  2DA6 A;  2CU7 A;  5JLX A;  3PM1 A;  3ZQC A;  5C4X J;  2EQR A;  9ANT A;  3KKD A;  1TWC J;  3DEW A;  3G1O A;  4JYK A;  4JX5 A;  1Z77 A;  3ZQG A;  1B72 A;  3BTC A;  3T6N A;  1R9T J;  1ZR4 A;  3TED A;  2G7S A;  4M3B A;  2R5Y A;  3G1M A;  1MBF A;  2LVS A;  1JGG A;  2JA6 J;  3HTH A;  3JRF A;  1U9O A;  2EH3 A;  1G2H A;  2L7F P;  4A93 J;  3CCY A;  3E7Q A;  3JRI A;  2YUS A;  1DU6 A;  2HDD A;  3VVX A;  3GTK J;  1I50 J;  3S5R A;  2COB A;  5EDN A;  1O4X A;  3RQI A;  1OCT C;  3FK7 A;  3PPB A;  5CXG A;  2ECB A;  5FGL A;  2YVE A;  3H0G J;  3JRG A;  2NOG A;  3OSG A;  5EF6 A;  4AF5 A;  4MLO A;  3HDD A;  2F07 A;  1IDZ A;  2DJN A;  4D7N A;  2AHQ A;  4FCY A;  3AQT A;  5E3M A;  1VF9 A;  3BG3 A;  2KDZ A;  3S1R J;  3V6G A;  3BR3 A;  3VVZ A;  3OOU A;  3S17 J;  2TRT A;  2VPR A;  2WAQ N;  2CJJ A;  5HSZ A;  5J1Y A;  5F04 A;  4DYR A;  1FEX A;  3FK6 A;  1AKH A;  3KKC A;  3ON2 A;  2EBI A;  3G1L A;  1JUS A;  2EZL A;  3QPL A;  1Y1W J;  2QTQ A;  2LR8 A;  2XSD C;  5BNG A;  5DTD A;  5IOZ A;  2Y30 A;  3TW6 A;  3S2D J;  2IU5 A;  4PXI A;  1UG2 A;  1QVU A;  2ZB9 A;  1E3O C;  1LE8 B;  1IUF A;  3K2A A;  1JUP A;  2ECC A;  4DYC A;  2JA7 J;  5DAJ A;  2NVX J;  2QCO A;  2ZCM A;  3BG5 A;  3PO2 J;  2G0E A;  2H1K A;  2HYT A;  2ID3 A;  5FKN A;  3GTP J;  3RD3 A;  2JA5 J;  5EEA A;  3HTJ A;  1IJW C;  2DMP A;  2FBQ A;  2CRG A;  2GUH A;  3G7R A;  5M5W J;  1HDD C;  2Y31 A;  5F1J A;  2E19 A;  4G12 A;  4QSH A;  4B4C A;  1RKW A;  5IOY A;  2HXO A;  4B3A A;  3F0C A;  4IHX A;  1FTT A;  3VW2 A;  4C3J J;  3NPI A;  2DA2 A;  2LY9 A;  2X6O A;  2V57 A;  2E2H J;  3Q0W A;  3IV5 A;  3NAR A;  1JKQ C;  2WB1 N;  2X9D A;  1Z0X A;  2WGB A;  3QPS A;  2DMQ A;  3HGY A;  1B72 B;  1PUF A;  4FTH A;  1VI0 A;  4AC0 A;  3SFI A;  3NAU A;  5CXI A;  1MBH A;  4ABZ A;  2JN6 A;  3VPR A;  5D19 A;  3S16 J;  1TWF J;  4JX4 A;  5M5Y J;  1YRN B;  5FLV A;  5C4Y A;  5HOD A;  5FKO A;  1H8A C;  4IHV A;  3WHB A;  5J1R A;  1JTX A;  5K7Z A;  5IYD J;  3IUV A;  4M3E A;  5D1R A;  1QRY A;  4UDS A;  2AO9 A;  3LJL A;  2HI3 A;  3B6A A;  5EG0 A;  4GCL A;  5EYR A;  2EZH A;  4I6Z A;  3HOV J;  2ZOY A;  2DMU A;  4CGR A;  2Y2Z A;  2CQQ A;  4JKZ A;  1WH7 A;  3DCF A;  3LWJ A;  4M3F A;  3BR1 A;  4W1U A;  1ZGW A;  3O8H A;  4MXM A;  2JMW A;  2XDN A;  3BTI A;  1P7J A;  1AKH B;  2JWT A;  4RBO A;  4MIM A;  1HDP A;  3JRH A;  4BY1 J;  3VVY A;  3EGQ A;  3FIW A;  2RHA A;  2Q24 A;  1I6H J;  2GLO A;  4XRM A;  1K61 A;  2DA5 A;  4NEL A;  2LP0 A;  2D6Y A;  1RES A;  5DS9 A;  1JT0 A;  2JA8 J;  3BNI A;  3K7A J;  4DW6 A;  4GFL A;  2XPU A;  3VOX A;  2PBX A;  2B63 J;  2DG8 A;  4MK6 A;  2G7G A;  4GFB A;  1WGX A;  5IPA A;  1BJZ A;  3B6C A;  2XGE A;  2QOP A;  3I4M J;  1JKR C;  3JSJ A;  4KWA A;  5F0F A;  2REK A;  2QWT A;  3LSP A;  1ZR2 A;  5AQC A;  2Y0S N;  1SFO J;  1MH4 A;  2HOT A;  1YRN A;  1JT6 A;  2FD5 A;  3S2H J;  1ZTR A;  2K9Q A;  3BTJ A;  1B8I A;  2VKE A;  2RAE A;  1LFU P;  1D5Y A;  2NVQ J;  2MGQ A;  1GVD A;  2CUF A;  4AUX A;  3QKX A;  5GP9 A;  4NDL A;  4DZP A;  1PUF B;  1GT0 C;  2HYJ A;  3VW0 A;  1U8B A;  2ZCX A;  2M34 A;  5C4J J;  2E1O A;  1ETX A;  2ID6 A;  3MKL A;  3ZQF A;  4C3H J;  2RAS A;  3VW1 A;  1SGM A;  3S14 J;  2R5Z A;  1ENH A;  4UUT A;  2IEK A;  2DMN A;  4JP0 A;  4C3I J;  4EEF G;  2UXI A;  2L0K A;  1JKO C;  4S0H B;  1DU0 A;  3NNR A;  1WPK A;  3HOU J;  5IYB J;  1AU7 A;  1BA5 A;  2VUM J;  4AC6 A;  3I4N J;  1RPW A;  3HGG A;  3FRQ A;  4X1E A;  5EG0 B;  2DN0 A;  2O8K A;  1APL C;  5IP7 J;  1VFC A;  1MSF C;  1X58 A;  1OCP A;  2JK3 A;  3A01 B;  2E2I J;  2OI8 A;  1HLV A;  4V2G A;  4MFD A;  3E7L A;  3S1Q J;  5IP6 A;  2O7T A;  4FIS A;  1UI6 A;  2ZOZ A;  3V78 A;  2GFN A;  3ZOB A;  1FIP A;  5K7H A;  3HOX J;  3UKG A;  2NVT J;  5E3O A;  1HF0 A;  4B1R A;  2O9L A;  1AHD P;  2HOS A;  1A6I A;  1F36 A;  2VKV A;  3AQS A;  2LD5 A;  5F0H A;  4A3K J;  2NP5 A;  3GTO J;  4A3D J;  3G56 A;  3HB9 A;  1JKP C;  4D5C A;  3QQA A;  2DG7 A;  2ELK A;  4A3C J;  1ETY A;  2MG4 A;  3ZQL A;  1XG1 A;  2K40 A;  1LFB A;  3C07 A;  2W48 A;  5EZH A;  2IAI A;  5EGO B;  2QIB A;  3NRG A;  1ETK A;  1ETV A;  2HOA A;  4FE7 A;  1UMQ A;  2QF7 A;  4NN1 A;  2NS8 A;  1ITY A;  5E3N A;  3MNL A;  4MFE A;  5C3E J;  3ZQH A;  3JRC A;  3RKQ A;  3CQZ J;  3F1B A;  3BR0 A;  4XRS G;  3FKI J;  2PZ9 A;  3NI7 A;  2DA7 A;  3P9T A;  3GZI A;  2OPT A;  1GUU A;  3HTA A;  4AYB N;  3WHC A;  2OER A;  4JNN A;  2DA1 A;  2FJ1 A;  3LNQ A;  4GCT A;  3KZ9 A;  5C44 J;  4A3B J;  5D18 A;  2Y9Y A;  1B8I B;  5FLM J;  3MVP A;  2XB5 A;  4V2F A;  3TW7 A;  1IRZ A;  2WUI A;  4L62 A;  3BR2 A;  3BJB A;  3A01 A;  2L7M P;  1HCR A;  2LTP A;  1U78 A;  5GPA A;  4BKX A;  3H3V K;  2WV1 A;  3VUQ A;  3IH2 A;  4CYC A;  2R5Z B;  3HOZ J;  3HOY J;  1S7E A;  5FKM A;  1U9N A;  3L1P A;  3BT9 A;  5GPC A;  2P81 A;  1UI5 A;  2ME0 A;  4YZE A;  1ETQ A;  1RR7 A;  3COL A;  2JJ7 A;  1IDY A;  4C2M J;  1TWA J;  1MBK A;  2IBD A;  2G7L A;  1FJL A;  4XK4 A;  3QBM A;  3BR5 A;  5F0C A;  1I3Q J;  2R93 J;  4MO7 A;  2YS9 A;  4ACI A;  2I10 A;  1MBG A;  2O7O A;  4Y52 J;  1T33 A;  4A3M J;  1UHS A;  3HTI A;  1JTY A;  2GM4 A;  3IH4 A;  3PAS A;  2UXH A;  5EGO A;  5IYC J;  3RH2 A;  3BQZ A;  3TP0 A;  5FMP A;  4RDU A;  4IEJ A;  3HEF A;  1X2N A;  1MBJ A;  4IHW A;  1BW5 A;  2M0C A;  1MSE C;  1H88 C;  2NP3 A;  2YU9 J;  4QIW N;  1POG A;  2EZI A;  4W97 A;  3NXC A;  4UUS B;  1ORK A;  2K9S A;  3Q0V A;  4IHY A;  1WI3 A;  3JR9 A;  1NK2 P;  4A3L J;  3GTJ J;  1MBE A;  5EFY A;  1XS9 A;  2FQ4 A;  2NS7 A;  1H89 C;  5M3M J;  1CQT A;  2GEN A;  5FKK A;  2M2E A;  1JJ8 C;  4HKU A;  2TCT A;  3ANP A;  5K7F A;  2ZCN A;  1ZQ3 P;  3BCG A;  3VP5 A;  2H8R A;  2N8G A;  4FE4 A;  4A69 C;  4D5F A;  4QTR A;  3JRE A;  4J19 A;  3HIM A;  5FJ8 J;  1IG7 A;  2UXO A;  3ANG A;  5H9T A;  1F43 A;  1EF4 A;  3GBG A;  4Y7N J;  5M5X J;  2QKO A;  1WH5 A;  5FKL A;  4A3E J;  4M3G A;  5K58 A;  1MH3 A;  4BBR J;  1WCM J;  5EZG A;  3BHQ A;  4GFK A;  1XC5 A;  2L7Z A;  3KNW A;  1IGN A;  2W53 A;  2EZK A;  2X48 A;  1NK3 P;  3GTQ J;  1VND A;  5J3L A;  1IC8 A;  3GTG J;  1W0U A;  1GV2 A;  1QVT A;  2E2J J;  2R92 J;  1GDT A;  3A03 A;  2DA4 A;  2LLK A;  2CQX A;  3FIS A;  4CYC B;  4DZJ A;  3CRJ A;  4BBS J;  2CUE A;  4BY7 J;  2ME6 A;  3W6V A;  3BR6 A;  1GV5 A;  2GBY A;  2YVH A;  3SDG A;  4D7M A;  4DYQ A;  1JUM A;  4UUS A;  3BG9 A;  4M6V A;  1OFC X;  2DTZ A;  4JX6 A;  3HBL A;  3GEU A;  5E3L A;  1TC3 C;  2HKU A;  3M4O J;  2UXU A;  2M9H A;  3C2B A;  3HOW J;  4A3J J;  3PO3 J;  1Q1V A;  2VI6 A;  5F08 A;  3JRA A;  3S15 J;  2HXI A;  3Q3S A; 
#chains in the Genus database with same CATH topology
 1M1E B;  3DPJ A;  2XGD A;  4A3I J;  3CJQ B;  2DQR A;  4Y15 A;  2R0Q C;  3AL0 C;  3I64 A;  4IXA A;  2KT0 A;  1J7K A;  2R7Z J;  5CJ9 A;  2BVM A;  1EV7 A;  3QOE A;  5H20 A;  2NOJ B;  5DM6 F;  1KQ8 A;  2BOL A;  1FOX A;  5FHP A;  2EFP A;  4U0V A;  4P9F A;  3MZH A;  4KIF A;  3OS0 A;  4L5E A;  4XLP F;  2OJE D;  5J1U A;  4CO8 A;  4ASN A;  5HAW A;  4AU7 A;  4I0A A;  2K4B A;  3K4N A;  1F4K A;  1MNM C;  1MJA A;  2M7A A;  2D5V A;  4RGX A;  1JGS A;  3ASN H;  1MKM A;  4ZDP A;  1ZRF A;  5HS7 A;  3MMY B;  2EWN A;  2X0L A;  4M9Z A;  5D4R A;  1GXQ A;  2XGC A;  4CCM A;  3OYC A;  3OSF A;  4XID A;  3RKX A;  3VOE A;  2BXY A;  2X1D A;  4KA4 A;  3MCZ A;  3TBI A;  2E34 A;  4IRH A;  3TP3 A;  5KNL A;  3JTH A;  1WZ2 A;  2DYR H;  4A3G J;  3S1N J;  1OJL A;  3T1B A;  1XMA A;  4LGW A;  1X19 A;  1T56 A;  4MHG A;  1FZP B;  2DT6 A;  2DMT A;  1EH6 A;  4Z6Y A;  2AS5 F;  2E71 A;  2E1M C;  5FRN A;  4GYG A;  4IRV A;  3CDL A;  3HSR A;  3WOD F;  3S93 A;  2R7D A;  4EM2 A;  3EYY A;  5AIP A;  2F6C A;  3EQL F;  4RM2 A;  4XRS A;  3BLY A;  5F1R A;  1R1V A;  1JJ6 C;  1ZGJ A;  3KEQ A;  2Y0M A;  1K83 J;  5HBU A;  1S7O A;  1FLI A;  3PM1 A;  3LMM A;  3H92 A;  3G2B A;  2EQR A;  3V8K A;  4LIT A;  3G1O A;  3DEW A;  4JYK A;  1UB9 A;  3M1C A;  1OR7 C;  1R36 A;  1Z77 A;  2WAF A;  3M8J A;  1O3T A;  2JA6 J;  4LMY A;  2ICW G;  1U9O A;  3I56 I;  2EH3 A;  2L7F P;  1IN6 A;  3CCY A;  1E0E A;  4OMY A;  3F6O A;  4B8X A;  1UZC A;  4FX0 A;  5TIS C;  2JQ7 A;  3VVX A;  4CUG A;  4ZYG A;  1ERD A;  1HBX G;  3T8T A;  3P5J A;  1YLF A;  5FGM A;  2B3W A;  2RKH A;  3KET A;  2D2W A;  1TZL A;  1Q1H A;  1ZLK A;  3MD2 A;  5FGL A;  2YVE A;  2OBP A;  5K5O A;  1XX5 A;  2JRT A;  3H0G J;  4LLL A;  1IN4 A;  3HDD A;  3ECO A;  2F07 A;  3WTX C;  2AHQ A;  2FBH A;  2MAB A;  3LSM A;  3AQT A;  1V3F A;  1VF9 A;  3U21 A;  5E3M A;  2MLG A;  2KDZ A;  2P5K A;  2VPR A;  2KIF A;  2XIG A;  3OOP A;  4HV5 A;  2ZXW H;  2OCC H;  5J1Y A;  4KNY A;  2L9V A;  2KJC A;  2HVQ A;  5F04 A;  5KCM A;  4DYR A;  3F23 A;  1YS7 A;  1N77 A;  1AKH A;  4EVI A;  1FEX A;  5LGT A;  2EBI A;  4KN4 X;  4KIT B;  1JUS A;  3SZT A;  3ZR8 X;  2DFI A;  1YYV A;  2QTQ A;  3V7R A;  1ZG1 A;  3VSK A;  1ZAR A;  1R1U A;  1Y8R B;  2L9S A;  3S2D J;  4PXI A;  1XGO A;  2WV0 A;  2ZB9 A;  3K2Z A;  1FBQ A;  2KP6 A;  1IUF A;  2FE3 A;  2L4A A;  4DYC A;  2JA7 J;  2NVX J;  1UCR A;  1JE8 A;  3RPQ A;  5LEK A;  3PO2 J;  2G0E A;  4G7H F;  2HYT A;  2A6E F;  2L54 A;  1TNT A;  5K1Y A;  1IRX A;  1IJW C;  3C18 A;  2ZO4 A;  1P6R A;  1W5S A;  3G7R A;  3RYR A;  1LVA A;  4LD5 A;  5F1J A;  5LHH A;  4YG2 F;  5IOY A;  4DBR A;  5E1Z B;  4KIB A;  2CUJ A;  1QO0 D;  2H09 A;  3AFH A;  2DA2 A;  2K4J A;  1RI7 A;  4F93 B;  3Q0W A;  5AIQ A;  3N05 A;  4EJO A;  3CLO A;  4P5O A;  3VFZ A;  3HL2 A;  4M71 A;  2K5C A;  1R4N B;  2E5N A;  3HGY A;  3T8R A;  2PBI A;  3SFI A;  5HLT A;  3PNV A;  1X4O A;  2Q1Z B;  4RAG A;  1HW2 A;  3NAU A;  1X4P A;  4XKW A;  5CXI A;  2F5V A;  2RRE A;  3EPZ A;  2WBM A;  4A6E A;  3F22 A;  1DDN A;  5HSZ A;  2UUZ A;  4M73 A;  3N4M A;  4ETS A;  3S16 J;  2VJJ A;  2H8W A;  2KDO A;  5D5X B;  1N78 A;  3I0T A;  5C4Y A;  5HOD A;  1IAW A;  2UXN A;  1HC8 A;  4RLF A;  4XKV A;  3E6B A;  2IA0 A;  5EG0 A;  4ZDO A;  3LJL A;  2LRE A;  2DBB A;  3HOV J;  2O8X A;  1BR1 A;  2FOW A;  3A1Y A;  2DMU A;  4ZTJ A;  3QOD A;  1HKS A;  4PCQ A;  1WH7 A;  1WJC A;  3ELK A;  3BR1 A;  4M3F A;  1ZGW A;  4BHC A;  1E3H A;  1I1S A;  2L5Q A;  1AKH B;  4U7B A;  2VQC A;  2P7V B;  4MIM A;  4YIR X;  4FAS D;  2UZK A;  1ONV A;  3E5Q A;  1I6H J;  4AVP A;  3KX2 A;  1RC9 A;  3E1S A;  3TO9 A;  4PGH A;  1H9G A;  1FNN A;  1BM9 A;  2JA8 J;  1OYW A;  3C2H A;  1WJE A;  3TDU C;  4GFL A;  2XPU A;  1MNE A;  4PK4 A;  3VYT B;  3GFM A;  2PBX A;  1T95 A;  4XLC A;  2WY8 Q;  2Y75 A;  4IX7 A;  2VJ5 A;  2KRC A;  3LQR A;  3QPT A;  5H6Q A;  2PEX A;  1YE9 A;  1ZAO A;  2QOP A;  2KRH A;  3JSJ A;  4KWA A;  4TV7 A;  3U1K A;  4A2U A;  5DD4 A;  5DV5 A;  3CMA I;  1ZR2 A;  2F48 A;  3REO A;  2GOX B;  2LF7 A;  2ELJ A;  4BYY A;  5J6X A;  1QZE A;  1D0Y A;  4N9I A;  2K9Q A;  1W7P B;  4AWX B;  1O3R A;  5JVT A;  1P4X A;  2ZBK A;  5FB2 A;  2PMU A;  1HKT A;  3PUB A;  1GVD A;  3RTR A;  4E7J A;  4ZDL A;  4NDL A;  2HYJ A;  3TGN A;  4QWQ A;  4BJT A;  4BL0 B;  3OIQ A;  3GYH X;  1ETX A;  2ID6 A;  1TQP A;  1YG2 A;  3ZQF A;  3QRF F;  3H0D A;  1SGM A;  2R5Z A;  1ENH A;  4UUT A;  3J80 K;  4WX9 A;  4CZZ A;  3RPU D;  2CV1 A;  2Y0S A;  1CGP A;  4IRG A;  5E17 F;  3MKY B;  2UXI A;  3P9K A;  6PAX A;  4S0H B;  3NNR A;  2B7E A;  3CP2 A;  1SD4 A;  3OR1 C;  1FOK A;  3MWM A;  3F72 A;  1RPW A;  3HGG A;  4OU0 A;  5EG0 B;  3IWZ A;  1GLN A;  1QGP A;  5DUK A;  3FXK A;  2LG4 A;  3DEE A;  3A01 B;  1OCP A;  5HOO A;  3FZV A;  3DQV C;  1HLV A;  1O7L A;  2ZOZ A;  2O7T A;  4FIS A;  5ICC A;  3RSN A;  3V78 A;  2EB7 A;  3LSK A;  1FIP A;  2DPU A;  3HOX J;  1IN5 A;  2ZCW A;  5A2Q Z;  1OLT A;  4II3 A;  4AIK A;  3ZRG A;  4BE2 A;  3WU2 C;  2BZT A;  1XSD A;  2HOS A;  3CC2 I;  2LD5 A;  2NP5 A;  4ESB A;  3GTO J;  3HB9 A;  3F3X A;  1YS6 A;  1VQ4 I;  1KYZ A;  1SFK A;  3PL8 A;  3QQA A;  4B09 A;  5HS9 A;  2DG7 A;  2IW5 A;  3IKT A;  5D5V B;  3DKX A;  4A3C J;  1ETY A;  1IXC A;  2MG4 A;  3ZQL A;  1XG1 A;  3NWS A;  5EZH A;  2IAI A;  4MQV A;  1X1B A;  1QZY A;  1V4R A;  2QF7 A;  4O6J A;  1FSH A;  4RGR A;  3HTU A;  5E3N A;  3M8F A;  2MH2 A;  1Z91 A;  3RKY A;  1S7A A;  4PUS A;  4ANJ A;  1K7A A;  1I5Z A;  4XKB A;  3GZI A;  3WTV C;  2DPD A;  1GUU A;  3HTA A;  2AQE A;  4JNN A;  4GCT A;  1OCZ H;  2IT0 A;  3KZ9 A;  3H5R A;  3TMO A;  3FHZ A;  5FLM J;  4A5M A;  4L0Y B;  4BS9 A;  2XB5 A;  3G71 I;  3W3C A;  1W36 C;  2FML A;  2KIM A;  3TW7 A;  2WUI A;  2XF6 A;  3HG9 A;  2LTP A;  4RB1 A;  1LVK A;  5GPA A;  2OTJ I;  2VC0 A;  2K3F A;  4S05 A;  3H3V K;  3LA3 A;  1ZH5 A;  4WIB A;  3IH2 A;  1K4T A;  2R5Z B;  1D1A A;  1X3U A;  3ASO H;  3K4C A;  1U9N A;  4U7D A;  1RR7 A;  3W2A A;  4AYB A;  3D5S C;  4LG3 A;  3T5X A;  3FKJ A;  2G7L A;  3I53 A;  1J5Y A;  2A05 A;  3QBM A;  1VQO I;  2R93 J;  3J81 Z;  4CXF A;  2VL8 A;  2HQA A;  1T38 A;  4CCJ A;  1A36 A;  2K27 A;  2ZSH B;  3LA7 A;  2AXT C;  2GM4 A;  3ZN1 A;  2UXH A;  5IYC J;  3BQZ A;  3L2V A;  4HQE A;  5HVQ C;  3MAJ A;  1SFE A;  3E6M A;  2OU2 A;  4BQN A;  4HST A;  3AKZ A;  4FX4 A;  3BJA A;  1MSE C;  1W1W E;  3OYK A;  1R5H A;  3IUO A;  3NXC A;  4IVN A;  1HQC A;  1ORK A;  2HYF A;  4OMZ A;  1V54 H;  1TTY A;  3Q0V A;  3DU6 A;  4UV8 A;  1FYL A;  4UY8 I;  4PGG A;  1QHG A;  2QYO A;  4HX7 A;  2EIM H;  3CC4 I;  2EFW A;  3L2U A;  2YVX A;  2FQ4 A;  2NS7 A;  4G6Q A;  5BS6 A;  2W57 A;  1X3Z B;  4MNU A;  3GVA A;  2XGX A;  4IPA A;  4QPO A;  2GEN A;  1Z6R A;  1E2X A;  2M2E A;  4HKU A;  4P1W A;  4C30 A;  4BHP A;  3ANP A;  2V1U A;  5DEQ A;  2ZCN A;  2ZME A;  2GIZ A;  1ZQ3 P;  3S3O A;  1RZ4 A;  3FXJ A;  4F52 A;  2XC7 A;  3BCG A;  5CVU A;  1OPC A;  3PSF A;  4J19 A;  4FE4 A;  4A69 C;  1VQ9 I;  4ZH4 F;  1U5T C;  4P96 A;  3DTI A;  5KHD A;  5LBQ A;  5FKL A;  4M3G A;  2XAF A;  3TKY A;  5EZG A;  4GFK A;  3KLO A;  1XC5 A;  3QU6 A;  2JVG A;  3DWL E;  2CQK A;  1KQ9 A;  2A3S A;  1NK3 P;  1VND A;  2V4J C;  5HDG A;  1J59 A;  1YOV B;  2E2J J;  2BE5 F;  5CKT A;  1GDT A;  1UHW A;  3F8B A;  1KZH A;  4CSW A;  4YIF A;  3CRJ A;  1KON A;  4BY7 J;  3GFI A;  2W00 A;  3KFW X;  4D7M A;  3DF8 A;  3ZMS A;  1JUM A;  4UUS A;  3BG9 A;  4M6V A;  2V1D A;  2P8T A;  5LHG A;  1XGM A;  3RDI A;  4MTE A;  3KP2 A;  5E3L A;  1AA7 A;  4J00 A;  3WG7 H;  3AAF A;  2IS6 A;  4A12 A;  3OL4 A;  3HUG B;  3VB2 A;  1YW7 A;  4A3J J;  1S9H A;  3PNY A;  5TRD A;  4ZYD A;  3Q3S A;  1VQ7 I;  2XRN A;  1Z3X A;  5L3D A;  4QPQ A;  4JL3 A;  1CF7 A;  4ZC3 A;  3QYB A;  4XIC A;  2HEO A;  3CJN A;  3LHQ A;  2FX0 A;  3FXM A;  3DPT A;  3IAS 2;  1WFX A;  3JRD A;  3ESW B;  3R6S A;  4N0B A;  3OIO A;  1B59 A;  4D0P A;  3HE0 A;  2O5R A;  3GUD A;  1UEL B;  2DTR A;  2GIV A;  3QP6 A;  4EM1 A;  1W0T A;  3CTA A;  3K6G A;  1WKM A;  3U1D A;  3O60 A;  3KP4 A;  1DQU A;  1Z67 A;  2W25 A;  2O6G E;  4CCN A;  4L9T A;  2NRA C;  4HDU A;  2R5Y B;  4II2 A;  4NHJ A;  4X6A J;  1ETO A;  4LLG F;  3ON4 A;  4WXH A;  4L0Z B;  4G7O F;  2K85 A;  4E7H A;  1BL0 A;  2QQB A;  3HZJ A;  2ZME B;  3D1N I;  4GCV A;  2NX4 A;  3AG1 H;  3VOK A;  4PFP A;  2IS4 A;  2GA2 A;  1RIO H;  3D5L A;  4B3X A;  4I76 A;  3RZD J;  2W1O A;  3CDH A;  2DA3 A;  3ZQI A;  1OR7 A;  2EFO A;  2GXG A;  3HXL A;  3LSJ A;  3B81 A;  4CGZ A;  1FIA A;  3S32 A;  5DM7 F;  1O3Q A;  5L3B A;  3AL0 B;  2V9P A;  1BOB A;  1Y56 A;  3SJM A;  2A5W A;  3PQK A;  4NB5 A;  3HM5 A;  3CJD A;  1KU3 A;  2LF8 A;  2XDV A;  2M7B A;  2VOP A;  5LLQ A;  1SVO A;  2E36 A;  1BR4 A;  2MSY A;  4XLN F;  2WY7 Q;  1ZK8 A;  2ZXJ A;  2XPW A;  5J4Y A;  3GEZ A;  4G9Y A;  3V42 A;  1BN5 A;  1S6L A;  3O8G A;  3OYH A;  1YIT I;  3LOC A;  3FHN A;  2LNB A;  4LJZ F;  5CW8 A;  2HNH A;  5JLX A;  4KIS A;  3GX4 X;  4N9H A;  1EH7 A;  9ANT A;  3KKD A;  3JCU C;  1P4W A;  2E1N A;  1PP7 U;  5HS8 A;  3TO7 A;  3BTC A;  2CQ7 A;  3H35 A;  3DU5 A;  2LVS A;  3BCB A;  4BE1 A;  1JGG A;  2LY2 A;  3JRF A;  3EYI A;  5LGU A;  3PQJ A;  1CF7 B;  2DOE A;  3QOP A;  3GTK J;  4R79 A;  3HSE A;  1O4X A;  3PPB A;  1R5G A;  4BXU A;  2R7R A;  2V26 A;  3K4B A;  1XD7 A;  3DLA A;  2NOG A;  3PFI A;  4YRV A;  3OSG A;  4AF5 A;  1IDZ A;  4AVZ A;  2STW A;  3BG6 A;  1J0R A;  2XVC A;  4FT8 A;  3BG3 A;  3BR3 A;  1P2F A;  5KK1 A;  4XL9 A;  2HPI A;  1TW3 A;  4A0Z A;  1Y0U A;  3GW2 A;  3KKC A;  2L02 A;  2LKP A;  3MZ8 A;  1Y1W J;  1B1B A;  5AON A;  2XSD C;  3F8C A;  3KEY A;  1ON2 A;  4RB2 C;  1S3J A;  2ZME C;  5E18 F;  2K02 A;  4XON A;  1UG2 A;  1E3O C;  4NNJ A;  1U8R A;  3O3K A;  1JUP A;  2K9L A;  2L7K A;  1V55 H;  2W24 A;  2CV0 A;  3FM3 A;  2AXL A;  1BI0 A;  3SDB A;  4PJJ A;  5F6F A;  2H1K A;  4EQQ A;  1EJ9 A;  1REP C;  1L0O C;  5EEA A;  2CRG A;  2GQQ A;  3J7A O;  1FC3 A;  1HDD C;  2IP2 A;  2P7C B;  2E19 A;  4HRI A;  1RKW A;  2CW8 A;  4HEA 2;  3LSI A;  5H6R A;  1GHC A;  4U0Y A;  1FTT A;  4C3J J;  4OIR F;  2LY9 A;  2DU9 A;  3D0S A;  2DI3 A;  3K8P C;  2E2H J;  3KLN A;  2E7X A;  1ZG3 A;  2WB1 N;  2X9D A;  2DT5 A;  3CF2 A;  3K4J A;  3L9F A;  3CME I;  1ZYR F;  3FMS A;  2DMQ A;  3SYT A;  3HRU A;  4AC0 A;  2YX4 A;  3DKW A;  2RV8 A;  2GZW A;  1R4M B;  2BY3 A;  4ENM A;  1U3E M;  2XSJ C;  3AG4 H;  1YX5 A;  5J4V A;  4G6T B;  2HFH A;  2B0L A;  3OS2 A;  4XLF A;  5IYD J;  5J1R A;  2RNG A;  5IT9 Z;  3FF5 A;  2HZT A;  4M3E A;  5D1R A;  1QRY A;  1SAU A;  4GCL A;  5DDG A;  3B6A A;  1X1A A;  2Y69 H;  3ML6 A;  4O5V A;  5EYR A;  3JSO A;  4XN3 A;  5L3G A;  3JAM Z;  4PSX A;  1OMI A;  1U6G A;  4IZZ A;  4HQM A;  2NS0 A;  2OD5 A;  3ZMD A;  3LWJ A;  4H0E A;  3HSF A;  4ZJZ A;  4M6X A;  3GME A;  5BOX A;  3BTI A;  1E17 A;  1P7J A;  2HOE A;  2ISZ A;  3BG7 A;  3QAH A;  4O3M A;  1FBU A;  3IHU A;  2MFZ A;  3UNG C;  4RA2 A;  2A07 F;  2I8D A;  1R1T A;  1Z1D A;  2FQ3 A;  3L2R A;  2RHA A;  2A6T A;  3O2P E;  2CV2 A;  2Q8K A;  3K9T A;  1BC7 C;  3GLX A;  1Z21 A;  2FEZ A;  4XRM A;  1K61 A;  2IA1 A;  2DA5 A;  3HYI A;  4KUM A;  1G59 A;  2RGV A;  3B73 A;  1RRJ A;  2DT7 B;  4I99 C;  5DS9 A;  1TT0 A;  4G7Z F;  1Y39 A;  1JT0 A;  4DW6 A;  4WF2 A;  2BY1 A;  2B1E A;  1IXR C;  1ZN2 A;  1XSX A;  2DG8 A;  3COA C;  1D0X A;  3CF5 F;  5L3C A;  2G7G A;  1SD7 A;  2OAZ A;  1WWX A;  1BJZ A;  2OV7 A;  3HTS B;  2KL4 A;  2HYG D;  2FBI A;  2Q0O A;  3VSL A;  1Y6I A;  3F9K A;  5F0F A;  2REK A;  3LAJ A;  3BCA A;  2R7Q A;  2Y0S N;  1MH4 A;  2YSR A;  1SFO J;  2M87 A;  3S2H J;  4HBL A;  2M0M A;  4HAM A;  1B8I A;  3DP7 A;  1G8X A;  2VKE A;  4ZYH A;  2X6W A;  5F64 A;  5ED4 A;  1SFU A;  1D5Y A;  2NVQ J;  3L2C A;  3I5U A;  2ZJ2 A;  1XGN A;  5GP9 A;  4DZP A;  4BE0 A;  3S3N A;  1GT0 C;  3QKX A;  4F92 B;  1U8B A;  2ZCX A;  1WRJ A;  2M34 A;  2XKO A;  2LBF A;  2QUF A;  2E1O A;  4XM3 A;  5C4J J;  1ZG5 A;  3D5R C;  3S14 J;  3ONQ A;  1XB4 A;  2CO5 A;  1A35 A;  3ISP A;  4CHU A;  2KRF A;  2ACJ A;  1MD0 A;  2L0K A;  1JKO C;  4HG2 A;  3W2V A;  1DU0 A;  1WPK A;  1P4A A;  3HOU J;  1F1Z A;  1BA5 A;  2VUM J;  4I01 A;  4AC6 A;  4IKF A;  2J5O A;  2ZFW A;  1XSV A;  2FU4 A;  3W2W A;  4I09 A;  1APL C;  1VFC A;  1MSF C;  2FBK A;  5JR3 A;  2IRF G;  4BJ5 C;  3A2K A;  1BC8 C;  3ZCO A;  3R61 A;  2HWV A;  2DK5 A;  5DD8 A;  3ZOB A;  2GFN A;  3EET A;  1RR8 C;  1VQ5 I;  1FPQ A;  3UKG A;  2NVT J;  3K0L A;  1I6X A;  4Y13 A;  3LQQ A;  1T39 A;  1AHD P;  1F36 A;  3IRQ A;  2VKV A;  2QZ8 A;  4A3D J;  2IS2 A;  3LFK A;  4GYI A;  1JKP C;  2GAU A;  1W7P A;  2JVH A;  2BVL A;  3C2G A;  4L9V A;  1B4A A;  4OIP F;  3K4L A;  5A2Q K;  2K40 A;  3TO6 A;  4C2U A;  3C07 A;  2V9V A;  4EJV A;  2VKD A;  1OCC H;  5EGO B;  4N4N B;  3NRG A;  2W84 A;  2MH9 A;  4ZZL A;  2BBY A;  2HOA A;  3K69 A;  3WU1 B;  1UMQ A;  1H9T A;  4N4O B;  2XV4 S;  1LEA A;  4A0X A;  3MNL A;  4MFE A;  4OIQ F;  3ZQH A;  4L5J A;  3JRC A;  3RKQ A;  3CQZ J;  3F1B A;  3FKI J;  4DIQ A;  2DA7 A;  3P9T A;  2OPT A;  3KCC A;  5BQT A;  3SZG A;  4AYB N;  2JSP A;  2OER A;  2DA1 A;  2D45 A;  4XR6 A;  4AM3 A;  2WB1 A;  3RKW A;  2Y9Y A;  1B8I B;  3VWB A;  2KQR A;  2QLZ A;  4L62 A;  2ELH A;  1G4D A;  2VXD A;  3A01 A;  3J7Z I;  2OUM A;  1X3W B;  3DV8 A;  3PSI A;  3I54 A;  2LBF B;  2MA3 A;  2IVM A;  4UV9 A;  2WV1 A;  1K4S A;  3VUQ A;  5TJJ A;  4RMN A;  3SQN A;  2HU9 A;  4G6D A;  4HOB A;  2A6H F;  1Z7U A;  3BT9 A;  5GPC A;  1SVM A;  2P81 A;  4YZE A;  1ETQ A;  4C2M J;  1IDY A;  1MBK A;  3S2W A;  1ULY A;  2QEN A;  3WE3 A;  1FJL A;  4XK4 A;  2CMP A;  5FFX A;  1HKQ A;  3BR5 A;  3MEX A;  4HX4 A;  4GXO A;  2YS9 A;  2PLY A;  4ACI A;  3MKZ A;  5E8G A;  3KP7 A;  2L3D A;  4A3M J;  1I3A A;  5TGT A;  3FXO A;  2EV6 A;  1KA8 A;  3LST A;  4BGD A;  2ZSI B;  5HDN A;  5DUI A;  3EDP A;  1R5I D;  4RDU A;  4IEJ A;  1U5T A;  3HEF A;  5HLH A;  3J81 K;  2I5U A;  1BW5 A;  2BHZ A;  4H4K C;  1K78 A;  2K86 A;  1H88 C;  3ZN0 A;  1NH3 A;  1VTN C;  1POG A;  4LK1 F;  4KMF A;  3ERM A;  4IHY A;  4GO1 A;  1WI3 A;  3M7G A;  1YW9 A;  1IXS B;  2FJI 1;  4EJW A;  3BRO A;  3PFY A;  3RI4 A;  1SVL A;  1U0J A;  3TQN A;  4G94 A;  2EK5 A;  1C0W A;  1CQT A;  4XLH A;  4MEX F;  1S29 A;  2TCT A;  4DGW B;  2M3A A;  2PMH A;  3GF2 A;  1T98 A;  1V5F A;  2JUC A;  2N8G A;  3JRE A;  3PUF A;  1TBX A;  5FJ8 J;  1IG7 A;  3F6V A;  1F43 A;  2QKO A;  4Y7N J;  5M5X J;  1WH5 A;  3T0Y A;  2R7O A;  4CCO A;  4A3E J;  5ERI A;  2V79 A;  3F8N A;  3FXU A;  2E1C A;  4U87 A;  4XSX F;  4BAC A;  2EV5 A;  1IGN A;  4FET A;  2X1C A;  2QKL B;  2A2F X;  2W53 A;  3H9Q A;  4G8X A;  4HZF A;  2D1V A;  1J2X A;  2P6T A;  1W0U A;  4E4H A;  3CC7 I;  2VT2 A;  5LHI A;  1TQI A;  4BQQ A;  3A03 A;  4I7H A;  2LLK A;  1XMX A;  2GXB A;  2DDB A;  2FXA A;  2XF7 A;  3BJ6 A;  3FBI B;  2CUE A;  2ME6 A;  3BR6 A;  1GV5 A;  5HNF A;  3WU0 A;  3ZQQ A;  3OS1 A;  1ODD A;  2K9M A;  3HBL A;  1BIB A;  2XAU A;  1NHA A;  3C7J A;  2HKU A;  2M8E A;  3P9I A;  1LNW A;  4I98 B;  2YU3 A;  2KPM A;  1VQK I;  1MGT A;  1T0F C;  2DOF A;  1FX7 A;  3PO3 J;  3ZGK A;  2E5Z A;  2HXI A;  1I1G A;  2F2E A;  1L3L A;  4CYD A;  4EAT A;  1U5T B;  2LH9 A;  3KYD B;  3BQY A;  2W82 A;  4BEH B;  4BXX J;  1K78 B;  4MGR A;  2ZJP F;  1G3Y A;  1RET A;  5GAD J;  3BWG A;  4UNO A;  4LOC A;  5F27 A;  1X2M A;  2XB0 X;  3K4K A;  4U0W A;  3I55 I;  3PNT A;  3MFK A;  2NXN B;  4DOZ A;  4BUP A;  3NQO A;  4ICH A;  1G3S A;  2DK8 A;  2EA2 A;  4AIH A;  2OQR A;  2XPV A;  2M1B A;  5FD6 A;  5K5Q A;  2A68 F;  1R7J A;  2M45 A;  3HOT A;  1XN7 A;  3LSH A;  2VQL A;  2XRL A;  4UXN A;  4UB6 C;  2M8G X;  1BBY A;  1ZLJ A;  3IP4 B;  2VPL A;  1SAN A;  2C6Y A;  1PP8 F;  1DPU A;  5DCM A;  3DPL C;  3NRV A;  1ZHF A;  1LDD A;  2RVC A;  4JBA A;  1YIJ I;  3A02 A;  1ZKG A;  2LK2 A;  3LSG A;  3K10 A;  2ZJR F;  1RKT A;  3K70 D;  2KMU A;  1HW5 A;  1LE8 A;  3LSR A;  5FD5 A;  2FF4 A;  2QQA A;  5FRM A;  2UXP A;  2PMZ A;  2H1L A;  2VBZ A;  4A3F J;  3QU3 A;  2ESH A;  2IJL A;  3IH3 A;  5FFZ A;  5JLW A;  4IRI A;  3JRB A;  1P7I A;  2R3S A;  2Y9Z A;  2OZ6 A;  1HOM A;  3IAM 2;  3Q5F A;  2DCE A;  2NVY J;  4XRF A;  3G6E I;  3WTY C;  3HUG A;  3ERE D;  2ZJQ F;  1QHH D;  1R23 A;  1F9N A;  2K9N A;  4ENN A;  2MD5 A;  3QYF A;  4HSR A;  1ZRC A;  5GAG J;  2KHM A;  2QM3 A;  2QKM B;  2OF7 A;  3Q0U A;  4XQF A;  3DFG A;  1KU2 A;  3MN2 A;  3CMY A;  1X1P A;  3M3Y J;  1TWH J;  4HNV A;  4WXC A;  1BW6 A;  1YIO A;  3WGH A;  4ME9 A;  1FYK A;  1ON1 A;  3BDD A;  4KFC A;  1PYV A;  1BI3 A;  4M3D A;  1A5J A;  4GCK A;  3CD6 I;  2DA6 A;  1S72 I;  2LRD A;  2GWR A;  5C4X J;  1TWC J;  1J75 A;  1B72 A;  2GOM A;  3PJR A;  3R4K A;  4M3B A;  2R5Y A;  4B44 A;  3HTH A;  2XAS A;  2VE8 A;  3E7Q A;  3HKZ A;  2ZKZ A;  4Q48 A;  5H2F C;  3I59 B;  3PIO F;  4FQG A;  1BI2 A;  2COB A;  3S5R A;  3OYL A;  1OCT C;  3FK7 A;  2XKP A;  5CXG A;  2E35 A;  5KVR A;  4HV6 A;  3ABT A;  3GZ6 A;  2HKX A;  3OR2 C;  1GXP A;  2CWE A;  1HSJ A;  1MMG A;  2KZV A;  4MLO A;  2VXZ A;  4XKC A;  1BIA A;  2KKO A;  1J9I A;  1A31 A;  2FMY A;  1X1C A;  4OAY A;  3S1R J;  3VVZ A;  1J09 A;  5L3F A;  3RJP A;  1ZEL A;  3NS4 A;  5LGN A;  3BP8 A;  2CJJ A;  1RUN A;  1MMS A;  4XLA A;  2Y48 A;  3JTG A;  3FK6 A;  3WTT C;  3BOQ A;  5D8L B;  1X1D A;  5DCM B;  3OL3 A;  3G1L A;  5CVI A;  2ZNY A;  2EZL A;  1JXS A;  3ON2 A;  5CPR B;  4DBQ A;  4S04 A;  4B47 A;  2LR8 A;  4I0B A;  4ZYA A;  1D3Y A;  2Y30 A;  4F3Q A;  2R7V A;  1A6Q A;  1QVU A;  4C9Y A;  4IHT A;  2G7U A;  1YJW I;  1LE8 B;  2PG4 A;  4RAZ A;  1B9N A;  1D1C A;  3W6J B;  4OD4 A;  2QCO A;  2ZCM A;  3BG5 A;  4RB3 C;  2ID3 A;  3GTP J;  3RD3 A;  2WAQ A;  2DMP A;  1QA6 A;  4UUV A;  3BZC A;  4IJA A;  3ECH A;  3WGG A;  1V5E A;  4IO9 F;  3FXQ A;  5E8I A;  4LIU A;  3HPG A;  5CVV A;  2V9K A;  4UVB A;  4B4C A;  5BMZ A;  2HXO A;  3B02 A;  4DVY P;  4IQJ A;  4B3A A;  5D5W B;  4IHX A;  5JFR A;  2JT1 A;  4IOA F;  3ABK H;  3NPI A;  4CZC A;  4NC6 A;  3NAR A;  2PFB A;  1W4M A;  4IHS A;  1R58 A;  2HVS A;  1Z0X A;  4XOR A;  5EEH A;  3HRM A;  3QPS A;  1B72 B;  2A61 A;  3CCQ I;  1PUF A;  4FTH A;  1VI0 A;  2F4M B;  3E3V A;  2KIU A;  3CMM A;  2QSG X;  1H0M A;  3GWZ A;  2OQG A;  2F5F A;  3TDZ C;  1G3T A;  2ZNZ A;  1FWZ A;  3ABU A;  3ULQ B;  2H6B A;  1SMT A;  1YJ9 I;  3VPR A;  5D19 A;  3ZQ7 A;  1YRN B;  1HST A;  3KP3 A;  4F91 B;  4ESF A;  2R7S A;  1OCR H;  4ITV A;  1IZ1 A;  1ZGA A;  2RQQ A;  1LKX A;  3IUV A;  4UDS A;  1SAX A;  3M8E A;  4I6Z A;  1R00 A;  4BU2 A;  1T2K A;  4CGR A;  2BGC A;  2XAJ A;  3FMR A;  5HNH A;  3Q9S A;  2RQP A;  3EUA A;  2XAQ A;  1YFH A;  4W1U A;  3LAP A;  1SEU A;  3O8H A;  4MQ9 F;  5IT9 K;  2L2O A;  3V7S A;  2ISY A;  2XDN A;  3NEU A;  1FSE A;  2JWT A;  4RBO A;  1HDP A;  4D9J A;  3JRH A;  3VVY A;  5E1W A;  3JAM K;  4MEY F;  1WI9 A;  2ETH A;  1RES A;  2E7W A;  3QWL A;  1TLH B;  1VZ0 A;  3VOX A;  3K1M A;  1VQN I;  2B63 J;  3CZ6 A;  3VEP A;  2YPR A;  2Z1D A;  4MK6 A;  5E79 C;  3GXO A;  5J8C A;  1JHF A;  1LUJ B;  1WGX A;  2XHK A;  3BZK A;  2R7U A;  3B6C A;  2XGE A;  1RNL A;  3ZP5 A;  2E60 A;  2STT A;  3I4M J;  1JKR C;  1QNT A;  3SZP A;  4BXF A;  5AQC A;  4P55 A;  1SD6 A;  1JT6 A;  1ZTR A;  3BTJ A;  4PDK A;  2IPQ X;  2KIQ A;  3H3Z A;  1ZRE A;  1DPR A;  4KJZ A;  5FLX Z;  2RAE A;  1LFU P;  2FRH A;  3JW4 A;  1IN8 A;  2MGQ A;  2CUF A;  5ILV A;  2HVR A;  2LKS A;  1PUF B;  2AQF A;  5LD2 C;  2EJR A;  1XCB A;  4XN0 A;  5KAI C;  3H36 A;  4PJL A;  5FRO A;  4C3H J;  3MKL A;  3HC7 A;  2RAS A;  2X1E A;  3AG3 H;  1P9Q C;  3UR3 C;  2KZG A;  2ZFU A;  2IEK A;  4JP0 A;  4C3I J;  3CCU I;  4EMS A;  3X2Q H;  4EEF G;  3GZ5 A;  2PJR A;  4EV0 A;  3DXJ F;  3OYE A;  1AU7 A;  1TW2 A;  3I4N J;  2VOD A;  3FRQ A;  1XCV A;  2DLL A;  2DN0 A;  2O8K A;  5IP7 J;  3E97 A;  4M72 A;  2DW4 A;  1WJF A;  4LFU A;  2E2I J;  3KYL A;  4V2G A;  4MFD A;  3S1Q J;  5IP6 A;  3CJR B;  3VYU B;  2ZXH A;  1Z3Y A;  5CQE A;  3HPH A;  4UHT A;  2W4S A;  5GTH C;  2WAE A;  3H9G A;  4B1R A;  3I9V 2;  4GRI A;  3G4S I;  1A6I A;  2BXZ A;  2FNA A;  1UHM A;  3AQS A;  2PX9 A;  5F0H A;  3G56 A;  3HIF A;  2VON A;  1ACI A;  2ELK A;  2F5E A;  1YW8 A;  1OKR A;  2R7X A;  1LFB A;  3GO5 A;  1OQY A;  4ZZD A;  4A6D A;  2QIB A;  3H3U A;  4FE7 A;  4NN1 A;  3HHH A;  2BV6 A;  2DDA A;  3LFU A;  4WXD A;  2NS8 A;  3J7Y J;  5C3E J;  4BDZ A;  3ZPL A;  1YQA A;  2X51 A;  3OIP A;  1WVR A;  2A5Y B;  1MDM B;  4XRS G;  3TOA A;  4I2O A;  2XF5 A;  4AD9 A;  2CW0 F;  3FX3 A;  3WHC A;  2FJ1 A;  3LNQ A;  2M4K A;  4KIG A;  4LG0 B;  4A3B J;  2JRM A;  1EKE A;  4E7S A;  4LB5 A;  4XMY A;  3DPU A;  2EIJ H;  3FMQ A;  3QP5 A;  2Z9O A;  1BR2 A;  3BR2 A;  3ZMU A;  3BJB A;  2L7M P;  2QVO A;  3HRT A;  3CCE I;  3NWT A;  1QZZ A;  3VDX A;  1U78 A;  3OMY A;  3LL7 A;  2XAG A;  1LEB A;  1S5L C;  2EIK H;  2PI0 A;  4CYC A;  3ABL H;  3L1P A;  4EJT A;  1UI5 A;  1V5G A;  2VLA A;  2IXS A;  2VT3 A;  3RCO A;  1LDK B;  2GXA A;  3COL A;  1TWA J;  2PJR B;  1I27 A;  1R6R A;  2IBD A;  4I02 A;  3L7W A;  3MQ0 A;  2DQL A;  1K6O A;  2ZC2 A;  3L00 A;  2O7O A;  4Y52 J;  3OYD A;  1VQ6 I;  1UHS A;  2F5C A;  3BY6 A;  1T08 B;  2QEX I;  1DUX C;  1JTY A;  3CUQ B;  2O0Y A;  3IH4 A;  3WTW C;  5EGO A;  1YTY A;  5B3S H;  3GCM A;  3TP0 A;  1N25 A;  4WWC A;  2O61 A;  3E5X A;  2BW3 B;  1WJD A;  3RIR A;  3KZI C;  4NBQ A;  1X2N A;  4LK0 F;  1MBJ A;  2M0C A;  1UG0 A;  4R1H A;  2RNJ A;  4QIW N;  3SFZ A;  2EZI A;  1R22 A;  4CDG A;  2VC1 A;  2K9S A;  4LIV A;  4HDV A;  4HLY A;  1LDJ A;  1FMV A;  3FDY A;  1FT9 A;  2WC2 A;  1WJ5 A;  4KIC A;  4ESJ A;  4BH9 A;  4U9L A;  1YJN I;  5M3M J;  2HQN A;  2DXI A;  2HGC A;  2PQ8 A;  2NNY A;  1XMK A;  3HHG A;  2EIL H;  3N97 A;  4UVA A;  4HLX A;  4KN7 X;  5FKK A;  5BPI A;  2HDW A;  5K7F A;  3E0J B;  2VQG A;  2BHY A;  2J5P A;  3U9G A;  4E7Z A;  1WSU A;  2H8R A;  3TOB A;  4QTR A;  3HIM A;  3SXY A;  4IOC F;  4C2M A;  1B6A A;  3WG9 A;  1QQI A;  3LA2 A;  1T0F A;  4L9J A;  5K58 A;  1MH3 A;  5K5R A;  1WCM J;  4KDP A;  3BHQ A;  3TL4 X;  3SHF A;  2L7Z A;  3WGI A;  2EZK A;  3IRR A;  3EUK L;  1R71 A;  1HW1 A;  1I39 A;  2H27 A;  3GTQ J;  2V7F A;  5J3L A;  1IC8 A;  2EA4 A;  3ZMT A;  2P5V A;  1UST A;  3DTE A;  4BHB A;  1F5T A;  1HA8 A;  1TL8 A;  2R92 J;  2DA4 A;  2Z3Y A;  4EGZ A;  2CQX A;  1KU9 A;  3FIS A;  4CYC B;  1UFM A;  4RM3 A;  3ROU A;  1XTA A;  1STZ A;  2L4M A;  4Q5S F;  4WK8 F;  2HTJ A;  3RYP A;  4CH7 A;  2YVH A;  2CFX A;  3SDG A;  4DYQ A;  4HX8 A;  1OFC X;  4JX6 A;  2VKH A;  5ICF A;  5D6F A;  4HA8 A;  2HR3 A;  4JOM A;  1IUY A;  2NVU B;  3RPU A;  2UXU A;  1EH8 A;  2M9H A;  4MTD A;  3C2B A;  2XUB A;  3H5A A;  2VI6 A;  5F08 A;  3DBL B;  1A04 A;  4PJN A;  3ZMV A;  3S15 J;  2H94 A;  2FUG 2;  3GTM J;  5M3F J;  3CUQ C;  2PJP A;  3OYI A;  2HQ5 A;  4CA0 A;  2MW8 A;  3IWF A;  3EUP A;  3K1P A;  1FOY A;  4Y3O A;  1IV6 A;  5DCF A;  3BPV A;  3DEU A;  3QYE A;  2PFV A;  3EUH C;  3IL2 A;  1T6S A;  2YX7 A;  2LFB A;  3GTL J;  3WE2 A;  1QPI A;  3K1N A;  2YR2 A;  4BJ6 C;  1NG7 A;  4PJ0 C;  3CCM I;  4EGY A;  1FP2 A;  2PMZ N;  1MZB A;  4YFN F;  2VE9 A;  2G3B A;  1Z05 A;  2G7H A;  1YO5 C;  3BTL A;  3R60 A;  3CWR A;  3C1D A;  4PSW A;  2DOA A;  3CCR I;  1DP3 A;  1PUE E;  4R8H A;  3KE2 A;  4KT6 A;  3RZO J;  2DO7 A;  4KT5 C;  2L9R A;  1TWG J;  2EV0 A;  1WJB A;  5J40 A;  1NTC A;  1UAA A;  1KGS A;  2OZU A;  4DNC A;  4NQW A;  3OY9 A;  2LKX A;  1WHU A;  1BJA A;  2KFD A;  1MW7 A;  3BPX A;  4EJU A;  5HDK A;  4XSZ F;  3VOD A;  3I4P A;  3S1M J;  1YX3 A;  4Q47 A;  4F55 A;  3VIB A;  4OD5 A;  1VQL I;  1FTZ A;  1ETW A;  1TP4 A;  3KIO A;  4BEH A;  1QU3 A;  2F5D A;  3KZY A;  4PZJ A;  2VBW A;  3HKZ N;  3ZXS A;  5IP9 J;  1Y1V J;  2L9N A;  2VN2 A;  2MC4 A;  3BRU A;  2VJ4 A;  3DKY A;  2JUG A;  1W5C C;  3OYG A;  1K6Y A;  2JZY A;  1MMN A;  2CU7 A;  1G3W A;  3ZQC A;  1LQ1 A;  2CH0 A;  3K4M A;  5ICG A;  2P5L C;  3DLL F;  4JX5 A;  3ZQG A;  4YFK F;  4CIC A;  1IRF A;  3S8P A;  2LSO A;  1R9T J;  3IKV A;  2R7T A;  1ZR4 A;  4RAY A;  3TED A;  3T6N A;  2G7S A;  2TDX A;  3G1M A;  1MBF A;  4BQA A;  1G2H A;  4A93 J;  3JRI A;  4U88 A;  1FP1 D;  2YUS A;  4HF1 A;  1DU6 A;  2HDD A;  2ZXI A;  1I50 J;  2M4G A;  5EDN A;  2L01 A;  4E7K A;  3RQI A;  5JHF A;  5ILS A;  3CO7 C;  5LFA A;  2ECB A;  3H9J A;  2LMD A;  3JRG A;  3OWT A;  1EA3 A;  2QQ9 A;  5EF6 A;  2M30 A;  1KU7 A;  3E6D A;  4LB6 B;  2DJN A;  5LRR A;  4D7N A;  4FCY A;  2HKO A;  2MBF A;  2MYS A;  4BQO A;  2VOO A;  3GFL A;  3V6G A;  3OOU A;  3S17 J;  2TRT A;  2WAQ N;  4ZYE A;  1W36 D;  3P9C A;  1FMW A;  1W7P D;  4XLE A;  1TT5 B;  3QPL A;  5GAE J;  1WJA A;  2HDC A;  2BY0 A;  2IA2 A;  3RQ4 A;  5BNG A;  2IGM A;  3CCL I;  1LPQ A;  3L09 A;  5DTD A;  5IOZ A;  3TW6 A;  2IU5 A;  1YHQ I;  2CW7 A;  2R4G A;  3F8F A;  5CVR A;  2UWM A;  3CES A;  2W85 A;  4L5I A;  3K2A A;  4NQW B;  4XBF A;  3BC8 A;  2ECC A;  4EM0 B;  1Z7L A;  3O6B B;  5DAJ A;  2BYV E;  2VJI A;  4HW0 A;  4Y33 A;  2QSF X;  5FKN A;  4AIJ A;  2LDU A;  3KPH A;  5E20 A;  1O3S A;  2JA5 J;  2CUZ A;  2FBQ A;  5B66 C;  1BI1 A;  3HTJ A;  2GUH A;  2OTL I;  5M5W J;  3E6C C;  3OV8 A;  2Y31 A;  1SFX A;  1JI8 A;  3H5N A;  2CG4 A;  2UXX A;  5FO5 A;  4G12 A;  4QSH A;  4DJA A;  1OYY A;  4NC8 A;  3W6K B;  2GA1 A;  1KYW A;  3F0C A;  3MZY A;  3I59 A;  4RB0 A;  2WTE A;  1JHH A;  3VW2 A;  2CFO A;  2WWY A;  2D1H A;  2VAS A;  3F21 A;  3G3Z A;  2DFH A;  2ESN A;  1PDN C;  3M9A A;  1KQ0 A;  2X6O A;  1LJ9 A;  1OIS A;  2V57 A;  2NAZ A;  3QPH A;  5KAF C;  3IV5 A;  2FSW A;  2JPB A;  1JKQ C;  3OYA A;  1VQM I;  2WGB A;  4OWR B;  1R49 A;  5D6E A;  1XGS A;  3CDI A;  3I58 A;  1VQP I;  2LYC A;  2BEO A;  1IF1 A;  3GLL A;  4HYE A;  4ENK A;  3CCJ I;  1FOW A;  2BY2 A;  3R0A A;  3DBH B;  1MBH A;  4ABZ A;  1Y0N A;  2K7L A;  2JN6 A;  2JA2 A;  4BNC A;  3CCS I;  2CYY A;  4HF2 A;  2PN6 A;  3HJE A;  3S3M A;  1TWF J;  2IGO A;  1SD5 A;  4JX4 A;  5M5Y J;  1QPM A;  5FLV A;  5FKO A;  1H8A C;  4IHV A;  3WHB A;  1JTX A;  2EFN A;  4A0Y A;  5K7Z A;  2X85 A;  5D5U B;  5LRS A;  3A0H C;  2AO9 A;  2HI3 A;  4FHT A;  2EZH A;  3P7N A;  4M6Y A;  4RGU A;  5EJC A;  2RDP A;  2FA5 A;  3M1E A;  2ZOY A;  2JSC A;  2P6S A;  2Y2Z A;  4E6K G;  5LEJ A;  3L2W A;  2CQQ A;  4JKZ A;  3DCF A;  2VB6 A;  5IT3 A;  4HF0 A;  4MXM A;  2JMW A;  2KIS A;  1D5V A;  3HOS A;  3A4C A;  1D0Z A;  4M9S A;  2JTV A;  4BY1 J;  5EEG A;  3EGQ A;  4BDY A;  3FIW A;  5ILU A;  4A5N A;  4P9U A;  2O3F A;  4ON0 A;  2Q24 A;  3ZMZ A;  2DJI A;  2GLO A;  4V19 K;  1TQM A;  4F7Z A;  2X6Y A;  2VQH A;  2LP0 A;  4NEL A;  4E7I A;  4CCL A;  2VBY A;  1SMY F;  2D6Y A;  2B9S A;  4J01 A;  3BNI A;  2EPF A;  3WTZ A;  2A69 F;  1B9M A;  2V1X A;  3K7A J;  3OYF A;  4M9X A;  2V6C A;  3FWE A;  2QBY A;  3C3W A;  3GFJ A;  4GFB A;  1P92 A;  3H1C A;  5IPA A;  1D1B A;  1OYI A;  3DTK A;  2LY1 A;  3I3L A;  3CO6 C;  2V1N A;  1NG6 A;  4NC7 A;  5J47 A;  4RAF A;  4YFX F;  2HPM A;  2QWT A;  4L9N A;  3LSP A;  2CSO A;  3A0B C;  4PJM A;  2HOT A;  4ZTF A;  1YRN A;  2FD5 A;  3LWF A;  4YEJ A;  2P0W A;  2H6C A;  2K3P A;  4IF4 A;  4JK1 X;  1D8K A;  3Q9V A;  3J80 Z;  1MJB A;  4AUX A;  4C2T A;  4Y4R A;  4D1Q A;  3VW0 A;  1MMD A;  2Z5U A;  4E70 A;  4HPQ A;  4Z2Y A;  3WTU C;  2Q2E A;  4IQ4 A;  2XAH A;  3VW1 A;  3V8J A;  1MIJ A;  3R0J A;  3GZN B;  2Z2S B;  1O7F A;  3K70 C;  2DMN A;  1RUO A;  5GAH J;  5FLX K;  2RN7 A;  3DBR B;  2IGN A;  1PJR A;  2NYX A;  3M07 A;  1DGW Y;  1E3P A;  1GVJ A;  2V6E A;  3SWH A;  1IV8 A;  1LB2 A;  5IYB J;  3CLQ A;  3CUO A;  1K79 A;  2F4O B;  4X1E A;  4ENJ A;  3F8M A;  1IRG A;  2LC2 A;  1QBJ A;  1XDU A;  2IS1 A;  1X58 A;  2JK3 A;  2OI8 A;  4KYW A;  3E7L A;  1UI6 A;  2LOO A;  2O03 A;  2Z99 A;  1LFP A;  5K7H A;  5E3O A;  3I71 A;  2QWW A;  3VYS B;  1HF0 A;  1IO2 A;  1VQ8 I;  2HQR A;  2O9L A;  1UJ8 A;  1N75 A;  3SEQ A;  2Z33 A;  1Z9C A;  4OIO F;  3WTS C;  5J8F A;  1HXD A;  4DQ2 A;  5JHU A;  4A3K J;  4PFO A;  4D5C A;  3CCV I;  2RC4 A;  2CS3 A;  1TNS A;  3V8L A;  2X6X A;  3BJO A;  2W48 A;  2QBY B;  1ETK A;  1ETV A;  4L18 B;  1U2W A;  5B5E C;  3PIP F;  1ITY A;  1D8J A;  3MKW B;  4KMU X;  3V4G A;  4NUB A;  1Y8Q B;  4E7L A;  4Y17 A;  3BR0 A;  1S8N A;  2PZ9 A;  3NI7 A;  1MJ9 A;  2OC6 A;  2KLO A;  3OYM A;  2CQN A;  4B48 A;  3J7A Y;  1T8I A;  3E5U A;  4RS8 A;  3SEZ A;  5HLI A;  4YII A;  5C44 J;  5D18 A;  3MVP A;  5CVJ A;  3FBN B;  4M74 A;  4V2F A;  2FOK A;  2M5W A;  3KYC B;  4OOI A;  5B1A H;  1WQ2 A;  2ADU A;  4QLC U;  1IRZ A;  1HCR A;  2Q2E B;  2MD0 A;  4BKX A;  1Z6T A;  3HRS A;  2DYS H;  3KP6 A;  4RGS A;  3HOZ J;  4XNF A;  3HOY J;  2EIN H;  1S7E A;  5FKM A;  3VTI A;  3FM5 A;  2ME0 A;  1DGR M;  2QQ8 A;  2JJ7 A;  4JQF A;  2VBX A;  4K2E A;  5CLS A;  2VIX A;  4GGG A;  5F0C A;  1I3Q J;  4MO7 A;  4Q4Z F;  1FY7 A;  3JSP A;  2I10 A;  1MBG A;  1T33 A;  5ICE A;  3IC7 A;  3BZ6 A;  5JVG F;  2OA4 A;  2X4H A;  3OYB A;  3HTI A;  3PAS A;  4YEL A;  3RH2 A;  4U9N A;  1MND A;  2XRO A;  3OYN A;  2MC3 A;  5FMP A;  4IL6 C;  2DAO A;  3CP8 A;  2DFF A;  2JPC A;  5B1B H;  1IW7 F;  4IHW A;  2NP3 A;  2Z16 A;  2YU9 J;  2R7F A;  2CGP A;  1MDM A;  4W97 A;  4X0G A;  1SC7 A;  4OIN F;  3KEO A;  4UUS B;  2F4I A;  5CQG A;  1USS A;  1MMA A;  2HTS A;  2WAD A;  1G6N A;  3JR9 A;  3G73 A;  2COM A;  4LG0 A;  3KP5 A;  1OCO H;  4XOP A;  1NK2 P;  4A3L J;  3GTJ J;  1MBE A;  5EFY A;  1XS9 A;  2P4W A;  1H89 C;  1PVE A;  3KZZ A;  3AG2 H;  2OCE A;  3U2R A;  1XPX A;  1JJ8 C;  1W5T A;  2ZY9 A;  4WCG A;  3V7C A;  3VP5 A;  2DOD A;  2NNN A;  4D5F A;  2FNP A;  2UXO A;  3ANG A;  5H9T A;  1EF4 A;  5DYM A;  2UV1 A;  3GBG A;  3ABM H;  5HLG A;  1BOA A;  3CJT B;  1DP7 P;  2QA4 I;  2HZD A;  4BBR J;  3OYJ A;  2IGK A;  3KNW A;  2E1M B;  5CYV A;  4HNT A;  2QSH X;  2X48 A;  1O57 A;  3GTG J;  3CUQ A;  4AID A;  5D8K B;  4CCK A;  2WA0 A;  1GV2 A;  2HS5 A;  5L3E A;  3L2Q A;  1QVT A;  2BW3 A;  2EFQ A;  5IY5 H;  2KJB A;  3VYR B;  2G9W A;  1ZRD A;  4DZJ A;  5E1X A;  3EUH A;  4UVC A;  4LLN A;  4BBS J;  3W6V A;  5BPD A;  2GBY A;  1AOY A;  1XDS A;  4UB8 C;  4OAZ A;  1YI2 I;  1IN7 A;  2DTZ A;  3GEU A;  5JI6 A;  4HNU A;  3FXL A;  4BAY A;  2DFE A;  1TC3 C;  2R7W A;  1AWC A;  3M4O J;  4GDF A;  3FXR A;  4B43 A;  1FBS A;  4XOT A;  3HOW J;  2MLK A;  5GTI C;  2W7N A;  5D4S A;  1Q1V A;  3JRA A;  4RLQ A;  2QGU A;  1FYM A; 
#chains in the Genus database with same CATH homology
 3DPJ A;  2XGD A;  4A3I J;  3BQY A;  3GTM J;  5M3F J;  4JL3 A;  2R0Q C;  4BXX J;  4XIC A;  3EUP A;  2HQ5 A;  2MW8 A;  2KT0 A;  3LHQ A;  1RET A;  2FX0 A;  2R7Z J;  1IV6 A;  4LOC A;  5F27 A;  3JRD A;  1X2M A;  2XB0 X;  3OIO A;  2LFB A;  3HE0 A;  5FHP A;  3GTL J;  1QPI A;  4ICH A;  2XPV A;  1W0T A;  2PMZ N;  3O60 A;  4L5E A;  2G3B A;  5J1U A;  3BTL A;  2R5Y B;  4X6A J;  5HAW A;  2XRL A;  3CWR A;  1ETO A;  3ON4 A;  2M8G X;  1BL0 A;  1MNM C;  3D1N I;  2D5V A;  1SAN A;  3RZO J;  2NX4 A;  3VOK A;  2L9R A;  1TWG J;  3A02 A;  4I76 A;  1ZKG A;  2LK2 A;  1NTC A;  2XGC A;  3LSG A;  3OSF A;  1RKT A;  3RZD J;  2DA3 A;  3ZQI A;  4XID A;  1LE8 A;  3LSR A;  2LKX A;  2UXP A;  4A3F J;  3TP3 A;  5JLW A;  3IH3 A;  3LSJ A;  3B81 A;  4A3G J;  3S1N J;  3JRB A;  1P7I A;  2Y9Z A;  1FIA A;  1OJL A;  1HOM A;  3S1M J;  2NVY J;  1T56 A;  3VIB A;  2DMT A;  2K9N A;  3SJM A;  3HM5 A;  3CJD A;  1FTZ A;  3CDL A;  2OF7 A;  3Q0U A;  1ETW A;  3MN2 A;  3CMY A;  3M3Y J;  2MSY A;  1TWH J;  4HNV A;  5IP9 J;  3HKZ N;  4XRS A;  1BW6 A;  4ME9 A;  1Y1V J;  3BRU A;  1ZK8 A;  1JJ6 C;  2XPW A;  5HBU A;  1K83 J;  3O8G A;  4M3D A;  3LOC A;  1A5J A;  5CW8 A;  4GCK A;  2DA6 A;  2CU7 A;  5JLX A;  3PM1 A;  3ZQC A;  5C4X J;  2EQR A;  9ANT A;  3KKD A;  1TWC J;  3DEW A;  3G1O A;  4JYK A;  4JX5 A;  1Z77 A;  3ZQG A;  1B72 A;  3BTC A;  3T6N A;  1R9T J;  1ZR4 A;  3TED A;  2G7S A;  4M3B A;  2R5Y A;  3G1M A;  1MBF A;  2LVS A;  1JGG A;  2JA6 J;  3HTH A;  3JRF A;  1U9O A;  2EH3 A;  1G2H A;  2L7F P;  4A93 J;  3CCY A;  3E7Q A;  3JRI A;  2YUS A;  1DU6 A;  2HDD A;  3VVX A;  3GTK J;  1I50 J;  3S5R A;  2COB A;  5EDN A;  1O4X A;  3RQI A;  1OCT C;  3FK7 A;  3PPB A;  5CXG A;  2ECB A;  5FGL A;  2YVE A;  3H0G J;  3JRG A;  2NOG A;  3OSG A;  5EF6 A;  4AF5 A;  4MLO A;  3HDD A;  2F07 A;  1IDZ A;  2DJN A;  4D7N A;  2AHQ A;  4FCY A;  3AQT A;  5E3M A;  1VF9 A;  3BG3 A;  2KDZ A;  3S1R J;  3V6G A;  3BR3 A;  3VVZ A;  3OOU A;  3S17 J;  2TRT A;  2VPR A;  2WAQ N;  2CJJ A;  5HSZ A;  5J1Y A;  5F04 A;  4DYR A;  1FEX A;  3FK6 A;  1AKH A;  3KKC A;  3ON2 A;  2EBI A;  3G1L A;  1JUS A;  2EZL A;  3QPL A;  1Y1W J;  2QTQ A;  2LR8 A;  2XSD C;  5BNG A;  5DTD A;  5IOZ A;  2Y30 A;  3TW6 A;  3S2D J;  2IU5 A;  4PXI A;  1UG2 A;  1QVU A;  2ZB9 A;  1E3O C;  1LE8 B;  1IUF A;  3K2A A;  1JUP A;  2ECC A;  4DYC A;  2JA7 J;  5DAJ A;  2NVX J;  2QCO A;  2ZCM A;  3BG5 A;  3PO2 J;  2G0E A;  2H1K A;  2HYT A;  2ID3 A;  5FKN A;  3GTP J;  3RD3 A;  2JA5 J;  5EEA A;  3HTJ A;  1IJW C;  2DMP A;  2FBQ A;  2CRG A;  2GUH A;  3G7R A;  5M5W J;  1HDD C;  2Y31 A;  5F1J A;  2E19 A;  4G12 A;  4QSH A;  4B4C A;  1RKW A;  5IOY A;  2HXO A;  4B3A A;  3F0C A;  4IHX A;  1FTT A;  3VW2 A;  4C3J J;  3NPI A;  2DA2 A;  2LY9 A;  2X6O A;  2V57 A;  2E2H J;  3Q0W A;  3IV5 A;  3NAR A;  1JKQ C;  2WB1 N;  2X9D A;  1Z0X A;  2WGB A;  3QPS A;  2DMQ A;  3HGY A;  1B72 B;  1PUF A;  4FTH A;  1VI0 A;  4AC0 A;  3SFI A;  3NAU A;  5CXI A;  1MBH A;  4ABZ A;  2JN6 A;  3VPR A;  5D19 A;  3S16 J;  1TWF J;  4JX4 A;  5M5Y J;  1YRN B;  5FLV A;  5C4Y A;  5HOD A;  5FKO A;  1H8A C;  4IHV A;  3WHB A;  5J1R A;  1JTX A;  5K7Z A;  5IYD J;  3IUV A;  4M3E A;  5D1R A;  1QRY A;  4UDS A;  2AO9 A;  3LJL A;  2HI3 A;  3B6A A;  5EG0 A;  4GCL A;  5EYR A;  2EZH A;  4I6Z A;  3HOV J;  2ZOY A;  2DMU A;  4CGR A;  2Y2Z A;  2CQQ A;  4JKZ A;  1WH7 A;  3DCF A;  3LWJ A;  4M3F A;  3BR1 A;  4W1U A;  1ZGW A;  3O8H A;  4MXM A;  2JMW A;  2XDN A;  3BTI A;  1P7J A;  1AKH B;  2JWT A;  4RBO A;  4MIM A;  1HDP A;  3JRH A;  4BY1 J;  3VVY A;  3EGQ A;  3FIW A;  2RHA A;  2Q24 A;  1I6H J;  2GLO A;  4XRM A;  1K61 A;  2DA5 A;  4NEL A;  2LP0 A;  2D6Y A;  1RES A;  5DS9 A;  1JT0 A;  2JA8 J;  3BNI A;  3K7A J;  4DW6 A;  4GFL A;  2XPU A;  3VOX A;  2PBX A;  2B63 J;  2DG8 A;  4MK6 A;  2G7G A;  4GFB A;  1WGX A;  5IPA A;  1BJZ A;  3B6C A;  2XGE A;  2QOP A;  3I4M J;  1JKR C;  3JSJ A;  4KWA A;  5F0F A;  2REK A;  2QWT A;  3LSP A;  1ZR2 A;  5AQC A;  2Y0S N;  1SFO J;  1MH4 A;  2HOT A;  1YRN A;  1JT6 A;  2FD5 A;  3S2H J;  1ZTR A;  2K9Q A;  3BTJ A;  1B8I A;  2VKE A;  2RAE A;  1LFU P;  1D5Y A;  2NVQ J;  2MGQ A;  1GVD A;  2CUF A;  4AUX A;  3QKX A;  5GP9 A;  4NDL A;  4DZP A;  1PUF B;  1GT0 C;  2HYJ A;  3VW0 A;  1U8B A;  2ZCX A;  2M34 A;  5C4J J;  2E1O A;  1ETX A;  2ID6 A;  3MKL A;  3ZQF A;  4C3H J;  2RAS A;  3VW1 A;  1SGM A;  3S14 J;  2R5Z A;  1ENH A;  4UUT A;  2IEK A;  2DMN A;  4JP0 A;  4C3I J;  4EEF G;  2UXI A;  2L0K A;  1JKO C;  4S0H B;  1DU0 A;  3NNR A;  1WPK A;  3HOU J;  5IYB J;  1AU7 A;  1BA5 A;  2VUM J;  4AC6 A;  3I4N J;  1RPW A;  3HGG A;  3FRQ A;  4X1E A;  5EG0 B;  2DN0 A;  2O8K A;  1APL C;  5IP7 J;  1VFC A;  1MSF C;  1X58 A;  1OCP A;  2JK3 A;  3A01 B;  2E2I J;  2OI8 A;  1HLV A;  4V2G A;  4MFD A;  3E7L A;  3S1Q J;  5IP6 A;  2O7T A;  4FIS A;  1UI6 A;  2ZOZ A;  3V78 A;  2GFN A;  3ZOB A;  1FIP A;  5K7H A;  3HOX J;  3UKG A;  2NVT J;  5E3O A;  1HF0 A;  4B1R A;  2O9L A;  1AHD P;  2HOS A;  1A6I A;  1F36 A;  2VKV A;  3AQS A;  2LD5 A;  5F0H A;  4A3K J;  2NP5 A;  3GTO J;  4A3D J;  3G56 A;  3HB9 A;  1JKP C;  4D5C A;  3QQA A;  2DG7 A;  2ELK A;  4A3C J;  1ETY A;  2MG4 A;  3ZQL A;  1XG1 A;  2K40 A;  1LFB A;  3C07 A;  2W48 A;  5EZH A;  2IAI A;  5EGO B;  2QIB A;  3NRG A;  1ETK A;  1ETV A;  2HOA A;  4FE7 A;  1UMQ A;  2QF7 A;  4NN1 A;  2NS8 A;  1ITY A;  5E3N A;  3MNL A;  4MFE A;  5C3E J;  3ZQH A;  3JRC A;  3RKQ A;  3CQZ J;  3F1B A;  3BR0 A;  4XRS G;  3FKI J;  2PZ9 A;  3NI7 A;  2DA7 A;  3P9T A;  3GZI A;  2OPT A;  1GUU A;  3HTA A;  4AYB N;  3WHC A;  2OER A;  4JNN A;  2DA1 A;  2FJ1 A;  3LNQ A;  4GCT A;  3KZ9 A;  5C44 J;  4A3B J;  5D18 A;  2Y9Y A;  1B8I B;  5FLM J;  3MVP A;  2XB5 A;  4V2F A;  3TW7 A;  1IRZ A;  2WUI A;  4L62 A;  3BR2 A;  3BJB A;  3A01 A;  2L7M P;  1HCR A;  2LTP A;  1U78 A;  5GPA A;  4BKX A;  3H3V K;  2WV1 A;  3VUQ A;  3IH2 A;  4CYC A;  2R5Z B;  3HOZ J;  3HOY J;  1S7E A;  5FKM A;  1U9N A;  3L1P A;  3BT9 A;  5GPC A;  2P81 A;  1UI5 A;  2ME0 A;  4YZE A;  1ETQ A;  1RR7 A;  3COL A;  2JJ7 A;  1IDY A;  4C2M J;  1TWA J;  1MBK A;  2IBD A;  2G7L A;  1FJL A;  4XK4 A;  3QBM A;  3BR5 A;  5F0C A;  1I3Q J;  2R93 J;  4MO7 A;  2YS9 A;  4ACI A;  2I10 A;  1MBG A;  2O7O A;  4Y52 J;  1T33 A;  4A3M J;  1UHS A;  3HTI A;  1JTY A;  2GM4 A;  3IH4 A;  3PAS A;  2UXH A;  5EGO A;  5IYC J;  3RH2 A;  3BQZ A;  3TP0 A;  5FMP A;  4RDU A;  4IEJ A;  3HEF A;  1X2N A;  1MBJ A;  4IHW A;  1BW5 A;  2M0C A;  1MSE C;  1H88 C;  2NP3 A;  2YU9 J;  4QIW N;  1POG A;  2EZI A;  4W97 A;  3NXC A;  4UUS B;  1ORK A;  2K9S A;  3Q0V A;  4IHY A;  1WI3 A;  3JR9 A;  1NK2 P;  4A3L J;  3GTJ J;  1MBE A;  5EFY A;  1XS9 A;  2FQ4 A;  2NS7 A;  1H89 C;  5M3M J;  1CQT A;  2GEN A;  5FKK A;  2M2E A;  1JJ8 C;  4HKU A;  2TCT A;  3ANP A;  5K7F A;  2ZCN A;  1ZQ3 P;  3BCG A;  3VP5 A;  2H8R A;  2N8G A;  4FE4 A;  4A69 C;  4D5F A;  4QTR A;  3JRE A;  4J19 A;  3HIM A;  5FJ8 J;  1IG7 A;  2UXO A;  3ANG A;  5H9T A;  1F43 A;  1EF4 A;  3GBG A;  4Y7N J;  5M5X J;  2QKO A;  1WH5 A;  5FKL A;  4A3E J;  4M3G A;  5K58 A;  1MH3 A;  4BBR J;  1WCM J;  5EZG A;  3BHQ A;  4GFK A;  1XC5 A;  2L7Z A;  3KNW A;  1IGN A;  2W53 A;  2EZK A;  2X48 A;  1NK3 P;  3GTQ J;  1VND A;  5J3L A;  1IC8 A;  3GTG J;  1W0U A;  1GV2 A;  1QVT A;  2E2J J;  2R92 J;  1GDT A;  3A03 A;  2DA4 A;  2LLK A;  2CQX A;  3FIS A;  4CYC B;  4DZJ A;  3CRJ A;  4BBS J;  2CUE A;  4BY7 J;  2ME6 A;  3W6V A;  3BR6 A;  1GV5 A;  2GBY A;  2YVH A;  3SDG A;  4D7M A;  4DYQ A;  1JUM A;  4UUS A;  3BG9 A;  4M6V A;  1OFC X;  2DTZ A;  4JX6 A;  3HBL A;  3GEU A;  5E3L A;  1TC3 C;  2HKU A;  3M4O J;  2UXU A;  2M9H A;  3C2B A;  3HOW J;  4A3J J;  3PO3 J;  1Q1V A;  2VI6 A;  5F08 A;  3JRA A;  3S15 J;  2HXI A;  3Q3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...