3BR5A

Crystal structure of the complex of rhodamine 6g bound to qacr(e90q), a mutant of a multidrug binding transcriptional repressor
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
186
structure length
184
Chain Sequence
b'NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKSEQIKCKTNREKFYLYNELSLTTQYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTQNINERIKLMNKFSQIFLNGLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator qacR
publication title Formal electrostatic interactions do not govern QacR-cation affinity
rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 77
structure length 184
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2007-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3br5A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3br5A02
2HQ5A 2N8GA 3GTMJ 1RKWA 4GCLA 2M8GX 3HE0A 3LWJA 4M3EA 3SFIA 4JL3A 1JKRC 3KKCA 4DZJA 2M2EA 1U9OA 1JT6A 1EF4A 4JX6A 5DTDA 1Q1VA 4B3AA 3ZQGA 1ZR4A 4XK4A 2DMTA 3K7AJ 2R7ZJ 2FBQA 3O8GA 4PXIA 4GFKA 1AU7A 5F08A 3M3YJ 1ETYA 1LE8B 3CCYA 2IEKA 1X2MA 1G2HA 2EZIA 5E3LA 5J1RA 2HOTA 3S2HJ 3OSFA 5EYRA 2DA3A 3GTGJ 5IYBJ 3JRHA 1OFCX 2ZOYA 2DA5A 3ON4A 2JK3A 2XPVA 5FKKA 1MBHA 2Y9ZA 3LOCA 5FKOA 3IH4A 2JN6A 1F43A 4RDUA 3C07A 3RKQA 4A3FJ 3F0CA 1SFOJ 4JKZA 4MO7A 5M5XJ 4GFBA 2EH3A 4BKXA 3BTCA 3QPSA 1I50J 4A3CJ 2R5ZA 4AC0A 1JKPC 4A3KJ 4C3IJ 1B72B 1QPIA 1TC3C 2L9RA 4M3FA 4MK6A 2P81A 2XGCA 1MNMC 3GEUA 4NELA 5C4JJ 3RD3A 3VW2A 4FE4A 2JA8J 3S1QJ 2XPUA 1JUSA 2G7GA 1NK2P 1RR7A 2XSDC 4ACIA 4D5CA 4IHVA 2YVEA 1ENHA 1POGA 1ETQA 4MFEA 3IUVA 1FTTA 5HODA 3I4NJ 4V2FA 3HTJA 4J19A 5FKLA 1ZQ3P 5K7FA 2CUFA 2OERA 4AUXA 4C3JJ 3JRGA 3SJMA 3HGYA 2RHAA 3NAUA 1BW6A 1UMQA 5EZGA 2KDZA 3EUPA 2R5ZB 3HOXJ 3BR3A 1MH3A 5FJ8J 3BT9A 3VVYA 3NARA 1HDPA 1MH4A 2HOAA 3GTPJ 3BHQA 3VP5A 2NP3A 2DTZA 3JRCA 1VI0A 2IBDA 1H89C 2E2IJ 5EDNA 3W6VA 3CWRA 3GTLJ 1XC5A 2COBA 1WI3A 3K2AA 3ZQCA 2X6OA 4M3DA 2D5VA 3P9TA 3GTJJ 2QKOA 5IYDJ 3COLA 2UXIA 3LNQA 2GUHA 3ANPA 3A03A 2DN0A 2QTQA 2WAQN 1FIPA 3G1LA 3GTOJ 2G7SA 3GZIA 2XRLA 4MIMA 4Y52J 4YZEA 2AO9A 1VFCA 3QKXA 5F27A 4L62A 1WH5A 1MBGA 3KKDA 3JRAA 2L7MP 4DYRA 3KNWA 4V2GA 3JRFA 4DYCA 1HCRA 1O4XA 1ZGWA 5C3EJ 5EGOA 2CRGA 3FK7A 2NVYJ 3RQIA 3H3VK 5CW8A 1CQTA 3T6NA 1Y1VJ 1MBJA 2XPWA 3DEWA 4A3LJ 3JREA 4A3JJ 2IAIA 3WHBA 2RAEA 5C44J 2LK2A 2CQQA 1P7JA 5GP9A 4D7MA 1OJLA 2DA6A 5FHPA 2E1OA 2E19A 1W0UA 1ETVA 5FLVA 2FJ1A 3S17J 4CGRA 1MBEA 5AQCA 4M3GA 2F07A 1IDYA 4S0HB 3TW6A 1T56A 4XICA 2M9HA 4XRSG 3VW0A 5F1JA 2DMQA 2YUSA 1X58A 4UDSA 4L5EA 1IC8A 1FJLA 3V78A 5DAJA 5EGOB 2WGBA 1I6HJ 3FRQA 4GFLA 2GENA 2WB1N 3BR1A 5FKMA 1PUFA 3JRBA 3Q0VA 2ECCA 2TRTA 4IHWA 1A6IA 4IHYA 3CJDA 1MBFA 3HM5A 4A3MJ 5H9TA 3VIBA 3PO3J 2W48A 3IH3A 2EBIA 5EF6A 5M5WJ 2QOPA 1VF9A 2LR8A 3V6GA 4JX5A 3M4OJ 2ME6A 5GPCA 3BRUA 2Y31A 3S1MJ 3HOWJ 1MBKA 2CU7A 1QVTA 4LOCA 2R5YA 3UKGA 2Y0SN 2H1KA 4A3IJ 1DU6A 2LKXA 1Z0XA 3HOZJ 2QWTA 3FK6A 4DZPA 2OF7A 3S16J 3TP0A 2L7FP 2CJJA 4A69C 3JRDA 2LFBA 2NVTJ 2WUIA 1ZR2A 3S1NJ 1D5YA 3BG9A 3QPLA 4Y7NJ 2YS9A 4XRSA 5F0CA 1HOMA 3ZQFA 2VKVA 4ME9A 3KZ9A 2YVHA 3DCFA 1OCPA 2KT0A 3BQZA 1IDZA 3GTQJ 2DMUA 4CYCA 1H88C 3BTIA 3BG3A 1ETWA 2LVSA 4UUTA 2LD5A 2R5YB 2DMNA 5FLMJ 2GM4A 2E2JJ 2JA6J 9ANTA 4GCTA 1P7IA 3BR5A 5M3MJ 3HTAA 1BL0A 1TWGJ 1Y1WJ 1BJZA 2OPTA 2REKA 2ZCMA 3PO2J 2VPRA 2NS7A 3SDGA 2FX0A 4M6VA 2XGEA 3HOUJ 2XDNA 1T33A 5E3MA 5E3OA 2CUEA 1TWFJ 1K61A 1RETA 2O7OA 5EFYA 2UXOA 2Q24A 2UXPA 2LLKA 3ZQLA 2HXOA 1APLC 4QSHA 2QIBA 1JGGA 1ZK8A 4AC6A 1SANA 4CYCB 3ZQHA 4XRMA 4B4CA 4UUSA 2W53A 3S5RA 2Y9YA 1TWCJ 1WGXA 3VOKA 1JT0A 4D7NA 2HKUA 2MW8A 4MXMA 2MSYA 3E7LA 3VUQA 1ETKA 4A93J 5IPAA 2R0QC 5J1UA 2X48A 3NRGA 2TCTA 5IYCJ 3D1NI 1WCMJ 3LJLA 2GLOA 3BTLA 3QBMA 2GBYA 5M3FJ 4FISA 5F04A 2ZB9A 3B6AA 1GUUA 2JMWA 4G12A 4JYKA 1JKOC 3NI7A 3JRIA 3NPIA 1ZKGA 1JTYA 3VOXA 4IEJA 4JNNA 3VVZA 4UUSB 2XB5A 2NVQJ 5FGLA 1JJ6C 3FIWA 3L1PA 1JJ8C 2PMZN 2R93J 3RZDJ 1JUPA 1IJWC 2K9SA 2K9QA 1JTXA 2OI8A 1IUFA 2O8KA 2XGDA 1HLVA 2VI6A 5JLXA 3VVXA 1U8BA 4A3DJ 4X6AJ 1UHSA 1FEXA 5FMPA 2NX4A 2WV1A 1UI6A 4GCKA 3O8HA 1ORKA 2CQXA 1ETXA 3OIOA 1LFUP 1IGNA 2EZLA 2AHQA 2UXHA 2PZ9A 2ID6A 3G1OA 4MLOA 1JKQC 5IP9J 3A01A 3GTKJ 4A3EJ 4A3GJ 2ELKA 2G3BA 1E3OC 5IP7J 2HOSA 5E3NA 5EG0A 2PBXA 3B6CA 4QTRA 5D18A 1R9TJ 3BG5A 1VNDA 2XB0X 2HI3A 3S14J 1RPWA 5J1YA 3G1MA 5IOYA 2O9LA 5C4YA 1W0TA 3BJBA 3HOVJ 3CRJA 3F1BA 4KWAA 3I4MJ 3OOUA 4JX4A 1B72A 4BY1J 2G7LA 5HAWA 3HGGA 1GT0C 2Y2ZA 3Q0WA 1Z77A 3GBGA 1SGMA 5BNGA 1GDTA 1XS9A 1PUFB 2NP5A 3LSGA 2VUMJ 4FTHA 3MKLA 1ITYA 1S7EA 1MSEC 2ZCNA 2ECBA 5K58A 1TWHJ 2DJNA 4EEFG 3A01B 5CXIA 4W97A 2DA1A 5D1RA 2UXUA 5EG0B 5C4XJ 2EQRA 1NTCA 2JWTA 2Y30A 4W1UA 5IP6A 3JR9A 1HF0A 2H8RA 4IHXA 2JA5J 3AQTA 3NNRA 1FIAA 5CXGA 2MGQA 2LY9A 2K40A 1A5JA 2DG8A 3PASA 1UG2A 1RESA 1NK3P 2M34A 4M3BA 3JSJA 3EGQA 5K7HA 1BA5A 3HEFA 4RBOA 1MSFC 4BY7J 2R92J 3IV5A 1IV6A 3HBLA 1I3QJ 2MG4A 1JUMA 3BTJA 3HTHA 5GPAA 3LSJA 1GV5A 3G7RA 1ZTRA 3ANGA 3IH2A 1K83J 4HKUA 5HBUA 1XG1A 3S15J 5HSZA 2HYJA 2HXIA 3MN2A 4NN1A 1GVDA 2JJ7A 2LTPA 2ZOZA 3BR6A 3CMYA 2V57A 3AQSA 1B8IA 3BR2A 1LFBA 3LSPA 1AKHA 4ICHA 3QQAA 2DA2A 1QVUA 2X9DA 2DA7A 2GFNA 1BW5A 5J3LA 2DA4A 3PM1A 3VPRA 3C2BA 3ZQIA 3HKZN 3BNIA 2ME0A 4JP0A 4FCYA 3HTIA 2FD5A 1UI5A 4MFDA 4QIWN 3HDDA 4FE7A 2HDDA 2NS8A 3H0GJ 4AYBN 1DU0A 3A02A 1HDDC 2NVXJ 1X2NA 3O60A 3B81A 4AF5A 2I10A 3LHQA 4NDLA 3TW7A 2YU9J 3E7QA 2JA7J 3MVPA 5IOZA 4BBRJ 1YRNA 1FTZA 3TEDA 1U9NA 5K7ZA 3S2DJ 2NOGA 1AHDP 4A3BJ 3ON2A 1B8IB 5D19A 3HIMA 2LP0A 2G0EA 4I76A 4BXXJ 1GV2A 5EEAA 2HYTA 1AKHB 5EZHA 2K9NA 5JLWA 1U78A 3CQZJ 3VW1A 3HB9A 2L7ZA 2DG7A 2E2HJ 3MNLA 2IU5A 3DPJA 3TP3A 2RASA 3FISA 3Q3SA 5DS9A 1TWAJ 1ETOA 2QCOA 3ZOBA 3BCGA 3G56A 4BBSJ 2DMPA 3BR0A 2L0KA 2VKEA 1IRZA 2EZHA 4XIDA 4C3HJ 2B63J 4DYQA 1QRYA 4I6ZA 3NXCA 3Q0UA 1WPKA 1IG7A 3PPBA 4ABZA 5FKNA 2O7TA 3HOYJ 4D5FA 5F0HA 3OSGA 1YRNB 1OCTC 3BQYA 5F0FA 3WHCA 5M5YJ 3RZOJ 2QF7A 1LE8A 4C2MJ 3RH2A 1H8AC 4DW6A 2ID3A 2M0CA 2EZKA 3FKIJ 2ZCXA 1WH7A 2FQ4A 3CDLA 2D6YA 4HNVA 1F36A 4X1EA 3LSRA 1RKTA 4B1RA 3S1RJ
chains in the Genus database with same CATH superfamily
3QU3A 2HQ5A 3FX3A 4MTDA 4GCLA 2VJ4A 3V7CA 3OMYA 3HE0A 2CQKA 1KQ0A 1EA3A 2BE5F 3Q9VA 3KKCA 3WTWC 5DYMA 1P2FA 2FEZA 4JX6A 2PG4A 1ZR4A 2DMTA 2DW4A 2FBQA 4PXIA 1EH6A 4PSWA 2VBWA 3FXOA 1ETYA 4I01A 2IEKA 5HLHA 1X2MA 2OQGA 1Y6IA 4NQWA 2W57A 1LKXA 3S2HJ 3GTGJ 5A2QZ 4KT6A 3RKYA 3J7AO 2FE3A 5FKKA 1D1AA 1R7JA 2NAZA 2OU2A 4RDUA 1U8RA 1Z3YA 1MNEA 3OYNA 4A3FJ 4ZYGA 4MO7A 4R8HA 1SFOJ 4BKXA 2JVGA 1VZ0A 1J9IA 3FM5A 4A6DA 2R5ZA 2BY1A 2R7DA 4C3IJ 2RV8A 5IY5H 4M3FA 4N4NB 4E7IA 5H20A 2PQ8A 3A0HC 3IP4B 3E6BA 4DBQA 2D1HA 4UY8I 5CYVA 3CLQA 1U6GA 1NK2P 2RN7A 3CMEI 4IHVA 1WJDA 1POGA 3F8MA 4GRIA 3CCVI 3V7SA 3I4NJ 2QKMB 4IF4A 3TKYA 2W7NA 1RUNA 1ZQ3P 2CUFA 4XORA 1I1SA 1R1TA 2HKOA 4C3JJ 2M5WA 2RHAA 3HGYA 4ZJZA 2KDZA 3K4JA 3HTSB 4J00A 3HOXJ 3ZMZA 4XSXF 5FJ8J 4XLPF 3NARA 1HDPA 4RAZA 2HOAA 2CH0A 2V1XA 3IAS2 1U3EM 1ZELA 3OYAA 5D8LB 1L3LA 2IBDA 3CP2A 4ENNA 1WI3A 3K2AA 3GYHX 1UHWA 2X6OA 1BR2A 3P9TA 1FZPB 2CW0F 2NYXA 2BW3B 3BDDA 3Q5FA 4ZDPA 3DPUA 5IYDJ 4LLNA 3ANPA 2HPMA 2DN0A 4HV6A 4IJAA 5F64A 5DD4A 1H0MA 3G1LA 3WTYC 3PFIA 2VJJA 1R49A 1GLNA 3ERED 3LAJA 3FXQA 3TO9A 3I4PA 4R1HA 1MDMA 3GFLA 4MIMA 4EJTA 4YZEA 2DYSH 1DP3A 2QQ8A 5LGTA 2JUCA 1XGNA 4LG3A 3KKDA 1X4PA 1IRXA 1Y8RB 4OINF 4HV5A 5BOXA 1ODDA 1UAAA 4PFPA 4DYCA 3ZR8X 2VQCA 2F4OB 2K86A 1XDUA 1VQOI 2R7XA 2Q0OA 1MJAA 2QWWA 3EUKL 3HHGA 3H3VK 1M1EB 2GAUA 2CW7A 4HOBA 2R7RA 1HKTA 4IKFA 1Y39A 2LF8A 4A0XA 1I5ZA 2LK2A 2ZSIB 2VKDA 3CC7I 2DK5A 5AONA 3I59A 2E19A 3GMEA 2OCCH 2QSGX 4CGRA 3ML6A 5DCFA 1IDYA 4X0GA 1YG2A 2PBIA 5F1JA 1D0ZA 2ZMEB 3SDBA 2R7UA 1SFEA 2DMQA 3OS0A 1QPMA 1IC8A 2OZUA 1S6LA 1UZCA 3V78A 3QRFF 3CJNA 2L9SA 2XSJC 2L9NA 1KU7A 3OYMA 2R7TA 3WGIA 1YHQI 3SQNA 3FMSA 3AKZA 3IC7A 2QUFA 1PUFA 1YS6A 2HTJA 4BDYA 1H9TA 2TRTA 4IHYA 5CKTA 4A3MJ 1VQ5I 4KFCA 4NC6A 2FQ3A 1B9MA 4PDKA 3V8LA 1F1ZA 4OIRF 2W48A 4E7ZA 3CO6C 3O3KA 2A3SA 2EIMH 4D0PA 1QHGA 2WWYA 1V5EA 2HPIA 2UZKA 2QA4I 3UNGC 4BEHA 4JX5A 5KNLA 4KDPA 3S1MJ 4M72A 3M1EA 2X6XA 3HC7A 1MNDA 1OMIA 2XASA 4A3IJ 4MNUA 3ZPLA 2K7LA 4FASD 1Z0XA 2LREA 3S16J 4HRIA 1OQYA 3KE2A 3SZTA 4A69C 2QQ9A 5ICEA 1W1WE 2KRCA 2BBYA 3FXKA 3QOEA 4NQWB 4E70A 2RREA 4PSXA 1DDNA 1KYZA 3I54A 3N97A 2E35A 2WADA 3SHFA 3U21A 4CO8A 2K9LA 2MD5A 2KRHA 1IDZA 2A05A 2ZBKA 2XAJA 2WB1A 4NUBA 1H88C 3WU1B 1IF1A 4CH7A 3S3NA 3AG1H 2R5YB 3BPXA 2GM4A 4OIQF 9ANTA 2QSHX 1P7IA 3KX2A 1XSDA 3BCBA 4U7DA 2W84A 3RDIA 2ZCMA 1ZARA 1B6AA 1DQUA 3DQVC 2WAEA 1Y1WJ 1UB9A 1J75A 4O5VA 4BUPA 4FT8A 2BVLA 1O3QA 2XDNA 3RTRA 4XKCA 2M3AA 2ZJ2A 1KU2A 4XN0A 3J80K 2LLKA 1ZHFA 3H1CA 4I02A 3J81K 2CYYA 4B4CA 3HG9A 1FYMA 4UUSA 2W53A 2EIJH 2Y9YA 2OQRA 3ZMSA 2QQAA 1JT0A 1OLTA 3K2ZA 3BJOA 4GXOA 2MSYA 3VDXA 3OS2A 1ETKA 3LSMA 2CWEA 3TMOA 1U5TA 2R0QC 1T8IA 5J1UA 1G8XA 2XAFA 1LDDA 2LY1A 2BY2A 3FMQA 3I0TA 3QBMA 2R7VA 3P9IA 2GBYA 5M3FJ 2PI0A 4FQGA 3ZMDA 3KYCB 3JW4A 1YW7A 2Z33A 3ZRGA 3F8FA 1XGMA 3K4BA 5F04A 1RR8C 4ON0A 3HSEA 3IKVA 2XDVA 1R00A 3DU6A 3J80Z 1JKOC 2XVCA 3HYIA 4GYIA 4EM1A 3MMYB 2F5VA 3NPIA 4XMYA 3IWFA 1HW2A 3V8KA 4L18B 3VOXA 4IEJA 4JNNA 3HRUA 3JCUC 4EVIA 3J81Z 1I27A 3FXUA 2XUBA 3GFJA 1IN4A 1JJ6C 1AA7A 1JJ8C 3VFZA 2R93J 3RZDJ 3KCCA 4BHPA 1MMSA 2EFNA 4L9NA 3N4MA 1IUFA 2B9SA 2JZYA 3QYEA 2R3SA 2VI6A 1MIJA 5FMPA 1WWXA 4X6AJ 1FEXA 3MEXA 2NX4A 3G71I 4GCKA 2O5RA 2CQXA 1SVOA 1I1GA 3O8HA 3FXJA 4GGGA 5BMZA 1ETXA 2H27A 2EZLA 2UXHA 2VOPA 2PJRA 2WY7Q 3M7GA 1UELB 4OWRB 5BQTA 3KYDB 1GVJA 4KIFA 4MLOA 4ZC3A 4E6KG 4B48A 2VLAA 2L01A 2M0MA 4LB5A 5LGNA 2V9PA 2ISYA 4WWCA 4I09A 3B6CA 4QTRA 5D18A 1KGSA 1NHAA 5ILUA 1FSHA 5J1YA 1CF7B 4J01A 3VTIA 3HOVJ 1D8KA 3I4MJ 3OOUA 4BE1A 1B72A 2CGPA 3DU5A 3EETA 4RAGA 4YFXF 1RNLA 4IQ4A 1HKQA 4BJ5C 1TNSA 4ASNA 2GXAA 3GBGA 4F91B 1WJFA 5BNGA 2NP5A 1PUFB 3LSGA 5CVVA 3MKLA 2ZCNA 5K58A 2QBYB 3E6CC 2DJNA 2EPFA 5FFXA 3W2VA 5HNFA 1BI2A 1Z21A 4LB6B 3DBRB 3A2KA 2UXUA 2W24A 2EQRA 3JR9A 1HF0A 1J0RA 3NS4A 1FIAA 2MGQA 2LY9A 4C2TA 1V4RA 1EKEA 1NK3P 2V6EA 2Z1DA 3EGQA 3QPHA 2CUJA 3CUQB 3HEFA 4RBOA 3CF2A 1ZG3A 4CXFA 2WV0A 2O03A 3HTHA 3ZMVA 4ZTFA 2EV5A 1Z7UA 3BZCA 4GYGA 1I6XA 5B66C 1XG1A 3S15J 5HSZA 3J7YJ 2K5CA 2ZOZA 4PJ0C 3AQSA 4ZZDA 2RNGA 1PJRA 3ZN1A 4IXAA 2EWNA 2RGVA 5LHIA 5KCMA 3KPHA 4CCOA 4C2UA 2GFNA 1TLHB 1VQLI 3SZGA 3PM1A 4A5MA 3ULQB 3F22A 3PNTA 4AVPA 5HS9A 2E5ZA 2M1BA 2NS8A 3A0BC 3TQNA 4AYBN 3O60A 1X2NA 2OTJI 2O0YA 2YU9J 4Q5SF 3QU6A 3T8RA 3E7QA 2VODA 1TT0A 3WTZA 4UV8A 4OAYA 4HAMA 5DM7F 2KPMA 2P7CB 4IRIA 4G94A 3KZIC 5K7ZA 3HIFA 3ON2A 3TL4X 3BWGA 3HIMA 1GHCA 2HYTA 3VB2A 3LSHA 5JLWA 3HB9A 2CQ7A 2LY2A 3DTKA 2R7WA 3DTEA 5F6FA 2IU5A 2KQRA 4MQ9F 5E8IA 3GZ6A 3DPJA 2BVMA 3TP3A 2JQ7A 4RGUA 4RAYA 3Q3SA 3F23A 1G6NA 5GTHC 1E3HA 1TWAJ 4CA0A 3ZOBA 4N0BA 4XRFA 3BCGA 1U2WA 2L0KA 3L9FA 3GEZA 5E20A 1FP2A 2CW8A 2LC2A 3PSFA 1FOKA 3EUHA 1WPKA 3H9JA 3KP2A 4MGRA 4RM2A 3HOYJ 4D5FA 5F0HA 1PVEA 4V19K 1OCTC 5F0FA 2QF7A 5JI6A 5LEJA 4U9NA 3G6EI 4C2MJ 1SAXA 1N77A 2XIGA 4RLFA 4OD4A 1K7AA 1MW7A 1USTA 4UUVA 1X3ZB 1FYLA 3OYHA 2EZKA 3FKIJ 2W00A 3CDLA 1T0FA 1OYIA 1HW1A 4B1RA 3PNVA 1ZLKA 1W7PD 5BS6A 3JSPA 1RKWA 2E71A 2FOWA 3H5RA 4M3EA 4ZDLA 3WTTC 4BXUA 4DZJA 2X4HA 5KAIC 2VT2A 5CQGA 1UJ8A 3CMAI 3RPUA 1QNTA 1Q1VA 4ENMA 3ZQGA 1STZA 3K7AJ 4GDFA 2VJIA 4GFKA 2FBKA 5FD6A 1AU7A 1R1VA 1A04A 1XGOA 2BHZA 2Y0MA 2FNAA 2L02A 5F08A 1HBXG 2VB6A 3CCYA 1FWZA 3O2PE 5J1RA 4F55A 2KZGA 4LMYA 2HOTA 2CV1A 3OSFA 1F4KA 3RSNA 1A31A 3K10A 5IYBJ 5FB2A 1OFCX 2ZOYA 2DA5A 5B1AH 3IAM2 2XPVA 2UXNA 1MBHA 3LOCA 2STTA 2JN6A 1F43A 2ESNA 3LA3A 1YS7A 3ABKH 2VKHA 3C1DA 3Q9SA 5M5XJ 4GFBA 1G3TA 3BTCA 3RKWA 4A3CJ 3WGHA 2V1NA 1G3WA 4I0BA 1B72B 4XONA 2NNNA 4MK6A 2K9MA 2V6CA 1HXDA 5KVRA 3GXOA 4NELA 3OOPA 2VASA 5HDNA 2JA8J 5B3SH 1IN6A 5K5RA 3BG7A 3S1QJ 1KU9A 2F4MB 4A0YA 1JUSA 4BAYA 5DV5A 2Y48A 1NH3A 2YVEA 4UVAA 1SFXA 1FTTA 2BW3A 3AAFA 2KLOA 3F21A 1TBXA 2DJIA 2EFQA 2G7HA 5FKLA 4AWXB 1ZRDA 2P6SA 3HL2A 3T8TA 4WX9A 3KEQA 4KYWA 4KA4A 1BW6A 4G8XA 1HA8A 4BU2A 1U5TC 1DGWY 3AL0B 3BR3A 3KETA 1G3YA 3BT9A 2L54A 2PLYA 4H0EA 4UVCA 3I64A 3DKWA 3T1BA 3H5NA 3NEUA 2E7WA 2V7FA 2DLLA 3V42A 2BY0A 1VI0A 3GTLJ 2KHMA 1SFUA 3OYCA 3ZQCA 1O57A 4M3DA 1JHHA 4L9TA 1B9NA 2G7UA 3DEEA 4RMNA 4LIUA 3REOA 4HNTA 3H92A 2WAQN 4IL6C 4Q48A 1FIPA 1I3AA 2Q2EA 4L0YB 2ACJA 2G7SA 2FMLA 3DBHB 4NNJA 4P55A 2AO9A 3QKXA 3TDZC 5F27A 2NNYA 2ZMEA 1XSXA 2ZO4A 3IRRA 3BY6A 4HNUA 3SXYA 3KNWA 2DFEA 3JRFA 2CO5A 1YTYA 1O3SA 1SEUA 1BI1A 4WXHA 3WTUC 3FK7A 1GXQA 5CW8A 4LG0A 3T6NA 1Y1VJ 1MBJA 3DEWA 2X6YA 3M8JA 2HVSA 2D1VA 3WHBA 5BPIA 3OR1C 1AWCA 1LVKA 5GP9A 5KK1A 1OJLA 2DA6A 4B8XA 1QZZA 2O3FA 1Z67A 2PMUA 1FY7A 1C0WA 2HNHA 1IZ1A 1UG0A 4AU7A 3S17J 1MBEA 3VOEA 1K6OA 4AYBA 2MH9A 3PIOF 3HOSA 3HOTA 2P8TA 1W5TA 2RKHA 2V9VA 1X58A 2XAGA 2VL8A 3I55I 3QP5A 1X1DA 1I6HJ 1S7OA 1QHHD 3OIPA 4HLYA 2XAUA 2WB1N 5FKMA 4EV0A 4KMFA 2XROA 3JRBA 4XQFA 5KHDA 2WC2A 3K4CA 4XLNF 1R5HA 4IHWA 2BZTA 1A6IA 3FBNB 4TV7A 2LRDA 5H9TA 3RCOA 1VQPI 2MABA 3ZP5A 3IH3A 2E1MB 1DUXC 1Y0NA 5LLQA 5M5WJ 1X19A 1BBYA 1PP8F 3LSKA 5GPCA 1FLIA 1VQ6I 1L0OC 3HOWJ 3P7NA 4UB8C 1MBKA 2CU7A 4LOCA 3MKYB 2P5LC 2R5YA 1LVAA 4U0VA 2HR3A 3FK6A 4YFKF 4II3A 1VQ7I 5DDGA 2OF7A 2L7FP 4R79A 1JXSA 3JRDA 2NVTJ 1PUEE 1R4MB 1ZR2A 3QPLA 4M6YA 1WI9A 5LRSA 4XRSA 1TP4A 5F0CA 3EDPA 3ZQFA 4BACA 1LPQA 3KZ9A 3DKXA 4JBAA 3SYTA 4WF2A 2DFIA 1OCPA 3DCFA 5JHFA 2OA4A 3KEYA 5HLTA 4ESFA 2W25A 2ZJRF 2GZWA 2DMUA 1P4AA 5HLGA 1OR7A 1UHMA 2EINH 1T95A 2NS0A 3BTIA 3U9GA 1ERDA 4UUTA 2DODA 5FLMJ 4YG2F 3PIPF 3BR5A 1LQ1A 3HTAA 4IRHA 3VSLA 2IS6A 1W36C 3GCMA 3PO2J 1Z91A 1KQ9A 4WXCA 4BNCA 2NS7A 5LEKA 3I9V2 1YI2I 4M6VA 1LEBA 2JVHA 5E3MA 5E3OA 2CUEA 1DP7P 1TWFJ 4OU0A 5EFYA 1JHFA 2UXOA 1X3UA 4A0ZA 3ZQLA 4IOAF 4DJAA 2MLGA 1H9GA 2R4GA 2X1EA 4RA2A 2V1UA 1XN7A 3LQQA 4AIJA 3T0YA 2FMYA 5HDKA 1ZK8A 1JGGA 4XOPA 4CYCB 2KZVA 2JRTA 4ESJA 1J09A 1FOXA 3EUHC 3VOKA 1WGXA 2ZJPF 5LBQA 2PX9A 5HOOA 4D7NA 2MW8A 3CLOA 3TOBA 3NQOA 5IPAA 3LA7A 5IYCJ 5J8CA 1WCMJ 3LJLA 3BTLA 1KONA 2FJI1 4LGWA 4EJOA 2CFXA 3DLAA 4FISA 3KP4A 1T0FC 5DUIA 4IPAA 1G59A 2XAQA 2M4KA 2ZB9A 1GUUA 4CYDA 2JMWA 5FRMA 1LNWA 4P1WA 4H4KC 1JE8A 2HYGD 3HXLA 2KMUA 5FGLA 2Q2EB 2XB5A 2NVQJ 1EH7A 4Y33A 3L1PA 3WG9A 3OYDA 1V3FA 4NB5A 1JUPA 1X4OA 3K1MA 2OUMA 2K9SA 2K9QA 1JTXA 1CF7A 2OI8A 3LAPA 2O8KA 1QBJA 1ON1A 2EILH 4A5NA 1YITI 3S2WA 5K1YA 2Z99A 1BOBA 1UCRA 1OYYA 2VONA 4Y15A 4XL9A 3ERMA 4HG2A 3OYLA 1ORKA 2BEOA 4LG0B 1JI8A 4I0AA 4M73A 2QQBA 2IGNA 2WAQA 1LFUP 3GF2A 2AXTC 2ID6A 4PGGA 3G4SI 4L0ZB 1N25A 2QBYA 4IO9F 2HU9A 1BI3A 1IXSB 1YJ9I 2ELKA 1XSVA 1MKMA 2JPCA 4EQQA 3ECHA 5IT3A 2MYSA 1ZRCA 3BG5A 2STWA 4EGZA 1XD7A 5C4YA 2HWVA 1W0TA 4KWAA 3CRJA 3F1BA 2ADUA 5CVRA 4IZZA 2OTLI 4XLHA 2ELJA 4ZYHA 1GT0C 3CUQA 3Q0WA 1Z1DA 3V4GA 2Z9OA 3BJAA 3L2WA 4XM3A 4HSTA 1GDTA 2D45A 2VUMJ 3OS1A 1ITYA 2PMZA 1S29A 2QM3A 1MSEC 3LA2A 3OL3A 2RDPA 1IRFA 2DFFA 3KZZA 3A01B 4W97A 1YJWI 2DOFA 4HX8A 4KICA 4B44A 4A12A 1NTCA 2JWTA 2Y30A 5IP6A 4IHXA 1XTAA 3V7RA 2OAZA 2BHYA 3AQTA 3K6GA 1R6RA 5CXGA 3K70C 1YQAA 2K40A 5HS8A 3TBIA 2DG8A 3WTXC 1MMDA 1RESA 4BXFA 4F7ZA 5K7HA 1BR4A 1MSFC 2R92J 1IV6A 1FYKA 1Z3XA 3HSRA 2ICWG 4A6EA 4IX7A 2VJ5A 3G7RA 1GV5A 2ZFWA 4UB6C 1PDNC 1K83J 1YW9A 1J2XA 1W4MA 2KISA 2IP2A 2HXIA 4LFUA 1BIAA 5TISC 2LTPA 3BR6A 3CMYA 2J5PA 2V57A 3BR2A 4M9XA 2R7FA 3PJRA 3LQRA 2E34A 2AS5F 3LSPA 4ICHA 3FXMA 1O7LA 2ZMEC 2WBMA 1BW5A 3VPRA 2JTVA 1R71A 2GWRA 3C2BA 3HKZN 4FCYA 5L3BA 1D0XA 1UI5A 4FE7A 1V54H 4KIGA 1TL8A 3H0GJ 3A02A 3WTVC 4U88A 2QENA 3GVAA 2DOAA 3TW7A 2JA7J 2W82A 1QZEA 2X6WA 4RM3A 4MTEA 1O7FA 3MVPA 5IOZA 2HVRA 3B02A 3MFKA 2A6HF 5D19A 1B8IB 5D6FA 2LP0A 2G0EA 3CJRB 4I76A 4IQJA 4F3QA 2NRAC 1XB4A 3M8EA 5BPDA 1AKHB 4M9SA 1K6YA 1U78A 1TQIA 1FSEA 3MNLA 3MZYA 3PQJA 3EQLF 1A36A 1X1CA 2HKXA 4ZDOA 1HW5A 4ENJA 2FOKA 2B3WA 1ETOA 3GFIA 4LJZF 3KEOA 4BBSJ 3G56A 4HYEA 4BL0B 1IRZA 4XIDA 1B4AA 3FDYA 2L9VA 4C3HJ 5E1WA 4DYQA 1QRYA 1X3WB 3WE3A 4I6ZA 3NXCA 2L2OA 4XSZF 3PPBA 1Z6TA 3F9KA 5DCMB 5FKNA 3W2WA 5JVTA 2E36A 3H0DA 3N05A 4FETA 1O3TA 5M5YJ 2ETHA 2QGUA 3RZOJ 4CHUA 3ZN0A 2PFBA 4DW6A 1BM9A 2ID3A 3WGGA 2ZCXA 3HZJA 4UV9A 3FWEA 2ISZA 2A6TA 4HNVA 1F36A 4U7BA 4X1EA 3CC2I 1RKTA 3MAJA 3S1RJ 3CCLI 2IS1A 2FBHA 1QZYA 4Z6YA 5GADJ 2PMHA 3FZVA 5E79C 3LWJA 3SFIA 4JL3A 3WG7H 3HRMA 1WVRA 2M2EA 2PJPA 5HVQC 1EF4A 2K27A 4B3AA 2P5KA 5DUKA 3O8GA 5J8FA 2VQGA 3R0JA 2E60A 3LFUA 3M3YJ 5ICFA 2GQQA 3DLLF 1SC7A 1G2HA 2HZDA 1HKSA 3HRSA 2BYVE 1T38A 1K79A 3A4CA 4M9ZA 1KYWA 3GFMA 5EYRA 2DA3A 4I7HA 1TT5B 2BXZA 3OL4A 2M45A 4PUSA 1MZBA 1OR7C 4PFOA 5ICGA 2Y9ZA 4MQVA 5CVIA 2H09A 3CD6I 1FT9A 3RKQA 1NG6A 4PJJA 2COMA 4JKZA 2L3DA 3GX4X 2EH3A 3ISPA 3PL8A 3WODF 1I50J 1JKPC 4A3KJ 3JTHA 5GTIC 3MD2A 1QPIA 1V5FA 5E1ZB 2P81A 5H6RA 4U9LA 1MNMC 3GEUA 4Z2YA 1MD0A 5C4JJ 3RD3A 2B0LA 3E6DA 4U87A 3V8JA 1QA6A 3VW2A 2DT7B 4YIIA 1QU3A 3HPGA 1RR7A 2XSDC 4II2A 1BC8C 3IKTA 4ACIA 2LMDA 5D4RA 1ENHA 3IHUA 3OR2C 4E7JA 5FLXK 4IRVA 5EEHA 2BV6A 1SD7A 4MFEA 1IXCA 5GAHJ 3QAHA 5HODA 2OCEA 1QGPA 4V2FA 1S3JA 1OPCA 3E97A 2KJBA 2ZXHA 4BJ6C 3JRGA 3SJMA 2XF6A 2E5NA 4EM2A 3EUPA 3HHHA 3K4KA 2MC4A 4CCJA 1IN5A 3FXLA 3KP3A 4DQ2A 1MGTA 3VVYA 3VODA 1MH4A 3GTPJ 2F5DA 3VP5A 4C2MA 5B5EC 5CLSA 4BH9A 5J4YA 5E18F 2NP3A 4PK4A 1H89C 2IJLA 5EDNA 1G4DA 2XGXA 1Y8QB 5L3DA 4QWQA 3F6OA 3CCUI 3L2CA 3K1PA 3W6JB 5JVGF 4UNOA 1OCZH 5FLXZ 1YJNI 2VQHA 3U1DA 3GTJJ 4YIFA 2VE9A 1SVLA 1B59A 2UXIA 3LNQA 4FX0A 4YRVA 2GUHA 3A03A 3BOQA 2QTQA 2FNPA 2BXYA 5D4SA 5JHUA 4DIQA 3L2QA 4RGXA 2LSOA 4JQFA 2LKSA 2D2WA 3GZIA 2XRLA 2XRNA 3NWTA 2HYFA 2F5EA 3AG4H 2LH9A 5LGUA 5ILVA 5TJJA 2Z3YA 4L62A 1WH5A 2ZXJA 1MBGA 1IN8A 5EJCA 4DYRA 4KISA 1HCRA 1WJBA 1O4XA 1ZGWA 5C3EJ 4HDUA 3A1YA 2CRGA 3M8FA 3RQIA 3E1SA 3K4LA 3J7AY 4A3LJ 2UXXA 3JREA 2IAIA 5JFRA 3P9CA 2RAEA 3CTAA 4NC8A 4D7MA 4P9FA 3EYIA 1FNNA 3HKZA 2IS2A 2Z16A 3COAC 1ETVA 2ZJQF 1T39A 3LSTA 2F07A 5GAEJ 3GO5A 2Q8KA 1LEAA 4XICA 4XRSG 1T98A 3K4NA 3CUQC 3PNYA 3IWZA 1YLFA 2FU4A 3VYTB 5JR3A 2YUSA 3L2RA 4E7LA 4I2OA 1FJLA 2FXAA 4XLCA 1SMTA 5EGOB 5DAJA 2ZXIA 3M07A 2VPLA 1IO2A 2FF4A 4GFLA 4LD5A 1BN5A 1FMVA 1BR1A 2GENA 4MEYF 3BR1A 3Q0VA 1BIBA 4CZZA 4QPQA 4XKVA 3CJDA 1SD6A 1MBFA 5J6XA 3VIBA 3R0AA 4RB3C 2H1LA 3P9KA 1IRGA 2EBIA 4NC7A 3TDUC 5FROA 2A6EF 2QOPA 2KFDA 1VF9A 3V6GA 4EMSA 5CVUA 3M4OJ 3S32A 1RZ4A 2ME6A 2Z5UA 4OIOF 3H3UA 1QVTA 3DPTA 3U2RA 4AIHA 1W36D 1Z05A 3HOZJ 2QWTA 2L4AA 2CV2A 2LBFB 1TNTA 3HTUA 3HUGB 1FPQA 5LRRA 2LFBA 2P4WA 4RAFA 2WUIA 3S1NJ 4G7OF 1Q1HA 4Y7NJ 3R60A 2YS9A 2MA3A 2KL4A 2EV6A 3D5LA 1HOMA 3LSIA 2VKVA 3ABLH 2CQNA 2K3FA 2VBZA 4CCNA 3FBIB 4HQMA 4EGYA 3I56I 3FM3A 3GTQJ 4KIBA 4CYCA 2VN2A 3SFZA 1LDJA 3OV8A 2VC1A 1ETWA 2LVSA 2MD0A 4RB0A 2DDBA 2EB7A 1FBUA 3MQ0A 1YX5A 4Y13A 3I3LA 4P9UA 3T5XA 2DXIA 2OC6A 1A35A 1ZRFA 4OD5A 1TW2A 1PP7U 1FBQA 2VPRA 5B1BH 2IS4A 1D1BA 2ZCWA 4B3XA 3HOUJ 1T33A 5DEQA 2GOMA 2GA2A 3C7JA 1K61A 1RETA 2QKLB 2UXPA 1SAUA 1APLC 2KP6A 4NHJA 2LG4A 3I5UA 3LMMA 2WTEA 2DOEA 2X51A 1SANA 3OWTA 2ZNYA 3RPUD 4XRMA 4CCKA 1TTYA 3VEPA 3J7ZI 4RB1A 1QO0D 4KN4X 1W7PB 5ERIA 1LFPA 4IHTA 1U0JA 2QEXI 3PSIA 2HKUA 4MXMA 3H9GA 2H94A 3E7LA 4GCVA 4A93J 4CICA 2H6BA 3QYFA 2X48A 3X2QH 2TCTA 3D1NI 2L5QA 2IGMA 4BJTA 2ZY9A 4LK0F 4DOZA 3OYIA 4CUGA 3FHZA 3S3MA 2IW5A 2DQRA 2IA1A 4Y4RA 1ZG1A 3NI7A 2ZKZA 2Y69H 3F8NA 3CO7C 3U1KA 1RUOA 4LLLA 1JTYA 4G7HF 3ECOA 1LDKB 3CDIA 1ZGJA 1V5GA 2PMZN 3DEUA 1OCCH 4OIPF 5HNHA 1YO5C 3UR3C 1R36A 1W5SA 2G9WA 2V79A 2EJRA 4HF1A 2XGDA 5JLXA 3VVXA 2DYRH 1YOVB 4HQEA 1U8BA 1UHSA 3RI4A 1MMGA 2WV1A 1UI6A 2QZ8A 3DPLC 2K3PA 3KP6A 3VSKA 4RB2C 3P5JA 3CCQI 2NVUB 1ULYA 3S8PA 1VTNC 3OIOA 4O6JA 1T2KA 1IGNA 4N4OB 2AHQA 2EFWA 3E3VA 4Q47A 4G7ZF 1J7KA 3E5QA 1JKQC 3GTKJ 3A01A 2VIXA 2AQFA 3C18A 4CCLA 5IP7J 1E3OC 2HOSA 3AL0C 2PBXA 4I98B 1R9TJ 1VNDA 3S14J 1D3YA 2HI3A 1OKRA 2MBFA 4QPOA 4XLFA 5FD5A 3K70D 3BJBA 3KP7A 2KIQA 3ZQQA 4BY1J 2G7LA 1IV8A 4E4HA 4UXNA 2W1OA 4EJUA 2UV1A 3KIOA 3HGGA 3GW2A 4LLGF 3BP8A 1WQ2A 4BE0A 4DVYP 4HBLA 1XS9A 3ABMH 3GLXA 3L2UA 4FTHA 2RQPA 1E3PA 1S7EA 2FUG2 3AFHA 2ECBA 2IA2A 5HLIA 1YX3A 4ZZLA 1Z7LA 1TWHJ 1ZH5A 2YU3A 2YR2A 1J5YA 4UVBA 4CSWA 3JAMK 5EG0B 3H5AA 5L3GA 1XMAA 2ZXWH 5FRNA 2YX4A 2XKPA 2H8RA 4W1UA 1ZG5A 1ONVA 5D5VB 2JA5J 1D8JA 4XOTA 1ZN2A 1BC7C 2KRFA 1A5JA 2JRMA 1WJEA 3GWZA 2M34A 3GZ5A 4E7HA 4M74A 1BA5A 4HA8A 4BY7J 3IV5A 3GUDA 3HBLA 4JOMA 1A6QA 1P4WA 2DTRA 2MG4A 4L5IA 4IRGA 3C3WA 2DI3A 4JK1X 3BTJA 2F5CA 2ZFUA 3LSJA 2M8EA 4XN3A 2XHKA 3IH2A 3CDHA 4G9YA 5TGTA 4HKUA 2JSCA 3I71A 5LHHA 3OYKA 3MN2A 2A69F 1N75A 2JJ7A 2X1DA 2LNBA 3K9TA 5CJ9A 3AG2H 4IHSA 2EA4A 1B8IA 4HDVA 3JAMZ 3ABUA 4RGRA 1LFBA 1AKHA 2X85A 1S8NA 1XMXA 2X9DA 3G2BA 3R61A 3PUBA 4PCQA 3ZQ7A 3G73A 2E1NA 5J3LA 3JTGA 3BNIA 3BPVA 3HTIA 2KIUA 2FD5A 3DXJF 4QIWN 2O7TA 4XBFA 3LFKA 3HDDA 2RVCA 1FBSA 3ZGKA 1BJAA 1XPXA 4M6XA 1REPC 2NVXJ 5K5OA 3CCMI 2HOEA 4C30A 1IXRC 3W3CA 3B81A 4AF5A 2I10A 3SZPA 4B47A 3GZNB 1Y56A 1DGRM 1B1BA 2BGCA 2DU9A 2NXNB 2HQRA 1RRJA 1XMKA 1IUYA 5DCMA 4YFNF 4HF2A 4BBRJ 3TEDA 4BDZA 2GA1A 3S2DJ 2NOGA 4WIBA 3WU2C 2IGOA 2DPUA 2E1MC 5EEAA 2PN6A 1D1CA 3KLNA 2K9NA 3F8CA 5HDGA 2C6YA 2DO7A 4ETSA 4HSRA 3CQZJ 2DG7A 1LJ9A 2E2HJ 4G6QA 1F9NA 2BOLA 2EFPA 3KZYA 5AIPA 5ED4A 1ZLJA 2EFOA 1EV7A 2QCOA 1YW8A 1X1BA 1XGSA 3E5UA 3HPHA 2VOOA 1S7AA 3BZ6A 1WRJA 3OYFA 2AXLA 2EV0A 1IG7A 3I53A 2E1CA 4ABZA 4PJLA 3OSGA 1YRNB 1OCRH 2LDUA 3BQYA 3WHCA 3G3ZA 2F2EA 4HX7A 2IXSA 1K78A 1XDSA 3DTIA 2IRFG 2M0CA 1I39A 3CCSI 4BQAA 4AD9A 1TW3A 2FQ4A 2HTSA 5D5WB 2D6YA 2DT5A 5FO5A 3D0SA 4L9JA 2K02A 1ON2A 2N8GA 3GTMJ 1V55H 2M8GX 2EA2A 3L2VA 1SD5A 1JKRC 2GIVA 2VC0A 3C2GA 1U9OA 4Y3OA 1JT6A 2R7ZJ 5DTDA 4DBRA 1D5VA 4XK4A 2P5VA 2R7OA 3OYJA 4B09A 1FP1D 1G3SA 3BLYA 2OD5A 2QVOA 3CCRI 4KITB 1J59A 1LE8B 2O6GE 1R23A 2HFHA 2EZIA 2KKOA 5E3LA 3BJ6A 4B43A 3ROUA 2ZSHB 3ABTA 3W6KB 2DT6A 3BROA 2VBYA 2B7EA 3JRHA 3ON4A 2OZ6A 2JK3A 2Y75A 2HDWA 1MJBA 2LF7A 1W5CC 5FKOA 3IH4A 3CCJI 2VT3A 3C07A 3R4KA 2A07F 2B1EA 2V4JC 3F0CA 3HJEA 1P6RA 2X1CA 3F6VA 1OCOH 3QPSA 4AC0A 2DBBA 4QLCU 1TC3C 2L9RA 1SVMA 1T08B 1Z6RA 2VE8A 1JGSA 2XGCA 3HRTA 1EH8A 4HZFA 4BE2A 4P5OA 2MH2A 1Z9CA 4FE4A 1D0YA 2XPUA 3TOAA 4LITA 2G7GA 4ESBA 2PFVA 4D5CA 1OYWA 2OBPA 3TGNA 1ETQA 3IUVA 4AM3A 3HTJA 4J19A 1R1UA 5K7FA 3ASOH 2A61A 3CJQB 3CP8A 4KN7X 1VQ9I 4AUXA 2OERA 4CGZA 1S9HA 3SEQA 3NAUA 5EZGA 1UMQA 2R5ZB 4PGHA 1MH3A 1R5ID 4HEA2 2GIZA 5D6EA 2M4GA 1S5LC 3BHQA 4XR6A 1K4SA 2UUZA 4G6TB 3K4MA 1YYVA 3MWMA 2DTZA 2QLZA 3K1NA 3RYPA 3JRCA 4IVNA 2E2IJ 3W6VA 3CWRA 1R22A 3S93A 1XC5A 1RC9A 2COBA 4HF0A 2D5VA 3B73A 2HGCA 2CG4A 2QKOA 2MLKA 3DF8A 3COLA 3ASNH 4D1QA 5H2FC 3OYEA 4XKBA 5E8GA 1IAWA 3FKJA 2YX7A 3H36A 3KLOA 3MKWB 3GTOJ 1WZ2A 3RYRA 4OOIA 2UWMA 4Y52J 1VFCA 3TO6A 4RGSA 2P0WA 1AOYA 1HQCA 3L09A 1HSTA 2CV0A 5IT9K 4NBQA 4U0YA 4XKWA 2GOXB 1XX5A 2HS5A 2L7MP 3JRAA 3MKZA 4V2GA 3RPQA 4BYYA 4BQQA 5EGOA 2LYCA 3BCAA 3KYLA 1DPUA 4CDGA 2NVYJ 3ONQA 1EJ9A 2ZNZA 5AIQA 1VQKI 2FRHA 4D9JA 1CQTA 2A5YB 2XPWA 3S3OA 1K4TA 4A3JJ 3C2HA 2F5FA 3H3ZA 5C44J 4AIKA 2CQQA 1P7JA 4E7SA 4EJWA 5FHPA 5FFZA 3BG6A 1P9QC 3ZCOA 3NRVA 3QPTA 1VQ4I 2E1OA 1W0UA 4ZYAA 5KAFC 2I8DA 2NOJB 5FLVA 2FJ1A 5AQCA 4M3GA 3RJPA 5D5XB 4S0HB 1MDMB 3K0LA 3TW6A 1T56A 3F3XA 1S72I 2M9HA 3M9AA 2ELHA 2L7KA 3VW0A 2PEXA 4EM0B 5J4VA 2YSRA 3H9QA 3MZHA 4BQNA 2RNJA 3D5RC 5IT9Z 1TQMA 4HLXA 4L5EA 2DPDA 4UDSA 2DDAA 1XCVA 1WJ5A 3DWLE 2WGBA 3E0JB 4AIDA 1IN7A 4ZH4F 3FRQA 4LIVA 3RKXA 3W2AA 4ZYEA 3M1CA 1YFHA 2E7XA 5CPRB 2HZTA 2LBFA 2K85A 3HUGA 2ECCA 2TDXA 3I59B 2MFZA 1K78B 3HM5A 4BQOA 1UFMA 1F5TA 2IPQX 3PO3J 4PJNA 4P96A 3OYBA 4XLAA 4BS9A 5EF6A 4KT5C 1T6SA 2LR8A 3QWLA 5D8KB 3BRUA 3LWFA 2Y31A 2MC3A 3UKGA 2Y0SN 2IVMA 2H1KA 3FXRA 1DU6A 2LKXA 3DFGA 4F92B 4DZPA 1E0EA 4XLEA 3TP0A 3FMRA 2CJJA 3CZ6A 4FHTA 2YVXA 4OMYA 1WKMA 1D5YA 3BG9A 3LL7A 4BHCA 3PQKA 5J40A 2P7VB 4IOCF 2XF7A 1WFXA 2CMPA 3ZMUA 2K4BA 4U0WA 2VQLA 4F93B 4ME9A 2YVHA 4HX4A 3K8PC 1TQPA 2KT0A 2FA5A 3BQZA 4BEHB 3BG3A 4M71A 2H6CA 3CF5F 2LD5A 2JA6J 2DMNA 4GCTA 2E2JJ 4A2UA 1KU3A 1DPRA 4KUMA 1W7PA 5M3MJ 2JT1A 2VBXA 1BL0A 4KMUX 1TWGJ 1RIOH 1BJZA 2OPTA 4YELA 2REKA 5H6QA 2LKPA 2FSWA 3F72A 3OIQA 2IGKA 4ZTJA 3SDGA 1Y0UA 2FX0A 1RI7A 2M7BA 4WK8F 2IA0A 2XGEA 3DKYA 1LUJB 2O7OA 1SFKA 2Q24A 2ESHA 2HXOA 1P4XA 4UHTA 4QSHA 2QIBA 2JA2A 2O61A 4XNFA 5TRDA 1O3RA 4AC6A 1E17A 2XF5A 3E6MA 2Z2SB 3ZQHA 4DNCA 5CVJA 3L00A 4F52A 2CSOA 3S5RA 3DBLB 1TWCJ 3O6BB 2H8WA 4RS8A 1N78A 3VUQA 5FGMA 3RIRA 2F6CA 4BHBA 1FC3A 3NRGA 3PFYA 2GLOA 4LK1F 2V9KA 5HS7A 1WJAA 2K4JA 4FX4A 2P6TA 2W4SA 1BOAA 3B6AA 1E2XA 4OAZA 3CESA 2JUGA 4G12A 4HW0A 3QYBA 4JYKA 1P92A 3JRIA 1LB2A 1FX7A 4CCMA 2JSPA 3OYGA 1ZKGA 3BC8A 3IUOA 1FOWA 3QOPA 3VVZA 5D5UB 4UUSB 4WCGA 4GO1A 2F4IA 3FIWA 3K69A 1GXPA 1IJWC 4BGDA 4KJZA 4PJMA 5L3CA 4DGWB 1HLVA 1U5TB 2BY3A 3CMMA 2R7QA 4A3DJ 2M30A 3D5SC 4YEJA 1R4NB 2WA0A 1OISA 2EK5A 1X1AA 3EUAA 2PZ9A 3CUOA 3G1OA 1SMYF 5K5QA 2R7SA 4K2EA 3HSFA 5E17F 5IP9J 4S04A 4A3EJ 4A3GJ 1YE9A 5F1RA 2G3BA 2XV4S 2Q1ZB 1IW7F 4ANJA 5E3NA 5EG0A 4Q4ZF 2RQQA 2WY8Q 2XB0X 4O3MA 1RPWA 3G1MA 5IOYA 2O9LA 1SD4A 2XC7A 5ICCA 1ZREA 4JX4A 3OY9A 1X1PA 4OMZA 5HAWA 2M87A 2DAOA 3CJTB 1ZYRF 2QYOA 2Y2ZA 5DM6F 2V26A 5LD2C 3QP6A 1Z77A 2HEOA 1YIOA 2FBIA 1SGMA 4EATA 3VYSB 3ZXSA 2HDCA 2PJRB 2XKOA 1MMNA 1R58A 2HQAA 2V1DA 3PUFA 2L4MA 1ZGAA 3WTSC 2VXDA 2CS3A 1XCBA 1VQ8I 4EEFG 1MJ9A 4E7KA 5CXIA 4MEXF 2DA1A 3KP5A 4EJVA 5D1RA 2GXGA 5C4XJ 1ZAOA 1QQIA 3CC4I 3E5XA 4HPQA 3NNRA 3EYYA 2A2FX 3SWHA 3PASA 1UG2A 4N9HA 3JSJA 2YPRA 3NWSA 4M3BA 1WHUA 3RQ4A 1I3QJ 2KDOA 1JUMA 2LOOA 5GPAA 2I5UA 1ZTRA 6PAXA 3ANGA 5DD8A 5HBUA 5LHGA 3BZKA 2HYJA 4ZYDA 1MMAA 2KIMA 4NN1A 1GVDA 3L7WA 3ZMTA 2DCEA 3R6SA 3CCEI 2M7AA 1WJCA 4RLQA 3ELKA 3QQAA 5J47A 2DA2A 1QVUA 2DFHA 2DA7A 1YIJI 1ACIA 3QODA 3DP7A 2Y0SA 2DA4A 2AQEA 5CQEA 3ZQIA 3VWBA 5L3FA 2ME0A 3FF5A 4JP0A 1VQMI 4MFDA 2ZC2A 2HDDA 1DU0A 1HDDC 1VQNI 2VXZA 3VYUB 1KQ8A 3VYRB 2KJCA 2GXBA 3LHQA 4NDLA 2KIFA 2DK8A 4ITVA 1KZHA 5GAGJ 3FHNA 4S05A 5EEGA 4L5JA 4WXDA 1USSA 2A68F 2A5WA 3I58A 3AG3H 3IRQA 1FMWA 1YRNA 1BI0A 1FTZA 3WU0A 1WSUA 1U9NA 2J5OA 5L3EA 3MCZA 1AHDP 4A3BJ 4BXXJ 4C9YA 1GV2A 5E1XA 2JPBA 2W85A 4AVZA 4CZCA 5EZHA 2CUZA 2HVQA 2F48A 3TO7A 3VW1A 2L7ZA 3JSOA 2OJED 2OV7A 2CFOA 2IT0A 1HSJA 4I99C 3SEZA 1HC8A 2RASA 1NG7A 4PZJA 2X0LA 3FISA 2O8XA 5DS9A 1PYVA 3DV8A 3KFWX 4ENKA 3GLLA 3ESWB 1FOYA 3H35A 5LFAA 2DMPA 3BR0A 2VKEA 4KNYA 2EZHA 2QSFX 4MHGA 5ILSA 2B63J 3IL2A 2XAHA 3Q0UA 2DQLA 2WAFA 1CGPA 3EPZA 3WE2A 4L9VA 1TZLA 4G6DA 2EIKH 1LE8A 4YIRX 3RH2A 1H8AC 3MZ8A 4Y17A 3F8BA 5A2QK 1WH7A 4N9IA 1KA8A 2HQNA 3LSRA 2RC4A 1R5GA
chains in the Genus database with same CATH topology
2HQ5A 2N8GA 3GTMJ 1RKWA 4GCLA 2M8GX 3HE0A 3LWJA 4M3EA 3SFIA 4JL3A 1JKRC 3KKCA 4DZJA 2M2EA 1U9OA 1JT6A 1EF4A 4JX6A 5DTDA 1Q1VA 4B3AA 3ZQGA 1ZR4A 4XK4A 2DMTA 3K7AJ 2R7ZJ 2FBQA 3O8GA 4PXIA 4GFKA 1AU7A 5F08A 3M3YJ 1ETYA 1LE8B 3CCYA 2IEKA 1X2MA 1G2HA 2EZIA 5E3LA 5J1RA 2HOTA 3S2HJ 3OSFA 5EYRA 2DA3A 3GTGJ 5IYBJ 3JRHA 1OFCX 2ZOYA 2DA5A 3ON4A 2JK3A 2XPVA 5FKKA 1MBHA 2Y9ZA 3LOCA 5FKOA 3IH4A 2JN6A 1F43A 4RDUA 3C07A 3RKQA 4A3FJ 3F0CA 1SFOJ 4JKZA 4MO7A 5M5XJ 4GFBA 2EH3A 4BKXA 3BTCA 3QPSA 1I50J 4A3CJ 2R5ZA 4AC0A 1JKPC 4A3KJ 4C3IJ 1B72B 1QPIA 1TC3C 2L9RA 4M3FA 4MK6A 2P81A 2XGCA 1MNMC 3GEUA 4NELA 5C4JJ 3RD3A 3VW2A 4FE4A 2JA8J 3S1QJ 2XPUA 1JUSA 2G7GA 1NK2P 1RR7A 2XSDC 4ACIA 4D5CA 4IHVA 2YVEA 1ENHA 1POGA 1ETQA 4MFEA 3IUVA 1FTTA 5HODA 3I4NJ 4V2FA 3HTJA 4J19A 5FKLA 1ZQ3P 5K7FA 2CUFA 2OERA 4AUXA 4C3JJ 3JRGA 3SJMA 3HGYA 2RHAA 3NAUA 1BW6A 1UMQA 5EZGA 2KDZA 3EUPA 2R5ZB 3HOXJ 3BR3A 1MH3A 5FJ8J 3BT9A 3VVYA 3NARA 1HDPA 1MH4A 2HOAA 3GTPJ 3BHQA 3VP5A 2NP3A 2DTZA 3JRCA 1VI0A 2IBDA 1H89C 2E2IJ 5EDNA 3W6VA 3CWRA 3GTLJ 1XC5A 2COBA 1WI3A 3K2AA 3ZQCA 2X6OA 4M3DA 2D5VA 3P9TA 3GTJJ 2QKOA 5IYDJ 3COLA 2UXIA 3LNQA 2GUHA 3ANPA 3A03A 2DN0A 2QTQA 2WAQN 1FIPA 3G1LA 3GTOJ 2G7SA 3GZIA 2XRLA 4MIMA 4Y52J 4YZEA 2AO9A 1VFCA 3QKXA 5F27A 4L62A 1WH5A 1MBGA 3KKDA 3JRAA 2L7MP 4DYRA 3KNWA 4V2GA 3JRFA 4DYCA 1HCRA 1O4XA 1ZGWA 5C3EJ 5EGOA 2CRGA 3FK7A 2NVYJ 3RQIA 3H3VK 5CW8A 1CQTA 3T6NA 1Y1VJ 1MBJA 2XPWA 3DEWA 4A3LJ 3JREA 4A3JJ 2IAIA 3WHBA 2RAEA 5C44J 2LK2A 2CQQA 1P7JA 5GP9A 4D7MA 1OJLA 2DA6A 5FHPA 2E1OA 2E19A 1W0UA 1ETVA 5FLVA 2FJ1A 3S17J 4CGRA 1MBEA 5AQCA 4M3GA 2F07A 1IDYA 4S0HB 3TW6A 1T56A 4XICA 2M9HA 4XRSG 3VW0A 5F1JA 2DMQA 2YUSA 1X58A 4UDSA 4L5EA 1IC8A 1FJLA 3V78A 5DAJA 5EGOB 2WGBA 1I6HJ 3FRQA 4GFLA 2GENA 2WB1N 3BR1A 5FKMA 1PUFA 3JRBA 3Q0VA 2ECCA 2TRTA 4IHWA 1A6IA 4IHYA 3CJDA 1MBFA 3HM5A 4A3MJ 5H9TA 3VIBA 3PO3J 2W48A 3IH3A 2EBIA 5EF6A 5M5WJ 2QOPA 1VF9A 2LR8A 3V6GA 4JX5A 3M4OJ 2ME6A 5GPCA 3BRUA 2Y31A 3S1MJ 3HOWJ 1MBKA 2CU7A 1QVTA 4LOCA 2R5YA 3UKGA 2Y0SN 2H1KA 4A3IJ 1DU6A 2LKXA 1Z0XA 3HOZJ 2QWTA 3FK6A 4DZPA 2OF7A 3S16J 3TP0A 2L7FP 2CJJA 4A69C 3JRDA 2LFBA 2NVTJ 2WUIA 1ZR2A 3S1NJ 1D5YA 3BG9A 3QPLA 4Y7NJ 2YS9A 4XRSA 5F0CA 1HOMA 3ZQFA 2VKVA 4ME9A 3KZ9A 2YVHA 3DCFA 1OCPA 2KT0A 3BQZA 1IDZA 3GTQJ 2DMUA 4CYCA 1H88C 3BTIA 3BG3A 1ETWA 2LVSA 4UUTA 2LD5A 2R5YB 2DMNA 5FLMJ 2GM4A 2E2JJ 2JA6J 9ANTA 4GCTA 1P7IA 3BR5A 5M3MJ 3HTAA 1BL0A 1TWGJ 1Y1WJ 1BJZA 2OPTA 2REKA 2ZCMA 3PO2J 2VPRA 2NS7A 3SDGA 2FX0A 4M6VA 2XGEA 3HOUJ 2XDNA 1T33A 5E3MA 5E3OA 2CUEA 1TWFJ 1K61A 1RETA 2O7OA 5EFYA 2UXOA 2Q24A 2UXPA 2LLKA 3ZQLA 2HXOA 1APLC 4QSHA 2QIBA 1JGGA 1ZK8A 4AC6A 1SANA 4CYCB 3ZQHA 4XRMA 4B4CA 4UUSA 2W53A 3S5RA 2Y9YA 1TWCJ 1WGXA 3VOKA 1JT0A 4D7NA 2HKUA 2MW8A 4MXMA 2MSYA 3E7LA 3VUQA 1ETKA 4A93J 5IPAA 2R0QC 5J1UA 2X48A 3NRGA 2TCTA 5IYCJ 3D1NI 1WCMJ 3LJLA 2GLOA 3BTLA 3QBMA 2GBYA 5M3FJ 4FISA 5F04A 2ZB9A 3B6AA 1GUUA 2JMWA 4G12A 4JYKA 1JKOC 3NI7A 3JRIA 3NPIA 1ZKGA 1JTYA 3VOXA 4IEJA 4JNNA 3VVZA 4UUSB 2XB5A 2NVQJ 5FGLA 1JJ6C 3FIWA 3L1PA 1JJ8C 2PMZN 2R93J 3RZDJ 1JUPA 1IJWC 2K9SA 2K9QA 1JTXA 2OI8A 1IUFA 2O8KA 2XGDA 1HLVA 2VI6A 5JLXA 3VVXA 1U8BA 4A3DJ 4X6AJ 1UHSA 1FEXA 5FMPA 2NX4A 2WV1A 1UI6A 4GCKA 3O8HA 1ORKA 2CQXA 1ETXA 3OIOA 1LFUP 1IGNA 2EZLA 2AHQA 2UXHA 2PZ9A 2ID6A 3G1OA 4MLOA 1JKQC 5IP9J 3A01A 3GTKJ 4A3EJ 4A3GJ 2ELKA 2G3BA 1E3OC 5IP7J 2HOSA 5E3NA 5EG0A 2PBXA 3B6CA 4QTRA 5D18A 1R9TJ 3BG5A 1VNDA 2XB0X 2HI3A 3S14J 1RPWA 5J1YA 3G1MA 5IOYA 2O9LA 5C4YA 1W0TA 3BJBA 3HOVJ 3CRJA 3F1BA 4KWAA 3I4MJ 3OOUA 4JX4A 1B72A 4BY1J 2G7LA 5HAWA 3HGGA 1GT0C 2Y2ZA 3Q0WA 1Z77A 3GBGA 1SGMA 5BNGA 1GDTA 1XS9A 1PUFB 2NP5A 3LSGA 2VUMJ 4FTHA 3MKLA 1ITYA 1S7EA 1MSEC 2ZCNA 2ECBA 5K58A 1TWHJ 2DJNA 4EEFG 3A01B 5CXIA 4W97A 2DA1A 5D1RA 2UXUA 5EG0B 5C4XJ 2EQRA 1NTCA 2JWTA 2Y30A 4W1UA 5IP6A 3JR9A 1HF0A 2H8RA 4IHXA 2JA5J 3AQTA 3NNRA 1FIAA 5CXGA 2MGQA 2LY9A 2K40A 1A5JA 2DG8A 3PASA 1UG2A 1RESA 1NK3P 2M34A 4M3BA 3JSJA 3EGQA 5K7HA 1BA5A 3HEFA 4RBOA 1MSFC 4BY7J 2R92J 3IV5A 1IV6A 3HBLA 1I3QJ 2MG4A 1JUMA 3BTJA 3HTHA 5GPAA 3LSJA 1GV5A 3G7RA 1ZTRA 3ANGA 3IH2A 1K83J 4HKUA 5HBUA 1XG1A 3S15J 5HSZA 2HYJA 2HXIA 3MN2A 4NN1A 1GVDA 2JJ7A 2LTPA 2ZOZA 3BR6A 3CMYA 2V57A 3AQSA 1B8IA 3BR2A 1LFBA 3LSPA 1AKHA 4ICHA 3QQAA 2DA2A 1QVUA 2X9DA 2DA7A 2GFNA 1BW5A 5J3LA 2DA4A 3PM1A 3VPRA 3C2BA 3ZQIA 3HKZN 3BNIA 2ME0A 4JP0A 4FCYA 3HTIA 2FD5A 1UI5A 4MFDA 4QIWN 3HDDA 4FE7A 2HDDA 2NS8A 3H0GJ 4AYBN 1DU0A 3A02A 1HDDC 2NVXJ 1X2NA 3O60A 3B81A 4AF5A 2I10A 3LHQA 4NDLA 3TW7A 2YU9J 3E7QA 2JA7J 3MVPA 5IOZA 4BBRJ 1YRNA 1FTZA 3TEDA 1U9NA 5K7ZA 3S2DJ 2NOGA 1AHDP 4A3BJ 3ON2A 1B8IB 5D19A 3HIMA 2LP0A 2G0EA 4I76A 4BXXJ 1GV2A 5EEAA 2HYTA 1AKHB 5EZHA 2K9NA 5JLWA 1U78A 3CQZJ 3VW1A 3HB9A 2L7ZA 2DG7A 2E2HJ 3MNLA 2IU5A 3DPJA 3TP3A 2RASA 3FISA 3Q3SA 5DS9A 1TWAJ 1ETOA 2QCOA 3ZOBA 3BCGA 3G56A 4BBSJ 2DMPA 3BR0A 2L0KA 2VKEA 1IRZA 2EZHA 4XIDA 4C3HJ 2B63J 4DYQA 1QRYA 4I6ZA 3NXCA 3Q0UA 1WPKA 1IG7A 3PPBA 4ABZA 5FKNA 2O7TA 3HOYJ 4D5FA 5F0HA 3OSGA 1YRNB 1OCTC 3BQYA 5F0FA 3WHCA 5M5YJ 3RZOJ 2QF7A 1LE8A 4C2MJ 3RH2A 1H8AC 4DW6A 2ID3A 2M0CA 2EZKA 3FKIJ 2ZCXA 1WH7A 2FQ4A 3CDLA 2D6YA 4HNVA 1F36A 4X1EA 3LSRA 1RKTA 4B1RA 3S1RJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HQ5 A;  2N8G A;  3GTM J;  1RKW A;  4GCL A;  2M8G X;  3HE0 A;  3LWJ A;  4M3E A;  3SFI A;  4JL3 A;  1JKR C;  3KKC A;  4DZJ A;  2M2E A;  1U9O A;  1JT6 A;  1EF4 A;  4JX6 A;  5DTD A;  1Q1V A;  4B3A A;  3ZQG A;  1ZR4 A;  4XK4 A;  2DMT A;  3K7A J;  2R7Z J;  2FBQ A;  3O8G A;  4PXI A;  4GFK A;  1AU7 A;  5F08 A;  3M3Y J;  1ETY A;  1LE8 B;  3CCY A;  2IEK A;  1X2M A;  1G2H A;  2EZI A;  5E3L A;  5J1R A;  2HOT A;  3S2H J;  3OSF A;  5EYR A;  2DA3 A;  3GTG J;  5IYB J;  3JRH A;  1OFC X;  2ZOY A;  2DA5 A;  3ON4 A;  2JK3 A;  2XPV A;  5FKK A;  1MBH A;  2Y9Z A;  3LOC A;  5FKO A;  3IH4 A;  2JN6 A;  1F43 A;  4RDU A;  3C07 A;  3RKQ A;  4A3F J;  3F0C A;  1SFO J;  4JKZ A;  4MO7 A;  5M5X J;  4GFB A;  2EH3 A;  4BKX A;  3BTC A;  3QPS A;  1I50 J;  4A3C J;  2R5Z A;  4AC0 A;  1JKP C;  4A3K J;  4C3I J;  1B72 B;  1QPI A;  1TC3 C;  2L9R A;  4M3F A;  4MK6 A;  2P81 A;  2XGC A;  1MNM C;  3GEU A;  4NEL A;  5C4J J;  3RD3 A;  3VW2 A;  4FE4 A;  2JA8 J;  3S1Q J;  2XPU A;  1JUS A;  2G7G A;  1NK2 P;  1RR7 A;  2XSD C;  4ACI A;  4D5C A;  4IHV A;  2YVE A;  1ENH A;  1POG A;  1ETQ A;  4MFE A;  3IUV A;  1FTT A;  5HOD A;  3I4N J;  4V2F A;  3HTJ A;  4J19 A;  5FKL A;  1ZQ3 P;  5K7F A;  2CUF A;  2OER A;  4AUX A;  4C3J J;  3JRG A;  3SJM A;  3HGY A;  2RHA A;  3NAU A;  1BW6 A;  1UMQ A;  5EZG A;  2KDZ A;  3EUP A;  2R5Z B;  3HOX J;  3BR3 A;  1MH3 A;  5FJ8 J;  3BT9 A;  3VVY A;  3NAR A;  1HDP A;  1MH4 A;  2HOA A;  3GTP J;  3BHQ A;  3VP5 A;  2NP3 A;  2DTZ A;  3JRC A;  1VI0 A;  2IBD A;  1H89 C;  2E2I J;  5EDN A;  3W6V A;  3CWR A;  3GTL J;  1XC5 A;  2COB A;  1WI3 A;  3K2A A;  3ZQC A;  2X6O A;  4M3D A;  2D5V A;  3P9T A;  3GTJ J;  2QKO A;  5IYD J;  3COL A;  2UXI A;  3LNQ A;  2GUH A;  3ANP A;  3A03 A;  2DN0 A;  2QTQ A;  2WAQ N;  1FIP A;  3G1L A;  3GTO J;  2G7S A;  3GZI A;  2XRL A;  4MIM A;  4Y52 J;  4YZE A;  2AO9 A;  1VFC A;  3QKX A;  5F27 A;  4L62 A;  1WH5 A;  1MBG A;  3KKD A;  3JRA A;  2L7M P;  4DYR A;  3KNW A;  4V2G A;  3JRF A;  4DYC A;  1HCR A;  1O4X A;  1ZGW A;  5C3E J;  5EGO A;  2CRG A;  3FK7 A;  2NVY J;  3RQI A;  3H3V K;  5CW8 A;  1CQT A;  3T6N A;  1Y1V J;  1MBJ A;  2XPW A;  3DEW A;  4A3L J;  3JRE A;  4A3J J;  2IAI A;  3WHB A;  2RAE A;  5C44 J;  2LK2 A;  2CQQ A;  1P7J A;  5GP9 A;  4D7M A;  1OJL A;  2DA6 A;  5FHP A;  2E1O A;  2E19 A;  1W0U A;  1ETV A;  5FLV A;  2FJ1 A;  3S17 J;  4CGR A;  1MBE A;  5AQC A;  4M3G A;  2F07 A;  1IDY A;  4S0H B;  3TW6 A;  1T56 A;  4XIC A;  2M9H A;  4XRS G;  3VW0 A;  5F1J A;  2DMQ A;  2YUS A;  1X58 A;  4UDS A;  4L5E A;  1IC8 A;  1FJL A;  3V78 A;  5DAJ A;  5EGO B;  2WGB A;  1I6H J;  3FRQ A;  4GFL A;  2GEN A;  2WB1 N;  3BR1 A;  5FKM A;  1PUF A;  3JRB A;  3Q0V A;  2ECC A;  2TRT A;  4IHW A;  1A6I A;  4IHY A;  3CJD A;  1MBF A;  3HM5 A;  4A3M J;  5H9T A;  3VIB A;  3PO3 J;  2W48 A;  3IH3 A;  2EBI A;  5EF6 A;  5M5W J;  2QOP A;  1VF9 A;  2LR8 A;  3V6G A;  4JX5 A;  3M4O J;  2ME6 A;  5GPC A;  3BRU A;  2Y31 A;  3S1M J;  3HOW J;  1MBK A;  2CU7 A;  1QVT A;  4LOC A;  2R5Y A;  3UKG A;  2Y0S N;  2H1K A;  4A3I J;  1DU6 A;  2LKX A;  1Z0X A;  3HOZ J;  2QWT A;  3FK6 A;  4DZP A;  2OF7 A;  3S16 J;  3TP0 A;  2L7F P;  2CJJ A;  4A69 C;  3JRD A;  2LFB A;  2NVT J;  2WUI A;  1ZR2 A;  3S1N J;  1D5Y A;  3BG9 A;  3QPL A;  4Y7N J;  2YS9 A;  4XRS A;  5F0C A;  1HOM A;  3ZQF A;  2VKV A;  4ME9 A;  3KZ9 A;  2YVH A;  3DCF A;  1OCP A;  2KT0 A;  3BQZ A;  1IDZ A;  3GTQ J;  2DMU A;  4CYC A;  1H88 C;  3BTI A;  3BG3 A;  1ETW A;  2LVS A;  4UUT A;  2LD5 A;  2R5Y B;  2DMN A;  5FLM J;  2GM4 A;  2E2J J;  2JA6 J;  9ANT A;  4GCT A;  1P7I A;  3BR5 A;  5M3M J;  3HTA A;  1BL0 A;  1TWG J;  1Y1W J;  1BJZ A;  2OPT A;  2REK A;  2ZCM A;  3PO2 J;  2VPR A;  2NS7 A;  3SDG A;  2FX0 A;  4M6V A;  2XGE A;  3HOU J;  2XDN A;  1T33 A;  5E3M A;  5E3O A;  2CUE A;  1TWF J;  1K61 A;  1RET A;  2O7O A;  5EFY A;  2UXO A;  2Q24 A;  2UXP A;  2LLK A;  3ZQL A;  2HXO A;  1APL C;  4QSH A;  2QIB A;  1JGG A;  1ZK8 A;  4AC6 A;  1SAN A;  4CYC B;  3ZQH A;  4XRM A;  4B4C A;  4UUS A;  2W53 A;  3S5R A;  2Y9Y A;  1TWC J;  1WGX A;  3VOK A;  1JT0 A;  4D7N A;  2HKU A;  2MW8 A;  4MXM A;  2MSY A;  3E7L A;  3VUQ A;  1ETK A;  4A93 J;  5IPA A;  2R0Q C;  5J1U A;  2X48 A;  3NRG A;  2TCT A;  5IYC J;  3D1N I;  1WCM J;  3LJL A;  2GLO A;  3BTL A;  3QBM A;  2GBY A;  5M3F J;  4FIS A;  5F04 A;  2ZB9 A;  3B6A A;  1GUU A;  2JMW A;  4G12 A;  4JYK A;  1JKO C;  3NI7 A;  3JRI A;  3NPI A;  1ZKG A;  1JTY A;  3VOX A;  4IEJ A;  4JNN A;  3VVZ A;  4UUS B;  2XB5 A;  2NVQ J;  5FGL A;  1JJ6 C;  3FIW A;  3L1P A;  1JJ8 C;  2PMZ N;  2R93 J;  3RZD J;  1JUP A;  1IJW C;  2K9S A;  2K9Q A;  1JTX A;  2OI8 A;  1IUF A;  2O8K A;  2XGD A;  1HLV A;  2VI6 A;  5JLX A;  3VVX A;  1U8B A;  4A3D J;  4X6A J;  1UHS A;  1FEX A;  5FMP A;  2NX4 A;  2WV1 A;  1UI6 A;  4GCK A;  3O8H A;  1ORK A;  2CQX A;  1ETX A;  3OIO A;  1LFU P;  1IGN A;  2EZL A;  2AHQ A;  2UXH A;  2PZ9 A;  2ID6 A;  3G1O A;  4MLO A;  1JKQ C;  5IP9 J;  3A01 A;  3GTK J;  4A3E J;  4A3G J;  2ELK A;  2G3B A;  1E3O C;  5IP7 J;  2HOS A;  5E3N A;  5EG0 A;  2PBX A;  3B6C A;  4QTR A;  5D18 A;  1R9T J;  3BG5 A;  1VND A;  2XB0 X;  2HI3 A;  3S14 J;  1RPW A;  5J1Y A;  3G1M A;  5IOY A;  2O9L A;  5C4Y A;  1W0T A;  3BJB A;  3HOV J;  3CRJ A;  3F1B A;  4KWA A;  3I4M J;  3OOU A;  4JX4 A;  1B72 A;  4BY1 J;  2G7L A;  5HAW A;  3HGG A;  1GT0 C;  2Y2Z A;  3Q0W A;  1Z77 A;  3GBG A;  1SGM A;  5BNG A;  1GDT A;  1XS9 A;  1PUF B;  2NP5 A;  3LSG A;  2VUM J;  4FTH A;  3MKL A;  1ITY A;  1S7E A;  1MSE C;  2ZCN A;  2ECB A;  5K58 A;  1TWH J;  2DJN A;  4EEF G;  3A01 B;  5CXI A;  4W97 A;  2DA1 A;  5D1R A;  2UXU A;  5EG0 B;  5C4X J;  2EQR A;  1NTC A;  2JWT A;  2Y30 A;  4W1U A;  5IP6 A;  3JR9 A;  1HF0 A;  2H8R A;  4IHX A;  2JA5 J;  3AQT A;  3NNR A;  1FIA A;  5CXG A;  2MGQ A;  2LY9 A;  2K40 A;  1A5J A;  2DG8 A;  3PAS A;  1UG2 A;  1RES A;  1NK3 P;  2M34 A;  4M3B A;  3JSJ A;  3EGQ A;  5K7H A;  1BA5 A;  3HEF A;  4RBO A;  1MSF C;  4BY7 J;  2R92 J;  3IV5 A;  1IV6 A;  3HBL A;  1I3Q J;  2MG4 A;  1JUM A;  3BTJ A;  3HTH A;  5GPA A;  3LSJ A;  1GV5 A;  3G7R A;  1ZTR A;  3ANG A;  3IH2 A;  1K83 J;  4HKU A;  5HBU A;  1XG1 A;  3S15 J;  5HSZ A;  2HYJ A;  2HXI A;  3MN2 A;  4NN1 A;  1GVD A;  2JJ7 A;  2LTP A;  2ZOZ A;  3BR6 A;  3CMY A;  2V57 A;  3AQS A;  1B8I A;  3BR2 A;  1LFB A;  3LSP A;  1AKH A;  4ICH A;  3QQA A;  2DA2 A;  1QVU A;  2X9D A;  2DA7 A;  2GFN A;  1BW5 A;  5J3L A;  2DA4 A;  3PM1 A;  3VPR A;  3C2B A;  3ZQI A;  3HKZ N;  3BNI A;  2ME0 A;  4JP0 A;  4FCY A;  3HTI A;  2FD5 A;  1UI5 A;  4MFD A;  4QIW N;  3HDD A;  4FE7 A;  2HDD A;  2NS8 A;  3H0G J;  4AYB N;  1DU0 A;  3A02 A;  1HDD C;  2NVX J;  1X2N A;  3O60 A;  3B81 A;  4AF5 A;  2I10 A;  3LHQ A;  4NDL A;  3TW7 A;  2YU9 J;  3E7Q A;  2JA7 J;  3MVP A;  5IOZ A;  4BBR J;  1YRN A;  1FTZ A;  3TED A;  1U9N A;  5K7Z A;  3S2D J;  2NOG A;  1AHD P;  4A3B J;  3ON2 A;  1B8I B;  5D19 A;  3HIM A;  2LP0 A;  2G0E A;  4I76 A;  4BXX J;  1GV2 A;  5EEA A;  2HYT A;  1AKH B;  5EZH A;  2K9N A;  5JLW A;  1U78 A;  3CQZ J;  3VW1 A;  3HB9 A;  2L7Z A;  2DG7 A;  2E2H J;  3MNL A;  2IU5 A;  3DPJ A;  3TP3 A;  2RAS A;  3FIS A;  3Q3S A;  5DS9 A;  1TWA J;  1ETO A;  2QCO A;  3ZOB A;  3BCG A;  3G56 A;  4BBS J;  2DMP A;  3BR0 A;  2L0K A;  2VKE A;  1IRZ A;  2EZH A;  4XID A;  4C3H J;  2B63 J;  4DYQ A;  1QRY A;  4I6Z A;  3NXC A;  3Q0U A;  1WPK A;  1IG7 A;  3PPB A;  4ABZ A;  5FKN A;  2O7T A;  3HOY J;  4D5F A;  5F0H A;  3OSG A;  1YRN B;  1OCT C;  3BQY A;  5F0F A;  3WHC A;  5M5Y J;  3RZO J;  2QF7 A;  1LE8 A;  4C2M J;  3RH2 A;  1H8A C;  4DW6 A;  2ID3 A;  2M0C A;  2EZK A;  3FKI J;  2ZCX A;  1WH7 A;  2FQ4 A;  3CDL A;  2D6Y A;  4HNV A;  1F36 A;  4X1E A;  3LSR A;  1RKT A;  4B1R A;  3S1R J; 
#chains in the Genus database with same CATH topology
 3QU3 A;  2HQ5 A;  3FX3 A;  4MTD A;  4GCL A;  2VJ4 A;  3V7C A;  3OMY A;  3HE0 A;  2CQK A;  1KQ0 A;  1EA3 A;  2BE5 F;  3Q9V A;  3KKC A;  3WTW C;  5DYM A;  1P2F A;  2FEZ A;  4JX6 A;  2PG4 A;  1ZR4 A;  2DMT A;  2DW4 A;  2FBQ A;  4PXI A;  1EH6 A;  4PSW A;  2VBW A;  3FXO A;  1ETY A;  4I01 A;  2IEK A;  5HLH A;  1X2M A;  2OQG A;  1Y6I A;  4NQW A;  2W57 A;  1LKX A;  3S2H J;  3GTG J;  5A2Q Z;  4KT6 A;  3RKY A;  3J7A O;  2FE3 A;  5FKK A;  1D1A A;  1R7J A;  2NAZ A;  2OU2 A;  4RDU A;  1U8R A;  1Z3Y A;  1MNE A;  3OYN A;  4A3F J;  4ZYG A;  4MO7 A;  4R8H A;  1SFO J;  4BKX A;  2JVG A;  1VZ0 A;  1J9I A;  3FM5 A;  4A6D A;  2R5Z A;  2BY1 A;  2R7D A;  4C3I J;  2RV8 A;  5IY5 H;  4M3F A;  4N4N B;  4E7I A;  5H20 A;  2PQ8 A;  3A0H C;  3IP4 B;  3E6B A;  4DBQ A;  2D1H A;  4UY8 I;  5CYV A;  3CLQ A;  1U6G A;  1NK2 P;  2RN7 A;  3CME I;  4IHV A;  1WJD A;  1POG A;  3F8M A;  4GRI A;  3CCV I;  3V7S A;  3I4N J;  2QKM B;  4IF4 A;  3TKY A;  2W7N A;  1RUN A;  1ZQ3 P;  2CUF A;  4XOR A;  1I1S A;  1R1T A;  2HKO A;  4C3J J;  2M5W A;  2RHA A;  3HGY A;  4ZJZ A;  2KDZ A;  3K4J A;  3HTS B;  4J00 A;  3HOX J;  3ZMZ A;  4XSX F;  5FJ8 J;  4XLP F;  3NAR A;  1HDP A;  4RAZ A;  2HOA A;  2CH0 A;  2V1X A;  3IAS 2;  1U3E M;  1ZEL A;  3OYA A;  5D8L B;  1L3L A;  2IBD A;  3CP2 A;  4ENN A;  1WI3 A;  3K2A A;  3GYH X;  1UHW A;  2X6O A;  1BR2 A;  3P9T A;  1FZP B;  2CW0 F;  2NYX A;  2BW3 B;  3BDD A;  3Q5F A;  4ZDP A;  3DPU A;  5IYD J;  4LLN A;  3ANP A;  2HPM A;  2DN0 A;  4HV6 A;  4IJA A;  5F64 A;  5DD4 A;  1H0M A;  3G1L A;  3WTY C;  3PFI A;  2VJJ A;  1R49 A;  1GLN A;  3ERE D;  3LAJ A;  3FXQ A;  3TO9 A;  3I4P A;  4R1H A;  1MDM A;  3GFL A;  4MIM A;  4EJT A;  4YZE A;  2DYS H;  1DP3 A;  2QQ8 A;  5LGT A;  2JUC A;  1XGN A;  4LG3 A;  3KKD A;  1X4P A;  1IRX A;  1Y8R B;  4OIN F;  4HV5 A;  5BOX A;  1ODD A;  1UAA A;  4PFP A;  4DYC A;  3ZR8 X;  2VQC A;  2F4O B;  2K86 A;  1XDU A;  1VQO I;  2R7X A;  2Q0O A;  1MJA A;  2QWW A;  3EUK L;  3HHG A;  3H3V K;  1M1E B;  2GAU A;  2CW7 A;  4HOB A;  2R7R A;  1HKT A;  4IKF A;  1Y39 A;  2LF8 A;  4A0X A;  1I5Z A;  2LK2 A;  2ZSI B;  2VKD A;  3CC7 I;  2DK5 A;  5AON A;  3I59 A;  2E19 A;  3GME A;  2OCC H;  2QSG X;  4CGR A;  3ML6 A;  5DCF A;  1IDY A;  4X0G A;  1YG2 A;  2PBI A;  5F1J A;  1D0Z A;  2ZME B;  3SDB A;  2R7U A;  1SFE A;  2DMQ A;  3OS0 A;  1QPM A;  1IC8 A;  2OZU A;  1S6L A;  1UZC A;  3V78 A;  3QRF F;  3CJN A;  2L9S A;  2XSJ C;  2L9N A;  1KU7 A;  3OYM A;  2R7T A;  3WGI A;  1YHQ I;  3SQN A;  3FMS A;  3AKZ A;  3IC7 A;  2QUF A;  1PUF A;  1YS6 A;  2HTJ A;  4BDY A;  1H9T A;  2TRT A;  4IHY A;  5CKT A;  4A3M J;  1VQ5 I;  4KFC A;  4NC6 A;  2FQ3 A;  1B9M A;  4PDK A;  3V8L A;  1F1Z A;  4OIR F;  2W48 A;  4E7Z A;  3CO6 C;  3O3K A;  2A3S A;  2EIM H;  4D0P A;  1QHG A;  2WWY A;  1V5E A;  2HPI A;  2UZK A;  2QA4 I;  3UNG C;  4BEH A;  4JX5 A;  5KNL A;  4KDP A;  3S1M J;  4M72 A;  3M1E A;  2X6X A;  3HC7 A;  1MND A;  1OMI A;  2XAS A;  4A3I J;  4MNU A;  3ZPL A;  2K7L A;  4FAS D;  1Z0X A;  2LRE A;  3S16 J;  4HRI A;  1OQY A;  3KE2 A;  3SZT A;  4A69 C;  2QQ9 A;  5ICE A;  1W1W E;  2KRC A;  2BBY A;  3FXK A;  3QOE A;  4NQW B;  4E70 A;  2RRE A;  4PSX A;  1DDN A;  1KYZ A;  3I54 A;  3N97 A;  2E35 A;  2WAD A;  3SHF A;  3U21 A;  4CO8 A;  2K9L A;  2MD5 A;  2KRH A;  1IDZ A;  2A05 A;  2ZBK A;  2XAJ A;  2WB1 A;  4NUB A;  1H88 C;  3WU1 B;  1IF1 A;  4CH7 A;  3S3N A;  3AG1 H;  2R5Y B;  3BPX A;  2GM4 A;  4OIQ F;  9ANT A;  2QSH X;  1P7I A;  3KX2 A;  1XSD A;  3BCB A;  4U7D A;  2W84 A;  3RDI A;  2ZCM A;  1ZAR A;  1B6A A;  1DQU A;  3DQV C;  2WAE A;  1Y1W J;  1UB9 A;  1J75 A;  4O5V A;  4BUP A;  4FT8 A;  2BVL A;  1O3Q A;  2XDN A;  3RTR A;  4XKC A;  2M3A A;  2ZJ2 A;  1KU2 A;  4XN0 A;  3J80 K;  2LLK A;  1ZHF A;  3H1C A;  4I02 A;  3J81 K;  2CYY A;  4B4C A;  3HG9 A;  1FYM A;  4UUS A;  2W53 A;  2EIJ H;  2Y9Y A;  2OQR A;  3ZMS A;  2QQA A;  1JT0 A;  1OLT A;  3K2Z A;  3BJO A;  4GXO A;  2MSY A;  3VDX A;  3OS2 A;  1ETK A;  3LSM A;  2CWE A;  3TMO A;  1U5T A;  2R0Q C;  1T8I A;  5J1U A;  1G8X A;  2XAF A;  1LDD A;  2LY1 A;  2BY2 A;  3FMQ A;  3I0T A;  3QBM A;  2R7V A;  3P9I A;  2GBY A;  5M3F J;  2PI0 A;  4FQG A;  3ZMD A;  3KYC B;  3JW4 A;  1YW7 A;  2Z33 A;  3ZRG A;  3F8F A;  1XGM A;  3K4B A;  5F04 A;  1RR8 C;  4ON0 A;  3HSE A;  3IKV A;  2XDV A;  1R00 A;  3DU6 A;  3J80 Z;  1JKO C;  2XVC A;  3HYI A;  4GYI A;  4EM1 A;  3MMY B;  2F5V A;  3NPI A;  4XMY A;  3IWF A;  1HW2 A;  3V8K A;  4L18 B;  3VOX A;  4IEJ A;  4JNN A;  3HRU A;  3JCU C;  4EVI A;  3J81 Z;  1I27 A;  3FXU A;  2XUB A;  3GFJ A;  1IN4 A;  1JJ6 C;  1AA7 A;  1JJ8 C;  3VFZ A;  2R93 J;  3RZD J;  3KCC A;  4BHP A;  1MMS A;  2EFN A;  4L9N A;  3N4M A;  1IUF A;  2B9S A;  2JZY A;  3QYE A;  2R3S A;  2VI6 A;  1MIJ A;  5FMP A;  1WWX A;  4X6A J;  1FEX A;  3MEX A;  2NX4 A;  3G71 I;  4GCK A;  2O5R A;  2CQX A;  1SVO A;  1I1G A;  3O8H A;  3FXJ A;  4GGG A;  5BMZ A;  1ETX A;  2H27 A;  2EZL A;  2UXH A;  2VOP A;  2PJR A;  2WY7 Q;  3M7G A;  1UEL B;  4OWR B;  5BQT A;  3KYD B;  1GVJ A;  4KIF A;  4MLO A;  4ZC3 A;  4E6K G;  4B48 A;  2VLA A;  2L01 A;  2M0M A;  4LB5 A;  5LGN A;  2V9P A;  2ISY A;  4WWC A;  4I09 A;  3B6C A;  4QTR A;  5D18 A;  1KGS A;  1NHA A;  5ILU A;  1FSH A;  5J1Y A;  1CF7 B;  4J01 A;  3VTI A;  3HOV J;  1D8K A;  3I4M J;  3OOU A;  4BE1 A;  1B72 A;  2CGP A;  3DU5 A;  3EET A;  4RAG A;  4YFX F;  1RNL A;  4IQ4 A;  1HKQ A;  4BJ5 C;  1TNS A;  4ASN A;  2GXA A;  3GBG A;  4F91 B;  1WJF A;  5BNG A;  2NP5 A;  1PUF B;  3LSG A;  5CVV A;  3MKL A;  2ZCN A;  5K58 A;  2QBY B;  3E6C C;  2DJN A;  2EPF A;  5FFX A;  3W2V A;  5HNF A;  1BI2 A;  1Z21 A;  4LB6 B;  3DBR B;  3A2K A;  2UXU A;  2W24 A;  2EQR A;  3JR9 A;  1HF0 A;  1J0R A;  3NS4 A;  1FIA A;  2MGQ A;  2LY9 A;  4C2T A;  1V4R A;  1EKE A;  1NK3 P;  2V6E A;  2Z1D A;  3EGQ A;  3QPH A;  2CUJ A;  3CUQ B;  3HEF A;  4RBO A;  3CF2 A;  1ZG3 A;  4CXF A;  2WV0 A;  2O03 A;  3HTH A;  3ZMV A;  4ZTF A;  2EV5 A;  1Z7U A;  3BZC A;  4GYG A;  1I6X A;  5B66 C;  1XG1 A;  3S15 J;  5HSZ A;  3J7Y J;  2K5C A;  2ZOZ A;  4PJ0 C;  3AQS A;  4ZZD A;  2RNG A;  1PJR A;  3ZN1 A;  4IXA A;  2EWN A;  2RGV A;  5LHI A;  5KCM A;  3KPH A;  4CCO A;  4C2U A;  2GFN A;  1TLH B;  1VQL I;  3SZG A;  3PM1 A;  4A5M A;  3ULQ B;  3F22 A;  3PNT A;  4AVP A;  5HS9 A;  2E5Z A;  2M1B A;  2NS8 A;  3A0B C;  3TQN A;  4AYB N;  3O60 A;  1X2N A;  2OTJ I;  2O0Y A;  2YU9 J;  4Q5S F;  3QU6 A;  3T8R A;  3E7Q A;  2VOD A;  1TT0 A;  3WTZ A;  4UV8 A;  4OAY A;  4HAM A;  5DM7 F;  2KPM A;  2P7C B;  4IRI A;  4G94 A;  3KZI C;  5K7Z A;  3HIF A;  3ON2 A;  3TL4 X;  3BWG A;  3HIM A;  1GHC A;  2HYT A;  3VB2 A;  3LSH A;  5JLW A;  3HB9 A;  2CQ7 A;  2LY2 A;  3DTK A;  2R7W A;  3DTE A;  5F6F A;  2IU5 A;  2KQR A;  4MQ9 F;  5E8I A;  3GZ6 A;  3DPJ A;  2BVM A;  3TP3 A;  2JQ7 A;  4RGU A;  4RAY A;  3Q3S A;  3F23 A;  1G6N A;  5GTH C;  1E3H A;  1TWA J;  4CA0 A;  3ZOB A;  4N0B A;  4XRF A;  3BCG A;  1U2W A;  2L0K A;  3L9F A;  3GEZ A;  5E20 A;  1FP2 A;  2CW8 A;  2LC2 A;  3PSF A;  1FOK A;  3EUH A;  1WPK A;  3H9J A;  3KP2 A;  4MGR A;  4RM2 A;  3HOY J;  4D5F A;  5F0H A;  1PVE A;  4V19 K;  1OCT C;  5F0F A;  2QF7 A;  5JI6 A;  5LEJ A;  4U9N A;  3G6E I;  4C2M J;  1SAX A;  1N77 A;  2XIG A;  4RLF A;  4OD4 A;  1K7A A;  1MW7 A;  1UST A;  4UUV A;  1X3Z B;  1FYL A;  3OYH A;  2EZK A;  3FKI J;  2W00 A;  3CDL A;  1T0F A;  1OYI A;  1HW1 A;  4B1R A;  3PNV A;  1ZLK A;  1W7P D;  5BS6 A;  3JSP A;  1RKW A;  2E71 A;  2FOW A;  3H5R A;  4M3E A;  4ZDL A;  3WTT C;  4BXU A;  4DZJ A;  2X4H A;  5KAI C;  2VT2 A;  5CQG A;  1UJ8 A;  3CMA I;  3RPU A;  1QNT A;  1Q1V A;  4ENM A;  3ZQG A;  1STZ A;  3K7A J;  4GDF A;  2VJI A;  4GFK A;  2FBK A;  5FD6 A;  1AU7 A;  1R1V A;  1A04 A;  1XGO A;  2BHZ A;  2Y0M A;  2FNA A;  2L02 A;  5F08 A;  1HBX G;  2VB6 A;  3CCY A;  1FWZ A;  3O2P E;  5J1R A;  4F55 A;  2KZG A;  4LMY A;  2HOT A;  2CV1 A;  3OSF A;  1F4K A;  3RSN A;  1A31 A;  3K10 A;  5IYB J;  5FB2 A;  1OFC X;  2ZOY A;  2DA5 A;  5B1A H;  3IAM 2;  2XPV A;  2UXN A;  1MBH A;  3LOC A;  2STT A;  2JN6 A;  1F43 A;  2ESN A;  3LA3 A;  1YS7 A;  3ABK H;  2VKH A;  3C1D A;  3Q9S A;  5M5X J;  4GFB A;  1G3T A;  3BTC A;  3RKW A;  4A3C J;  3WGH A;  2V1N A;  1G3W A;  4I0B A;  1B72 B;  4XON A;  2NNN A;  4MK6 A;  2K9M A;  2V6C A;  1HXD A;  5KVR A;  3GXO A;  4NEL A;  3OOP A;  2VAS A;  5HDN A;  2JA8 J;  5B3S H;  1IN6 A;  5K5R A;  3BG7 A;  3S1Q J;  1KU9 A;  2F4M B;  4A0Y A;  1JUS A;  4BAY A;  5DV5 A;  2Y48 A;  1NH3 A;  2YVE A;  4UVA A;  1SFX A;  1FTT A;  2BW3 A;  3AAF A;  2KLO A;  3F21 A;  1TBX A;  2DJI A;  2EFQ A;  2G7H A;  5FKL A;  4AWX B;  1ZRD A;  2P6S A;  3HL2 A;  3T8T A;  4WX9 A;  3KEQ A;  4KYW A;  4KA4 A;  1BW6 A;  4G8X A;  1HA8 A;  4BU2 A;  1U5T C;  1DGW Y;  3AL0 B;  3BR3 A;  3KET A;  1G3Y A;  3BT9 A;  2L54 A;  2PLY A;  4H0E A;  4UVC A;  3I64 A;  3DKW A;  3T1B A;  3H5N A;  3NEU A;  2E7W A;  2V7F A;  2DLL A;  3V42 A;  2BY0 A;  1VI0 A;  3GTL J;  2KHM A;  1SFU A;  3OYC A;  3ZQC A;  1O57 A;  4M3D A;  1JHH A;  4L9T A;  1B9N A;  2G7U A;  3DEE A;  4RMN A;  4LIU A;  3REO A;  4HNT A;  3H92 A;  2WAQ N;  4IL6 C;  4Q48 A;  1FIP A;  1I3A A;  2Q2E A;  4L0Y B;  2ACJ A;  2G7S A;  2FML A;  3DBH B;  4NNJ A;  4P55 A;  2AO9 A;  3QKX A;  3TDZ C;  5F27 A;  2NNY A;  2ZME A;  1XSX A;  2ZO4 A;  3IRR A;  3BY6 A;  4HNU A;  3SXY A;  3KNW A;  2DFE A;  3JRF A;  2CO5 A;  1YTY A;  1O3S A;  1SEU A;  1BI1 A;  4WXH A;  3WTU C;  3FK7 A;  1GXQ A;  5CW8 A;  4LG0 A;  3T6N A;  1Y1V J;  1MBJ A;  3DEW A;  2X6Y A;  3M8J A;  2HVS A;  2D1V A;  3WHB A;  5BPI A;  3OR1 C;  1AWC A;  1LVK A;  5GP9 A;  5KK1 A;  1OJL A;  2DA6 A;  4B8X A;  1QZZ A;  2O3F A;  1Z67 A;  2PMU A;  1FY7 A;  1C0W A;  2HNH A;  1IZ1 A;  1UG0 A;  4AU7 A;  3S17 J;  1MBE A;  3VOE A;  1K6O A;  4AYB A;  2MH9 A;  3PIO F;  3HOS A;  3HOT A;  2P8T A;  1W5T A;  2RKH A;  2V9V A;  1X58 A;  2XAG A;  2VL8 A;  3I55 I;  3QP5 A;  1X1D A;  1I6H J;  1S7O A;  1QHH D;  3OIP A;  4HLY A;  2XAU A;  2WB1 N;  5FKM A;  4EV0 A;  4KMF A;  2XRO A;  3JRB A;  4XQF A;  5KHD A;  2WC2 A;  3K4C A;  4XLN F;  1R5H A;  4IHW A;  2BZT A;  1A6I A;  3FBN B;  4TV7 A;  2LRD A;  5H9T A;  3RCO A;  1VQP I;  2MAB A;  3ZP5 A;  3IH3 A;  2E1M B;  1DUX C;  1Y0N A;  5LLQ A;  5M5W J;  1X19 A;  1BBY A;  1PP8 F;  3LSK A;  5GPC A;  1FLI A;  1VQ6 I;  1L0O C;  3HOW J;  3P7N A;  4UB8 C;  1MBK A;  2CU7 A;  4LOC A;  3MKY B;  2P5L C;  2R5Y A;  1LVA A;  4U0V A;  2HR3 A;  3FK6 A;  4YFK F;  4II3 A;  1VQ7 I;  5DDG A;  2OF7 A;  2L7F P;  4R79 A;  1JXS A;  3JRD A;  2NVT J;  1PUE E;  1R4M B;  1ZR2 A;  3QPL A;  4M6Y A;  1WI9 A;  5LRS A;  4XRS A;  1TP4 A;  5F0C A;  3EDP A;  3ZQF A;  4BAC A;  1LPQ A;  3KZ9 A;  3DKX A;  4JBA A;  3SYT A;  4WF2 A;  2DFI A;  1OCP A;  3DCF A;  5JHF A;  2OA4 A;  3KEY A;  5HLT A;  4ESF A;  2W25 A;  2ZJR F;  2GZW A;  2DMU A;  1P4A A;  5HLG A;  1OR7 A;  1UHM A;  2EIN H;  1T95 A;  2NS0 A;  3BTI A;  3U9G A;  1ERD A;  4UUT A;  2DOD A;  5FLM J;  4YG2 F;  3PIP F;  3BR5 A;  1LQ1 A;  3HTA A;  4IRH A;  3VSL A;  2IS6 A;  1W36 C;  3GCM A;  3PO2 J;  1Z91 A;  1KQ9 A;  4WXC A;  4BNC A;  2NS7 A;  5LEK A;  3I9V 2;  1YI2 I;  4M6V A;  1LEB A;  2JVH A;  5E3M A;  5E3O A;  2CUE A;  1DP7 P;  1TWF J;  4OU0 A;  5EFY A;  1JHF A;  2UXO A;  1X3U A;  4A0Z A;  3ZQL A;  4IOA F;  4DJA A;  2MLG A;  1H9G A;  2R4G A;  2X1E A;  4RA2 A;  2V1U A;  1XN7 A;  3LQQ A;  4AIJ A;  3T0Y A;  2FMY A;  5HDK A;  1ZK8 A;  1JGG A;  4XOP A;  4CYC B;  2KZV A;  2JRT A;  4ESJ A;  1J09 A;  1FOX A;  3EUH C;  3VOK A;  1WGX A;  2ZJP F;  5LBQ A;  2PX9 A;  5HOO A;  4D7N A;  2MW8 A;  3CLO A;  3TOB A;  3NQO A;  5IPA A;  3LA7 A;  5IYC J;  5J8C A;  1WCM J;  3LJL A;  3BTL A;  1KON A;  2FJI 1;  4LGW A;  4EJO A;  2CFX A;  3DLA A;  4FIS A;  3KP4 A;  1T0F C;  5DUI A;  4IPA A;  1G59 A;  2XAQ A;  2M4K A;  2ZB9 A;  1GUU A;  4CYD A;  2JMW A;  5FRM A;  1LNW A;  4P1W A;  4H4K C;  1JE8 A;  2HYG D;  3HXL A;  2KMU A;  5FGL A;  2Q2E B;  2XB5 A;  2NVQ J;  1EH7 A;  4Y33 A;  3L1P A;  3WG9 A;  3OYD A;  1V3F A;  4NB5 A;  1JUP A;  1X4O A;  3K1M A;  2OUM A;  2K9S A;  2K9Q A;  1JTX A;  1CF7 A;  2OI8 A;  3LAP A;  2O8K A;  1QBJ A;  1ON1 A;  2EIL H;  4A5N A;  1YIT I;  3S2W A;  5K1Y A;  2Z99 A;  1BOB A;  1UCR A;  1OYY A;  2VON A;  4Y15 A;  4XL9 A;  3ERM A;  4HG2 A;  3OYL A;  1ORK A;  2BEO A;  4LG0 B;  1JI8 A;  4I0A A;  4M73 A;  2QQB A;  2IGN A;  2WAQ A;  1LFU P;  3GF2 A;  2AXT C;  2ID6 A;  4PGG A;  3G4S I;  4L0Z B;  1N25 A;  2QBY A;  4IO9 F;  2HU9 A;  1BI3 A;  1IXS B;  1YJ9 I;  2ELK A;  1XSV A;  1MKM A;  2JPC A;  4EQQ A;  3ECH A;  5IT3 A;  2MYS A;  1ZRC A;  3BG5 A;  2STW A;  4EGZ A;  1XD7 A;  5C4Y A;  2HWV A;  1W0T A;  4KWA A;  3CRJ A;  3F1B A;  2ADU A;  5CVR A;  4IZZ A;  2OTL I;  4XLH A;  2ELJ A;  4ZYH A;  1GT0 C;  3CUQ A;  3Q0W A;  1Z1D A;  3V4G A;  2Z9O A;  3BJA A;  3L2W A;  4XM3 A;  4HST A;  1GDT A;  2D45 A;  2VUM J;  3OS1 A;  1ITY A;  2PMZ A;  1S29 A;  2QM3 A;  1MSE C;  3LA2 A;  3OL3 A;  2RDP A;  1IRF A;  2DFF A;  3KZZ A;  3A01 B;  4W97 A;  1YJW I;  2DOF A;  4HX8 A;  4KIC A;  4B44 A;  4A12 A;  1NTC A;  2JWT A;  2Y30 A;  5IP6 A;  4IHX A;  1XTA A;  3V7R A;  2OAZ A;  2BHY A;  3AQT A;  3K6G A;  1R6R A;  5CXG A;  3K70 C;  1YQA A;  2K40 A;  5HS8 A;  3TBI A;  2DG8 A;  3WTX C;  1MMD A;  1RES A;  4BXF A;  4F7Z A;  5K7H A;  1BR4 A;  1MSF C;  2R92 J;  1IV6 A;  1FYK A;  1Z3X A;  3HSR A;  2ICW G;  4A6E A;  4IX7 A;  2VJ5 A;  3G7R A;  1GV5 A;  2ZFW A;  4UB6 C;  1PDN C;  1K83 J;  1YW9 A;  1J2X A;  1W4M A;  2KIS A;  2IP2 A;  2HXI A;  4LFU A;  1BIA A;  5TIS C;  2LTP A;  3BR6 A;  3CMY A;  2J5P A;  2V57 A;  3BR2 A;  4M9X A;  2R7F A;  3PJR A;  3LQR A;  2E34 A;  2AS5 F;  3LSP A;  4ICH A;  3FXM A;  1O7L A;  2ZME C;  2WBM A;  1BW5 A;  3VPR A;  2JTV A;  1R71 A;  2GWR A;  3C2B A;  3HKZ N;  4FCY A;  5L3B A;  1D0X A;  1UI5 A;  4FE7 A;  1V54 H;  4KIG A;  1TL8 A;  3H0G J;  3A02 A;  3WTV C;  4U88 A;  2QEN A;  3GVA A;  2DOA A;  3TW7 A;  2JA7 J;  2W82 A;  1QZE A;  2X6W A;  4RM3 A;  4MTE A;  1O7F A;  3MVP A;  5IOZ A;  2HVR A;  3B02 A;  3MFK A;  2A6H F;  5D19 A;  1B8I B;  5D6F A;  2LP0 A;  2G0E A;  3CJR B;  4I76 A;  4IQJ A;  4F3Q A;  2NRA C;  1XB4 A;  3M8E A;  5BPD A;  1AKH B;  4M9S A;  1K6Y A;  1U78 A;  1TQI A;  1FSE A;  3MNL A;  3MZY A;  3PQJ A;  3EQL F;  1A36 A;  1X1C A;  2HKX A;  4ZDO A;  1HW5 A;  4ENJ A;  2FOK A;  2B3W A;  1ETO A;  3GFI A;  4LJZ F;  3KEO A;  4BBS J;  3G56 A;  4HYE A;  4BL0 B;  1IRZ A;  4XID A;  1B4A A;  3FDY A;  2L9V A;  4C3H J;  5E1W A;  4DYQ A;  1QRY A;  1X3W B;  3WE3 A;  4I6Z A;  3NXC A;  2L2O A;  4XSZ F;  3PPB A;  1Z6T A;  3F9K A;  5DCM B;  5FKN A;  3W2W A;  5JVT A;  2E36 A;  3H0D A;  3N05 A;  4FET A;  1O3T A;  5M5Y J;  2ETH A;  2QGU A;  3RZO J;  4CHU A;  3ZN0 A;  2PFB A;  4DW6 A;  1BM9 A;  2ID3 A;  3WGG A;  2ZCX A;  3HZJ A;  4UV9 A;  3FWE A;  2ISZ A;  2A6T A;  4HNV A;  1F36 A;  4U7B A;  4X1E A;  3CC2 I;  1RKT A;  3MAJ A;  3S1R J;  3CCL I;  2IS1 A;  2FBH A;  1QZY A;  4Z6Y A;  5GAD J;  2PMH A;  3FZV A;  5E79 C;  3LWJ A;  3SFI A;  4JL3 A;  3WG7 H;  3HRM A;  1WVR A;  2M2E A;  2PJP A;  5HVQ C;  1EF4 A;  2K27 A;  4B3A A;  2P5K A;  5DUK A;  3O8G A;  5J8F A;  2VQG A;  3R0J A;  2E60 A;  3LFU A;  3M3Y J;  5ICF A;  2GQQ A;  3DLL F;  1SC7 A;  1G2H A;  2HZD A;  1HKS A;  3HRS A;  2BYV E;  1T38 A;  1K79 A;  3A4C A;  4M9Z A;  1KYW A;  3GFM A;  5EYR A;  2DA3 A;  4I7H A;  1TT5 B;  2BXZ A;  3OL4 A;  2M45 A;  4PUS A;  1MZB A;  1OR7 C;  4PFO A;  5ICG A;  2Y9Z A;  4MQV A;  5CVI A;  2H09 A;  3CD6 I;  1FT9 A;  3RKQ A;  1NG6 A;  4PJJ A;  2COM A;  4JKZ A;  2L3D A;  3GX4 X;  2EH3 A;  3ISP A;  3PL8 A;  3WOD F;  1I50 J;  1JKP C;  4A3K J;  3JTH A;  5GTI C;  3MD2 A;  1QPI A;  1V5F A;  5E1Z B;  2P81 A;  5H6R A;  4U9L A;  1MNM C;  3GEU A;  4Z2Y A;  1MD0 A;  5C4J J;  3RD3 A;  2B0L A;  3E6D A;  4U87 A;  3V8J A;  1QA6 A;  3VW2 A;  2DT7 B;  4YII A;  1QU3 A;  3HPG A;  1RR7 A;  2XSD C;  4II2 A;  1BC8 C;  3IKT A;  4ACI A;  2LMD A;  5D4R A;  1ENH A;  3IHU A;  3OR2 C;  4E7J A;  5FLX K;  4IRV A;  5EEH A;  2BV6 A;  1SD7 A;  4MFE A;  1IXC A;  5GAH J;  3QAH A;  5HOD A;  2OCE A;  1QGP A;  4V2F A;  1S3J A;  1OPC A;  3E97 A;  2KJB A;  2ZXH A;  4BJ6 C;  3JRG A;  3SJM A;  2XF6 A;  2E5N A;  4EM2 A;  3EUP A;  3HHH A;  3K4K A;  2MC4 A;  4CCJ A;  1IN5 A;  3FXL A;  3KP3 A;  4DQ2 A;  1MGT A;  3VVY A;  3VOD A;  1MH4 A;  3GTP J;  2F5D A;  3VP5 A;  4C2M A;  5B5E C;  5CLS A;  4BH9 A;  5J4Y A;  5E18 F;  2NP3 A;  4PK4 A;  1H89 C;  2IJL A;  5EDN A;  1G4D A;  2XGX A;  1Y8Q B;  5L3D A;  4QWQ A;  3F6O A;  3CCU I;  3L2C A;  3K1P A;  3W6J B;  5JVG F;  4UNO A;  1OCZ H;  5FLX Z;  1YJN I;  2VQH A;  3U1D A;  3GTJ J;  4YIF A;  2VE9 A;  1SVL A;  1B59 A;  2UXI A;  3LNQ A;  4FX0 A;  4YRV A;  2GUH A;  3A03 A;  3BOQ A;  2QTQ A;  2FNP A;  2BXY A;  5D4S A;  5JHU A;  4DIQ A;  3L2Q A;  4RGX A;  2LSO A;  4JQF A;  2LKS A;  2D2W A;  3GZI A;  2XRL A;  2XRN A;  3NWT A;  2HYF A;  2F5E A;  3AG4 H;  2LH9 A;  5LGU A;  5ILV A;  5TJJ A;  2Z3Y A;  4L62 A;  1WH5 A;  2ZXJ A;  1MBG A;  1IN8 A;  5EJC A;  4DYR A;  4KIS A;  1HCR A;  1WJB A;  1O4X A;  1ZGW A;  5C3E J;  4HDU A;  3A1Y A;  2CRG A;  3M8F A;  3RQI A;  3E1S A;  3K4L A;  3J7A Y;  4A3L J;  2UXX A;  3JRE A;  2IAI A;  5JFR A;  3P9C A;  2RAE A;  3CTA A;  4NC8 A;  4D7M A;  4P9F A;  3EYI A;  1FNN A;  3HKZ A;  2IS2 A;  2Z16 A;  3COA C;  1ETV A;  2ZJQ F;  1T39 A;  3LST A;  2F07 A;  5GAE J;  3GO5 A;  2Q8K A;  1LEA A;  4XIC A;  4XRS G;  1T98 A;  3K4N A;  3CUQ C;  3PNY A;  3IWZ A;  1YLF A;  2FU4 A;  3VYT B;  5JR3 A;  2YUS A;  3L2R A;  4E7L A;  4I2O A;  1FJL A;  2FXA A;  4XLC A;  1SMT A;  5EGO B;  5DAJ A;  2ZXI A;  3M07 A;  2VPL A;  1IO2 A;  2FF4 A;  4GFL A;  4LD5 A;  1BN5 A;  1FMV A;  1BR1 A;  2GEN A;  4MEY F;  3BR1 A;  3Q0V A;  1BIB A;  4CZZ A;  4QPQ A;  4XKV A;  3CJD A;  1SD6 A;  1MBF A;  5J6X A;  3VIB A;  3R0A A;  4RB3 C;  2H1L A;  3P9K A;  1IRG A;  2EBI A;  4NC7 A;  3TDU C;  5FRO A;  2A6E F;  2QOP A;  2KFD A;  1VF9 A;  3V6G A;  4EMS A;  5CVU A;  3M4O J;  3S32 A;  1RZ4 A;  2ME6 A;  2Z5U A;  4OIO F;  3H3U A;  1QVT A;  3DPT A;  3U2R A;  4AIH A;  1W36 D;  1Z05 A;  3HOZ J;  2QWT A;  2L4A A;  2CV2 A;  2LBF B;  1TNT A;  3HTU A;  3HUG B;  1FPQ A;  5LRR A;  2LFB A;  2P4W A;  4RAF A;  2WUI A;  3S1N J;  4G7O F;  1Q1H A;  4Y7N J;  3R60 A;  2YS9 A;  2MA3 A;  2KL4 A;  2EV6 A;  3D5L A;  1HOM A;  3LSI A;  2VKV A;  3ABL H;  2CQN A;  2K3F A;  2VBZ A;  4CCN A;  3FBI B;  4HQM A;  4EGY A;  3I56 I;  3FM3 A;  3GTQ J;  4KIB A;  4CYC A;  2VN2 A;  3SFZ A;  1LDJ A;  3OV8 A;  2VC1 A;  1ETW A;  2LVS A;  2MD0 A;  4RB0 A;  2DDB A;  2EB7 A;  1FBU A;  3MQ0 A;  1YX5 A;  4Y13 A;  3I3L A;  4P9U A;  3T5X A;  2DXI A;  2OC6 A;  1A35 A;  1ZRF A;  4OD5 A;  1TW2 A;  1PP7 U;  1FBQ A;  2VPR A;  5B1B H;  2IS4 A;  1D1B A;  2ZCW A;  4B3X A;  3HOU J;  1T33 A;  5DEQ A;  2GOM A;  2GA2 A;  3C7J A;  1K61 A;  1RET A;  2QKL B;  2UXP A;  1SAU A;  1APL C;  2KP6 A;  4NHJ A;  2LG4 A;  3I5U A;  3LMM A;  2WTE A;  2DOE A;  2X51 A;  1SAN A;  3OWT A;  2ZNY A;  3RPU D;  4XRM A;  4CCK A;  1TTY A;  3VEP A;  3J7Z I;  4RB1 A;  1QO0 D;  4KN4 X;  1W7P B;  5ERI A;  1LFP A;  4IHT A;  1U0J A;  2QEX I;  3PSI A;  2HKU A;  4MXM A;  3H9G A;  2H94 A;  3E7L A;  4GCV A;  4A93 J;  4CIC A;  2H6B A;  3QYF A;  2X48 A;  3X2Q H;  2TCT A;  3D1N I;  2L5Q A;  2IGM A;  4BJT A;  2ZY9 A;  4LK0 F;  4DOZ A;  3OYI A;  4CUG A;  3FHZ A;  3S3M A;  2IW5 A;  2DQR A;  2IA1 A;  4Y4R A;  1ZG1 A;  3NI7 A;  2ZKZ A;  2Y69 H;  3F8N A;  3CO7 C;  3U1K A;  1RUO A;  4LLL A;  1JTY A;  4G7H F;  3ECO A;  1LDK B;  3CDI A;  1ZGJ A;  1V5G A;  2PMZ N;  3DEU A;  1OCC H;  4OIP F;  5HNH A;  1YO5 C;  3UR3 C;  1R36 A;  1W5S A;  2G9W A;  2V79 A;  2EJR A;  4HF1 A;  2XGD A;  5JLX A;  3VVX A;  2DYR H;  1YOV B;  4HQE A;  1U8B A;  1UHS A;  3RI4 A;  1MMG A;  2WV1 A;  1UI6 A;  2QZ8 A;  3DPL C;  2K3P A;  3KP6 A;  3VSK A;  4RB2 C;  3P5J A;  3CCQ I;  2NVU B;  1ULY A;  3S8P A;  1VTN C;  3OIO A;  4O6J A;  1T2K A;  1IGN A;  4N4O B;  2AHQ A;  2EFW A;  3E3V A;  4Q47 A;  4G7Z F;  1J7K A;  3E5Q A;  1JKQ C;  3GTK J;  3A01 A;  2VIX A;  2AQF A;  3C18 A;  4CCL A;  5IP7 J;  1E3O C;  2HOS A;  3AL0 C;  2PBX A;  4I98 B;  1R9T J;  1VND A;  3S14 J;  1D3Y A;  2HI3 A;  1OKR A;  2MBF A;  4QPO A;  4XLF A;  5FD5 A;  3K70 D;  3BJB A;  3KP7 A;  2KIQ A;  3ZQQ A;  4BY1 J;  2G7L A;  1IV8 A;  4E4H A;  4UXN A;  2W1O A;  4EJU A;  2UV1 A;  3KIO A;  3HGG A;  3GW2 A;  4LLG F;  3BP8 A;  1WQ2 A;  4BE0 A;  4DVY P;  4HBL A;  1XS9 A;  3ABM H;  3GLX A;  3L2U A;  4FTH A;  2RQP A;  1E3P A;  1S7E A;  2FUG 2;  3AFH A;  2ECB A;  2IA2 A;  5HLI A;  1YX3 A;  4ZZL A;  1Z7L A;  1TWH J;  1ZH5 A;  2YU3 A;  2YR2 A;  1J5Y A;  4UVB A;  4CSW A;  3JAM K;  5EG0 B;  3H5A A;  5L3G A;  1XMA A;  2ZXW H;  5FRN A;  2YX4 A;  2XKP A;  2H8R A;  4W1U A;  1ZG5 A;  1ONV A;  5D5V B;  2JA5 J;  1D8J A;  4XOT A;  1ZN2 A;  1BC7 C;  2KRF A;  1A5J A;  2JRM A;  1WJE A;  3GWZ A;  2M34 A;  3GZ5 A;  4E7H A;  4M74 A;  1BA5 A;  4HA8 A;  4BY7 J;  3IV5 A;  3GUD A;  3HBL A;  4JOM A;  1A6Q A;  1P4W A;  2DTR A;  2MG4 A;  4L5I A;  4IRG A;  3C3W A;  2DI3 A;  4JK1 X;  3BTJ A;  2F5C A;  2ZFU A;  3LSJ A;  2M8E A;  4XN3 A;  2XHK A;  3IH2 A;  3CDH A;  4G9Y A;  5TGT A;  4HKU A;  2JSC A;  3I71 A;  5LHH A;  3OYK A;  3MN2 A;  2A69 F;  1N75 A;  2JJ7 A;  2X1D A;  2LNB A;  3K9T A;  5CJ9 A;  3AG2 H;  4IHS A;  2EA4 A;  1B8I A;  4HDV A;  3JAM Z;  3ABU A;  4RGR A;  1LFB A;  1AKH A;  2X85 A;  1S8N A;  1XMX A;  2X9D A;  3G2B A;  3R61 A;  3PUB A;  4PCQ A;  3ZQ7 A;  3G73 A;  2E1N A;  5J3L A;  3JTG A;  3BNI A;  3BPV A;  3HTI A;  2KIU A;  2FD5 A;  3DXJ F;  4QIW N;  2O7T A;  4XBF A;  3LFK A;  3HDD A;  2RVC A;  1FBS A;  3ZGK A;  1BJA A;  1XPX A;  4M6X A;  1REP C;  2NVX J;  5K5O A;  3CCM I;  2HOE A;  4C30 A;  1IXR C;  3W3C A;  3B81 A;  4AF5 A;  2I10 A;  3SZP A;  4B47 A;  3GZN B;  1Y56 A;  1DGR M;  1B1B A;  2BGC A;  2DU9 A;  2NXN B;  2HQR A;  1RRJ A;  1XMK A;  1IUY A;  5DCM A;  4YFN F;  4HF2 A;  4BBR J;  3TED A;  4BDZ A;  2GA1 A;  3S2D J;  2NOG A;  4WIB A;  3WU2 C;  2IGO A;  2DPU A;  2E1M C;  5EEA A;  2PN6 A;  1D1C A;  3KLN A;  2K9N A;  3F8C A;  5HDG A;  2C6Y A;  2DO7 A;  4ETS A;  4HSR A;  3CQZ J;  2DG7 A;  1LJ9 A;  2E2H J;  4G6Q A;  1F9N A;  2BOL A;  2EFP A;  3KZY A;  5AIP A;  5ED4 A;  1ZLJ A;  2EFO A;  1EV7 A;  2QCO A;  1YW8 A;  1X1B A;  1XGS A;  3E5U A;  3HPH A;  2VOO A;  1S7A A;  3BZ6 A;  1WRJ A;  3OYF A;  2AXL A;  2EV0 A;  1IG7 A;  3I53 A;  2E1C A;  4ABZ A;  4PJL A;  3OSG A;  1YRN B;  1OCR H;  2LDU A;  3BQY A;  3WHC A;  3G3Z A;  2F2E A;  4HX7 A;  2IXS A;  1K78 A;  1XDS A;  3DTI A;  2IRF G;  2M0C A;  1I39 A;  3CCS I;  4BQA A;  4AD9 A;  1TW3 A;  2FQ4 A;  2HTS A;  5D5W B;  2D6Y A;  2DT5 A;  5FO5 A;  3D0S A;  4L9J A;  2K02 A;  1ON2 A;  2N8G A;  3GTM J;  1V55 H;  2M8G X;  2EA2 A;  3L2V A;  1SD5 A;  1JKR C;  2GIV A;  2VC0 A;  3C2G A;  1U9O A;  4Y3O A;  1JT6 A;  2R7Z J;  5DTD A;  4DBR A;  1D5V A;  4XK4 A;  2P5V A;  2R7O A;  3OYJ A;  4B09 A;  1FP1 D;  1G3S A;  3BLY A;  2OD5 A;  2QVO A;  3CCR I;  4KIT B;  1J59 A;  1LE8 B;  2O6G E;  1R23 A;  2HFH A;  2EZI A;  2KKO A;  5E3L A;  3BJ6 A;  4B43 A;  3ROU A;  2ZSH B;  3ABT A;  3W6K B;  2DT6 A;  3BRO A;  2VBY A;  2B7E A;  3JRH A;  3ON4 A;  2OZ6 A;  2JK3 A;  2Y75 A;  2HDW A;  1MJB A;  2LF7 A;  1W5C C;  5FKO A;  3IH4 A;  3CCJ I;  2VT3 A;  3C07 A;  3R4K A;  2A07 F;  2B1E A;  2V4J C;  3F0C A;  3HJE A;  1P6R A;  2X1C A;  3F6V A;  1OCO H;  3QPS A;  4AC0 A;  2DBB A;  4QLC U;  1TC3 C;  2L9R A;  1SVM A;  1T08 B;  1Z6R A;  2VE8 A;  1JGS A;  2XGC A;  3HRT A;  1EH8 A;  4HZF A;  4BE2 A;  4P5O A;  2MH2 A;  1Z9C A;  4FE4 A;  1D0Y A;  2XPU A;  3TOA A;  4LIT A;  2G7G A;  4ESB A;  2PFV A;  4D5C A;  1OYW A;  2OBP A;  3TGN A;  1ETQ A;  3IUV A;  4AM3 A;  3HTJ A;  4J19 A;  1R1U A;  5K7F A;  3ASO H;  2A61 A;  3CJQ B;  3CP8 A;  4KN7 X;  1VQ9 I;  4AUX A;  2OER A;  4CGZ A;  1S9H A;  3SEQ A;  3NAU A;  5EZG A;  1UMQ A;  2R5Z B;  4PGH A;  1MH3 A;  1R5I D;  4HEA 2;  2GIZ A;  5D6E A;  2M4G A;  1S5L C;  3BHQ A;  4XR6 A;  1K4S A;  2UUZ A;  4G6T B;  3K4M A;  1YYV A;  3MWM A;  2DTZ A;  2QLZ A;  3K1N A;  3RYP A;  3JRC A;  4IVN A;  2E2I J;  3W6V A;  3CWR A;  1R22 A;  3S93 A;  1XC5 A;  1RC9 A;  2COB A;  4HF0 A;  2D5V A;  3B73 A;  2HGC A;  2CG4 A;  2QKO A;  2MLK A;  3DF8 A;  3COL A;  3ASN H;  4D1Q A;  5H2F C;  3OYE A;  4XKB A;  5E8G A;  1IAW A;  3FKJ A;  2YX7 A;  3H36 A;  3KLO A;  3MKW B;  3GTO J;  1WZ2 A;  3RYR A;  4OOI A;  2UWM A;  4Y52 J;  1VFC A;  3TO6 A;  4RGS A;  2P0W A;  1AOY A;  1HQC A;  3L09 A;  1HST A;  2CV0 A;  5IT9 K;  4NBQ A;  4U0Y A;  4XKW A;  2GOX B;  1XX5 A;  2HS5 A;  2L7M P;  3JRA A;  3MKZ A;  4V2G A;  3RPQ A;  4BYY A;  4BQQ A;  5EGO A;  2LYC A;  3BCA A;  3KYL A;  1DPU A;  4CDG A;  2NVY J;  3ONQ A;  1EJ9 A;  2ZNZ A;  5AIQ A;  1VQK I;  2FRH A;  4D9J A;  1CQT A;  2A5Y B;  2XPW A;  3S3O A;  1K4T A;  4A3J J;  3C2H A;  2F5F A;  3H3Z A;  5C44 J;  4AIK A;  2CQQ A;  1P7J A;  4E7S A;  4EJW A;  5FHP A;  5FFZ A;  3BG6 A;  1P9Q C;  3ZCO A;  3NRV A;  3QPT A;  1VQ4 I;  2E1O A;  1W0U A;  4ZYA A;  5KAF C;  2I8D A;  2NOJ B;  5FLV A;  2FJ1 A;  5AQC A;  4M3G A;  3RJP A;  5D5X B;  4S0H B;  1MDM B;  3K0L A;  3TW6 A;  1T56 A;  3F3X A;  1S72 I;  2M9H A;  3M9A A;  2ELH A;  2L7K A;  3VW0 A;  2PEX A;  4EM0 B;  5J4V A;  2YSR A;  3H9Q A;  3MZH A;  4BQN A;  2RNJ A;  3D5R C;  5IT9 Z;  1TQM A;  4HLX A;  4L5E A;  2DPD A;  4UDS A;  2DDA A;  1XCV A;  1WJ5 A;  3DWL E;  2WGB A;  3E0J B;  4AID A;  1IN7 A;  4ZH4 F;  3FRQ A;  4LIV A;  3RKX A;  3W2A A;  4ZYE A;  3M1C A;  1YFH A;  2E7X A;  5CPR B;  2HZT A;  2LBF A;  2K85 A;  3HUG A;  2ECC A;  2TDX A;  3I59 B;  2MFZ A;  1K78 B;  3HM5 A;  4BQO A;  1UFM A;  1F5T A;  2IPQ X;  3PO3 J;  4PJN A;  4P96 A;  3OYB A;  4XLA A;  4BS9 A;  5EF6 A;  4KT5 C;  1T6S A;  2LR8 A;  3QWL A;  5D8K B;  3BRU A;  3LWF A;  2Y31 A;  2MC3 A;  3UKG A;  2Y0S N;  2IVM A;  2H1K A;  3FXR A;  1DU6 A;  2LKX A;  3DFG A;  4F92 B;  4DZP A;  1E0E A;  4XLE A;  3TP0 A;  3FMR A;  2CJJ A;  3CZ6 A;  4FHT A;  2YVX A;  4OMY A;  1WKM A;  1D5Y A;  3BG9 A;  3LL7 A;  4BHC A;  3PQK A;  5J40 A;  2P7V B;  4IOC F;  2XF7 A;  1WFX A;  2CMP A;  3ZMU A;  2K4B A;  4U0W A;  2VQL A;  4F93 B;  4ME9 A;  2YVH A;  4HX4 A;  3K8P C;  1TQP A;  2KT0 A;  2FA5 A;  3BQZ A;  4BEH B;  3BG3 A;  4M71 A;  2H6C A;  3CF5 F;  2LD5 A;  2JA6 J;  2DMN A;  4GCT A;  2E2J J;  4A2U A;  1KU3 A;  1DPR A;  4KUM A;  1W7P A;  5M3M J;  2JT1 A;  2VBX A;  1BL0 A;  4KMU X;  1TWG J;  1RIO H;  1BJZ A;  2OPT A;  4YEL A;  2REK A;  5H6Q A;  2LKP A;  2FSW A;  3F72 A;  3OIQ A;  2IGK A;  4ZTJ A;  3SDG A;  1Y0U A;  2FX0 A;  1RI7 A;  2M7B A;  4WK8 F;  2IA0 A;  2XGE A;  3DKY A;  1LUJ B;  2O7O A;  1SFK A;  2Q24 A;  2ESH A;  2HXO A;  1P4X A;  4UHT A;  4QSH A;  2QIB A;  2JA2 A;  2O61 A;  4XNF A;  5TRD A;  1O3R A;  4AC6 A;  1E17 A;  2XF5 A;  3E6M A;  2Z2S B;  3ZQH A;  4DNC A;  5CVJ A;  3L00 A;  4F52 A;  2CSO A;  3S5R A;  3DBL B;  1TWC J;  3O6B B;  2H8W A;  4RS8 A;  1N78 A;  3VUQ A;  5FGM A;  3RIR A;  2F6C A;  4BHB A;  1FC3 A;  3NRG A;  3PFY A;  2GLO A;  4LK1 F;  2V9K A;  5HS7 A;  1WJA A;  2K4J A;  4FX4 A;  2P6T A;  2W4S A;  1BOA A;  3B6A A;  1E2X A;  4OAZ A;  3CES A;  2JUG A;  4G12 A;  4HW0 A;  3QYB A;  4JYK A;  1P92 A;  3JRI A;  1LB2 A;  1FX7 A;  4CCM A;  2JSP A;  3OYG A;  1ZKG A;  3BC8 A;  3IUO A;  1FOW A;  3QOP A;  3VVZ A;  5D5U B;  4UUS B;  4WCG A;  4GO1 A;  2F4I A;  3FIW A;  3K69 A;  1GXP A;  1IJW C;  4BGD A;  4KJZ A;  4PJM A;  5L3C A;  4DGW B;  1HLV A;  1U5T B;  2BY3 A;  3CMM A;  2R7Q A;  4A3D J;  2M30 A;  3D5S C;  4YEJ A;  1R4N B;  2WA0 A;  1OIS A;  2EK5 A;  1X1A A;  3EUA A;  2PZ9 A;  3CUO A;  3G1O A;  1SMY F;  5K5Q A;  2R7S A;  4K2E A;  3HSF A;  5E17 F;  5IP9 J;  4S04 A;  4A3E J;  4A3G J;  1YE9 A;  5F1R A;  2G3B A;  2XV4 S;  2Q1Z B;  1IW7 F;  4ANJ A;  5E3N A;  5EG0 A;  4Q4Z F;  2RQQ A;  2WY8 Q;  2XB0 X;  4O3M A;  1RPW A;  3G1M A;  5IOY A;  2O9L A;  1SD4 A;  2XC7 A;  5ICC A;  1ZRE A;  4JX4 A;  3OY9 A;  1X1P A;  4OMZ A;  5HAW A;  2M87 A;  2DAO A;  3CJT B;  1ZYR F;  2QYO A;  2Y2Z A;  5DM6 F;  2V26 A;  5LD2 C;  3QP6 A;  1Z77 A;  2HEO A;  1YIO A;  2FBI A;  1SGM A;  4EAT A;  3VYS B;  3ZXS A;  2HDC A;  2PJR B;  2XKO A;  1MMN A;  1R58 A;  2HQA A;  2V1D A;  3PUF A;  2L4M A;  1ZGA A;  3WTS C;  2VXD A;  2CS3 A;  1XCB A;  1VQ8 I;  4EEF G;  1MJ9 A;  4E7K A;  5CXI A;  4MEX F;  2DA1 A;  3KP5 A;  4EJV A;  5D1R A;  2GXG A;  5C4X J;  1ZAO A;  1QQI A;  3CC4 I;  3E5X A;  4HPQ A;  3NNR A;  3EYY A;  2A2F X;  3SWH A;  3PAS A;  1UG2 A;  4N9H A;  3JSJ A;  2YPR A;  3NWS A;  4M3B A;  1WHU A;  3RQ4 A;  1I3Q J;  2KDO A;  1JUM A;  2LOO A;  5GPA A;  2I5U A;  1ZTR A;  6PAX A;  3ANG A;  5DD8 A;  5HBU A;  5LHG A;  3BZK A;  2HYJ A;  4ZYD A;  1MMA A;  2KIM A;  4NN1 A;  1GVD A;  3L7W A;  3ZMT A;  2DCE A;  3R6S A;  3CCE I;  2M7A A;  1WJC A;  4RLQ A;  3ELK A;  3QQA A;  5J47 A;  2DA2 A;  1QVU A;  2DFH A;  2DA7 A;  1YIJ I;  1ACI A;  3QOD A;  3DP7 A;  2Y0S A;  2DA4 A;  2AQE A;  5CQE A;  3ZQI A;  3VWB A;  5L3F A;  2ME0 A;  3FF5 A;  4JP0 A;  1VQM I;  4MFD A;  2ZC2 A;  2HDD A;  1DU0 A;  1HDD C;  1VQN I;  2VXZ A;  3VYU B;  1KQ8 A;  3VYR B;  2KJC A;  2GXB A;  3LHQ A;  4NDL A;  2KIF A;  2DK8 A;  4ITV A;  1KZH A;  5GAG J;  3FHN A;  4S05 A;  5EEG A;  4L5J A;  4WXD A;  1USS A;  2A68 F;  2A5W A;  3I58 A;  3AG3 H;  3IRQ A;  1FMW A;  1YRN A;  1BI0 A;  1FTZ A;  3WU0 A;  1WSU A;  1U9N A;  2J5O A;  5L3E A;  3MCZ A;  1AHD P;  4A3B J;  4BXX J;  4C9Y A;  1GV2 A;  5E1X A;  2JPB A;  2W85 A;  4AVZ A;  4CZC A;  5EZH A;  2CUZ A;  2HVQ A;  2F48 A;  3TO7 A;  3VW1 A;  2L7Z A;  3JSO A;  2OJE D;  2OV7 A;  2CFO A;  2IT0 A;  1HSJ A;  4I99 C;  3SEZ A;  1HC8 A;  2RAS A;  1NG7 A;  4PZJ A;  2X0L A;  3FIS A;  2O8X A;  5DS9 A;  1PYV A;  3DV8 A;  3KFW X;  4ENK A;  3GLL A;  3ESW B;  1FOY A;  3H35 A;  5LFA A;  2DMP A;  3BR0 A;  2VKE A;  4KNY A;  2EZH A;  2QSF X;  4MHG A;  5ILS A;  2B63 J;  3IL2 A;  2XAH A;  3Q0U A;  2DQL A;  2WAF A;  1CGP A;  3EPZ A;  3WE2 A;  4L9V A;  1TZL A;  4G6D A;  2EIK H;  1LE8 A;  4YIR X;  3RH2 A;  1H8A C;  3MZ8 A;  4Y17 A;  3F8B A;  5A2Q K;  1WH7 A;  4N9I A;  1KA8 A;  2HQN A;  3LSR A;  2RC4 A;  1R5G A; 
#chains in the Genus database with same CATH homology
 2HQ5 A;  2N8G A;  3GTM J;  1RKW A;  4GCL A;  2M8G X;  3HE0 A;  3LWJ A;  4M3E A;  3SFI A;  4JL3 A;  1JKR C;  3KKC A;  4DZJ A;  2M2E A;  1U9O A;  1JT6 A;  1EF4 A;  4JX6 A;  5DTD A;  1Q1V A;  4B3A A;  3ZQG A;  1ZR4 A;  4XK4 A;  2DMT A;  3K7A J;  2R7Z J;  2FBQ A;  3O8G A;  4PXI A;  4GFK A;  1AU7 A;  5F08 A;  3M3Y J;  1ETY A;  1LE8 B;  3CCY A;  2IEK A;  1X2M A;  1G2H A;  2EZI A;  5E3L A;  5J1R A;  2HOT A;  3S2H J;  3OSF A;  5EYR A;  2DA3 A;  3GTG J;  5IYB J;  3JRH A;  1OFC X;  2ZOY A;  2DA5 A;  3ON4 A;  2JK3 A;  2XPV A;  5FKK A;  1MBH A;  2Y9Z A;  3LOC A;  5FKO A;  3IH4 A;  2JN6 A;  1F43 A;  4RDU A;  3C07 A;  3RKQ A;  4A3F J;  3F0C A;  1SFO J;  4JKZ A;  4MO7 A;  5M5X J;  4GFB A;  2EH3 A;  4BKX A;  3BTC A;  3QPS A;  1I50 J;  4A3C J;  2R5Z A;  4AC0 A;  1JKP C;  4A3K J;  4C3I J;  1B72 B;  1QPI A;  1TC3 C;  2L9R A;  4M3F A;  4MK6 A;  2P81 A;  2XGC A;  1MNM C;  3GEU A;  4NEL A;  5C4J J;  3RD3 A;  3VW2 A;  4FE4 A;  2JA8 J;  3S1Q J;  2XPU A;  1JUS A;  2G7G A;  1NK2 P;  1RR7 A;  2XSD C;  4ACI A;  4D5C A;  4IHV A;  2YVE A;  1ENH A;  1POG A;  1ETQ A;  4MFE A;  3IUV A;  1FTT A;  5HOD A;  3I4N J;  4V2F A;  3HTJ A;  4J19 A;  5FKL A;  1ZQ3 P;  5K7F A;  2CUF A;  2OER A;  4AUX A;  4C3J J;  3JRG A;  3SJM A;  3HGY A;  2RHA A;  3NAU A;  1BW6 A;  1UMQ A;  5EZG A;  2KDZ A;  3EUP A;  2R5Z B;  3HOX J;  3BR3 A;  1MH3 A;  5FJ8 J;  3BT9 A;  3VVY A;  3NAR A;  1HDP A;  1MH4 A;  2HOA A;  3GTP J;  3BHQ A;  3VP5 A;  2NP3 A;  2DTZ A;  3JRC A;  1VI0 A;  2IBD A;  1H89 C;  2E2I J;  5EDN A;  3W6V A;  3CWR A;  3GTL J;  1XC5 A;  2COB A;  1WI3 A;  3K2A A;  3ZQC A;  2X6O A;  4M3D A;  2D5V A;  3P9T A;  3GTJ J;  2QKO A;  5IYD J;  3COL A;  2UXI A;  3LNQ A;  2GUH A;  3ANP A;  3A03 A;  2DN0 A;  2QTQ A;  2WAQ N;  1FIP A;  3G1L A;  3GTO J;  2G7S A;  3GZI A;  2XRL A;  4MIM A;  4Y52 J;  4YZE A;  2AO9 A;  1VFC A;  3QKX A;  5F27 A;  4L62 A;  1WH5 A;  1MBG A;  3KKD A;  3JRA A;  2L7M P;  4DYR A;  3KNW A;  4V2G A;  3JRF A;  4DYC A;  1HCR A;  1O4X A;  1ZGW A;  5C3E J;  5EGO A;  2CRG A;  3FK7 A;  2NVY J;  3RQI A;  3H3V K;  5CW8 A;  1CQT A;  3T6N A;  1Y1V J;  1MBJ A;  2XPW A;  3DEW A;  4A3L J;  3JRE A;  4A3J J;  2IAI A;  3WHB A;  2RAE A;  5C44 J;  2LK2 A;  2CQQ A;  1P7J A;  5GP9 A;  4D7M A;  1OJL A;  2DA6 A;  5FHP A;  2E1O A;  2E19 A;  1W0U A;  1ETV A;  5FLV A;  2FJ1 A;  3S17 J;  4CGR A;  1MBE A;  5AQC A;  4M3G A;  2F07 A;  1IDY A;  4S0H B;  3TW6 A;  1T56 A;  4XIC A;  2M9H A;  4XRS G;  3VW0 A;  5F1J A;  2DMQ A;  2YUS A;  1X58 A;  4UDS A;  4L5E A;  1IC8 A;  1FJL A;  3V78 A;  5DAJ A;  5EGO B;  2WGB A;  1I6H J;  3FRQ A;  4GFL A;  2GEN A;  2WB1 N;  3BR1 A;  5FKM A;  1PUF A;  3JRB A;  3Q0V A;  2ECC A;  2TRT A;  4IHW A;  1A6I A;  4IHY A;  3CJD A;  1MBF A;  3HM5 A;  4A3M J;  5H9T A;  3VIB A;  3PO3 J;  2W48 A;  3IH3 A;  2EBI A;  5EF6 A;  5M5W J;  2QOP A;  1VF9 A;  2LR8 A;  3V6G A;  4JX5 A;  3M4O J;  2ME6 A;  5GPC A;  3BRU A;  2Y31 A;  3S1M J;  3HOW J;  1MBK A;  2CU7 A;  1QVT A;  4LOC A;  2R5Y A;  3UKG A;  2Y0S N;  2H1K A;  4A3I J;  1DU6 A;  2LKX A;  1Z0X A;  3HOZ J;  2QWT A;  3FK6 A;  4DZP A;  2OF7 A;  3S16 J;  3TP0 A;  2L7F P;  2CJJ A;  4A69 C;  3JRD A;  2LFB A;  2NVT J;  2WUI A;  1ZR2 A;  3S1N J;  1D5Y A;  3BG9 A;  3QPL A;  4Y7N J;  2YS9 A;  4XRS A;  5F0C A;  1HOM A;  3ZQF A;  2VKV A;  4ME9 A;  3KZ9 A;  2YVH A;  3DCF A;  1OCP A;  2KT0 A;  3BQZ A;  1IDZ A;  3GTQ J;  2DMU A;  4CYC A;  1H88 C;  3BTI A;  3BG3 A;  1ETW A;  2LVS A;  4UUT A;  2LD5 A;  2R5Y B;  2DMN A;  5FLM J;  2GM4 A;  2E2J J;  2JA6 J;  9ANT A;  4GCT A;  1P7I A;  3BR5 A;  5M3M J;  3HTA A;  1BL0 A;  1TWG J;  1Y1W J;  1BJZ A;  2OPT A;  2REK A;  2ZCM A;  3PO2 J;  2VPR A;  2NS7 A;  3SDG A;  2FX0 A;  4M6V A;  2XGE A;  3HOU J;  2XDN A;  1T33 A;  5E3M A;  5E3O A;  2CUE A;  1TWF J;  1K61 A;  1RET A;  2O7O A;  5EFY A;  2UXO A;  2Q24 A;  2UXP A;  2LLK A;  3ZQL A;  2HXO A;  1APL C;  4QSH A;  2QIB A;  1JGG A;  1ZK8 A;  4AC6 A;  1SAN A;  4CYC B;  3ZQH A;  4XRM A;  4B4C A;  4UUS A;  2W53 A;  3S5R A;  2Y9Y A;  1TWC J;  1WGX A;  3VOK A;  1JT0 A;  4D7N A;  2HKU A;  2MW8 A;  4MXM A;  2MSY A;  3E7L A;  3VUQ A;  1ETK A;  4A93 J;  5IPA A;  2R0Q C;  5J1U A;  2X48 A;  3NRG A;  2TCT A;  5IYC J;  3D1N I;  1WCM J;  3LJL A;  2GLO A;  3BTL A;  3QBM A;  2GBY A;  5M3F J;  4FIS A;  5F04 A;  2ZB9 A;  3B6A A;  1GUU A;  2JMW A;  4G12 A;  4JYK A;  1JKO C;  3NI7 A;  3JRI A;  3NPI A;  1ZKG A;  1JTY A;  3VOX A;  4IEJ A;  4JNN A;  3VVZ A;  4UUS B;  2XB5 A;  2NVQ J;  5FGL A;  1JJ6 C;  3FIW A;  3L1P A;  1JJ8 C;  2PMZ N;  2R93 J;  3RZD J;  1JUP A;  1IJW C;  2K9S A;  2K9Q A;  1JTX A;  2OI8 A;  1IUF A;  2O8K A;  2XGD A;  1HLV A;  2VI6 A;  5JLX A;  3VVX A;  1U8B A;  4A3D J;  4X6A J;  1UHS A;  1FEX A;  5FMP A;  2NX4 A;  2WV1 A;  1UI6 A;  4GCK A;  3O8H A;  1ORK A;  2CQX A;  1ETX A;  3OIO A;  1LFU P;  1IGN A;  2EZL A;  2AHQ A;  2UXH A;  2PZ9 A;  2ID6 A;  3G1O A;  4MLO A;  1JKQ C;  5IP9 J;  3A01 A;  3GTK J;  4A3E J;  4A3G J;  2ELK A;  2G3B A;  1E3O C;  5IP7 J;  2HOS A;  5E3N A;  5EG0 A;  2PBX A;  3B6C A;  4QTR A;  5D18 A;  1R9T J;  3BG5 A;  1VND A;  2XB0 X;  2HI3 A;  3S14 J;  1RPW A;  5J1Y A;  3G1M A;  5IOY A;  2O9L A;  5C4Y A;  1W0T A;  3BJB A;  3HOV J;  3CRJ A;  3F1B A;  4KWA A;  3I4M J;  3OOU A;  4JX4 A;  1B72 A;  4BY1 J;  2G7L A;  5HAW A;  3HGG A;  1GT0 C;  2Y2Z A;  3Q0W A;  1Z77 A;  3GBG A;  1SGM A;  5BNG A;  1GDT A;  1XS9 A;  1PUF B;  2NP5 A;  3LSG A;  2VUM J;  4FTH A;  3MKL A;  1ITY A;  1S7E A;  1MSE C;  2ZCN A;  2ECB A;  5K58 A;  1TWH J;  2DJN A;  4EEF G;  3A01 B;  5CXI A;  4W97 A;  2DA1 A;  5D1R A;  2UXU A;  5EG0 B;  5C4X J;  2EQR A;  1NTC A;  2JWT A;  2Y30 A;  4W1U A;  5IP6 A;  3JR9 A;  1HF0 A;  2H8R A;  4IHX A;  2JA5 J;  3AQT A;  3NNR A;  1FIA A;  5CXG A;  2MGQ A;  2LY9 A;  2K40 A;  1A5J A;  2DG8 A;  3PAS A;  1UG2 A;  1RES A;  1NK3 P;  2M34 A;  4M3B A;  3JSJ A;  3EGQ A;  5K7H A;  1BA5 A;  3HEF A;  4RBO A;  1MSF C;  4BY7 J;  2R92 J;  3IV5 A;  1IV6 A;  3HBL A;  1I3Q J;  2MG4 A;  1JUM A;  3BTJ A;  3HTH A;  5GPA A;  3LSJ A;  1GV5 A;  3G7R A;  1ZTR A;  3ANG A;  3IH2 A;  1K83 J;  4HKU A;  5HBU A;  1XG1 A;  3S15 J;  5HSZ A;  2HYJ A;  2HXI A;  3MN2 A;  4NN1 A;  1GVD A;  2JJ7 A;  2LTP A;  2ZOZ A;  3BR6 A;  3CMY A;  2V57 A;  3AQS A;  1B8I A;  3BR2 A;  1LFB A;  3LSP A;  1AKH A;  4ICH A;  3QQA A;  2DA2 A;  1QVU A;  2X9D A;  2DA7 A;  2GFN A;  1BW5 A;  5J3L A;  2DA4 A;  3PM1 A;  3VPR A;  3C2B A;  3ZQI A;  3HKZ N;  3BNI A;  2ME0 A;  4JP0 A;  4FCY A;  3HTI A;  2FD5 A;  1UI5 A;  4MFD A;  4QIW N;  3HDD A;  4FE7 A;  2HDD A;  2NS8 A;  3H0G J;  4AYB N;  1DU0 A;  3A02 A;  1HDD C;  2NVX J;  1X2N A;  3O60 A;  3B81 A;  4AF5 A;  2I10 A;  3LHQ A;  4NDL A;  3TW7 A;  2YU9 J;  3E7Q A;  2JA7 J;  3MVP A;  5IOZ A;  4BBR J;  1YRN A;  1FTZ A;  3TED A;  1U9N A;  5K7Z A;  3S2D J;  2NOG A;  1AHD P;  4A3B J;  3ON2 A;  1B8I B;  5D19 A;  3HIM A;  2LP0 A;  2G0E A;  4I76 A;  4BXX J;  1GV2 A;  5EEA A;  2HYT A;  1AKH B;  5EZH A;  2K9N A;  5JLW A;  1U78 A;  3CQZ J;  3VW1 A;  3HB9 A;  2L7Z A;  2DG7 A;  2E2H J;  3MNL A;  2IU5 A;  3DPJ A;  3TP3 A;  2RAS A;  3FIS A;  3Q3S A;  5DS9 A;  1TWA J;  1ETO A;  2QCO A;  3ZOB A;  3BCG A;  3G56 A;  4BBS J;  2DMP A;  3BR0 A;  2L0K A;  2VKE A;  1IRZ A;  2EZH A;  4XID A;  4C3H J;  2B63 J;  4DYQ A;  1QRY A;  4I6Z A;  3NXC A;  3Q0U A;  1WPK A;  1IG7 A;  3PPB A;  4ABZ A;  5FKN A;  2O7T A;  3HOY J;  4D5F A;  5F0H A;  3OSG A;  1YRN B;  1OCT C;  3BQY A;  5F0F A;  3WHC A;  5M5Y J;  3RZO J;  2QF7 A;  1LE8 A;  4C2M J;  3RH2 A;  1H8A C;  4DW6 A;  2ID3 A;  2M0C A;  2EZK A;  3FKI J;  2ZCX A;  1WH7 A;  2FQ4 A;  3CDL A;  2D6Y A;  4HNV A;  1F36 A;  4X1E A;  3LSR A;  1RKT A;  4B1R A;  3S1R J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...