3BR5A

Crystal structure of the complex of rhodamine 6g bound to qacr(e90q), a mutant of a multidrug binding transcriptional repressor
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
186
structure length
184
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKSEQIKCKTNREKFYLYNELSLTTQYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator qacR
publication title Formal electrostatic interactions do not govern QacR-cation affinity
rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 77
structure length 184
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2007-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3br5A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3br5A02
2DA7A 2ECCA 2HQ5A 4NDLA 5D18A 1IG7A 5IPAA 3HOVJ 4BKXA 3QPSA 2EZKA 1RKTA 2JA5J 2DMQA 3S17J 2R0QC 4A93J 5F04A 1Q1VA 2FX0A 3A01B 3PASA 2TRTA 3GTKJ 4AC6A 2PMZN 3A03A 2QCOA 4AF5A 4C3HJ 1Z0XA 3W6VA 1EF4A 4GCLA 4A3JJ 2IU5A 3V78A 4A3LJ 2FBQA 2VI6A 3HB9A 3RZOJ 5CW8A 1I3QJ 4W1UA 5FLMJ 1IJWC 3CMYA 1TWAJ 3LJLA 1ZQ3P 3GTPJ 2M0CA 5CXGA 1RPWA 2JMWA 5DTDA 3SJMA 2G3BA 3NNRA 2L0KA 4A3FJ 3G1LA 4BBRJ 2QIBA 1JUMA 1VF9A 4G12A 2DA6A 2ME6A 1HF0A 2DA5A 1BL0A 1RETA 3MNLA 4BBSJ 1X58A 3BR5A 2DMTA 3BHQA 3ZQLA 3NPIA 2YS9A 2JWTA 3Q0UA 2HDDA 1ENHA 3O60A 3BR0A 4C3IJ 2QTQA 1W0TA 2RASA 4NELA 1ETKA 4V2GA 3RH2A 4X1EA 5FJ8J 1YRNA 3I4NJ 2DA3A 2D5VA 3COLA 1WH5A 2NP5A 3CRJA 2FD5A 2RHAA 1B8IA 2HKUA 2ID6A 3S2DJ 1ETXA 4DYRA 1SFOJ 2GM4A 4M3EA 1B72B 1DU6A 4D5FA 3LWJA 5E3LA 1TWGJ 2V57A 5EGOB 2XDNA 3HBLA 1FTTA 1JT0A 2GLOA 4PXIA 3PM1A 3HOYJ 2E19A 2M2EA 2DJNA 4JX6A 2GUHA 3QQAA 2AHQA 3HE0A 2DTZA 3JRAA 1Z77A 3TP3A 3VUQA 2FQ4A 2K9QA 2NVQJ 1IRZA 2LK2A 2QF7A 3HTIA 3SFIA 1X2MA 1ZKGA 3JREA 3HKZN 3T6NA 2M34A 4HKUA 5DAJA 3ANPA 2B63J 3HGGA 4EEFG 3H3VK 3BNIA 1PUFB 1BW6A 3OIOA 1LFUP 3E7QA 2IEKA 2LLKA 3S1QJ 2R5ZB 2JJ7A 1HLVA 2WB1N 2R93J 3DPJA 3UKGA 4FE4A 2W53A 2KDZA 5M5WJ 3GBGA 3EGQA 4YZEA 3PO2J 3ZQCA 1P7JA 4MXMA 2DMNA 3BTLA 5K58A 3KZ9A 2G7GA 2GBYA 5FLVA 5JLXA 3TW7A 3O8GA 5EZHA 4BY1J 1HDPA 4UDSA 4CGRA 2VKVA 3KKCA 5GPCA 3BQYA 1WI3A 4FTHA 1VFCA 2XB5A 1OJLA 3RKQA 1X2NA 5K7FA 1JTXA 1WGXA 4A3IJ 1O4XA 2Q24A 5HBUA 4B1RA 4DYCA 5E3MA 4A3MJ 4JP0A 3BJBA 4IHWA 2LD5A 2HOAA 2UXIA 5FKOA 4DZPA 3G1OA 2WUIA 3D1NI 1NK2P 1FIAA 5H9TA 2Y31A 1BW5A 2H1KA 1JKPC 1ETQA 3BTCA 3HGYA 3BT9A 5J3LA 4D7NA 2NX4A 1TWCJ 3Q3SA 3BR3A 3Q0WA 4JL3A 1I50J 2QOPA 2JN6A 3VW0A 3VW2A 5F0FA 4IHXA 2R92J 2ECBA 2DG7A 2K9NA 3ZOBA 1JJ8C 5HODA 5EZGA 5C4JJ 5EG0A 5M5XJ 1U78A 1AKHA 3HOZJ 5E3OA 2DA1A 2EZLA 1GUUA 2RAEA 1T56A 1WPKA 2YVEA 3VVZA 3JRIA 5IYDJ 3NAUA 3VOXA 2NP3A 4BXXJ 2CUEA 2R5YA 2CUFA 2MG4A 4D5CA 2OPTA 3VVXA 3G1MA 4I6ZA 3KNWA 1ETYA 2Y2ZA 5BNGA 3ZQGA 3HEFA 1G2HA 5D19A 4A3GJ 3GTLJ 1OCPA 5J1RA 3JSJA 2NVYJ 2JA8J 1ZTRA 2R7ZJ 4D7MA 3FIWA 1WCMJ 3HIMA 4DW6A 4UUSA 3BRUA 3FKIJ 1JGGA 1GV5A 5FKNA 2NVXJ 2G0EA 9ANTA 4A69C 2PBXA 2CQQA 4A3BJ 3FK6A 5E3NA 2O9LA 1K83J 5EYRA 1HOMA 4XRSA 5K7HA 1UHSA 5EDNA 4M6VA 2HOTA 1VNDA 1YRNB 3HOUJ 4IHYA 1UI6A 2ZOZA 3VP5A 2MW8A 3P9TA 4CYCB 2YVHA 3GTGJ 1JKOC 4UUTA 2IBDA 1IGNA 3KKDA 2EBIA 3EUPA 3AQSA 1JJ6C 3RQIA 4ICHA 2NS7A 2TCTA 3Q0VA 2N8GA 2WV1A 4XRMA 1NK3P 3M3YJ 3CJDA 3G56A 5EFYA 3BR2A 4IEJA 1FJLA 3C07A 4MK6A 2W48A 4GCKA 3NARA 1OFCX 2M9HA 4QSHA 4ACIA 1JT6A 3CCYA 1SGMA 2XSDC 5F1JA 4MO7A 5M3MJ 1ZR4A 2CJJA 1FEXA 2CRGA 3VIBA 2Y30A 5IP7J 3TEDA 2EH3A 3S1MJ 1TWFJ 5IYBJ 1MSEC 2NS8A 1UG2A 3GTMJ 1P7IA 2GFNA 2UXPA 2P81A 3LOCA 1JTYA 4M3BA 3LSGA 2EZIA 1TWHJ 1MBGA 2Y9YA 1GT0C 4ABZA 2EZHA 4BY7J 2REKA 1XS9A 2YUSA 5EF6A 3LSRA 2UXUA 3FRQA 1CQTA 3H0GJ 2HYJA 1H89C 4KWAA 4L5EA 1MH4A 2OERA 2EQRA 5F0HA 4MFEA 2E2IJ 2DMPA 2X9DA 5IOYA 2ID3A 2F07A 3OSFA 2VUMJ 1SANA 2NOGA 3JRHA 2E2JJ 2CQXA 4DZJA 1POGA 5M5YJ 1IV6A 3LSPA 5IYCJ 2DMUA 1RR7A 3HM5A 2LP0A 4QIWN 3ZQHA 2R5ZA 3TP0A 2GENA 4MFDA 1S7EA 1FIPA 3IH4A 3HTAA 2O7OA 2Y0SN 1ITYA 2JK3A 3DEWA 2HYTA 3OSGA 3GEUA 2LVSA 3JRFA 1JKRC 2WAQN 5F27A 4FE7A 2G7LA 4MLOA 3IV5A 5EG0B 4S0HB 2XGDA 4GFKA 3ZQFA 1AKHB 4XK4A 1MBKA 1MSFC 3VOKA 1RKWA 4FCYA 2VKEA 4A3EJ 1LE8A 5IP9J 2E2HJ 2QWTA 3JRDA 2AO9A 4JX5A 4JNNA 2ELKA 5J1YA 3JR9A 2LR8A 2R5YB 4MIMA 4XIDA 3HTHA 4AC0A 1LFBA 2DG8A 2G7SA 2UXHA 2ZCXA 1GV2A 5FGLA 4X6AJ 3A02A 1ORKA 3PO3J 5C44J 1U9NA 2D6YA 2MGQA 4A3KJ 1GDTA 1OCTC 2JA7J 2ZCMA 3CWRA 1QPIA 4QTRA 2XRLA 2XGEA 4B3AA 3HOWJ 2M8GX 5GPAA 3A01A 4FISA 3AQTA 1MBEA 3LNQA 1W0UA 3HDDA 1U9OA 5AQCA 4JYKA 1UMQA 2XB0X 4B4CA 4UUSB 1ZR2A 5DS9A 2VPRA 4Y52J 3S2HJ 4M3FA 3NI7A 3M4OJ 2XPUA 4W97A 3GZIA 1AHDP 2PZ9A 3CDLA 1APLC 1JKQC 5K7ZA 3LSJA 1H88C 1XG1A 2LFBA 2OF7A 3HTJA 3JRCA 3S5RA 3GTJJ 3WHCA 1NTCA 3IH3A 1XC5A 1IDYA 3E7LA 1A6IA 1B8IB 3VW1A 1UI5A 1ETWA 3BG9A 2Y9ZA 1QVTA 4M3DA 4I76A 2LKXA 4XRSG 2QKOA 2IAIA 4AYBN 3ON4A 1WH7A 2XGCA 2L7ZA 1BJZA 5J1UA 3B6CA 3JRBA 1T33A 2K9SA 1IC8A 3BCGA 2XPWA 2CU7A 2ZOYA 3BG3A 3CQZJ 3HOXJ 3IUVA 1U8BA 3GTOJ 3RZDJ 3VVYA 5D1RA 4RDUA 5F08A 2E1OA 5JLWA 3BR6A 3TW6A 1RESA 3BTJA 2FJ1A 5M3FJ 2X48A 3MVPA 2ME0A 4ME9A 3QKXA 2HOSA 3ON2A 2L7FP 4GFLA 1JUPA 3K2AA 4DYQA 3RD3A 1F36A 4CYCA 4Y7NJ 5IOZA 3BQZA 1DU0A 2YU9J 3PPBA 1IUFA 1B72A 5FHPA 3MN2A 3V6GA 1VI0A 4HNVA 3S15J 2LY9A 2HXOA 3FK7A 3OOUA 5EGOA 2UXOA 5C4YA 5FMPA 1QVUA 1Y1VJ 3O8HA 1MBFA 2WGBA 5F0CA 3B81A 4C3JJ 1MH3A 1GVDA 4LOCA 3FISA 3ANGA 4JX4A 1A5JA 3BR1A 3NXCA 2X6OA 4JKZA 5HSZA 1HCRA 4AUXA 1ETOA 4L62A 4A3CJ 2DN0A 4J19A 4XICA 3JRGA 3BTIA 1ZK8A 5IP6A 4GFBA 1I6HJ 2I10A 4GCTA 1MNMC 1K61A 3L1PA 3WHBA 4V2FA 1HDDC 1PUFA 3I4MJ 3LHQA 2ZB9A 3IH2A 1ETVA 1JUSA 1H8AC 2L7MP 2K40A 5GP9A 3VPRA 2NVTJ 3B6AA 5FKLA 3S1NJ 1QRYA 2MSYA 3ZQIA 1E3OC 3C2BA 2JA6J 1Y1WJ 1D5YA 1TC3C 2ZCNA 4IHVA 2HI3A 2LTPA 1AU7A 3DCFA 1R9TJ 3F0CA 1BA5A 1IDZA 5CXIA 1MBJA 2COBA 3MKLA 4A3DJ 2O7TA 3QPLA 3S14J 5FKKA 3S16J 4NN1A 1MBHA 1ZGWA 3QBMA 4RBOA 4C2MJ 3S1RJ 2KT0A 2XPVA 3NRGA 3GTQJ 5C3EJ 2OI8A 5HAWA 5EEAA 3SDGA 1LE8B 3F1BA 3G7RA 2DA2A 5C4XJ 1FTZA 3K7AJ 2HXIA 4M3GA 2H8RA 2O8KA 5FKMA 1F43A 3BG5A 2L9RA 2DA4A
chains in the Genus database with same CATH superfamily
4GDFA 4ITVA 2E5NA 3COAC 2F6CA 2Q2EA 3DEUA 1DPUA 2XDVA 1RC9A 2HGCA 2EZKA 3CO6C 5FD5A 3S3OA 4IQJA 4L9NA 4E7SA 4A93J 2R0QC 3TGNA 1FOKA 1P4AA 4OD4A 4I0AA 3WG7H 3H36A 3FDYA 5CQGA 4YG2F 3GTKJ 5HOOA 1BI1A 3CMEI 3A03A 1L0OC 1ULYA 4YEJA 3L2UA 1EF4A 3CD6I 4GCLA 5B1AH 4ASNA 2XAFA 2QYOA 1FC3A 4CHUA 1YYVA 1LDJA 1I3QJ 2GA2A 3A0HC 5KCMA 3CMYA 3A1YA 3CLOA 1TWAJ 4HX4A 2WY8Q 1U6GA 3WTWC 1GXQA 3K8PC 1B6AA 1HSTA 1Z3YA 2IGOA 4E7ZA 4IOAF 4M9ZA 4LLGF 4ZDLA 2KPMA 4PJLA 3SJMA 1YHQI 2JPCA 1ERDA 4BBRJ 3KP5A 1JUMA 3PQJA 4IXAA 2E1CA 5K1YA 2D1HA 4PUSA 1VF9A 3V8LA 4DBQA 2ME6A 1P2FA 4FX0A 1RETA 4PJMA 1KQ0A 4PSWA 4BBSJ 3BR5A 2AQFA 2DMTA 2L9VA 2FNAA 3J80K 1LNWA 2VOOA 4ETSA 1K6OA 4OMZA 1O7LA 3R4KA 1IN6A 2QTQA 1W0TA 2RASA 1ETKA 3L2VA 4XM3A 2DT6A 1Y56A 4FT8A 1WH5A 2NP5A 2FD5A 4AIJA 1B8IA 2ID6A 3O6BB 5LHIA 4U7DA 4L0ZB 3D0SA 1SD5A 3FHZA 2X4HA 1B72B 4L5JA 1DU6A 1USTA 4M73A 1MNDA 1QZEA 4PJNA 1PDNC 1YG2A 1ZHFA 5LGTA 3AKZA 4UHTA 1V55H 3K70C 4NQWA 1YW9A 4JQFA 4BE2A 4EGYA 3IAM2 2O0YA 3HOYJ 1FSEA 4YRVA 2ZXJA 2AHQA 3QQAA 3TDUC 4R8HA 2DTZA 2L7KA 5D5XB 3TBIA 1QBJA 5E18F 3CTAA 4CA0A 3C2GA 4Q4ZF 3FM5A 1X19A 1X2MA 5GTIC 4DNCA 3T6NA 4HKUA 5HNHA 5DAJA 4B3XA 3ABMH 2VJ5A 2E36A 4EEFG 1EJ9A 4LG0B 1RRJA 5BS6A 1K78A 3RYPA 4HRIA 2JTVA 2QBYA 3QODA 5EEHA 4UXNA 2IEKA 1HLVA 1J0RA 1OR7A 1T95A 3UKGA 4FE4A 4I98B 2R7VA 4NB5A 3EGQA 3H9QA 4XLAA 4D0PA 2O03A 3Q9VA 3GZNB 1P7JA 2CUZA 1X3ZB 5DCMA 3JSOA 5D6EA 3K0LA 1R1TA 5FLVA 5JLXA 4O3MA 5EZHA 1V4RA 4KN4X 5CVRA 2JUCA 1QZYA 2VKVA 3KKCA 2HYFA 1ONVA 2XB5A 2A07F 3W2WA 1X2NA 3IC7A 3ECOA 1BR4A 4UY8I 2DDBA 1W7PA 2DI3A 1JTXA 3TOAA 3E0JB 1R5ID 2DQRA 1IN5A 5HBUA 3TMOA 4B1RA 4DYCA 5E3MA 2Q2EB 5DDGA 2IS6A 3BJBA 4IHWA 1G3YA 3CCRI 3OL4A 3A0BC 1OCCH 2LD5A 2UXIA 2VXZA 3DTIA 2V26A 3G1OA 3ZMTA 3FHNA 2KKOA 4MHGA 5D5WB 2O6GE 2ZSIB 3M8EA 4HDUA 1FNNA 1BW5A 1JKPC 4CH7A 2P5LC 1G3SA 3BTCA 3HGYA 5J3LA 4D7NA 5D8LB 3Q3SA 2YSRA 4BDYA 4RGUA 2QOPA 2MFZA 5F0FA 1N78A 2ECBA 2ZJQF 2QQ9A 3G6EI 2PEXA 1LPQA 5HODA 1PJRA 5C4JJ 2K3FA 5FROA 5EG0A 1RZ4A 2VONA 2XKOA 5TISC 5FGMA 5HLTA 3HOZJ 4EMSA 3H9JA 1T56A 1WPKA 1IRXA 4NBQA 2H09A 4J00A 1MIJA 3S8PA 4EJOA 3PIPF 1ZLKA 4V19K 3ZN0A 2DOAA 4ZTFA 2R7TA 2H1LA 4YFNF 3E5UA 2NP3A 3VOXA 4WXDA 1Z67A 2WBMA 1H0MA 2BY0A 3KNWA 3VVXA 1WJBA 2KFDA 1EH7A 4LIUA 2Y2ZA 5BNGA 1S7AA 4L9VA 5HLIA 2LNBA 4A3GJ 5AIQA 4CCJA 2ESHA 3E97A 3MZ8A 4RGXA 1TQMA 5K5OA 3HIMA 3BRUA 5L3BA 3KCCA 3TKYA 4U0YA 2G0EA 9ANTA 4A69C 2PBXA 3IUOA 3FK6A 4P5OA 1VQ6I 5EYRA 3SHFA 5K7HA 1UHSA 3DU6A 4IO9F 2HOTA 5BPIA 2ZFWA 2V6CA 2Q0OA 2GZWA 2KJCA 3QYEA 2WAFA 4E6KG 4LD5A 4O5VA 5ILUA 2CGPA 3SFZA 1UI6A 3WODF 2MC4A 3PUFA 4BH9A 2ZOZA 3VP5A 4JK1X 2ZXWH 1V3FA 2YVHA 2A61A 2AXTC 2EBIA 3EUPA 1A36A 3OYCA 2WV1A 2TCTA 3B73A 4NQWB 3CJDA 2IT0A 3BR2A 2VKDA 1T39A 2DFEA 4KMFA 4ENKA 4LFUA 1QHGA 3NARA 1T6SA 2YPRA 4ZTJA 2M9HA 1GHCA 4ACIA 4OIPF 4F52A 1SGMA 4MO7A 5M3MJ 1ZR4A 1SFUA 2OZUA 1FEXA 2LOOA 2BW3A 2CRGA 3VIBA 5JHUA 4M74A 2OJED 2KL4A 4G6TB 3TEDA 3FMRA 1T08B 2DFIA 1WZ2A 1K78B 2EH3A 1YLFA 3S1MJ 1MSEC 3R6SA 3OYIA 2QBYB 3OYEA 5HLGA 4BQNA 5DD4A 2DU9A 3F22A 3RPQA 3DQVC 3R0JA 2ZBKA 2GA1A 1QU3A 2YUSA 2XASA 4WXHA 5DCMB 2UXUA 3L7WA 2OTLI 3AG4H 4F91B 5ICCA 2ZKZA 1FP1D 2M30A 2BZTA 4L5EA 4XQFA 3P9CA 5ERIA 1G6NA 3OYJA 3F6OA 4G6QA 4UVBA 5E79C 2JSPA 1SANA 1W7PB 1XMKA 2L5QA 2WC2A 3OYDA 3OSFA 4C2TA 1IXRC 1XMXA 2O61A 1YX3A 3OYMA 2X51A 4G7OF 3MAJA 3BY6A 3K1MA 3HUGA 3L2WA 1QGPA 3ASOH 3E6BA 1R1UA 3H35A 3I3LA 4WK8F 3VODA 2OTJI 1ON2A 1YS7A 2CO5A 4RLQA 1TT5B 1ITYA 1U2WA 5CVUA 1UHMA 3ABTA 4Y13A 2JK3A 2HYTA 5L3EA 3GEUA 4ZYAA 4IQ4A 1F1ZA 2AS5F 1VQMI 3I4PA 4PDKA 3RIRA 4YIRX 3H3ZA 5EG0B 4RB3C 3J7AO 4ESJA 4KNYA 1Z7LA 3NWSA 2VKEA 3KP2A 2AO9A 4JX5A 2VQHA 3P5JA 3T8TA 5J1YA 4OMYA 2EFOA 2YU3A 3V42A 3HHGA 3HTHA 1LB2A 1XCVA 1IXSB 1J5YA 3BLYA 3A02A 4X6AJ 1T0FA 5C44J 2ZCMA 4A3KJ 2V1XA 3JCUC 2VN2A 1E3PA 1Z3XA 3E6MA 3F21A 3CWRA 1LVKA 4A5MA 4B3AA 4DBRA 4QTRA 1SAXA 3HOWJ 5GPAA 3A01A 3F72A 3TO6A 2BBYA 2LC2A 1ZRCA 1UMQA 1ZR2A 1S72I 2E5ZA 3TQNA 5LHGA 2HKOA 3RSNA 3AL0B 1TLHB 3BPVA 4M3FA 3GWZA 2XPUA 1WJDA 1AHDP 2COMA 5E17F 3LAJA 4LK0F 4LMYA 1XG1A 3GX4X 5FFZA 3S5RA 4U9NA 2CH0A 2DQLA 4LITA 1IDYA 5ILVA 1B4AA 2W1OA 4UVAA 4OIRF 1A6IA 4RS8A 3WTXC 1UI5A 3H3UA 3VYRB 3BZCA 2VBXA 3NEUA 1LEAA 2NOJB 3ZMZA 3ON4A 4XRSG 2XGCA 3L9FA 2L7ZA 1VZ0A 3BCGA 3AAFA 3N05A 3PSIA 2ZOYA 2A69F 3CQZJ 4HLXA 3IKVA 3KP4A 1KQ8A 1FP2A 4KUMA 4BNCA 5JLWA 2E1OA 2XF5A 1W5SA 3G3ZA 1R6RA 2MYSA 1WJAA 3BR6A 3BTJA 2BW3B 1TBXA 4BQQA 3GO5A 1KYZA 1N25A 1FWZA 4C2UA 3QKXA 1VQ4I 2L7FP 3HXLA 1TQPA 3EPZA 4DYQA 1F36A 4EM0B 5IOZA 4BXFA 4J01A 1DU0A 5EGOA 5ICEA 5C4YA 2YR2A 2V79A 1QVUA 3WU1B 1LDDA 4HLYA 1MBFA 4C3JJ 2AQEA 1U5TA 2E7WA 1GVDA 3TO7A 4LOCA 3ABUA 3ANGA 4JKZA 3BR1A 1XGSA 5HSZA 1HCRA 3CCUI 3BPXA 1BR1A 1FOXA 3ZMVA 3H0DA 5IP6A 4GFBA 1I6HJ 2WA0A 4AIHA 4GCTA 1ZG1A 1K61A 1IF1A 4M9SA 1BC7C 2EV6A 3ONQA 4V2FA 4RAGA 2ZB9A 3KE2A 4N0BA 3KX2A 2K40A 2IJLA 3F8NA 4XSXF 4ZYHA 5FKLA 3S1NJ 1QRYA 5LRRA 4L9JA 1Y1WJ 1D5YA 1TC3C 4IHVA 3LL7A 1AU7A 3CCVI 3F0CA 3ZGKA 3DTEA 4XLFA 3KLOA 2FBHA 1K7AA 2O7TA 4BU2A 1ZGWA 3QP5A 5D4SA 4C2MJ 3ZRGA 4I02A 2G7HA 5GAGJ 3EDPA 1RNLA 2R7WA 1Y8QB 2IVMA 4M3GA 2HXIA 4OIOF 2DPUA 3HIFA 3N4MA 2L9RA 2DA4A 2DA7A 2O5RA 1XSVA 4NDLA 5ICGA 2X1CA 1ZRFA 1J09A 4HSTA 5IPAA 4BKXA 4LB5A 1DP7P 5E8GA 3QPSA 2OV7A 2HQNA 3E5QA 3SWHA 2DOEA 1YTYA 2ZXHA 1RKTA 5GTHC 3S17J 1STZA 2XV4S 4AYBA 4DVYP 3A01B 3IWFA 4ZJZA 1R7JA 4CXFA 1EA3A 2RQQA 3H5NA 4OU0A 3TL4X 2TRTA 3HOSA 1XTAA 4ZDPA 4BL0B 3KYLA 4MEXF 2DT7B 1MNEA 2XF7A 2IU5A 2KRCA 3K70D 2Z33A 4A3LJ 3HB9A 2KZGA 3CUQC 2BGCA 3RZOJ 1SEUA 4U88A 2Y48A 4OAZA 3CCQI 1I6XA 3NQOA 2XGXA 3NS4A 1RPWA 1LFPA 2LH9A 5FFXA 2JMWA 5CVIA 3U9GA 2EV5A 5F64A 2KISA 3NNRA 1O3TA 1WKMA 2UZKA 4A3FJ 3G1LA 3TO9A 2QIBA 1I5ZA 4EATA 2OCCH 4G12A 2DA6A 3W3CA 2DA5A 5BMZA 5HS9A 1MMSA 3DV8A 3MNLA 3S2WA 3F23A 4HZFA 1MZBA 4R1HA 2ZCWA 3CF2A 3OYBA 4CCMA 4MEYF 3CJQB 1UJ8A 2H6BA 2YS9A 2RDPA 4C3IJ 3A2KA 1BI3A 2L02A 1VQ7I 4V2GA 4NELA 3OV8A 2FXAA 1ZGJA 3EUAA 4X1EA 3I4NJ 1IRFA 2D5VA 2EFQA 1SMTA 3X2QH 3COLA 3QYFA 2GM4A 3LA3A 4XBFA 2XAQA 4ENNA 3GLXA 4R79A 5ED4A 2K5CA 3ECHA 5E3LA 2EINH 1Z7UA 5EGOB 1MMDA 2XDNA 3HBLA 4PSXA 3I64A 3L09A 3PM1A 4P55A 2DJNA 1U5TB 3JRAA 2QM3A 4IRGA 3TP3A 1BC8C 4MQ9F 2K9QA 2VKHA 3Q9SA 2P7CB 4CSWA 3PSFA 3HKZN 1ZAOA 3GUDA 3RDIA 1BIAA 2ELHA 2FSWA 2HZDA 3HGGA 1Y39A 2VT2A 2L54A 2CFOA 3OIOA 1LFUP 2A6EF 5IT9Z 2ELJA 4PCQA 2WB1N 2OA4A 2F5EA 4HG2A 3EYYA 1WJEA 2E71A 2WTEA 3WTVC 3OYFA 3GBGA 4DIQA 1X1PA 1MDMA 3PO2J 2QEXI 2O3FA 2DAOA 1EH6A 3VOEA 2XC7A 4ZYGA 2G7GA 3DPUA 2A68F 5E8IA 3MQ0A 1KQ9A 1MJAA 3J7ZI 4KIGA 5GPCA 5A2QZ 1IZ1A 4XN3A 3V7CA 1VFCA 4L18B 3PUBA 1HKSA 2EA4A 4KDPA 4XN0A 3DPLC 3EQLF 1OYYA 1WGXA 4BDZA 2Q24A 1P92A 4H0EA 2MLGA 4A3MJ 4N9IA 4JP0A 2GQQA 2HOAA 5FKOA 2WUIA 2HTJA 1D0YA 2F5DA 4HF1A 1BJAA 3QU6A 4DQ2A 3FXRA 3OR2C 3IL2A 3HTSB 2BXYA 2L9SA 3BT9A 1YQAA 3F6VA 1W5CC 3HG9A 4JL3A 1I50J 3SEQA 4I0BA 2JN6A 3OYNA 3VW0A 3VW2A 4IHXA 2R92J 2R4GA 2IXSA 3I9V2 4N4NB 2DG7A 3GFLA 2BY2A 5J8CA 5HDNA 1SFXA 1XCBA 4NNJA 5M5XJ 4AVPA 1U78A 4MTEA 1WJFA 2DA1A 2RAEA 2YVEA 3VVZA 3JRIA 3NAUA 3K4LA 1FSHA 4FASD 2E34A 4IF4A 1KU2A 2ZJPF 4WXCA 4IRVA 3AFHA 2CUEA 3F3XA 4KMUX 3MKWB 2MG4A 3D5LA 2DFHA 4PGHA 2OPTA 4I6ZA 3V7RA 2ADUA 1ETYA 1YJNI 3ZQGA 3HEFA 4LLLA 4AWXB 3SYTA 5D19A 3ABKH 3CJRB 5J1RA 2NVYJ 4ESBA 2JA8J 2R7ZJ 5L3FA 3ZMDA 4D7MA 3OYLA 1KU7A 4EM2A 3HPGA 2GXBA 3DWLE 4UUSA 3ASNH 3CCLI 3FKIJ 2UV1A 1JGGA 2Q1ZB 4EM1A 4A3BJ 2B9SA 1JHFA 5LD2C 2ACJA 2O9LA 1H9GA 1MJ9A 3ELKA 4M6VA 3CC7I 3J81Z 5CLSA 4IHYA 3MKYB 1FPQA 2KRFA 4B44A 2EIJH 1SVOA 1SD6A 4CCNA 2ZY9A 2HQRA 1D0ZA 3PIOF 2JQ7A 3K1PA 1BR2A 1HC8A 3AQSA 2DK5A 5FLXZ 4ICHA 4XRMA 2V9VA 4KITB 3M3YJ 5EFYA 3HOTA 2QSGX 3FX3A 3DBRB 3C2HA 2CW8A 5H6RA 4GCKA 3CMAI 2QKLB 3RCOA 4YFKF 1DUXC 1OFCX 4QSHA 3LFUA 2K7LA 2XSDC 4XRFA 5F1JA 2XROA 3VB2A 5KHDA 1LJ9A 2CJJA 4I2OA 2TDXA 3OIQA 4EGZA 5IP7J 3WE2A 1TWFJ 5IYBJ 2VBYA 3OS0A 4CGZA 2A6TA 1UG2A 1P7IA 1S9HA 3I0TA 2P81A 4TV7A 4XKWA 3LOCA 3VSLA 4HX7A 5AONA 3LSGA 4AIKA 2EZIA 2A3SA 4G94A 5LLQA 2HVQA 4PFOA 2MD5A 4HF0A 1X3UA 1FZPB 2EZHA 4BY7J 2NXNB 4G7HF 2EFNA 1XS9A 1MDMB 5IT3A 1TP4A 2M7BA 2PMZA 3K4JA 1H89C 2DYRH 1MH4A 4B09A 2IS1A 4QPOA 1Z1DA 3ZMSA 5TRDA 1HKTA 4G9YA 1P4XA 2W4SA 3GVAA 3E1SA 4RGSA 3JRHA 4XONA 5M5YJ 1POGA 1YE9A 3LSPA 3CO7C 3TDZC 2DFFA 3HM5A 4GCVA 1ZGAA 3ERMA 3ZQHA 2R5ZA 3TP0A 5TGTA 1J9IA 4MFDA 4EJWA 3VYUB 2VJJA 2HPIA 2RV8A 4BE1A 3T5XA 2J5PA 2Y0SN 3ZMUA 3F8CA 4OIQF 3DEWA 3OSGA 4KIBA 3ZCOA 4NC8A 2BHYA 2LRDA 2WAQN 2CV2A 3LSMA 3EUHC 4MLOA 3DLLF 2G7LA 2DOFA 1OLTA 4CYDA 3IV5A 4QLCU 3A4CA 3L00A 4S0HB 2XGDA 4GFKA 3ZQFA 4G7ZF 5BOXA 2ZMEC 5E1WA 1MW7A 5LEJA 4II2A 3VOKA 1RKWA 4FCYA 4A3EJ 2OD5A 2E2HJ 3I53A 3BROA 1HW1A 1CF7A 2ZMEA 3PL8A 2LR8A 5D8KB 1VQOI 1FBSA 2QGUA 3DP7A 2VJ4A 2G7SA 2HOEA 5KAFC 3MEXA 1ORKA 1U9NA 4PFPA 2D6YA 2WADA 3QOPA 2BEOA 3HTUA 2XRLA 2XGEA 5HVQC 1K4SA 5J40A 1R23A 4ESFA 3CJTB 4UVCA 2IA0A 3AQTA 4RGRA 4BACA 1W0UA 3O3KA 3GZ6A 1D1BA 4JYKA 1OISA 2PQ8A 1ZELA 4A6EA 4UUSB 1B59A 4IRHA 3SXYA 5DS9A 3M8JA 4GGGA 4Y52J 3S2HJ 1HBXG 3M4OJ 3FF5A 1KZHA 1ZN2A 3LMMA 5DCFA 4YIFA 2KIUA 4Q47A 4F92B 1RIOH 1JKQC 5K7ZA 3LSJA 3KP6A 5KK1A 2HU9A 5CJ9A 2MD0A 4A0YA 2Z9OA 2LFBA 4HBLA 3HTJA 4OINF 3ZQQA 4XLHA 3SZGA 1NTCA 2I5UA 2M4KA 4U7BA 4Q5SF 2UWMA 4O6JA 2W24A 1B8IB 1T8IA 1ETWA 1FY7A 3W6JB 3AL0C 1IW7F 2FE3A 1XDSA 3GXOA 1WH7A 4WX9A 4IZZA 1BJZA 3RJPA 3JRBA 1SVMA 2HTSA 4NUBA 2HQAA 4NC6A 1I1SA 2XPWA 2UXNA 3H5RA 4A2UA 3I56I 3EUKL 3VVYA 3FXKA 2GOXB 2NAZA 3ZQ7A 5ICFA 5GAHJ 4G6DA 2P5VA 3FXMA 5D6FA 3WGGA 2W85A 1R58A 5M3FJ 2HOSA 4GFLA 3K4KA 5IY5H 3K4CA 4CYCA 3IP4B 1RI7A 3BZ6A 4UB6C 4Y7NJ 3BQZA 3WGHA 1DDNA 2YU9J 3HRSA 1IUFA 3D5SC 3S15J 1R00A 2RNGA 5KAIC 3BG6A 4B48A 2QKMB 1Z21A 1E2XA 2EV0A 1K6YA 4D1QA 3O8HA 3PNYA 4BQAA 3G71I 4XLCA 2B1EA 4RB0A 2OU2A 3WTTC 3NXCA 4B8XA 4E7HA 2Y0MA 3K4BA 4AUXA 1ETOA 4UV8A 4A3CJ 2HWVA 2DN0A 4L62A 4XICA 3BTIA 4AIDA 4Y3OA 3L2QA 2I10A 3MZYA 1MNMC 4L9TA 2NRAC 3G4SI 1JI8A 1BOBA 1YI2I 2H8WA 1PP8F 2OQRA 2FMLA 2KJBA 1PUFA 1ETVA 1ZLJA 2ESNA 3DU5A 4XSZF 1H8AC 3HRUA 5GP9A 2NVTJ 2DDAA 2MSYA 2JA6J 3C2BA 2ZCNA 3DLAA 2LTPA 2R7DA 3BCAA 2PMHA 4IL6C 3RYRA 1EH8A 4F3QA 1BA5A 1IDZA 2CFXA 1MBJA 2COBA 3MKLA 4A0XA 4A3DJ 2OQGA 1HA8A 3S14J 3R0AA 2VLAA 3QBMA 2KT0A 2Z99A 3NRGA 2KMUA 3GTQJ 3ML6A 1MJBA 4CZCA 5EEAA 3SDGA 2V9PA 2EIKH 3VYTB 5C4XJ 1FTZA 4M71A 2H8RA 3EYIA 4UB8C 2ICWG 1WI9A 3KP7A 2DTRA 2ECCA 2HQ5A 1IXCA 1XGMA 3K4MA 2P7VB 1MMNA 3HHHA 1OMIA 2BVLA 5J4YA 3B02A 3M1CA 1TW3A 4E7KA 3CDHA 2XVCA 2OC6A 3K6GA 1EV7A 2JZYA 1Q1VA 1S29A 1EKEA 2FX0A 2K4JA 2W82A 2QVOA 3PASA 3CP8A 4AC6A 3K9TA 4ZZLA 1BOAA 2YVXA 3CDIA 4AF5A 4M6YA 1Z0XA 3DBLB 3W6VA 4Y4RA 4Y33A 1YO5C 2OAZA 1N75A 2V1NA 4A3JJ 1V5GA 2CW7A 4KICA 1YITI 2FBQA 1J7KA 5CW8A 4KISA 1ON1A 4MNUA 1OCZH 1XDUA 2GAUA 5FLMJ 1IJWC 1XSXA 3OL3A 3LFKA 1ZQ3P 4S04A 4XLNF 1XGOA 5CXGA 2F5FA 4ENMA 1WWXA 4KYWA 3M1EA 5J4VA 5DTDA 3DF8A 2ZFUA 4AD9A 1Y0UA 2D2WA 3BC8A 3RKYA 4JBAA 3NWTA 3C18A 1HF0A 1HKQA 3AG1H 1KA8A 4YIIA 1N77A 1O57A 4XMYA 2IPQX 3LA2A 2XAJA 5HS7A 3BHQA 1G59A 2XAHA 3KEQA 4CZZA 3NPIA 4XKVA 4XL9A 1ENHA 3BR0A 4PK4A 2H6CA 3LQQA 5FJ8J 1YRNA 1ZARA 3FMQA 2IRFG 2DA3A 2JUGA 2KQRA 2M1BA 3BJOA 3R61A 2RHAA 5DUKA 3CRJA 1ETXA 4DYRA 2PI0A 4IX7A 2JRTA 1DQUA 3VYSB 2OUMA 1OCRH 2V57A 1UG0A 1XMAA 1YOVB 4I99C 2GLOA 3GZ5A 2E19A 4BHCA 2M2EA 2M4GA 2GUHA 3U1DA 3HE0A 2QSFX 5GAEJ 5TJJA 5HDGA 3KZZA 1W36C 6PAXA 1E0EA 2EK5A 3OOPA 4PGGA 2NVQJ 1UCRA 3FM3A 3PFYA 3P7NA 5H2FC 1UFMA 3ZN1A 3RI4A 3IWZA 3ANPA 2PX9A 2P4WA 3WGIA 3H3VK 4C30A 3BNIA 3CCSI 1PUFB 1BW6A 3E7QA 2VB6A 2LLKA 3BDDA 3FXQA 2JJ7A 1IN7A 2XAUA 3HUGB 5J47A 1T38A 3S1QJ 2FU4A 3AG2H 2R93J 1Z05A 3E3VA 2M0MA 2V9KA 3L2RA 4XLPF 1W4MA 2E1MC 4RAYA 2W53A 2KDZA 1MMAA 1OYIA 2Z5UA 1B1BA 3K2ZA 3HZJA 4MXMA 2DMNA 5K58A 1FMVA 3KZ9A 3ESWB 2X0LA 3TW7A 1YFHA 1HDPA 2FA5A 4CGRA 2XKPA 3BQYA 1PVEA 5JHFA 3BZKA 1KU3A 5FRMA 1OJLA 2OBPA 3RKQA 1P6RA 5JI6A 2FF4A 3FBIB 2MH9A 2STTA 5CYVA 4IHTA 2IGKA 3ROUA 4HV6A 4XR6A 3OS2A 2QQAA 3DKYA 4WCGA 5HS8A 5BPDA 3PJRA 1FIAA 5H9TA 1I1GA 3E6DA 3QP6A 2NX4A 1TWCJ 2KLOA 3H9GA 4KA4A 2DXIA 4KT5C 1SVLA 1C0WA 2ZC2A 4MGRA 2NS0A 4A0ZA 2HR3A 2EZLA 3OMYA 1BI2A 1F4KA 1R5HA 2I8DA 2IS2A 3CUQA 4ENJA 1K4TA 4XOPA 2EIMH 2GIZA 5FRNA 1S6LA 1V5FA 4RM3A 2VXDA 4CICA 2BY1A 1LDKB 2HDWA 2RKHA 3GTLJ 3HSFA 3G2BA 4BHBA 3FIWA 3VFZA 3H5AA 5LBQA 5FKNA 5F6FA 4DJAA 4DGWB 3HKZA 3FKJA 4LIVA 3VDXA 3S32A 1Z6TA 3M7GA 4XRSA 2V4JC 3JAMZ 2KHMA 1VNDA 3IRQA 1YRNB 2RNJA 1Q1HA 2JRMA 4MQVA 4EQQA 3UR3C 4BHPA 4CCOA 2WB1A 2FMYA 4HEA2 1Y8RB 2MW8A 4HYEA 3GLLA 4ANJA 2K85A 2KDOA 3GTGJ 1IUYA 2IBDA 2M45A 5BQTA 5FO5A 2EJRA 2BXZA 2NS7A 3HRTA 1NK3P 3G56A 2VJIA 4HDVA 1BI0A 1PP7U 4MK6A 1TZLA 2W48A 2R7XA 2WV0A 3S93A 2DO7A 3SZTA 2QQ8A 4BGDA 1O3QA 1JT6A 2DK8A 3CZ6A 4LLNA 2G9WA 2X1EA 2L9NA 1VQ5I 3GYHX 2PFBA 2Y30A 1XB4A 3BOQA 2LBFA 4FX4A 2STWA 3GTMJ 2GFNA 1TW2A 2UXPA 2FNPA 5ILSA 4M3BA 1TWHJ 5LFAA 4XLEA 3OYGA 1QA6A 4IRIA 2Y9YA 2EILH 1GT0C 2P8TA 1X1BA 2GOMA 3D5RC 1I39A 1W5TA 3LSIA 4Q48A 4BQOA 3MZHA 1A35A 1FLIA 4C2MA 3GMEA 2GWRA 3LSRA 4IOCF 4BEHA 3OYAA 5L3GA 4LGWA 1R1VA 2F5VA 3H0GJ 3K10A 4RAZA 2JVHA 2XHKA 4KWAA 2M87A 1WQ2A 2OERA 1R5GA 2EQRA 2GIVA 3C1DA 2D45A 2E2IJ 3V8JA 3W2AA 5IOYA 2F2EA 5HDKA 1USSA 2ID3A 4M9XA 3M07A 3KEOA 3G73A 1B9NA 2F07A 2L3DA 2NOGA 5DUIA 2E2JJ 2CQXA 2A2FX 4DZJA 1I3AA 5GADJ 5EEGA 1LUJB 4UUVA 1S7OA 5IYCJ 2CQNA 3KIOA 3LAPA 4IVNA 2LP0A 3P9KA 4QIWN 2XUBA 3I58A 4WIBA 2ZSHB 1QQIA 3MFKA 2GENA 1S7EA 2KIQA 1JHHA 1IRGA 2L2OA 3K1NA 2X85A 3QU3A 3OS1A 1D8JA 3FMSA 3HTAA 4BS9A 2O7OA 1XPXA 2P0WA 4BUPA 1T98A 3KEYA 5H6QA 1IO2A 2CYYA 2LVSA 1JKRC 5DV5A 5F27A 3ERED 1YS6A 3KFWX 4KN7X 1FT9A 3P9IA 3S3NA 4BXUA 4XK4A 1MSFC 1R71A 3DXJF 1LE8A 3J80Z 1FYMA 3OWTA 3ZP5A 1LQ1A 4JNNA 4RB2C 2ELKA 3MMYB 5LRSA 2EFWA 3ZPLA 2VQCA 4D9JA 3CUQB 1FBQA 5L3CA 5IT9K 1D5VA 2Y75A 3BCBA 4AC0A 2UXHA 1GV2A 1OCOH 3HSRA 1SC7A 3RKWA 3MWMA 2MGQA 1OCTC 5CQEA 3HPHA 2LKSA 1QPIA 2BY3A 4FISA 1D1AA 4CO8A 1MBEA 3LNQA 1U9OA 3E5XA 5AQCA 2FUG2 5A2QK 4NC7A 1KYWA 3C7JA 4W97A 1VQPI 3GZIA 2PZ9A 3CDLA 1APLC 2GXAA 2V1DA 2PMUA 2AXLA 5K5RA 4OAYA 1X3WB 1YW8A 2K9MA 4LJZF 2LMDA 4L5IA 2CV0A 3GTJJ 3WHCA 3IH3A 3U2RA 1XC5A 1P4WA 2M5WA 5LGNA 2FQ3A 3I54A 1WJ5A 1TNTA 4E7JA 4BJ6C 2HZTA 2VQLA 5DD8A 3LQRA 1HSJA 1AOYA 4M3DA 4I76A 4ZZDA 2LKXA 1BN5A 2IAIA 2Z3YA 1GXPA 1DGRM 5J1UA 2K9SA 4PJ0C 2CSOA 2CU7A 3BG3A 2DYSH 3RZDJ 3WTSC 4RM2A 3GW2A 2PJPA 2R7SA 5F08A 5JFRA 1RUOA 1GVJA 3WTUC 1RESA 3V7SA 2W25A 1TQIA 4AVZA 4MTDA 2X48A 3MVPA 2LF8A 2LBFB 4IHSA 1P9QC 2W7NA 1G3WA 1A04A 2K86A 4EJTA 1X1CA 2V6EA 3ZR8X 2XF6A 5JR3A 4UV9A 1JUPA 3RD3A 2HS5A 2PBIA 4RLFA 1R22A 3PPBA 1ZYRF 2Y0SA 4KIFA 3JW4A 3MN2A 2YX7A 4ON0A 1FOYA 1VI0A 4HNVA 4P9UA 2JSCA 2B7EA 1IAWA 2LY9A 5H20A 1XGNA 2HXOA 2WAQA 3FK7A 4LK1F 5FMPA 4BEHB 2HPMA 1QPMA 5F0CA 2G7UA 2BOLA 2CG4A 2QWWA 3HJEA 3H92A 4JX4A 4U0WA 4E4HA 1A5JA 3ZXSA 1GLNA 3PNVA 2EB7A 2UUZA 3RPUD 3J81K 2NNNA 2KRHA 2H27A 3V8KA 2P5KA 1OR7C 3L1PA 5AIPA 2JPBA 3I4MJ 3ULQB 2KP6A 1JUSA 2L7MP 1G8XA 4HSRA 3B6AA 2LKPA 3ZQIA 4DOZA 5FLXK 2CW0F 1UB9A 5CPRB 1L3LA 2HFHA 3DCFA 2VE9A 1R9TJ 4UNOA 3GCMA 5LEKA 2ZO4A 4HPQA 3S16J 4XORA 1MBHA 2MC3A 1RR8C 2XSJC 3S1RJ 3FXUA 1QHHD 5C3EJ 2OI8A 1LE8B 2VBWA 4P1WA 2X6YA 3DPTA 2K3PA 3G7RA 3K7AJ 2QSHX 2O8KA 1SD4A 3EUHA 2BHZA 3FBNB 5FKMA 4FETA 1F43A 2Z16A 1WRJA 1WFXA 5D18A 2RGVA 1IG7A 4QPQA 3SQNA 3L2CA 1PUEE 3HOVJ 4P96A 1XSDA 5DM7F 2IGNA 1JXSA 5JVTA 4AM3A 1HQCA 1XD7A 1VQ9I 2CQ7A 2DODA 5E1XA 2LSOA 2JA5J 2DMQA 4H4KC 2EA2A 4XKCA 4Y15A 5F04A 3JTHA 3SDBA 5CKTA 4PJJA 3QYBA 3IKTA 2FEZA 2PMZN 2ISZA 2QCOA 3DEEA 3T8RA 3M9AA 4RMNA 5DYMA 4C3HJ 4HNTA 1J59A 2XRNA 3U21A 3V78A 3OYKA 3C3WA 2VI6A 2WWYA 4W1UA 4IKFA 2BE5F 1WVRA 1ACIA 2ZNYA 2VIXA 2LDUA 4HQMA 3LJLA 3GTPJ 2M0CA 3AG3H 2R7FA 4HX8A 1W36D 2DPDA 4LB6B 1YJWI 4RA2A 2MBFA 3KZYA 2VPLA 2MA3A 2WY7Q 2G3BA 2L0KA 2Q8KA 4IPAA 2K9LA 4CDGA 1FX7A 4K2EA 5D5UB 1YJ9I 3CUOA 3T1BA 2A5YB 1F5TA 3FZVA 3MD2A 4YELA 2KIMA 1BL0A 1FOWA 3WG9A 4A12A 3QOEA 1MGTA 4WWCA 1X58A 3HC7A 4E70A 3F8MA 1Z91A 1YW7A 1YIOA 3ZQLA 1QNTA 4I7HA 2QZ8A 2CS3A 2JWTA 3KPHA 1NH3A 3Q0UA 2V7FA 2HDDA 3O60A 1U3EM 3ABLH 2QUFA 3RH2A 4PZJA 2DCEA 3SZPA 2OCEA 1BIBA 1Z9CA 2HDCA 2F48A 2HKUA 3S2DJ 1SFOJ 4M3EA 2XAGA 2E60A 4D5FA 3LWJA 2VE8A 1TWGJ 5CVJA 2V1UA 4F55A 1FTTA 1JT0A 2JA2A 2VQGA 5L3DA 4PXIA 1ZH5A 4U87A 4JX6A 2QENA 2OZ6A 1UZCA 2LF7A 2VL8A 3CCJI 2QQBA 4XKBA 1TT0A 1Z77A 3VUQA 2FQ4A 4KT6A 2R3SA 1KONA 1IRZA 2LK2A 2QF7A 2W57A 3SFIA 3HTIA 3FXLA 1ZKGA 4CCLA 3JREA 2M34A 3F8BA 2FBIA 4YFXF 5FB2A 1V54H 3VSKA 4ZYEA 3WE3A 2B63J 3JSPA 1VQKI 4XNFA 3J7AY 3M8FA 2HVRA 3RTRA 1E17A 2R5ZB 1XN7A 3N97A 3F8FA 3DPJA 3I59A 3GFJA 5CVVA 3KLNA 1WJCA 5M5WJ 3DTKA 4YZEA 1KU9A 4GXOA 3HSEA 4G8XA 4XOTA 3ZQCA 3BTLA 4EVIA 2GBYA 4FHTA 3QPHA 3O8GA 4HOBA 4BY1J 3BJAA 4UDSA 1TNSA 3T0YA 5B66C 2KZVA 1YIJI 1WI3A 4FTHA 2L4MA 2Y69H 3DKWA 3I55I 5K7FA 4A3IJ 1O4XA 4F93B 1I27A 4HW0A 1UHWA 1CF7B 3V4GA 2ZMEB 2O8XA 1G4DA 1FYLA 4N9HA 3EETA 2R7QA 3FWEA 4DZPA 3D1NI 1NK2P 3K69A 3KYDB 2Y31A 1LVAA 2H1KA 1ETQA 4OD5A 3KZIC 4E7LA 2B3WA 1B9MA 3BR3A 3DKXA 3Q0WA 1MD0A 4GRIA 4N4OB 2EWNA 2K9NA 3ZOBA 1ODDA 1JJ8C 2BV6A 5EZGA 1YX5A 1QZZA 1F9NA 2BVMA 2R7RA 3QAHA 3QPTA 5E20A 1AKHA 5E3OA 3RPUA 1GUUA 3NRVA 3KP3A 2P6SA 4CUGA 2VT3A 3Q5FA 5IYDJ 1T0FC 3CC2I 1UAAA 2C6YA 2ZJRF 5B1BH 1OYWA 1DPRA 4BXXJ 2R5YA 1R4MB 3HYIA 1FYKA 2CUFA 2P6TA 2LG4A 2E35A 4D5CA 3QRFF 3G1MA 4AU7A 2EFPA 2M3AA 1V5EA 3PFIA 1DP3A 1VQ8I 1WSUA 2HEOA 1D3YA 4KJZA 4Z2YA 5KVRA 1G2HA 2GXGA 1X1AA 1U0JA 2XIGA 2ZXIA 2IS4A 1OCPA 3JSJA 3CJNA 1ZTRA 1WCMJ 2JT1A 4DW6A 1WHUA 2IA2A 3GFIA 1GV5A 2NVXJ 2PG4A 2CQQA 4I01A 4B47A 4B43A 5E3NA 1HOMA 1K83J 2VBZA 5J8FA 5EDNA 1MMGA 2VC1A 4M6XA 3HOUJ 5E1ZB 1AWCA 3CMMA 3J7YJ 1O3SA 1M1EB 3OY9A 2FJI1 5DM6F 2MLKA 3VWBA 3E6CC 4HF2A 2M7AA 1T2KA 1TTYA 3HL2A 3P9TA 2PN6A 4CYCB 3CF5F 1JKOC 2X6XA 4UUTA 1QO0D 5EJCA 1IGNA 3KKDA 1JJ6C 4NHJA 3RQIA 1PYVA 1K79A 2A05A 2N8GA 3O2PE 3Q0VA 4EJUA 2Z2SB 4IEJA 4U0VA 1FJLA 3C07A 4RB1A 4II3A 3KYCB 2F4IA 3LSTA 3CCYA 4HV5A 4A5NA 2W00A 3FXJA 5J6XA 2FOWA 4HQEA 2KIFA 3FXOA 4EV0A 5LHHA 1NG6A 1FMWA 1ZRDA 1J2XA 2E7XA 2IGMA 3ISPA 2NS8A 4IJAA 2MH2A 4BJTA 2QLZA 1JTYA 1HW5A 1UELB 3I59B 1MBGA 3DFGA 4OWRB 2ZNZA 2A6HF 1U5TC 1IN4A 3R60A 2HYGD 4ABZA 4ZYDA 2CUJA 1D8KA 1DGWY 2REKA 5EF6A 3BP8A 2LY1A 1RUNA 1D1CA 3SEZA 3PQKA 3IHUA 4GO1A 3FRQA 1CQTA 2HYJA 1HXDA 3MCZA 4Z6YA 3CESA 2VC0A 3K4NA 4HNUA 5F0HA 4MFEA 2DMPA 2X9DA 3OR1C 2PJRA 3UNGC 2VUMJ 2HNHA 3OIPA 4JOMA 1SD7A 1LEBA 3BG7A 3RKXA 4FQGA 1IV6A 2NNYA 2DMUA 1RR7A 5B5EC 2RREA 2LYCA 3LSHA 2ISYA 2DT5A 3VTIA 2CQKA 1R36A 1G3TA 1FIPA 1J75A 4CCKA 3IH4A 2HKXA 4GYIA 4F7ZA 2RQPA 3JTGA 3LWFA 3LSKA 1R4NB 2L01A 1Y6IA 4M72A 2LREA 3JRFA 2F4OB 2DW4A 4FE7A 2UXXA 3QWLA 3GEZA 1AKHB 2D1VA 1MBKA 2B0LA 3TOBA 5IP9J 2QWTA 3GFMA 4E7IA 3JRDA 2CV1A 4RAFA 2F5CA 3JR9A 1JE8A 3MKZA 2RN7A 3WU2C 2R5YB 4MIMA 1D0XA 1ZG5A 3PNTA 4XIDA 1S3JA 1LFBA 2DG8A 3IAS2 4GYGA 1IN8A 1JGSA 2FRHA 2K02A 4WF2A 4Y17A 2ZCXA 4BJ5C 1BBYA 5FGLA 3PO3J 2VASA 2JA7J 2X1DA 1H9TA 1GDTA 1HW2A 5F1RA 4HAMA 2M8GX 2NYXA 3F9KA 4BE0A 1AA7A 1A6QA 2WAEA 1SMYF 2E1NA 3RQ4A 3HDDA 4LG3A 2XB0X 4B4CA 1TL8A 3WTYC 4QWQA 2QA4I 2ETHA 2VPRA 2IW5A 4ZC3A 3VEPA 1ZREA 3NI7A 3OYHA 1SFKA 1U8RA 3W6KB 2M8EA 1H88C 4HA8A 3CC4I 4P9FA 5D5VB 2OF7A 2IA1A 2A5WA 1W1WE 3JRCA 2RVCA 3E7LA 4I09A 1KGSA 1S5LC 1A31A 3VW1A 2J5OA 3CCEI 3BG9A 1VTNC 1IV8A 3REOA 2Y9ZA 1Z6RA 1ZG3A 1QVTA 2K27A 5DEQA 4X0GA 3CCMI 2QKOA 4AYBN 2F4MB 4KFCA 3B6CA 1T33A 1IC8A 3CP2A 2ZJ2A 2HVSA 2VODA 5KNLA 3HOXJ 3IUVA 1U8BA 3GTOJ 2DBBA 5D1RA 1R49A 4RDUA 1VQLI 3WU0A 3GF2A 3TW6A 2FOKA 2CMPA 2FJ1A 5FD6A 1LKXA 2ME0A 4EJVA 4ME9A 1W7PD 1Y0NA 1OKRA 3ON2A 1BM9A 3K2AA 2PLYA 2EPFA 2DLLA 4BAYA 2JVGA 2Z1DA 1X4PA 3U1KA 2R7UA 1B72A 5HNFA 5FHPA 1REPC 4U9LA 3V6GA 3DBHB 3BJ6A 4A6DA 2BYVE 5JVGF 4S05A 1X4OA 1SAUA 3OOUA 2UXOA 2IP2A 4L0YB 1VQNI 1Y1VJ 2PFVA 4BYYA 1FBUA 3KETA 3I71A 4OOIA 2WGBA 1NHAA 3H1CA 3B81A 2E1MB 1MH3A 3HRMA 3FISA 2X6OA 5LGUA 3I5UA 2PJRB 4J19A 2R7OA 3JRGA 3JAMK 2LY2A 1O3RA 3BWGA 1ZK8A 2FBKA 2X6WA 2RC4A 4LG0A 2W84A 1MKMA 1CGPA 5B3SH 3WHBA 5HLHA 2YX4A 1HDDC 3LHQA 1S8NA 3IH2A 4C9YA 3VPRA 1OPCA 4ZH4F 5D4RA 2VOPA 3IRRA 1E3OC 3S3MA 2L4AA 2HI3A 2MABA 3LA7A 1SFEA 5CXIA 2NVUB 2K4BA 1XX5A 2CWEA 3WTZA 3QPLA 5FKKA 4NN1A 2H94A 3CLQA 4RBOA 2XPVA 5K5QA 1O7FA 5HAWA 1X1DA 4ZDOA 3F1BA 2DJIA 2DA2A 3W2VA 1NG7A 3BG5A 1OQYA 1E3HA
chains in the Genus database with same CATH topology
2DA7A 2ECCA 2HQ5A 4NDLA 5D18A 1IG7A 5IPAA 3HOVJ 4BKXA 3QPSA 2EZKA 1RKTA 2JA5J 2DMQA 3S17J 2R0QC 4A93J 5F04A 1Q1VA 2FX0A 3A01B 3PASA 2TRTA 3GTKJ 4AC6A 2PMZN 3A03A 2QCOA 4AF5A 4C3HJ 1Z0XA 3W6VA 1EF4A 4GCLA 4A3JJ 2IU5A 3V78A 4A3LJ 2FBQA 2VI6A 3HB9A 3RZOJ 5CW8A 1I3QJ 4W1UA 5FLMJ 1IJWC 3CMYA 1TWAJ 3LJLA 1ZQ3P 3GTPJ 2M0CA 5CXGA 1RPWA 2JMWA 5DTDA 3SJMA 2G3BA 3NNRA 2L0KA 4A3FJ 3G1LA 4BBRJ 2QIBA 1JUMA 1VF9A 4G12A 2DA6A 2ME6A 1HF0A 2DA5A 1BL0A 1RETA 3MNLA 4BBSJ 1X58A 3BR5A 2DMTA 3BHQA 3ZQLA 3NPIA 2YS9A 2JWTA 3Q0UA 2HDDA 1ENHA 3O60A 3BR0A 4C3IJ 2QTQA 1W0TA 2RASA 4NELA 1ETKA 4V2GA 3RH2A 4X1EA 5FJ8J 1YRNA 3I4NJ 2DA3A 2D5VA 3COLA 1WH5A 2NP5A 3CRJA 2FD5A 2RHAA 1B8IA 2HKUA 2ID6A 3S2DJ 1ETXA 4DYRA 1SFOJ 2GM4A 4M3EA 1B72B 1DU6A 4D5FA 3LWJA 5E3LA 1TWGJ 2V57A 5EGOB 2XDNA 3HBLA 1FTTA 1JT0A 2GLOA 4PXIA 3PM1A 3HOYJ 2E19A 2M2EA 2DJNA 4JX6A 2GUHA 3QQAA 2AHQA 3HE0A 2DTZA 3JRAA 1Z77A 3TP3A 3VUQA 2FQ4A 2K9QA 2NVQJ 1IRZA 2LK2A 2QF7A 3HTIA 3SFIA 1X2MA 1ZKGA 3JREA 3HKZN 3T6NA 2M34A 4HKUA 5DAJA 3ANPA 2B63J 3HGGA 4EEFG 3H3VK 3BNIA 1PUFB 1BW6A 3OIOA 1LFUP 3E7QA 2IEKA 2LLKA 3S1QJ 2R5ZB 2JJ7A 1HLVA 2WB1N 2R93J 3DPJA 3UKGA 4FE4A 2W53A 2KDZA 5M5WJ 3GBGA 3EGQA 4YZEA 3PO2J 3ZQCA 1P7JA 4MXMA 2DMNA 3BTLA 5K58A 3KZ9A 2G7GA 2GBYA 5FLVA 5JLXA 3TW7A 3O8GA 5EZHA 4BY1J 1HDPA 4UDSA 4CGRA 2VKVA 3KKCA 5GPCA 3BQYA 1WI3A 4FTHA 1VFCA 2XB5A 1OJLA 3RKQA 1X2NA 5K7FA 1JTXA 1WGXA 4A3IJ 1O4XA 2Q24A 5HBUA 4B1RA 4DYCA 5E3MA 4A3MJ 4JP0A 3BJBA 4IHWA 2LD5A 2HOAA 2UXIA 5FKOA 4DZPA 3G1OA 2WUIA 3D1NI 1NK2P 1FIAA 5H9TA 2Y31A 1BW5A 2H1KA 1JKPC 1ETQA 3BTCA 3HGYA 3BT9A 5J3LA 4D7NA 2NX4A 1TWCJ 3Q3SA 3BR3A 3Q0WA 4JL3A 1I50J 2QOPA 2JN6A 3VW0A 3VW2A 5F0FA 4IHXA 2R92J 2ECBA 2DG7A 2K9NA 3ZOBA 1JJ8C 5HODA 5EZGA 5C4JJ 5EG0A 5M5XJ 1U78A 1AKHA 3HOZJ 5E3OA 2DA1A 2EZLA 1GUUA 2RAEA 1T56A 1WPKA 2YVEA 3VVZA 3JRIA 5IYDJ 3NAUA 3VOXA 2NP3A 4BXXJ 2CUEA 2R5YA 2CUFA 2MG4A 4D5CA 2OPTA 3VVXA 3G1MA 4I6ZA 3KNWA 1ETYA 2Y2ZA 5BNGA 3ZQGA 3HEFA 1G2HA 5D19A 4A3GJ 3GTLJ 1OCPA 5J1RA 3JSJA 2NVYJ 2JA8J 1ZTRA 2R7ZJ 4D7MA 3FIWA 1WCMJ 3HIMA 4DW6A 4UUSA 3BRUA 3FKIJ 1JGGA 1GV5A 5FKNA 2NVXJ 2G0EA 9ANTA 4A69C 2PBXA 2CQQA 4A3BJ 3FK6A 5E3NA 2O9LA 1K83J 5EYRA 1HOMA 4XRSA 5K7HA 1UHSA 5EDNA 4M6VA 2HOTA 1VNDA 1YRNB 3HOUJ 4IHYA 1UI6A 2ZOZA 3VP5A 2MW8A 3P9TA 4CYCB 2YVHA 3GTGJ 1JKOC 4UUTA 2IBDA 1IGNA 3KKDA 2EBIA 3EUPA 3AQSA 1JJ6C 3RQIA 4ICHA 2NS7A 2TCTA 3Q0VA 2N8GA 2WV1A 4XRMA 1NK3P 3M3YJ 3CJDA 3G56A 5EFYA 3BR2A 4IEJA 1FJLA 3C07A 4MK6A 2W48A 4GCKA 3NARA 1OFCX 2M9HA 4QSHA 4ACIA 1JT6A 3CCYA 1SGMA 2XSDC 5F1JA 4MO7A 5M3MJ 1ZR4A 2CJJA 1FEXA 2CRGA 3VIBA 2Y30A 5IP7J 3TEDA 2EH3A 3S1MJ 1TWFJ 5IYBJ 1MSEC 2NS8A 1UG2A 3GTMJ 1P7IA 2GFNA 2UXPA 2P81A 3LOCA 1JTYA 4M3BA 3LSGA 2EZIA 1TWHJ 1MBGA 2Y9YA 1GT0C 4ABZA 2EZHA 4BY7J 2REKA 1XS9A 2YUSA 5EF6A 3LSRA 2UXUA 3FRQA 1CQTA 3H0GJ 2HYJA 1H89C 4KWAA 4L5EA 1MH4A 2OERA 2EQRA 5F0HA 4MFEA 2E2IJ 2DMPA 2X9DA 5IOYA 2ID3A 2F07A 3OSFA 2VUMJ 1SANA 2NOGA 3JRHA 2E2JJ 2CQXA 4DZJA 1POGA 5M5YJ 1IV6A 3LSPA 5IYCJ 2DMUA 1RR7A 3HM5A 2LP0A 4QIWN 3ZQHA 2R5ZA 3TP0A 2GENA 4MFDA 1S7EA 1FIPA 3IH4A 3HTAA 2O7OA 2Y0SN 1ITYA 2JK3A 3DEWA 2HYTA 3OSGA 3GEUA 2LVSA 3JRFA 1JKRC 2WAQN 5F27A 4FE7A 2G7LA 4MLOA 3IV5A 5EG0B 4S0HB 2XGDA 4GFKA 3ZQFA 1AKHB 4XK4A 1MBKA 1MSFC 3VOKA 1RKWA 4FCYA 2VKEA 4A3EJ 1LE8A 5IP9J 2E2HJ 2QWTA 3JRDA 2AO9A 4JX5A 4JNNA 2ELKA 5J1YA 3JR9A 2LR8A 2R5YB 4MIMA 4XIDA 3HTHA 4AC0A 1LFBA 2DG8A 2G7SA 2UXHA 2ZCXA 1GV2A 5FGLA 4X6AJ 3A02A 1ORKA 3PO3J 5C44J 1U9NA 2D6YA 2MGQA 4A3KJ 1GDTA 1OCTC 2JA7J 2ZCMA 3CWRA 1QPIA 4QTRA 2XRLA 2XGEA 4B3AA 3HOWJ 2M8GX 5GPAA 3A01A 4FISA 3AQTA 1MBEA 3LNQA 1W0UA 3HDDA 1U9OA 5AQCA 4JYKA 1UMQA 2XB0X 4B4CA 4UUSB 1ZR2A 5DS9A 2VPRA 4Y52J 3S2HJ 4M3FA 3NI7A 3M4OJ 2XPUA 4W97A 3GZIA 1AHDP 2PZ9A 3CDLA 1APLC 1JKQC 5K7ZA 3LSJA 1H88C 1XG1A 2LFBA 2OF7A 3HTJA 3JRCA 3S5RA 3GTJJ 3WHCA 1NTCA 3IH3A 1XC5A 1IDYA 3E7LA 1A6IA 1B8IB 3VW1A 1UI5A 1ETWA 3BG9A 2Y9ZA 1QVTA 4M3DA 4I76A 2LKXA 4XRSG 2QKOA 2IAIA 4AYBN 3ON4A 1WH7A 2XGCA 2L7ZA 1BJZA 5J1UA 3B6CA 3JRBA 1T33A 2K9SA 1IC8A 3BCGA 2XPWA 2CU7A 2ZOYA 3BG3A 3CQZJ 3HOXJ 3IUVA 1U8BA 3GTOJ 3RZDJ 3VVYA 5D1RA 4RDUA 5F08A 2E1OA 5JLWA 3BR6A 3TW6A 1RESA 3BTJA 2FJ1A 5M3FJ 2X48A 3MVPA 2ME0A 4ME9A 3QKXA 2HOSA 3ON2A 2L7FP 4GFLA 1JUPA 3K2AA 4DYQA 3RD3A 1F36A 4CYCA 4Y7NJ 5IOZA 3BQZA 1DU0A 2YU9J 3PPBA 1IUFA 1B72A 5FHPA 3MN2A 3V6GA 1VI0A 4HNVA 3S15J 2LY9A 2HXOA 3FK7A 3OOUA 5EGOA 2UXOA 5C4YA 5FMPA 1QVUA 1Y1VJ 3O8HA 1MBFA 2WGBA 5F0CA 3B81A 4C3JJ 1MH3A 1GVDA 4LOCA 3FISA 3ANGA 4JX4A 1A5JA 3BR1A 3NXCA 2X6OA 4JKZA 5HSZA 1HCRA 4AUXA 1ETOA 4L62A 4A3CJ 2DN0A 4J19A 4XICA 3JRGA 3BTIA 1ZK8A 5IP6A 4GFBA 1I6HJ 2I10A 4GCTA 1MNMC 1K61A 3L1PA 3WHBA 4V2FA 1HDDC 1PUFA 3I4MJ 3LHQA 2ZB9A 3IH2A 1ETVA 1JUSA 1H8AC 2L7MP 2K40A 5GP9A 3VPRA 2NVTJ 3B6AA 5FKLA 3S1NJ 1QRYA 2MSYA 3ZQIA 1E3OC 3C2BA 2JA6J 1Y1WJ 1D5YA 1TC3C 2ZCNA 4IHVA 2HI3A 2LTPA 1AU7A 3DCFA 1R9TJ 3F0CA 1BA5A 1IDZA 5CXIA 1MBJA 2COBA 3MKLA 4A3DJ 2O7TA 3QPLA 3S14J 5FKKA 3S16J 4NN1A 1MBHA 1ZGWA 3QBMA 4RBOA 4C2MJ 3S1RJ 2KT0A 2XPVA 3NRGA 3GTQJ 5C3EJ 2OI8A 5HAWA 5EEAA 3SDGA 1LE8B 3F1BA 3G7RA 2DA2A 5C4XJ 1FTZA 3K7AJ 2HXIA 4M3GA 2H8RA 2O8KA 5FKMA 1F43A 3BG5A 2L9RA 2DA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DA7 A;  2ECC A;  2HQ5 A;  4NDL A;  5D18 A;  1IG7 A;  5IPA A;  3HOV J;  4BKX A;  3QPS A;  2EZK A;  1RKT A;  2JA5 J;  2DMQ A;  3S17 J;  2R0Q C;  4A93 J;  5F04 A;  1Q1V A;  2FX0 A;  3A01 B;  3PAS A;  2TRT A;  3GTK J;  4AC6 A;  2PMZ N;  3A03 A;  2QCO A;  4AF5 A;  4C3H J;  1Z0X A;  3W6V A;  1EF4 A;  4GCL A;  4A3J J;  2IU5 A;  3V78 A;  4A3L J;  2FBQ A;  2VI6 A;  3HB9 A;  3RZO J;  5CW8 A;  1I3Q J;  4W1U A;  5FLM J;  1IJW C;  3CMY A;  1TWA J;  3LJL A;  1ZQ3 P;  3GTP J;  2M0C A;  5CXG A;  1RPW A;  2JMW A;  5DTD A;  3SJM A;  2G3B A;  3NNR A;  2L0K A;  4A3F J;  3G1L A;  4BBR J;  2QIB A;  1JUM A;  1VF9 A;  4G12 A;  2DA6 A;  2ME6 A;  1HF0 A;  2DA5 A;  1BL0 A;  1RET A;  3MNL A;  4BBS J;  1X58 A;  3BR5 A;  2DMT A;  3BHQ A;  3ZQL A;  3NPI A;  2YS9 A;  2JWT A;  3Q0U A;  2HDD A;  1ENH A;  3O60 A;  3BR0 A;  4C3I J;  2QTQ A;  1W0T A;  2RAS A;  4NEL A;  1ETK A;  4V2G A;  3RH2 A;  4X1E A;  5FJ8 J;  1YRN A;  3I4N J;  2DA3 A;  2D5V A;  3COL A;  1WH5 A;  2NP5 A;  3CRJ A;  2FD5 A;  2RHA A;  1B8I A;  2HKU A;  2ID6 A;  3S2D J;  1ETX A;  4DYR A;  1SFO J;  2GM4 A;  4M3E A;  1B72 B;  1DU6 A;  4D5F A;  3LWJ A;  5E3L A;  1TWG J;  2V57 A;  5EGO B;  2XDN A;  3HBL A;  1FTT A;  1JT0 A;  2GLO A;  4PXI A;  3PM1 A;  3HOY J;  2E19 A;  2M2E A;  2DJN A;  4JX6 A;  2GUH A;  3QQA A;  2AHQ A;  3HE0 A;  2DTZ A;  3JRA A;  1Z77 A;  3TP3 A;  3VUQ A;  2FQ4 A;  2K9Q A;  2NVQ J;  1IRZ A;  2LK2 A;  2QF7 A;  3HTI A;  3SFI A;  1X2M A;  1ZKG A;  3JRE A;  3HKZ N;  3T6N A;  2M34 A;  4HKU A;  5DAJ A;  3ANP A;  2B63 J;  3HGG A;  4EEF G;  3H3V K;  3BNI A;  1PUF B;  1BW6 A;  3OIO A;  1LFU P;  3E7Q A;  2IEK A;  2LLK A;  3S1Q J;  2R5Z B;  2JJ7 A;  1HLV A;  2WB1 N;  2R93 J;  3DPJ A;  3UKG A;  4FE4 A;  2W53 A;  2KDZ A;  5M5W J;  3GBG A;  3EGQ A;  4YZE A;  3PO2 J;  3ZQC A;  1P7J A;  4MXM A;  2DMN A;  3BTL A;  5K58 A;  3KZ9 A;  2G7G A;  2GBY A;  5FLV A;  5JLX A;  3TW7 A;  3O8G A;  5EZH A;  4BY1 J;  1HDP A;  4UDS A;  4CGR A;  2VKV A;  3KKC A;  5GPC A;  3BQY A;  1WI3 A;  4FTH A;  1VFC A;  2XB5 A;  1OJL A;  3RKQ A;  1X2N A;  5K7F A;  1JTX A;  1WGX A;  4A3I J;  1O4X A;  2Q24 A;  5HBU A;  4B1R A;  4DYC A;  5E3M A;  4A3M J;  4JP0 A;  3BJB A;  4IHW A;  2LD5 A;  2HOA A;  2UXI A;  5FKO A;  4DZP A;  3G1O A;  2WUI A;  3D1N I;  1NK2 P;  1FIA A;  5H9T A;  2Y31 A;  1BW5 A;  2H1K A;  1JKP C;  1ETQ A;  3BTC A;  3HGY A;  3BT9 A;  5J3L A;  4D7N A;  2NX4 A;  1TWC J;  3Q3S A;  3BR3 A;  3Q0W A;  4JL3 A;  1I50 J;  2QOP A;  2JN6 A;  3VW0 A;  3VW2 A;  5F0F A;  4IHX A;  2R92 J;  2ECB A;  2DG7 A;  2K9N A;  3ZOB A;  1JJ8 C;  5HOD A;  5EZG A;  5C4J J;  5EG0 A;  5M5X J;  1U78 A;  1AKH A;  3HOZ J;  5E3O A;  2DA1 A;  2EZL A;  1GUU A;  2RAE A;  1T56 A;  1WPK A;  2YVE A;  3VVZ A;  3JRI A;  5IYD J;  3NAU A;  3VOX A;  2NP3 A;  4BXX J;  2CUE A;  2R5Y A;  2CUF A;  2MG4 A;  4D5C A;  2OPT A;  3VVX A;  3G1M A;  4I6Z A;  3KNW A;  1ETY A;  2Y2Z A;  5BNG A;  3ZQG A;  3HEF A;  1G2H A;  5D19 A;  4A3G J;  3GTL J;  1OCP A;  5J1R A;  3JSJ A;  2NVY J;  2JA8 J;  1ZTR A;  2R7Z J;  4D7M A;  3FIW A;  1WCM J;  3HIM A;  4DW6 A;  4UUS A;  3BRU A;  3FKI J;  1JGG A;  1GV5 A;  5FKN A;  2NVX J;  2G0E A;  9ANT A;  4A69 C;  2PBX A;  2CQQ A;  4A3B J;  3FK6 A;  5E3N A;  2O9L A;  1K83 J;  5EYR A;  1HOM A;  4XRS A;  5K7H A;  1UHS A;  5EDN A;  4M6V A;  2HOT A;  1VND A;  1YRN B;  3HOU J;  4IHY A;  1UI6 A;  2ZOZ A;  3VP5 A;  2MW8 A;  3P9T A;  4CYC B;  2YVH A;  3GTG J;  1JKO C;  4UUT A;  2IBD A;  1IGN A;  3KKD A;  2EBI A;  3EUP A;  3AQS A;  1JJ6 C;  3RQI A;  4ICH A;  2NS7 A;  2TCT A;  3Q0V A;  2N8G A;  2WV1 A;  4XRM A;  1NK3 P;  3M3Y J;  3CJD A;  3G56 A;  5EFY A;  3BR2 A;  4IEJ A;  1FJL A;  3C07 A;  4MK6 A;  2W48 A;  4GCK A;  3NAR A;  1OFC X;  2M9H A;  4QSH A;  4ACI A;  1JT6 A;  3CCY A;  1SGM A;  2XSD C;  5F1J A;  4MO7 A;  5M3M J;  1ZR4 A;  2CJJ A;  1FEX A;  2CRG A;  3VIB A;  2Y30 A;  5IP7 J;  3TED A;  2EH3 A;  3S1M J;  1TWF J;  5IYB J;  1MSE C;  2NS8 A;  1UG2 A;  3GTM J;  1P7I A;  2GFN A;  2UXP A;  2P81 A;  3LOC A;  1JTY A;  4M3B A;  3LSG A;  2EZI A;  1TWH J;  1MBG A;  2Y9Y A;  1GT0 C;  4ABZ A;  2EZH A;  4BY7 J;  2REK A;  1XS9 A;  2YUS A;  5EF6 A;  3LSR A;  2UXU A;  3FRQ A;  1CQT A;  3H0G J;  2HYJ A;  1H89 C;  4KWA A;  4L5E A;  1MH4 A;  2OER A;  2EQR A;  5F0H A;  4MFE A;  2E2I J;  2DMP A;  2X9D A;  5IOY A;  2ID3 A;  2F07 A;  3OSF A;  2VUM J;  1SAN A;  2NOG A;  3JRH A;  2E2J J;  2CQX A;  4DZJ A;  1POG A;  5M5Y J;  1IV6 A;  3LSP A;  5IYC J;  2DMU A;  1RR7 A;  3HM5 A;  2LP0 A;  4QIW N;  3ZQH A;  2R5Z A;  3TP0 A;  2GEN A;  4MFD A;  1S7E A;  1FIP A;  3IH4 A;  3HTA A;  2O7O A;  2Y0S N;  1ITY A;  2JK3 A;  3DEW A;  2HYT A;  3OSG A;  3GEU A;  2LVS A;  3JRF A;  1JKR C;  2WAQ N;  5F27 A;  4FE7 A;  2G7L A;  4MLO A;  3IV5 A;  5EG0 B;  4S0H B;  2XGD A;  4GFK A;  3ZQF A;  1AKH B;  4XK4 A;  1MBK A;  1MSF C;  3VOK A;  1RKW A;  4FCY A;  2VKE A;  4A3E J;  1LE8 A;  5IP9 J;  2E2H J;  2QWT A;  3JRD A;  2AO9 A;  4JX5 A;  4JNN A;  2ELK A;  5J1Y A;  3JR9 A;  2LR8 A;  2R5Y B;  4MIM A;  4XID A;  3HTH A;  4AC0 A;  1LFB A;  2DG8 A;  2G7S A;  2UXH A;  2ZCX A;  1GV2 A;  5FGL A;  4X6A J;  3A02 A;  1ORK A;  3PO3 J;  5C44 J;  1U9N A;  2D6Y A;  2MGQ A;  4A3K J;  1GDT A;  1OCT C;  2JA7 J;  2ZCM A;  3CWR A;  1QPI A;  4QTR A;  2XRL A;  2XGE A;  4B3A A;  3HOW J;  2M8G X;  5GPA A;  3A01 A;  4FIS A;  3AQT A;  1MBE A;  3LNQ A;  1W0U A;  3HDD A;  1U9O A;  5AQC A;  4JYK A;  1UMQ A;  2XB0 X;  4B4C A;  4UUS B;  1ZR2 A;  5DS9 A;  2VPR A;  4Y52 J;  3S2H J;  4M3F A;  3NI7 A;  3M4O J;  2XPU A;  4W97 A;  3GZI A;  1AHD P;  2PZ9 A;  3CDL A;  1APL C;  1JKQ C;  5K7Z A;  3LSJ A;  1H88 C;  1XG1 A;  2LFB A;  2OF7 A;  3HTJ A;  3JRC A;  3S5R A;  3GTJ J;  3WHC A;  1NTC A;  3IH3 A;  1XC5 A;  1IDY A;  3E7L A;  1A6I A;  1B8I B;  3VW1 A;  1UI5 A;  1ETW A;  3BG9 A;  2Y9Z A;  1QVT A;  4M3D A;  4I76 A;  2LKX A;  4XRS G;  2QKO A;  2IAI A;  4AYB N;  3ON4 A;  1WH7 A;  2XGC A;  2L7Z A;  1BJZ A;  5J1U A;  3B6C A;  3JRB A;  1T33 A;  2K9S A;  1IC8 A;  3BCG A;  2XPW A;  2CU7 A;  2ZOY A;  3BG3 A;  3CQZ J;  3HOX J;  3IUV A;  1U8B A;  3GTO J;  3RZD J;  3VVY A;  5D1R A;  4RDU A;  5F08 A;  2E1O A;  5JLW A;  3BR6 A;  3TW6 A;  1RES A;  3BTJ A;  2FJ1 A;  5M3F J;  2X48 A;  3MVP A;  2ME0 A;  4ME9 A;  3QKX A;  2HOS A;  3ON2 A;  2L7F P;  4GFL A;  1JUP A;  3K2A A;  4DYQ A;  3RD3 A;  1F36 A;  4CYC A;  4Y7N J;  5IOZ A;  3BQZ A;  1DU0 A;  2YU9 J;  3PPB A;  1IUF A;  1B72 A;  5FHP A;  3MN2 A;  3V6G A;  1VI0 A;  4HNV A;  3S15 J;  2LY9 A;  2HXO A;  3FK7 A;  3OOU A;  5EGO A;  2UXO A;  5C4Y A;  5FMP A;  1QVU A;  1Y1V J;  3O8H A;  1MBF A;  2WGB A;  5F0C A;  3B81 A;  4C3J J;  1MH3 A;  1GVD A;  4LOC A;  3FIS A;  3ANG A;  4JX4 A;  1A5J A;  3BR1 A;  3NXC A;  2X6O A;  4JKZ A;  5HSZ A;  1HCR A;  4AUX A;  1ETO A;  4L62 A;  4A3C J;  2DN0 A;  4J19 A;  4XIC A;  3JRG A;  3BTI A;  1ZK8 A;  5IP6 A;  4GFB A;  1I6H J;  2I10 A;  4GCT A;  1MNM C;  1K61 A;  3L1P A;  3WHB A;  4V2F A;  1HDD C;  1PUF A;  3I4M J;  3LHQ A;  2ZB9 A;  3IH2 A;  1ETV A;  1JUS A;  1H8A C;  2L7M P;  2K40 A;  5GP9 A;  3VPR A;  2NVT J;  3B6A A;  5FKL A;  3S1N J;  1QRY A;  2MSY A;  3ZQI A;  1E3O C;  3C2B A;  2JA6 J;  1Y1W J;  1D5Y A;  1TC3 C;  2ZCN A;  4IHV A;  2HI3 A;  2LTP A;  1AU7 A;  3DCF A;  1R9T J;  3F0C A;  1BA5 A;  1IDZ A;  5CXI A;  1MBJ A;  2COB A;  3MKL A;  4A3D J;  2O7T A;  3QPL A;  3S14 J;  5FKK A;  3S16 J;  4NN1 A;  1MBH A;  1ZGW A;  3QBM A;  4RBO A;  4C2M J;  3S1R J;  2KT0 A;  2XPV A;  3NRG A;  3GTQ J;  5C3E J;  2OI8 A;  5HAW A;  5EEA A;  3SDG A;  1LE8 B;  3F1B A;  3G7R A;  2DA2 A;  5C4X J;  1FTZ A;  3K7A J;  2HXI A;  4M3G A;  2H8R A;  2O8K A;  5FKM A;  1F43 A;  3BG5 A;  2L9R A;  2DA4 A; 
#chains in the Genus database with same CATH topology
 4GDF A;  4ITV A;  2E5N A;  3COA C;  2F6C A;  2Q2E A;  3DEU A;  1DPU A;  2XDV A;  1RC9 A;  2HGC A;  2EZK A;  3CO6 C;  5FD5 A;  3S3O A;  4IQJ A;  4L9N A;  4E7S A;  4A93 J;  2R0Q C;  3TGN A;  1FOK A;  1P4A A;  4OD4 A;  4I0A A;  3WG7 H;  3H36 A;  3FDY A;  5CQG A;  4YG2 F;  3GTK J;  5HOO A;  1BI1 A;  3CME I;  3A03 A;  1L0O C;  1ULY A;  4YEJ A;  3L2U A;  1EF4 A;  3CD6 I;  4GCL A;  5B1A H;  4ASN A;  2XAF A;  2QYO A;  1FC3 A;  4CHU A;  1YYV A;  1LDJ A;  1I3Q J;  2GA2 A;  3A0H C;  5KCM A;  3CMY A;  3A1Y A;  3CLO A;  1TWA J;  4HX4 A;  2WY8 Q;  1U6G A;  3WTW C;  1GXQ A;  3K8P C;  1B6A A;  1HST A;  1Z3Y A;  2IGO A;  4E7Z A;  4IOA F;  4M9Z A;  4LLG F;  4ZDL A;  2KPM A;  4PJL A;  3SJM A;  1YHQ I;  2JPC A;  1ERD A;  4BBR J;  3KP5 A;  1JUM A;  3PQJ A;  4IXA A;  2E1C A;  5K1Y A;  2D1H A;  4PUS A;  1VF9 A;  3V8L A;  4DBQ A;  2ME6 A;  1P2F A;  4FX0 A;  1RET A;  4PJM A;  1KQ0 A;  4PSW A;  4BBS J;  3BR5 A;  2AQF A;  2DMT A;  2L9V A;  2FNA A;  3J80 K;  1LNW A;  2VOO A;  4ETS A;  1K6O A;  4OMZ A;  1O7L A;  3R4K A;  1IN6 A;  2QTQ A;  1W0T A;  2RAS A;  1ETK A;  3L2V A;  4XM3 A;  2DT6 A;  1Y56 A;  4FT8 A;  1WH5 A;  2NP5 A;  2FD5 A;  4AIJ A;  1B8I A;  2ID6 A;  3O6B B;  5LHI A;  4U7D A;  4L0Z B;  3D0S A;  1SD5 A;  3FHZ A;  2X4H A;  1B72 B;  4L5J A;  1DU6 A;  1UST A;  4M73 A;  1MND A;  1QZE A;  4PJN A;  1PDN C;  1YG2 A;  1ZHF A;  5LGT A;  3AKZ A;  4UHT A;  1V55 H;  3K70 C;  4NQW A;  1YW9 A;  4JQF A;  4BE2 A;  4EGY A;  3IAM 2;  2O0Y A;  3HOY J;  1FSE A;  4YRV A;  2ZXJ A;  2AHQ A;  3QQA A;  3TDU C;  4R8H A;  2DTZ A;  2L7K A;  5D5X B;  3TBI A;  1QBJ A;  5E18 F;  3CTA A;  4CA0 A;  3C2G A;  4Q4Z F;  3FM5 A;  1X19 A;  1X2M A;  5GTI C;  4DNC A;  3T6N A;  4HKU A;  5HNH A;  5DAJ A;  4B3X A;  3ABM H;  2VJ5 A;  2E36 A;  4EEF G;  1EJ9 A;  4LG0 B;  1RRJ A;  5BS6 A;  1K78 A;  3RYP A;  4HRI A;  2JTV A;  2QBY A;  3QOD A;  5EEH A;  4UXN A;  2IEK A;  1HLV A;  1J0R A;  1OR7 A;  1T95 A;  3UKG A;  4FE4 A;  4I98 B;  2R7V A;  4NB5 A;  3EGQ A;  3H9Q A;  4XLA A;  4D0P A;  2O03 A;  3Q9V A;  3GZN B;  1P7J A;  2CUZ A;  1X3Z B;  5DCM A;  3JSO A;  5D6E A;  3K0L A;  1R1T A;  5FLV A;  5JLX A;  4O3M A;  5EZH A;  1V4R A;  4KN4 X;  5CVR A;  2JUC A;  1QZY A;  2VKV A;  3KKC A;  2HYF A;  1ONV A;  2XB5 A;  2A07 F;  3W2W A;  1X2N A;  3IC7 A;  3ECO A;  1BR4 A;  4UY8 I;  2DDB A;  1W7P A;  2DI3 A;  1JTX A;  3TOA A;  3E0J B;  1R5I D;  2DQR A;  1IN5 A;  5HBU A;  3TMO A;  4B1R A;  4DYC A;  5E3M A;  2Q2E B;  5DDG A;  2IS6 A;  3BJB A;  4IHW A;  1G3Y A;  3CCR I;  3OL4 A;  3A0B C;  1OCC H;  2LD5 A;  2UXI A;  2VXZ A;  3DTI A;  2V26 A;  3G1O A;  3ZMT A;  3FHN A;  2KKO A;  4MHG A;  5D5W B;  2O6G E;  2ZSI B;  3M8E A;  4HDU A;  1FNN A;  1BW5 A;  1JKP C;  4CH7 A;  2P5L C;  1G3S A;  3BTC A;  3HGY A;  5J3L A;  4D7N A;  5D8L B;  3Q3S A;  2YSR A;  4BDY A;  4RGU A;  2QOP A;  2MFZ A;  5F0F A;  1N78 A;  2ECB A;  2ZJQ F;  2QQ9 A;  3G6E I;  2PEX A;  1LPQ A;  5HOD A;  1PJR A;  5C4J J;  2K3F A;  5FRO A;  5EG0 A;  1RZ4 A;  2VON A;  2XKO A;  5TIS C;  5FGM A;  5HLT A;  3HOZ J;  4EMS A;  3H9J A;  1T56 A;  1WPK A;  1IRX A;  4NBQ A;  2H09 A;  4J00 A;  1MIJ A;  3S8P A;  4EJO A;  3PIP F;  1ZLK A;  4V19 K;  3ZN0 A;  2DOA A;  4ZTF A;  2R7T A;  2H1L A;  4YFN F;  3E5U A;  2NP3 A;  3VOX A;  4WXD A;  1Z67 A;  2WBM A;  1H0M A;  2BY0 A;  3KNW A;  3VVX A;  1WJB A;  2KFD A;  1EH7 A;  4LIU A;  2Y2Z A;  5BNG A;  1S7A A;  4L9V A;  5HLI A;  2LNB A;  4A3G J;  5AIQ A;  4CCJ A;  2ESH A;  3E97 A;  3MZ8 A;  4RGX A;  1TQM A;  5K5O A;  3HIM A;  3BRU A;  5L3B A;  3KCC A;  3TKY A;  4U0Y A;  2G0E A;  9ANT A;  4A69 C;  2PBX A;  3IUO A;  3FK6 A;  4P5O A;  1VQ6 I;  5EYR A;  3SHF A;  5K7H A;  1UHS A;  3DU6 A;  4IO9 F;  2HOT A;  5BPI A;  2ZFW A;  2V6C A;  2Q0O A;  2GZW A;  2KJC A;  3QYE A;  2WAF A;  4E6K G;  4LD5 A;  4O5V A;  5ILU A;  2CGP A;  3SFZ A;  1UI6 A;  3WOD F;  2MC4 A;  3PUF A;  4BH9 A;  2ZOZ A;  3VP5 A;  4JK1 X;  2ZXW H;  1V3F A;  2YVH A;  2A61 A;  2AXT C;  2EBI A;  3EUP A;  1A36 A;  3OYC A;  2WV1 A;  2TCT A;  3B73 A;  4NQW B;  3CJD A;  2IT0 A;  3BR2 A;  2VKD A;  1T39 A;  2DFE A;  4KMF A;  4ENK A;  4LFU A;  1QHG A;  3NAR A;  1T6S A;  2YPR A;  4ZTJ A;  2M9H A;  1GHC A;  4ACI A;  4OIP F;  4F52 A;  1SGM A;  4MO7 A;  5M3M J;  1ZR4 A;  1SFU A;  2OZU A;  1FEX A;  2LOO A;  2BW3 A;  2CRG A;  3VIB A;  5JHU A;  4M74 A;  2OJE D;  2KL4 A;  4G6T B;  3TED A;  3FMR A;  1T08 B;  2DFI A;  1WZ2 A;  1K78 B;  2EH3 A;  1YLF A;  3S1M J;  1MSE C;  3R6S A;  3OYI A;  2QBY B;  3OYE A;  5HLG A;  4BQN A;  5DD4 A;  2DU9 A;  3F22 A;  3RPQ A;  3DQV C;  3R0J A;  2ZBK A;  2GA1 A;  1QU3 A;  2YUS A;  2XAS A;  4WXH A;  5DCM B;  2UXU A;  3L7W A;  2OTL I;  3AG4 H;  4F91 B;  5ICC A;  2ZKZ A;  1FP1 D;  2M30 A;  2BZT A;  4L5E A;  4XQF A;  3P9C A;  5ERI A;  1G6N A;  3OYJ A;  3F6O A;  4G6Q A;  4UVB A;  5E79 C;  2JSP A;  1SAN A;  1W7P B;  1XMK A;  2L5Q A;  2WC2 A;  3OYD A;  3OSF A;  4C2T A;  1IXR C;  1XMX A;  2O61 A;  1YX3 A;  3OYM A;  2X51 A;  4G7O F;  3MAJ A;  3BY6 A;  3K1M A;  3HUG A;  3L2W A;  1QGP A;  3ASO H;  3E6B A;  1R1U A;  3H35 A;  3I3L A;  4WK8 F;  3VOD A;  2OTJ I;  1ON2 A;  1YS7 A;  2CO5 A;  4RLQ A;  1TT5 B;  1ITY A;  1U2W A;  5CVU A;  1UHM A;  3ABT A;  4Y13 A;  2JK3 A;  2HYT A;  5L3E A;  3GEU A;  4ZYA A;  4IQ4 A;  1F1Z A;  2AS5 F;  1VQM I;  3I4P A;  4PDK A;  3RIR A;  4YIR X;  3H3Z A;  5EG0 B;  4RB3 C;  3J7A O;  4ESJ A;  4KNY A;  1Z7L A;  3NWS A;  2VKE A;  3KP2 A;  2AO9 A;  4JX5 A;  2VQH A;  3P5J A;  3T8T A;  5J1Y A;  4OMY A;  2EFO A;  2YU3 A;  3V42 A;  3HHG A;  3HTH A;  1LB2 A;  1XCV A;  1IXS B;  1J5Y A;  3BLY A;  3A02 A;  4X6A J;  1T0F A;  5C44 J;  2ZCM A;  4A3K J;  2V1X A;  3JCU C;  2VN2 A;  1E3P A;  1Z3X A;  3E6M A;  3F21 A;  3CWR A;  1LVK A;  4A5M A;  4B3A A;  4DBR A;  4QTR A;  1SAX A;  3HOW J;  5GPA A;  3A01 A;  3F72 A;  3TO6 A;  2BBY A;  2LC2 A;  1ZRC A;  1UMQ A;  1ZR2 A;  1S72 I;  2E5Z A;  3TQN A;  5LHG A;  2HKO A;  3RSN A;  3AL0 B;  1TLH B;  3BPV A;  4M3F A;  3GWZ A;  2XPU A;  1WJD A;  1AHD P;  2COM A;  5E17 F;  3LAJ A;  4LK0 F;  4LMY A;  1XG1 A;  3GX4 X;  5FFZ A;  3S5R A;  4U9N A;  2CH0 A;  2DQL A;  4LIT A;  1IDY A;  5ILV A;  1B4A A;  2W1O A;  4UVA A;  4OIR F;  1A6I A;  4RS8 A;  3WTX C;  1UI5 A;  3H3U A;  3VYR B;  3BZC A;  2VBX A;  3NEU A;  1LEA A;  2NOJ B;  3ZMZ A;  3ON4 A;  4XRS G;  2XGC A;  3L9F A;  2L7Z A;  1VZ0 A;  3BCG A;  3AAF A;  3N05 A;  3PSI A;  2ZOY A;  2A69 F;  3CQZ J;  4HLX A;  3IKV A;  3KP4 A;  1KQ8 A;  1FP2 A;  4KUM A;  4BNC A;  5JLW A;  2E1O A;  2XF5 A;  1W5S A;  3G3Z A;  1R6R A;  2MYS A;  1WJA A;  3BR6 A;  3BTJ A;  2BW3 B;  1TBX A;  4BQQ A;  3GO5 A;  1KYZ A;  1N25 A;  1FWZ A;  4C2U A;  3QKX A;  1VQ4 I;  2L7F P;  3HXL A;  1TQP A;  3EPZ A;  4DYQ A;  1F36 A;  4EM0 B;  5IOZ A;  4BXF A;  4J01 A;  1DU0 A;  5EGO A;  5ICE A;  5C4Y A;  2YR2 A;  2V79 A;  1QVU A;  3WU1 B;  1LDD A;  4HLY A;  1MBF A;  4C3J J;  2AQE A;  1U5T A;  2E7W A;  1GVD A;  3TO7 A;  4LOC A;  3ABU A;  3ANG A;  4JKZ A;  3BR1 A;  1XGS A;  5HSZ A;  1HCR A;  3CCU I;  3BPX A;  1BR1 A;  1FOX A;  3ZMV A;  3H0D A;  5IP6 A;  4GFB A;  1I6H J;  2WA0 A;  4AIH A;  4GCT A;  1ZG1 A;  1K61 A;  1IF1 A;  4M9S A;  1BC7 C;  2EV6 A;  3ONQ A;  4V2F A;  4RAG A;  2ZB9 A;  3KE2 A;  4N0B A;  3KX2 A;  2K40 A;  2IJL A;  3F8N A;  4XSX F;  4ZYH A;  5FKL A;  3S1N J;  1QRY A;  5LRR A;  4L9J A;  1Y1W J;  1D5Y A;  1TC3 C;  4IHV A;  3LL7 A;  1AU7 A;  3CCV I;  3F0C A;  3ZGK A;  3DTE A;  4XLF A;  3KLO A;  2FBH A;  1K7A A;  2O7T A;  4BU2 A;  1ZGW A;  3QP5 A;  5D4S A;  4C2M J;  3ZRG A;  4I02 A;  2G7H A;  5GAG J;  3EDP A;  1RNL A;  2R7W A;  1Y8Q B;  2IVM A;  4M3G A;  2HXI A;  4OIO F;  2DPU A;  3HIF A;  3N4M A;  2L9R A;  2DA4 A;  2DA7 A;  2O5R A;  1XSV A;  4NDL A;  5ICG A;  2X1C A;  1ZRF A;  1J09 A;  4HST A;  5IPA A;  4BKX A;  4LB5 A;  1DP7 P;  5E8G A;  3QPS A;  2OV7 A;  2HQN A;  3E5Q A;  3SWH A;  2DOE A;  1YTY A;  2ZXH A;  1RKT A;  5GTH C;  3S17 J;  1STZ A;  2XV4 S;  4AYB A;  4DVY P;  3A01 B;  3IWF A;  4ZJZ A;  1R7J A;  4CXF A;  1EA3 A;  2RQQ A;  3H5N A;  4OU0 A;  3TL4 X;  2TRT A;  3HOS A;  1XTA A;  4ZDP A;  4BL0 B;  3KYL A;  4MEX F;  2DT7 B;  1MNE A;  2XF7 A;  2IU5 A;  2KRC A;  3K70 D;  2Z33 A;  4A3L J;  3HB9 A;  2KZG A;  3CUQ C;  2BGC A;  3RZO J;  1SEU A;  4U88 A;  2Y48 A;  4OAZ A;  3CCQ I;  1I6X A;  3NQO A;  2XGX A;  3NS4 A;  1RPW A;  1LFP A;  2LH9 A;  5FFX A;  2JMW A;  5CVI A;  3U9G A;  2EV5 A;  5F64 A;  2KIS A;  3NNR A;  1O3T A;  1WKM A;  2UZK A;  4A3F J;  3G1L A;  3TO9 A;  2QIB A;  1I5Z A;  4EAT A;  2OCC H;  4G12 A;  2DA6 A;  3W3C A;  2DA5 A;  5BMZ A;  5HS9 A;  1MMS A;  3DV8 A;  3MNL A;  3S2W A;  3F23 A;  4HZF A;  1MZB A;  4R1H A;  2ZCW A;  3CF2 A;  3OYB A;  4CCM A;  4MEY F;  3CJQ B;  1UJ8 A;  2H6B A;  2YS9 A;  2RDP A;  4C3I J;  3A2K A;  1BI3 A;  2L02 A;  1VQ7 I;  4V2G A;  4NEL A;  3OV8 A;  2FXA A;  1ZGJ A;  3EUA A;  4X1E A;  3I4N J;  1IRF A;  2D5V A;  2EFQ A;  1SMT A;  3X2Q H;  3COL A;  3QYF A;  2GM4 A;  3LA3 A;  4XBF A;  2XAQ A;  4ENN A;  3GLX A;  4R79 A;  5ED4 A;  2K5C A;  3ECH A;  5E3L A;  2EIN H;  1Z7U A;  5EGO B;  1MMD A;  2XDN A;  3HBL A;  4PSX A;  3I64 A;  3L09 A;  3PM1 A;  4P55 A;  2DJN A;  1U5T B;  3JRA A;  2QM3 A;  4IRG A;  3TP3 A;  1BC8 C;  4MQ9 F;  2K9Q A;  2VKH A;  3Q9S A;  2P7C B;  4CSW A;  3PSF A;  3HKZ N;  1ZAO A;  3GUD A;  3RDI A;  1BIA A;  2ELH A;  2FSW A;  2HZD A;  3HGG A;  1Y39 A;  2VT2 A;  2L54 A;  2CFO A;  3OIO A;  1LFU P;  2A6E F;  5IT9 Z;  2ELJ A;  4PCQ A;  2WB1 N;  2OA4 A;  2F5E A;  4HG2 A;  3EYY A;  1WJE A;  2E71 A;  2WTE A;  3WTV C;  3OYF A;  3GBG A;  4DIQ A;  1X1P A;  1MDM A;  3PO2 J;  2QEX I;  2O3F A;  2DAO A;  1EH6 A;  3VOE A;  2XC7 A;  4ZYG A;  2G7G A;  3DPU A;  2A68 F;  5E8I A;  3MQ0 A;  1KQ9 A;  1MJA A;  3J7Z I;  4KIG A;  5GPC A;  5A2Q Z;  1IZ1 A;  4XN3 A;  3V7C A;  1VFC A;  4L18 B;  3PUB A;  1HKS A;  2EA4 A;  4KDP A;  4XN0 A;  3DPL C;  3EQL F;  1OYY A;  1WGX A;  4BDZ A;  2Q24 A;  1P92 A;  4H0E A;  2MLG A;  4A3M J;  4N9I A;  4JP0 A;  2GQQ A;  2HOA A;  5FKO A;  2WUI A;  2HTJ A;  1D0Y A;  2F5D A;  4HF1 A;  1BJA A;  3QU6 A;  4DQ2 A;  3FXR A;  3OR2 C;  3IL2 A;  3HTS B;  2BXY A;  2L9S A;  3BT9 A;  1YQA A;  3F6V A;  1W5C C;  3HG9 A;  4JL3 A;  1I50 J;  3SEQ A;  4I0B A;  2JN6 A;  3OYN A;  3VW0 A;  3VW2 A;  4IHX A;  2R92 J;  2R4G A;  2IXS A;  3I9V 2;  4N4N B;  2DG7 A;  3GFL A;  2BY2 A;  5J8C A;  5HDN A;  1SFX A;  1XCB A;  4NNJ A;  5M5X J;  4AVP A;  1U78 A;  4MTE A;  1WJF A;  2DA1 A;  2RAE A;  2YVE A;  3VVZ A;  3JRI A;  3NAU A;  3K4L A;  1FSH A;  4FAS D;  2E34 A;  4IF4 A;  1KU2 A;  2ZJP F;  4WXC A;  4IRV A;  3AFH A;  2CUE A;  3F3X A;  4KMU X;  3MKW B;  2MG4 A;  3D5L A;  2DFH A;  4PGH A;  2OPT A;  4I6Z A;  3V7R A;  2ADU A;  1ETY A;  1YJN I;  3ZQG A;  3HEF A;  4LLL A;  4AWX B;  3SYT A;  5D19 A;  3ABK H;  3CJR B;  5J1R A;  2NVY J;  4ESB A;  2JA8 J;  2R7Z J;  5L3F A;  3ZMD A;  4D7M A;  3OYL A;  1KU7 A;  4EM2 A;  3HPG A;  2GXB A;  3DWL E;  4UUS A;  3ASN H;  3CCL I;  3FKI J;  2UV1 A;  1JGG A;  2Q1Z B;  4EM1 A;  4A3B J;  2B9S A;  1JHF A;  5LD2 C;  2ACJ A;  2O9L A;  1H9G A;  1MJ9 A;  3ELK A;  4M6V A;  3CC7 I;  3J81 Z;  5CLS A;  4IHY A;  3MKY B;  1FPQ A;  2KRF A;  4B44 A;  2EIJ H;  1SVO A;  1SD6 A;  4CCN A;  2ZY9 A;  2HQR A;  1D0Z A;  3PIO F;  2JQ7 A;  3K1P A;  1BR2 A;  1HC8 A;  3AQS A;  2DK5 A;  5FLX Z;  4ICH A;  4XRM A;  2V9V A;  4KIT B;  3M3Y J;  5EFY A;  3HOT A;  2QSG X;  3FX3 A;  3DBR B;  3C2H A;  2CW8 A;  5H6R A;  4GCK A;  3CMA I;  2QKL B;  3RCO A;  4YFK F;  1DUX C;  1OFC X;  4QSH A;  3LFU A;  2K7L A;  2XSD C;  4XRF A;  5F1J A;  2XRO A;  3VB2 A;  5KHD A;  1LJ9 A;  2CJJ A;  4I2O A;  2TDX A;  3OIQ A;  4EGZ A;  5IP7 J;  3WE2 A;  1TWF J;  5IYB J;  2VBY A;  3OS0 A;  4CGZ A;  2A6T A;  1UG2 A;  1P7I A;  1S9H A;  3I0T A;  2P81 A;  4TV7 A;  4XKW A;  3LOC A;  3VSL A;  4HX7 A;  5AON A;  3LSG A;  4AIK A;  2EZI A;  2A3S A;  4G94 A;  5LLQ A;  2HVQ A;  4PFO A;  2MD5 A;  4HF0 A;  1X3U A;  1FZP B;  2EZH A;  4BY7 J;  2NXN B;  4G7H F;  2EFN A;  1XS9 A;  1MDM B;  5IT3 A;  1TP4 A;  2M7B A;  2PMZ A;  3K4J A;  1H89 C;  2DYR H;  1MH4 A;  4B09 A;  2IS1 A;  4QPO A;  1Z1D A;  3ZMS A;  5TRD A;  1HKT A;  4G9Y A;  1P4X A;  2W4S A;  3GVA A;  3E1S A;  4RGS A;  3JRH A;  4XON A;  5M5Y J;  1POG A;  1YE9 A;  3LSP A;  3CO7 C;  3TDZ C;  2DFF A;  3HM5 A;  4GCV A;  1ZGA A;  3ERM A;  3ZQH A;  2R5Z A;  3TP0 A;  5TGT A;  1J9I A;  4MFD A;  4EJW A;  3VYU B;  2VJJ A;  2HPI A;  2RV8 A;  4BE1 A;  3T5X A;  2J5P A;  2Y0S N;  3ZMU A;  3F8C A;  4OIQ F;  3DEW A;  3OSG A;  4KIB A;  3ZCO A;  4NC8 A;  2BHY A;  2LRD A;  2WAQ N;  2CV2 A;  3LSM A;  3EUH C;  4MLO A;  3DLL F;  2G7L A;  2DOF A;  1OLT A;  4CYD A;  3IV5 A;  4QLC U;  3A4C A;  3L00 A;  4S0H B;  2XGD A;  4GFK A;  3ZQF A;  4G7Z F;  5BOX A;  2ZME C;  5E1W A;  1MW7 A;  5LEJ A;  4II2 A;  3VOK A;  1RKW A;  4FCY A;  4A3E J;  2OD5 A;  2E2H J;  3I53 A;  3BRO A;  1HW1 A;  1CF7 A;  2ZME A;  3PL8 A;  2LR8 A;  5D8K B;  1VQO I;  1FBS A;  2QGU A;  3DP7 A;  2VJ4 A;  2G7S A;  2HOE A;  5KAF C;  3MEX A;  1ORK A;  1U9N A;  4PFP A;  2D6Y A;  2WAD A;  3QOP A;  2BEO A;  3HTU A;  2XRL A;  2XGE A;  5HVQ C;  1K4S A;  5J40 A;  1R23 A;  4ESF A;  3CJT B;  4UVC A;  2IA0 A;  3AQT A;  4RGR A;  4BAC A;  1W0U A;  3O3K A;  3GZ6 A;  1D1B A;  4JYK A;  1OIS A;  2PQ8 A;  1ZEL A;  4A6E A;  4UUS B;  1B59 A;  4IRH A;  3SXY A;  5DS9 A;  3M8J A;  4GGG A;  4Y52 J;  3S2H J;  1HBX G;  3M4O J;  3FF5 A;  1KZH A;  1ZN2 A;  3LMM A;  5DCF A;  4YIF A;  2KIU A;  4Q47 A;  4F92 B;  1RIO H;  1JKQ C;  5K7Z A;  3LSJ A;  3KP6 A;  5KK1 A;  2HU9 A;  5CJ9 A;  2MD0 A;  4A0Y A;  2Z9O A;  2LFB A;  4HBL A;  3HTJ A;  4OIN F;  3ZQQ A;  4XLH A;  3SZG A;  1NTC A;  2I5U A;  2M4K A;  4U7B A;  4Q5S F;  2UWM A;  4O6J A;  2W24 A;  1B8I B;  1T8I A;  1ETW A;  1FY7 A;  3W6J B;  3AL0 C;  1IW7 F;  2FE3 A;  1XDS A;  3GXO A;  1WH7 A;  4WX9 A;  4IZZ A;  1BJZ A;  3RJP A;  3JRB A;  1SVM A;  2HTS A;  4NUB A;  2HQA A;  4NC6 A;  1I1S A;  2XPW A;  2UXN A;  3H5R A;  4A2U A;  3I56 I;  3EUK L;  3VVY A;  3FXK A;  2GOX B;  2NAZ A;  3ZQ7 A;  5ICF A;  5GAH J;  4G6D A;  2P5V A;  3FXM A;  5D6F A;  3WGG A;  2W85 A;  1R58 A;  5M3F J;  2HOS A;  4GFL A;  3K4K A;  5IY5 H;  3K4C A;  4CYC A;  3IP4 B;  1RI7 A;  3BZ6 A;  4UB6 C;  4Y7N J;  3BQZ A;  3WGH A;  1DDN A;  2YU9 J;  3HRS A;  1IUF A;  3D5S C;  3S15 J;  1R00 A;  2RNG A;  5KAI C;  3BG6 A;  4B48 A;  2QKM B;  1Z21 A;  1E2X A;  2EV0 A;  1K6Y A;  4D1Q A;  3O8H A;  3PNY A;  4BQA A;  3G71 I;  4XLC A;  2B1E A;  4RB0 A;  2OU2 A;  3WTT C;  3NXC A;  4B8X A;  4E7H A;  2Y0M A;  3K4B A;  4AUX A;  1ETO A;  4UV8 A;  4A3C J;  2HWV A;  2DN0 A;  4L62 A;  4XIC A;  3BTI A;  4AID A;  4Y3O A;  3L2Q A;  2I10 A;  3MZY A;  1MNM C;  4L9T A;  2NRA C;  3G4S I;  1JI8 A;  1BOB A;  1YI2 I;  2H8W A;  1PP8 F;  2OQR A;  2FML A;  2KJB A;  1PUF A;  1ETV A;  1ZLJ A;  2ESN A;  3DU5 A;  4XSZ F;  1H8A C;  3HRU A;  5GP9 A;  2NVT J;  2DDA A;  2MSY A;  2JA6 J;  3C2B A;  2ZCN A;  3DLA A;  2LTP A;  2R7D A;  3BCA A;  2PMH A;  4IL6 C;  3RYR A;  1EH8 A;  4F3Q A;  1BA5 A;  1IDZ A;  2CFX A;  1MBJ A;  2COB A;  3MKL A;  4A0X A;  4A3D J;  2OQG A;  1HA8 A;  3S14 J;  3R0A A;  2VLA A;  3QBM A;  2KT0 A;  2Z99 A;  3NRG A;  2KMU A;  3GTQ J;  3ML6 A;  1MJB A;  4CZC A;  5EEA A;  3SDG A;  2V9P A;  2EIK H;  3VYT B;  5C4X J;  1FTZ A;  4M71 A;  2H8R A;  3EYI A;  4UB8 C;  2ICW G;  1WI9 A;  3KP7 A;  2DTR A;  2ECC A;  2HQ5 A;  1IXC A;  1XGM A;  3K4M A;  2P7V B;  1MMN A;  3HHH A;  1OMI A;  2BVL A;  5J4Y A;  3B02 A;  3M1C A;  1TW3 A;  4E7K A;  3CDH A;  2XVC A;  2OC6 A;  3K6G A;  1EV7 A;  2JZY A;  1Q1V A;  1S29 A;  1EKE A;  2FX0 A;  2K4J A;  2W82 A;  2QVO A;  3PAS A;  3CP8 A;  4AC6 A;  3K9T A;  4ZZL A;  1BOA A;  2YVX A;  3CDI A;  4AF5 A;  4M6Y A;  1Z0X A;  3DBL B;  3W6V A;  4Y4R A;  4Y33 A;  1YO5 C;  2OAZ A;  1N75 A;  2V1N A;  4A3J J;  1V5G A;  2CW7 A;  4KIC A;  1YIT I;  2FBQ A;  1J7K A;  5CW8 A;  4KIS A;  1ON1 A;  4MNU A;  1OCZ H;  1XDU A;  2GAU A;  5FLM J;  1IJW C;  1XSX A;  3OL3 A;  3LFK A;  1ZQ3 P;  4S04 A;  4XLN F;  1XGO A;  5CXG A;  2F5F A;  4ENM A;  1WWX A;  4KYW A;  3M1E A;  5J4V A;  5DTD A;  3DF8 A;  2ZFU A;  4AD9 A;  1Y0U A;  2D2W A;  3BC8 A;  3RKY A;  4JBA A;  3NWT A;  3C18 A;  1HF0 A;  1HKQ A;  3AG1 H;  1KA8 A;  4YII A;  1N77 A;  1O57 A;  4XMY A;  2IPQ X;  3LA2 A;  2XAJ A;  5HS7 A;  3BHQ A;  1G59 A;  2XAH A;  3KEQ A;  4CZZ A;  3NPI A;  4XKV A;  4XL9 A;  1ENH A;  3BR0 A;  4PK4 A;  2H6C A;  3LQQ A;  5FJ8 J;  1YRN A;  1ZAR A;  3FMQ A;  2IRF G;  2DA3 A;  2JUG A;  2KQR A;  2M1B A;  3BJO A;  3R61 A;  2RHA A;  5DUK A;  3CRJ A;  1ETX A;  4DYR A;  2PI0 A;  4IX7 A;  2JRT A;  1DQU A;  3VYS B;  2OUM A;  1OCR H;  2V57 A;  1UG0 A;  1XMA A;  1YOV B;  4I99 C;  2GLO A;  3GZ5 A;  2E19 A;  4BHC A;  2M2E A;  2M4G A;  2GUH A;  3U1D A;  3HE0 A;  2QSF X;  5GAE J;  5TJJ A;  5HDG A;  3KZZ A;  1W36 C;  6PAX A;  1E0E A;  2EK5 A;  3OOP A;  4PGG A;  2NVQ J;  1UCR A;  3FM3 A;  3PFY A;  3P7N A;  5H2F C;  1UFM A;  3ZN1 A;  3RI4 A;  3IWZ A;  3ANP A;  2PX9 A;  2P4W A;  3WGI A;  3H3V K;  4C30 A;  3BNI A;  3CCS I;  1PUF B;  1BW6 A;  3E7Q A;  2VB6 A;  2LLK A;  3BDD A;  3FXQ A;  2JJ7 A;  1IN7 A;  2XAU A;  3HUG B;  5J47 A;  1T38 A;  3S1Q J;  2FU4 A;  3AG2 H;  2R93 J;  1Z05 A;  3E3V A;  2M0M A;  2V9K A;  3L2R A;  4XLP F;  1W4M A;  2E1M C;  4RAY A;  2W53 A;  2KDZ A;  1MMA A;  1OYI A;  2Z5U A;  1B1B A;  3K2Z A;  3HZJ A;  4MXM A;  2DMN A;  5K58 A;  1FMV A;  3KZ9 A;  3ESW B;  2X0L A;  3TW7 A;  1YFH A;  1HDP A;  2FA5 A;  4CGR A;  2XKP A;  3BQY A;  1PVE A;  5JHF A;  3BZK A;  1KU3 A;  5FRM A;  1OJL A;  2OBP A;  3RKQ A;  1P6R A;  5JI6 A;  2FF4 A;  3FBI B;  2MH9 A;  2STT A;  5CYV A;  4IHT A;  2IGK A;  3ROU A;  4HV6 A;  4XR6 A;  3OS2 A;  2QQA A;  3DKY A;  4WCG A;  5HS8 A;  5BPD A;  3PJR A;  1FIA A;  5H9T A;  1I1G A;  3E6D A;  3QP6 A;  2NX4 A;  1TWC J;  2KLO A;  3H9G A;  4KA4 A;  2DXI A;  4KT5 C;  1SVL A;  1C0W A;  2ZC2 A;  4MGR A;  2NS0 A;  4A0Z A;  2HR3 A;  2EZL A;  3OMY A;  1BI2 A;  1F4K A;  1R5H A;  2I8D A;  2IS2 A;  3CUQ A;  4ENJ A;  1K4T A;  4XOP A;  2EIM H;  2GIZ A;  5FRN A;  1S6L A;  1V5F A;  4RM3 A;  2VXD A;  4CIC A;  2BY1 A;  1LDK B;  2HDW A;  2RKH A;  3GTL J;  3HSF A;  3G2B A;  4BHB A;  3FIW A;  3VFZ A;  3H5A A;  5LBQ A;  5FKN A;  5F6F A;  4DJA A;  4DGW B;  3HKZ A;  3FKJ A;  4LIV A;  3VDX A;  3S32 A;  1Z6T A;  3M7G A;  4XRS A;  2V4J C;  3JAM Z;  2KHM A;  1VND A;  3IRQ A;  1YRN B;  2RNJ A;  1Q1H A;  2JRM A;  4MQV A;  4EQQ A;  3UR3 C;  4BHP A;  4CCO A;  2WB1 A;  2FMY A;  4HEA 2;  1Y8R B;  2MW8 A;  4HYE A;  3GLL A;  4ANJ A;  2K85 A;  2KDO A;  3GTG J;  1IUY A;  2IBD A;  2M45 A;  5BQT A;  5FO5 A;  2EJR A;  2BXZ A;  2NS7 A;  3HRT A;  1NK3 P;  3G56 A;  2VJI A;  4HDV A;  1BI0 A;  1PP7 U;  4MK6 A;  1TZL A;  2W48 A;  2R7X A;  2WV0 A;  3S93 A;  2DO7 A;  3SZT A;  2QQ8 A;  4BGD A;  1O3Q A;  1JT6 A;  2DK8 A;  3CZ6 A;  4LLN A;  2G9W A;  2X1E A;  2L9N A;  1VQ5 I;  3GYH X;  2PFB A;  2Y30 A;  1XB4 A;  3BOQ A;  2LBF A;  4FX4 A;  2STW A;  3GTM J;  2GFN A;  1TW2 A;  2UXP A;  2FNP A;  5ILS A;  4M3B A;  1TWH J;  5LFA A;  4XLE A;  3OYG A;  1QA6 A;  4IRI A;  2Y9Y A;  2EIL H;  1GT0 C;  2P8T A;  1X1B A;  2GOM A;  3D5R C;  1I39 A;  1W5T A;  3LSI A;  4Q48 A;  4BQO A;  3MZH A;  1A35 A;  1FLI A;  4C2M A;  3GME A;  2GWR A;  3LSR A;  4IOC F;  4BEH A;  3OYA A;  5L3G A;  4LGW A;  1R1V A;  2F5V A;  3H0G J;  3K10 A;  4RAZ A;  2JVH A;  2XHK A;  4KWA A;  2M87 A;  1WQ2 A;  2OER A;  1R5G A;  2EQR A;  2GIV A;  3C1D A;  2D45 A;  2E2I J;  3V8J A;  3W2A A;  5IOY A;  2F2E A;  5HDK A;  1USS A;  2ID3 A;  4M9X A;  3M07 A;  3KEO A;  3G73 A;  1B9N A;  2F07 A;  2L3D A;  2NOG A;  5DUI A;  2E2J J;  2CQX A;  2A2F X;  4DZJ A;  1I3A A;  5GAD J;  5EEG A;  1LUJ B;  4UUV A;  1S7O A;  5IYC J;  2CQN A;  3KIO A;  3LAP A;  4IVN A;  2LP0 A;  3P9K A;  4QIW N;  2XUB A;  3I58 A;  4WIB A;  2ZSH B;  1QQI A;  3MFK A;  2GEN A;  1S7E A;  2KIQ A;  1JHH A;  1IRG A;  2L2O A;  3K1N A;  2X85 A;  3QU3 A;  3OS1 A;  1D8J A;  3FMS A;  3HTA A;  4BS9 A;  2O7O A;  1XPX A;  2P0W A;  4BUP A;  1T98 A;  3KEY A;  5H6Q A;  1IO2 A;  2CYY A;  2LVS A;  1JKR C;  5DV5 A;  5F27 A;  3ERE D;  1YS6 A;  3KFW X;  4KN7 X;  1FT9 A;  3P9I A;  3S3N A;  4BXU A;  4XK4 A;  1MSF C;  1R71 A;  3DXJ F;  1LE8 A;  3J80 Z;  1FYM A;  3OWT A;  3ZP5 A;  1LQ1 A;  4JNN A;  4RB2 C;  2ELK A;  3MMY B;  5LRS A;  2EFW A;  3ZPL A;  2VQC A;  4D9J A;  3CUQ B;  1FBQ A;  5L3C A;  5IT9 K;  1D5V A;  2Y75 A;  3BCB A;  4AC0 A;  2UXH A;  1GV2 A;  1OCO H;  3HSR A;  1SC7 A;  3RKW A;  3MWM A;  2MGQ A;  1OCT C;  5CQE A;  3HPH A;  2LKS A;  1QPI A;  2BY3 A;  4FIS A;  1D1A A;  4CO8 A;  1MBE A;  3LNQ A;  1U9O A;  3E5X A;  5AQC A;  2FUG 2;  5A2Q K;  4NC7 A;  1KYW A;  3C7J A;  4W97 A;  1VQP I;  3GZI A;  2PZ9 A;  3CDL A;  1APL C;  2GXA A;  2V1D A;  2PMU A;  2AXL A;  5K5R A;  4OAY A;  1X3W B;  1YW8 A;  2K9M A;  4LJZ F;  2LMD A;  4L5I A;  2CV0 A;  3GTJ J;  3WHC A;  3IH3 A;  3U2R A;  1XC5 A;  1P4W A;  2M5W A;  5LGN A;  2FQ3 A;  3I54 A;  1WJ5 A;  1TNT A;  4E7J A;  4BJ6 C;  2HZT A;  2VQL A;  5DD8 A;  3LQR A;  1HSJ A;  1AOY A;  4M3D A;  4I76 A;  4ZZD A;  2LKX A;  1BN5 A;  2IAI A;  2Z3Y A;  1GXP A;  1DGR M;  5J1U A;  2K9S A;  4PJ0 C;  2CSO A;  2CU7 A;  3BG3 A;  2DYS H;  3RZD J;  3WTS C;  4RM2 A;  3GW2 A;  2PJP A;  2R7S A;  5F08 A;  5JFR A;  1RUO A;  1GVJ A;  3WTU C;  1RES A;  3V7S A;  2W25 A;  1TQI A;  4AVZ A;  4MTD A;  2X48 A;  3MVP A;  2LF8 A;  2LBF B;  4IHS A;  1P9Q C;  2W7N A;  1G3W A;  1A04 A;  2K86 A;  4EJT A;  1X1C A;  2V6E A;  3ZR8 X;  2XF6 A;  5JR3 A;  4UV9 A;  1JUP A;  3RD3 A;  2HS5 A;  2PBI A;  4RLF A;  1R22 A;  3PPB A;  1ZYR F;  2Y0S A;  4KIF A;  3JW4 A;  3MN2 A;  2YX7 A;  4ON0 A;  1FOY A;  1VI0 A;  4HNV A;  4P9U A;  2JSC A;  2B7E A;  1IAW A;  2LY9 A;  5H20 A;  1XGN A;  2HXO A;  2WAQ A;  3FK7 A;  4LK1 F;  5FMP A;  4BEH B;  2HPM A;  1QPM A;  5F0C A;  2G7U A;  2BOL A;  2CG4 A;  2QWW A;  3HJE A;  3H92 A;  4JX4 A;  4U0W A;  4E4H A;  1A5J A;  3ZXS A;  1GLN A;  3PNV A;  2EB7 A;  2UUZ A;  3RPU D;  3J81 K;  2NNN A;  2KRH A;  2H27 A;  3V8K A;  2P5K A;  1OR7 C;  3L1P A;  5AIP A;  2JPB A;  3I4M J;  3ULQ B;  2KP6 A;  1JUS A;  2L7M P;  1G8X A;  4HSR A;  3B6A A;  2LKP A;  3ZQI A;  4DOZ A;  5FLX K;  2CW0 F;  1UB9 A;  5CPR B;  1L3L A;  2HFH A;  3DCF A;  2VE9 A;  1R9T J;  4UNO A;  3GCM A;  5LEK A;  2ZO4 A;  4HPQ A;  3S16 J;  4XOR A;  1MBH A;  2MC3 A;  1RR8 C;  2XSJ C;  3S1R J;  3FXU A;  1QHH D;  5C3E J;  2OI8 A;  1LE8 B;  2VBW A;  4P1W A;  2X6Y A;  3DPT A;  2K3P A;  3G7R A;  3K7A J;  2QSH X;  2O8K A;  1SD4 A;  3EUH A;  2BHZ A;  3FBN B;  5FKM A;  4FET A;  1F43 A;  2Z16 A;  1WRJ A;  1WFX A;  5D18 A;  2RGV A;  1IG7 A;  4QPQ A;  3SQN A;  3L2C A;  1PUE E;  3HOV J;  4P96 A;  1XSD A;  5DM7 F;  2IGN A;  1JXS A;  5JVT A;  4AM3 A;  1HQC A;  1XD7 A;  1VQ9 I;  2CQ7 A;  2DOD A;  5E1X A;  2LSO A;  2JA5 J;  2DMQ A;  4H4K C;  2EA2 A;  4XKC A;  4Y15 A;  5F04 A;  3JTH A;  3SDB A;  5CKT A;  4PJJ A;  3QYB A;  3IKT A;  2FEZ A;  2PMZ N;  2ISZ A;  2QCO A;  3DEE A;  3T8R A;  3M9A A;  4RMN A;  5DYM A;  4C3H J;  4HNT A;  1J59 A;  2XRN A;  3U21 A;  3V78 A;  3OYK A;  3C3W A;  2VI6 A;  2WWY A;  4W1U A;  4IKF A;  2BE5 F;  1WVR A;  1ACI A;  2ZNY A;  2VIX A;  2LDU A;  4HQM A;  3LJL A;  3GTP J;  2M0C A;  3AG3 H;  2R7F A;  4HX8 A;  1W36 D;  2DPD A;  4LB6 B;  1YJW I;  4RA2 A;  2MBF A;  3KZY A;  2VPL A;  2MA3 A;  2WY7 Q;  2G3B A;  2L0K A;  2Q8K A;  4IPA A;  2K9L A;  4CDG A;  1FX7 A;  4K2E A;  5D5U B;  1YJ9 I;  3CUO A;  3T1B A;  2A5Y B;  1F5T A;  3FZV A;  3MD2 A;  4YEL A;  2KIM A;  1BL0 A;  1FOW A;  3WG9 A;  4A12 A;  3QOE A;  1MGT A;  4WWC A;  1X58 A;  3HC7 A;  4E70 A;  3F8M A;  1Z91 A;  1YW7 A;  1YIO A;  3ZQL A;  1QNT A;  4I7H A;  2QZ8 A;  2CS3 A;  2JWT A;  3KPH A;  1NH3 A;  3Q0U A;  2V7F A;  2HDD A;  3O60 A;  1U3E M;  3ABL H;  2QUF A;  3RH2 A;  4PZJ A;  2DCE A;  3SZP A;  2OCE A;  1BIB A;  1Z9C A;  2HDC A;  2F48 A;  2HKU A;  3S2D J;  1SFO J;  4M3E A;  2XAG A;  2E60 A;  4D5F A;  3LWJ A;  2VE8 A;  1TWG J;  5CVJ A;  2V1U A;  4F55 A;  1FTT A;  1JT0 A;  2JA2 A;  2VQG A;  5L3D A;  4PXI A;  1ZH5 A;  4U87 A;  4JX6 A;  2QEN A;  2OZ6 A;  1UZC A;  2LF7 A;  2VL8 A;  3CCJ I;  2QQB A;  4XKB A;  1TT0 A;  1Z77 A;  3VUQ A;  2FQ4 A;  4KT6 A;  2R3S A;  1KON A;  1IRZ A;  2LK2 A;  2QF7 A;  2W57 A;  3SFI A;  3HTI A;  3FXL A;  1ZKG A;  4CCL A;  3JRE A;  2M34 A;  3F8B A;  2FBI A;  4YFX F;  5FB2 A;  1V54 H;  3VSK A;  4ZYE A;  3WE3 A;  2B63 J;  3JSP A;  1VQK I;  4XNF A;  3J7A Y;  3M8F A;  2HVR A;  3RTR A;  1E17 A;  2R5Z B;  1XN7 A;  3N97 A;  3F8F A;  3DPJ A;  3I59 A;  3GFJ A;  5CVV A;  3KLN A;  1WJC A;  5M5W J;  3DTK A;  4YZE A;  1KU9 A;  4GXO A;  3HSE A;  4G8X A;  4XOT A;  3ZQC A;  3BTL A;  4EVI A;  2GBY A;  4FHT A;  3QPH A;  3O8G A;  4HOB A;  4BY1 J;  3BJA A;  4UDS A;  1TNS A;  3T0Y A;  5B66 C;  2KZV A;  1YIJ I;  1WI3 A;  4FTH A;  2L4M A;  2Y69 H;  3DKW A;  3I55 I;  5K7F A;  4A3I J;  1O4X A;  4F93 B;  1I27 A;  4HW0 A;  1UHW A;  1CF7 B;  3V4G A;  2ZME B;  2O8X A;  1G4D A;  1FYL A;  4N9H A;  3EET A;  2R7Q A;  3FWE A;  4DZP A;  3D1N I;  1NK2 P;  3K69 A;  3KYD B;  2Y31 A;  1LVA A;  2H1K A;  1ETQ A;  4OD5 A;  3KZI C;  4E7L A;  2B3W A;  1B9M A;  3BR3 A;  3DKX A;  3Q0W A;  1MD0 A;  4GRI A;  4N4O B;  2EWN A;  2K9N A;  3ZOB A;  1ODD A;  1JJ8 C;  2BV6 A;  5EZG A;  1YX5 A;  1QZZ A;  1F9N A;  2BVM A;  2R7R A;  3QAH A;  3QPT A;  5E20 A;  1AKH A;  5E3O A;  3RPU A;  1GUU A;  3NRV A;  3KP3 A;  2P6S A;  4CUG A;  2VT3 A;  3Q5F A;  5IYD J;  1T0F C;  3CC2 I;  1UAA A;  2C6Y A;  2ZJR F;  5B1B H;  1OYW A;  1DPR A;  4BXX J;  2R5Y A;  1R4M B;  3HYI A;  1FYK A;  2CUF A;  2P6T A;  2LG4 A;  2E35 A;  4D5C A;  3QRF F;  3G1M A;  4AU7 A;  2EFP A;  2M3A A;  1V5E A;  3PFI A;  1DP3 A;  1VQ8 I;  1WSU A;  2HEO A;  1D3Y A;  4KJZ A;  4Z2Y A;  5KVR A;  1G2H A;  2GXG A;  1X1A A;  1U0J A;  2XIG A;  2ZXI A;  2IS4 A;  1OCP A;  3JSJ A;  3CJN A;  1ZTR A;  1WCM J;  2JT1 A;  4DW6 A;  1WHU A;  2IA2 A;  3GFI A;  1GV5 A;  2NVX J;  2PG4 A;  2CQQ A;  4I01 A;  4B47 A;  4B43 A;  5E3N A;  1HOM A;  1K83 J;  2VBZ A;  5J8F A;  5EDN A;  1MMG A;  2VC1 A;  4M6X A;  3HOU J;  5E1Z B;  1AWC A;  3CMM A;  3J7Y J;  1O3S A;  1M1E B;  3OY9 A;  2FJI 1;  5DM6 F;  2MLK A;  3VWB A;  3E6C C;  4HF2 A;  2M7A A;  1T2K A;  1TTY A;  3HL2 A;  3P9T A;  2PN6 A;  4CYC B;  3CF5 F;  1JKO C;  2X6X A;  4UUT A;  1QO0 D;  5EJC A;  1IGN A;  3KKD A;  1JJ6 C;  4NHJ A;  3RQI A;  1PYV A;  1K79 A;  2A05 A;  2N8G A;  3O2P E;  3Q0V A;  4EJU A;  2Z2S B;  4IEJ A;  4U0V A;  1FJL A;  3C07 A;  4RB1 A;  4II3 A;  3KYC B;  2F4I A;  3LST A;  3CCY A;  4HV5 A;  4A5N A;  2W00 A;  3FXJ A;  5J6X A;  2FOW A;  4HQE A;  2KIF A;  3FXO A;  4EV0 A;  5LHH A;  1NG6 A;  1FMW A;  1ZRD A;  1J2X A;  2E7X A;  2IGM A;  3ISP A;  2NS8 A;  4IJA A;  2MH2 A;  4BJT A;  2QLZ A;  1JTY A;  1HW5 A;  1UEL B;  3I59 B;  1MBG A;  3DFG A;  4OWR B;  2ZNZ A;  2A6H F;  1U5T C;  1IN4 A;  3R60 A;  2HYG D;  4ABZ A;  4ZYD A;  2CUJ A;  1D8K A;  1DGW Y;  2REK A;  5EF6 A;  3BP8 A;  2LY1 A;  1RUN A;  1D1C A;  3SEZ A;  3PQK A;  3IHU A;  4GO1 A;  3FRQ A;  1CQT A;  2HYJ A;  1HXD A;  3MCZ A;  4Z6Y A;  3CES A;  2VC0 A;  3K4N A;  4HNU A;  5F0H A;  4MFE A;  2DMP A;  2X9D A;  3OR1 C;  2PJR A;  3UNG C;  2VUM J;  2HNH A;  3OIP A;  4JOM A;  1SD7 A;  1LEB A;  3BG7 A;  3RKX A;  4FQG A;  1IV6 A;  2NNY A;  2DMU A;  1RR7 A;  5B5E C;  2RRE A;  2LYC A;  3LSH A;  2ISY A;  2DT5 A;  3VTI A;  2CQK A;  1R36 A;  1G3T A;  1FIP A;  1J75 A;  4CCK A;  3IH4 A;  2HKX A;  4GYI A;  4F7Z A;  2RQP A;  3JTG A;  3LWF A;  3LSK A;  1R4N B;  2L01 A;  1Y6I A;  4M72 A;  2LRE A;  3JRF A;  2F4O B;  2DW4 A;  4FE7 A;  2UXX A;  3QWL A;  3GEZ A;  1AKH B;  2D1V A;  1MBK A;  2B0L A;  3TOB A;  5IP9 J;  2QWT A;  3GFM A;  4E7I A;  3JRD A;  2CV1 A;  4RAF A;  2F5C A;  3JR9 A;  1JE8 A;  3MKZ A;  2RN7 A;  3WU2 C;  2R5Y B;  4MIM A;  1D0X A;  1ZG5 A;  3PNT A;  4XID A;  1S3J A;  1LFB A;  2DG8 A;  3IAS 2;  4GYG A;  1IN8 A;  1JGS A;  2FRH A;  2K02 A;  4WF2 A;  4Y17 A;  2ZCX A;  4BJ5 C;  1BBY A;  5FGL A;  3PO3 J;  2VAS A;  2JA7 J;  2X1D A;  1H9T A;  1GDT A;  1HW2 A;  5F1R A;  4HAM A;  2M8G X;  2NYX A;  3F9K A;  4BE0 A;  1AA7 A;  1A6Q A;  2WAE A;  1SMY F;  2E1N A;  3RQ4 A;  3HDD A;  4LG3 A;  2XB0 X;  4B4C A;  1TL8 A;  3WTY C;  4QWQ A;  2QA4 I;  2ETH A;  2VPR A;  2IW5 A;  4ZC3 A;  3VEP A;  1ZRE A;  3NI7 A;  3OYH A;  1SFK A;  1U8R A;  3W6K B;  2M8E A;  1H88 C;  4HA8 A;  3CC4 I;  4P9F A;  5D5V B;  2OF7 A;  2IA1 A;  2A5W A;  1W1W E;  3JRC A;  2RVC A;  3E7L A;  4I09 A;  1KGS A;  1S5L C;  1A31 A;  3VW1 A;  2J5O A;  3CCE I;  3BG9 A;  1VTN C;  1IV8 A;  3REO A;  2Y9Z A;  1Z6R A;  1ZG3 A;  1QVT A;  2K27 A;  5DEQ A;  4X0G A;  3CCM I;  2QKO A;  4AYB N;  2F4M B;  4KFC A;  3B6C A;  1T33 A;  1IC8 A;  3CP2 A;  2ZJ2 A;  2HVS A;  2VOD A;  5KNL A;  3HOX J;  3IUV A;  1U8B A;  3GTO J;  2DBB A;  5D1R A;  1R49 A;  4RDU A;  1VQL I;  3WU0 A;  3GF2 A;  3TW6 A;  2FOK A;  2CMP A;  2FJ1 A;  5FD6 A;  1LKX A;  2ME0 A;  4EJV A;  4ME9 A;  1W7P D;  1Y0N A;  1OKR A;  3ON2 A;  1BM9 A;  3K2A A;  2PLY A;  2EPF A;  2DLL A;  4BAY A;  2JVG A;  2Z1D A;  1X4P A;  3U1K A;  2R7U A;  1B72 A;  5HNF A;  5FHP A;  1REP C;  4U9L A;  3V6G A;  3DBH B;  3BJ6 A;  4A6D A;  2BYV E;  5JVG F;  4S05 A;  1X4O A;  1SAU A;  3OOU A;  2UXO A;  2IP2 A;  4L0Y B;  1VQN I;  1Y1V J;  2PFV A;  4BYY A;  1FBU A;  3KET A;  3I71 A;  4OOI A;  2WGB A;  1NHA A;  3H1C A;  3B81 A;  2E1M B;  1MH3 A;  3HRM A;  3FIS A;  2X6O A;  5LGU A;  3I5U A;  2PJR B;  4J19 A;  2R7O A;  3JRG A;  3JAM K;  2LY2 A;  1O3R A;  3BWG A;  1ZK8 A;  2FBK A;  2X6W A;  2RC4 A;  4LG0 A;  2W84 A;  1MKM A;  1CGP A;  5B3S H;  3WHB A;  5HLH A;  2YX4 A;  1HDD C;  3LHQ A;  1S8N A;  3IH2 A;  4C9Y A;  3VPR A;  1OPC A;  4ZH4 F;  5D4R A;  2VOP A;  3IRR A;  1E3O C;  3S3M A;  2L4A A;  2HI3 A;  2MAB A;  3LA7 A;  1SFE A;  5CXI A;  2NVU B;  2K4B A;  1XX5 A;  2CWE A;  3WTZ A;  3QPL A;  5FKK A;  4NN1 A;  2H94 A;  3CLQ A;  4RBO A;  2XPV A;  5K5Q A;  1O7F A;  5HAW A;  1X1D A;  4ZDO A;  3F1B A;  2DJI A;  2DA2 A;  3W2V A;  1NG7 A;  3BG5 A;  1OQY A;  1E3H A; 
#chains in the Genus database with same CATH homology
 2DA7 A;  2ECC A;  2HQ5 A;  4NDL A;  5D18 A;  1IG7 A;  5IPA A;  3HOV J;  4BKX A;  3QPS A;  2EZK A;  1RKT A;  2JA5 J;  2DMQ A;  3S17 J;  2R0Q C;  4A93 J;  5F04 A;  1Q1V A;  2FX0 A;  3A01 B;  3PAS A;  2TRT A;  3GTK J;  4AC6 A;  2PMZ N;  3A03 A;  2QCO A;  4AF5 A;  4C3H J;  1Z0X A;  3W6V A;  1EF4 A;  4GCL A;  4A3J J;  2IU5 A;  3V78 A;  4A3L J;  2FBQ A;  2VI6 A;  3HB9 A;  3RZO J;  5CW8 A;  1I3Q J;  4W1U A;  5FLM J;  1IJW C;  3CMY A;  1TWA J;  3LJL A;  1ZQ3 P;  3GTP J;  2M0C A;  5CXG A;  1RPW A;  2JMW A;  5DTD A;  3SJM A;  2G3B A;  3NNR A;  2L0K A;  4A3F J;  3G1L A;  4BBR J;  2QIB A;  1JUM A;  1VF9 A;  4G12 A;  2DA6 A;  2ME6 A;  1HF0 A;  2DA5 A;  1BL0 A;  1RET A;  3MNL A;  4BBS J;  1X58 A;  3BR5 A;  2DMT A;  3BHQ A;  3ZQL A;  3NPI A;  2YS9 A;  2JWT A;  3Q0U A;  2HDD A;  1ENH A;  3O60 A;  3BR0 A;  4C3I J;  2QTQ A;  1W0T A;  2RAS A;  4NEL A;  1ETK A;  4V2G A;  3RH2 A;  4X1E A;  5FJ8 J;  1YRN A;  3I4N J;  2DA3 A;  2D5V A;  3COL A;  1WH5 A;  2NP5 A;  3CRJ A;  2FD5 A;  2RHA A;  1B8I A;  2HKU A;  2ID6 A;  3S2D J;  1ETX A;  4DYR A;  1SFO J;  2GM4 A;  4M3E A;  1B72 B;  1DU6 A;  4D5F A;  3LWJ A;  5E3L A;  1TWG J;  2V57 A;  5EGO B;  2XDN A;  3HBL A;  1FTT A;  1JT0 A;  2GLO A;  4PXI A;  3PM1 A;  3HOY J;  2E19 A;  2M2E A;  2DJN A;  4JX6 A;  2GUH A;  3QQA A;  2AHQ A;  3HE0 A;  2DTZ A;  3JRA A;  1Z77 A;  3TP3 A;  3VUQ A;  2FQ4 A;  2K9Q A;  2NVQ J;  1IRZ A;  2LK2 A;  2QF7 A;  3HTI A;  3SFI A;  1X2M A;  1ZKG A;  3JRE A;  3HKZ N;  3T6N A;  2M34 A;  4HKU A;  5DAJ A;  3ANP A;  2B63 J;  3HGG A;  4EEF G;  3H3V K;  3BNI A;  1PUF B;  1BW6 A;  3OIO A;  1LFU P;  3E7Q A;  2IEK A;  2LLK A;  3S1Q J;  2R5Z B;  2JJ7 A;  1HLV A;  2WB1 N;  2R93 J;  3DPJ A;  3UKG A;  4FE4 A;  2W53 A;  2KDZ A;  5M5W J;  3GBG A;  3EGQ A;  4YZE A;  3PO2 J;  3ZQC A;  1P7J A;  4MXM A;  2DMN A;  3BTL A;  5K58 A;  3KZ9 A;  2G7G A;  2GBY A;  5FLV A;  5JLX A;  3TW7 A;  3O8G A;  5EZH A;  4BY1 J;  1HDP A;  4UDS A;  4CGR A;  2VKV A;  3KKC A;  5GPC A;  3BQY A;  1WI3 A;  4FTH A;  1VFC A;  2XB5 A;  1OJL A;  3RKQ A;  1X2N A;  5K7F A;  1JTX A;  1WGX A;  4A3I J;  1O4X A;  2Q24 A;  5HBU A;  4B1R A;  4DYC A;  5E3M A;  4A3M J;  4JP0 A;  3BJB A;  4IHW A;  2LD5 A;  2HOA A;  2UXI A;  5FKO A;  4DZP A;  3G1O A;  2WUI A;  3D1N I;  1NK2 P;  1FIA A;  5H9T A;  2Y31 A;  1BW5 A;  2H1K A;  1JKP C;  1ETQ A;  3BTC A;  3HGY A;  3BT9 A;  5J3L A;  4D7N A;  2NX4 A;  1TWC J;  3Q3S A;  3BR3 A;  3Q0W A;  4JL3 A;  1I50 J;  2QOP A;  2JN6 A;  3VW0 A;  3VW2 A;  5F0F A;  4IHX A;  2R92 J;  2ECB A;  2DG7 A;  2K9N A;  3ZOB A;  1JJ8 C;  5HOD A;  5EZG A;  5C4J J;  5EG0 A;  5M5X J;  1U78 A;  1AKH A;  3HOZ J;  5E3O A;  2DA1 A;  2EZL A;  1GUU A;  2RAE A;  1T56 A;  1WPK A;  2YVE A;  3VVZ A;  3JRI A;  5IYD J;  3NAU A;  3VOX A;  2NP3 A;  4BXX J;  2CUE A;  2R5Y A;  2CUF A;  2MG4 A;  4D5C A;  2OPT A;  3VVX A;  3G1M A;  4I6Z A;  3KNW A;  1ETY A;  2Y2Z A;  5BNG A;  3ZQG A;  3HEF A;  1G2H A;  5D19 A;  4A3G J;  3GTL J;  1OCP A;  5J1R A;  3JSJ A;  2NVY J;  2JA8 J;  1ZTR A;  2R7Z J;  4D7M A;  3FIW A;  1WCM J;  3HIM A;  4DW6 A;  4UUS A;  3BRU A;  3FKI J;  1JGG A;  1GV5 A;  5FKN A;  2NVX J;  2G0E A;  9ANT A;  4A69 C;  2PBX A;  2CQQ A;  4A3B J;  3FK6 A;  5E3N A;  2O9L A;  1K83 J;  5EYR A;  1HOM A;  4XRS A;  5K7H A;  1UHS A;  5EDN A;  4M6V A;  2HOT A;  1VND A;  1YRN B;  3HOU J;  4IHY A;  1UI6 A;  2ZOZ A;  3VP5 A;  2MW8 A;  3P9T A;  4CYC B;  2YVH A;  3GTG J;  1JKO C;  4UUT A;  2IBD A;  1IGN A;  3KKD A;  2EBI A;  3EUP A;  3AQS A;  1JJ6 C;  3RQI A;  4ICH A;  2NS7 A;  2TCT A;  3Q0V A;  2N8G A;  2WV1 A;  4XRM A;  1NK3 P;  3M3Y J;  3CJD A;  3G56 A;  5EFY A;  3BR2 A;  4IEJ A;  1FJL A;  3C07 A;  4MK6 A;  2W48 A;  4GCK A;  3NAR A;  1OFC X;  2M9H A;  4QSH A;  4ACI A;  1JT6 A;  3CCY A;  1SGM A;  2XSD C;  5F1J A;  4MO7 A;  5M3M J;  1ZR4 A;  2CJJ A;  1FEX A;  2CRG A;  3VIB A;  2Y30 A;  5IP7 J;  3TED A;  2EH3 A;  3S1M J;  1TWF J;  5IYB J;  1MSE C;  2NS8 A;  1UG2 A;  3GTM J;  1P7I A;  2GFN A;  2UXP A;  2P81 A;  3LOC A;  1JTY A;  4M3B A;  3LSG A;  2EZI A;  1TWH J;  1MBG A;  2Y9Y A;  1GT0 C;  4ABZ A;  2EZH A;  4BY7 J;  2REK A;  1XS9 A;  2YUS A;  5EF6 A;  3LSR A;  2UXU A;  3FRQ A;  1CQT A;  3H0G J;  2HYJ A;  1H89 C;  4KWA A;  4L5E A;  1MH4 A;  2OER A;  2EQR A;  5F0H A;  4MFE A;  2E2I J;  2DMP A;  2X9D A;  5IOY A;  2ID3 A;  2F07 A;  3OSF A;  2VUM J;  1SAN A;  2NOG A;  3JRH A;  2E2J J;  2CQX A;  4DZJ A;  1POG A;  5M5Y J;  1IV6 A;  3LSP A;  5IYC J;  2DMU A;  1RR7 A;  3HM5 A;  2LP0 A;  4QIW N;  3ZQH A;  2R5Z A;  3TP0 A;  2GEN A;  4MFD A;  1S7E A;  1FIP A;  3IH4 A;  3HTA A;  2O7O A;  2Y0S N;  1ITY A;  2JK3 A;  3DEW A;  2HYT A;  3OSG A;  3GEU A;  2LVS A;  3JRF A;  1JKR C;  2WAQ N;  5F27 A;  4FE7 A;  2G7L A;  4MLO A;  3IV5 A;  5EG0 B;  4S0H B;  2XGD A;  4GFK A;  3ZQF A;  1AKH B;  4XK4 A;  1MBK A;  1MSF C;  3VOK A;  1RKW A;  4FCY A;  2VKE A;  4A3E J;  1LE8 A;  5IP9 J;  2E2H J;  2QWT A;  3JRD A;  2AO9 A;  4JX5 A;  4JNN A;  2ELK A;  5J1Y A;  3JR9 A;  2LR8 A;  2R5Y B;  4MIM A;  4XID A;  3HTH A;  4AC0 A;  1LFB A;  2DG8 A;  2G7S A;  2UXH A;  2ZCX A;  1GV2 A;  5FGL A;  4X6A J;  3A02 A;  1ORK A;  3PO3 J;  5C44 J;  1U9N A;  2D6Y A;  2MGQ A;  4A3K J;  1GDT A;  1OCT C;  2JA7 J;  2ZCM A;  3CWR A;  1QPI A;  4QTR A;  2XRL A;  2XGE A;  4B3A A;  3HOW J;  2M8G X;  5GPA A;  3A01 A;  4FIS A;  3AQT A;  1MBE A;  3LNQ A;  1W0U A;  3HDD A;  1U9O A;  5AQC A;  4JYK A;  1UMQ A;  2XB0 X;  4B4C A;  4UUS B;  1ZR2 A;  5DS9 A;  2VPR A;  4Y52 J;  3S2H J;  4M3F A;  3NI7 A;  3M4O J;  2XPU A;  4W97 A;  3GZI A;  1AHD P;  2PZ9 A;  3CDL A;  1APL C;  1JKQ C;  5K7Z A;  3LSJ A;  1H88 C;  1XG1 A;  2LFB A;  2OF7 A;  3HTJ A;  3JRC A;  3S5R A;  3GTJ J;  3WHC A;  1NTC A;  3IH3 A;  1XC5 A;  1IDY A;  3E7L A;  1A6I A;  1B8I B;  3VW1 A;  1UI5 A;  1ETW A;  3BG9 A;  2Y9Z A;  1QVT A;  4M3D A;  4I76 A;  2LKX A;  4XRS G;  2QKO A;  2IAI A;  4AYB N;  3ON4 A;  1WH7 A;  2XGC A;  2L7Z A;  1BJZ A;  5J1U A;  3B6C A;  3JRB A;  1T33 A;  2K9S A;  1IC8 A;  3BCG A;  2XPW A;  2CU7 A;  2ZOY A;  3BG3 A;  3CQZ J;  3HOX J;  3IUV A;  1U8B A;  3GTO J;  3RZD J;  3VVY A;  5D1R A;  4RDU A;  5F08 A;  2E1O A;  5JLW A;  3BR6 A;  3TW6 A;  1RES A;  3BTJ A;  2FJ1 A;  5M3F J;  2X48 A;  3MVP A;  2ME0 A;  4ME9 A;  3QKX A;  2HOS A;  3ON2 A;  2L7F P;  4GFL A;  1JUP A;  3K2A A;  4DYQ A;  3RD3 A;  1F36 A;  4CYC A;  4Y7N J;  5IOZ A;  3BQZ A;  1DU0 A;  2YU9 J;  3PPB A;  1IUF A;  1B72 A;  5FHP A;  3MN2 A;  3V6G A;  1VI0 A;  4HNV A;  3S15 J;  2LY9 A;  2HXO A;  3FK7 A;  3OOU A;  5EGO A;  2UXO A;  5C4Y A;  5FMP A;  1QVU A;  1Y1V J;  3O8H A;  1MBF A;  2WGB A;  5F0C A;  3B81 A;  4C3J J;  1MH3 A;  1GVD A;  4LOC A;  3FIS A;  3ANG A;  4JX4 A;  1A5J A;  3BR1 A;  3NXC A;  2X6O A;  4JKZ A;  5HSZ A;  1HCR A;  4AUX A;  1ETO A;  4L62 A;  4A3C J;  2DN0 A;  4J19 A;  4XIC A;  3JRG A;  3BTI A;  1ZK8 A;  5IP6 A;  4GFB A;  1I6H J;  2I10 A;  4GCT A;  1MNM C;  1K61 A;  3L1P A;  3WHB A;  4V2F A;  1HDD C;  1PUF A;  3I4M J;  3LHQ A;  2ZB9 A;  3IH2 A;  1ETV A;  1JUS A;  1H8A C;  2L7M P;  2K40 A;  5GP9 A;  3VPR A;  2NVT J;  3B6A A;  5FKL A;  3S1N J;  1QRY A;  2MSY A;  3ZQI A;  1E3O C;  3C2B A;  2JA6 J;  1Y1W J;  1D5Y A;  1TC3 C;  2ZCN A;  4IHV A;  2HI3 A;  2LTP A;  1AU7 A;  3DCF A;  1R9T J;  3F0C A;  1BA5 A;  1IDZ A;  5CXI A;  1MBJ A;  2COB A;  3MKL A;  4A3D J;  2O7T A;  3QPL A;  3S14 J;  5FKK A;  3S16 J;  4NN1 A;  1MBH A;  1ZGW A;  3QBM A;  4RBO A;  4C2M J;  3S1R J;  2KT0 A;  2XPV A;  3NRG A;  3GTQ J;  5C3E J;  2OI8 A;  5HAW A;  5EEA A;  3SDG A;  1LE8 B;  3F1B A;  3G7R A;  2DA2 A;  5C4X J;  1FTZ A;  3K7A J;  2HXI A;  4M3G A;  2H8R A;  2O8K A;  5FKM A;  1F43 A;  3BG5 A;  2L9R A;  2DA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...