3BRTB

Nemo/ikk association domain structure
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
61
structure length
61
Chain Sequence
ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a NEMO/IKK-Associating Domain Reveals Architecture of the Interaction Site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transcription
molecule keywords Inhibitor of nuclear factor kappa-B kinase subunit beta,Inhi
total genus 30
structure length 61
sequence length 61
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11577 NEMO NF-kappa-B essential modulator NEMO
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.390 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3brtB00
2YKOA 3BRTB 1JOCA 2YKPA 3EQ2A 2YKQA 3L4FA 2W6BA 3BRVB 3CL3D
chains in the Genus database with same CATH superfamily
1MV8A 1Q2NA 2WVRA 2R5DA 4OH8B 1HUCA 2NPSC 3CXHI 1KZUB 4UB6H 4WB4A 1OZHA 4WY4A 1S5LE 1NAYA 1T3UA 3D6ZA 2MJZA 1BGYD 1RQVA 1WT6A 4H0LB 4IFFA 4H0LC 1H88A 2C0XA 1T3JA 1UIXA 4H44D 3KYQA 1VL2A 2DW3A 4N6JA 1A02J 1QVFO 3OJAB 4U3FD 1OMIA 2I8DA 4C7RA 2QJYB 2OARA 2W90A 2E74B 3RBZA 3GF3A 5KLVK 3L70D 3A5TA 1HGZA 3TK1A 1NTZG 4I1LA 1H0TA 1BDDA 3B4SA 3BRTB 1LJ2A 1OXZA 3U1AA 2GM4A 3SFDC 4ASVA 1S9KE 1FOSE 1OIPA 2D2CC 2OQQA 1T2KD 3RK3B 4D6TE 2RMZA 1X0TA 1L0NK 4KHXA 3A7OA 3TSIA 1RF1A 5APTA 1FOSF 4LLHA 3H1IE 1E5WA 1SQBJ 1SQPG 3L73G 1JY3P 1BE3G 3M9HA 1JY3N 1BCCG 4NPDA 1YI2P 2IX7C 2Y0DA 4JF7A 5E79E 3H1KE 3VYIA 2WWWA 4BRYA 1SQXG 2M5AA 2ZVNB 1GL2B 2KOGA 2KUBA 1LT9A 3CWBJ 4H13D 1NHLA 2NZ2A 1X22A 3CCEP 4KJMA 1J1DC 2WT7B 1RE3C 1J1DB 4IL6X 2FYUJ 4BWNA 1Y47A 3A2AA 2WSEH 1VQOP 2XNDH 1K04A 1IZNB 5APXA 3SWFA 1RQUA 1SQVK 1L2PA 3G4SP 1P84H 2K88A 4D6TG 1EXIA 2WPQA 4KT0J 2YNYA 1N7SD 1RF1B 3IFMA 1LT9C 2PAJA 3V2NA 3L72J 1PGQA 3BCCG 3L71E 2FYNB 1VQMP 1PIXA 2ZYDA 2N1TB 2J5UA 1R5LA 2P2UA 1AVYA 1FDIA 2QSIA 2HR3A 2WSCJ 3PHLA 1J2JB 1HH0A 1ZW0A 2IBZD 4RESB 3WU2E 3CC2P 1BGYJ 3HTKB 2IYPA 3CX5E 3G9RA 1VQ4P 5BVZA 3P8CE 1QX8A 3II6A 1VQ6P 1KILB 3Q3DA 1SQVE 1HF9A 2LXBA 3E1IA 3CX5D 3B5ND 3FXDA 4TLFA 3V6IA 4UB6E 1GW3A 1GW4A 1U57A 1YBKA 1K9MQ 3O6QB 1R5SA 3MUDA 3PRJA 4U3FE 1YQ4C 1GK4A 1NTZD 2ZJSE 3F89A 4R4LA 5KTBA 1P84E 2B87B 2OYIA 3AEGC 3D71A 2QEXP 1RE4A 5CBNA 1N73B 4U7JA 1EQ7A 1DIPA 1FBMA 2I1KA 2KS1A 1HJ0A 3BATA 4PV1D 3CPWO 4PJ0E 2YXQB 1PV3A 1PGJA 1OVRA 1VQLP 2FFDC 3KPEA 4LGDE 2XDJA 1FS0E 1URQB 3R4YA 1GDTA 2Q1KA 4WWIA 1BCCD 2H43A 2KSEA 1Q86Q 3L35A 1EDIA 3H32A 4OGQC 1HWTC 3IF4A 1L0NE 1KQLA 1M7LA 3H1JD 4OGQB 1ZRTE 3C8VA 1AFOA 3S9OA 1KFNA 3NMDA 2FYUK 3BCCJ 2P67A 4C46A 5K5GB 1IO4A 1JUNA 2W6JH 3TGUJ 3AEEC 3LW5J 5AVUB 3GLMA 3N7NA 1IFJA 1L4AD 3WUTA 5KJ7C 4GT1A 3K5BA 1FE6A 1MUUA 2N9BA 1LTGC 2P1JA 4O9BA 3FWNA 5KLVE 3AE7C 1ZR4A 1JY2N 1KB9D 3T97B 1KB9I 1GU5A 2HFED 5M1BA 3VN0A 1VQ5P 1N7LA 3H1LD 1SQPD 2FYZA 3C9IA 4L75A 2RN0A 2PRRA 5AW6B 4AQRD 4RJTA 1Z56A 1DEEG 2YMKA 2ZXEB 1N8RQ 2QM7A 1DH3A 1L4AA 2BEZF 2A06E 1NTMG 1Q90D 2PFXA 1R8EA 3A0HE 1FDOA 1ZV8A 1JY3O 2HLOA 2A45H 2H88C 1FZAA 3CLQA 3H1KD 4OVNF 3CCMP 2BEQD 3V2PA 3L4FA 4H13B 3CCRP 1RF1C 3AE8C 1KYOD 1IFMA 2QIWA 3AECC 4HKZH 1SQPJ 1JTHA 1SQBG 1N86A 2KNCB 1NU1E 3P7KA 2XZRA 4U3FG 5KLVJ 3MHVA 2YKQA 3KZIE 5AW0B 1EXJA 2M5AB 1XTGB 1Y9BA 2ZVOB 2LR2A 4I2LC 1SQQG 4L74A 3V4WA 2WPSA 5KLIB 3I55P 2OTJP 1YTZI 1BSHA 4L73A 4H13C 4HYTB 2W8ZA 2IPPA 1BDCA 5EFWB 1L4AC 2V7QJ 2BCCG 1L0LG 3L74G 3L70E 3HE5B 4BXLA 3M9BA 2KB7P 2E74D 5TISE 4RKUJ 3RL0B 2Q7CA 4WY4D 1VQ7P 1DX7A 1SFCC 1LTTC 2W83C 3H1HJ 1PPJE 4B86A 1AJYA 3T97A 3RL0g 1A02F 1VF5C 3D6YA 3L73E 3RK3D 4I7ZB 1KN7A 3ITKA 4UB8H 4EOTA 4PV1C 2WTYA 4PD4E 4PJ0H 3GHGC 4PD4H 3TGUD 5CJ4A 3H1HE 1M1JC 3LW5H 3CWBD 5AVTB 3BASA 5DJTB 5BU5A 1FZGA 3VTPC 1Q7YQ 1OWAA 4XE5B 1QVGO 2AEMA 2OYOA 3VP8A 5CCHC 3MUDC 1NYHA 3G3ZA 1LWUC 2KIKA 3B5NC 1HJBA 4AUWA 1OX3A 3I56P 1QEXA 1RY3A 2AEFA 2FYUD 2KSJA 5CJ0A 3H6PA 3TF5A 2HPCB 1GMJA 1SP4A 1LT9B 1RE4C 2KLUA 3L37A 2ZYGA 3QH9A 4Y99C 1NWQA 1FZBA 3OA7A 2JWDA 1J1EC 4D6TD 3MIWA 2IDBA 2O01H 3L75J 1NU1G 5CBOA 2HG5D 1PGPA 2JWAA 1LWUB 3Q2YA 5APWA 2N1TA 3O6QA 3RL0D 1ZP0C 3P8CD 2M3BA 1G2CA 5H2FE 2L5GB 1H8AA 3SSUA 2P58A 3L70J 3L73D 3RK3E 3CCLP 5B66E 1KMIZ 1EZVG 5B66H 1OW6A 2E5TA 1EZVI 2AEJA 2J59M 4GODA 4C7NB 2O1KA 1QL2A 4GKGA 1FDMA 3USSA 1AV1A 4DOJA 1JB0J 1CSBA 3A0HH 2BASA 2CK3H 3L75D 2UWJE 1SQVG 2IZ1A 5BU8B 2ZT9C 2O01N 3CWBE 4YXWH 2IBZG 1PPJG 2R32A 4JBZA 1GL2D 3CCQP 1JY2O 1VF5B 1SQPE 2Z5IA 1GZLA 2GUVA 3MGNA 2H7HA 1KB9E 1KB9H 2MKVA 2KS1B 2YXRB 3FWLA 3RK2C 2WSFJ 5AW1B 3RK2B 4EYYQ 1N73A 3KHUA 1NTKG 2VRSA 3H25A 5GTHH 1FZFA 1JM0A 2JKVA 2M3EA 1K05A 1NGMB 1KD1Q 2RKLA 3H1IJ 2OYIC 1JNMA 1PP9G 4H44B 1BGYG 4DJGA 2K9YA 3H1HG 3CMEP 3IR9A 1SFCD 3N4XA 2WITA 4I6MC 2A45G 1NJIQ 4WBAA 5AW2B 3IAOA 5KKZB 3CX5I 1IFNA 2C9NY 3HUSB 1ZN5A 2WSCH 3L75E 1CZQA 5DJUB 5TJHA 2ZAEB 1KQGB 2JJLA 3L72D 3M0AA 3TGUE 4Z1MH 2E76D 3P8MC 5AW8B 4NPFX 5H2FH 2QJKB 2WPRA 1IFDA 2WQYC 3M06A 2G3AA 3OAKA 3RGUA 2YMYA 1RH5B 3HUSC 1NU1K 3U59A 3WMM0 2Q5UA 5AVRB 4JPZB 4YPCA 1RF0A 3ABVC 3CC7P 3PLNA 4H0LD 4N3YB 3SWKA 2QA4P 1JCCA 2Y9ZA 3Q5SA 3M9QA 5KAFE 5KAIH 3CCSP 2QVAA 1URQA 2A06G 1H89A 3D70A 1GU4A 2AXCA 4OWFA 3WUUA 1L0ND 2WT7A 2NPSA 3L73J 4PD4D 2IBZE 2LKMA 2NRGA 1USDA 1JTHB 3ZDMA 2HPCA 1UIIA 3V4QA 1HVVA 3L72E 1KQSO 5KLVD 2C9LY 1SQVJ 1SQPK 2KP8A 2ZT9B 3GW6A 3MZWB 4N78E 2Q3IA 3R2PA 1EDJA 1FC2C 1URQC 3V5BA 1T6AA 2KXPB 3Q5RA 2WSEJ 3JSVC 5CCGA 1L4AB 1S5LX 1SS1A 2D2CB 3BRVB 2FYUE 5KJ7A 1YTZT 3H1JJ 2WZ7A 3AEAC 4GIFA 4IL6E 1X9VA 4EIJA 4IL6H 1BCCE 2Y0EA 2P7JA 4IFMA 2OYIB 1CI6B 2A06D 1PP9J 2ITAA 1JO5A 1NU1J 4L76A 2ZYAA 3H1IG 1M56D 1KYOI 1P84I 4CPGA 3BVHA 1KILD 1IK9A 3PTZA 1SFCA 3MP7B 3RL0C 3B5NB 1URQD 3KZIH 1XTCC 1WRGA 5GTHE 1NTMK 4TT3H 2FXOA 2PP6A 2QM8A 2QRXA 1NAFA 2YIUC 3CXHE 1USEA 3HD7B 1E79H 3HD7C 4HJGH 1L0LK 2CPSA 2QJPC 1Q81Q 3KDPB 4EI2A 2OTLP 1NTZK 1SQXK 2KYVA 5CMZA 1M90Q 4QMAA 4LC1A 1SQBK 3CL3D 2FFDA 3H1KJ 2K9JB 3MTUE 1YJWP 1GL2A 1FZCC 2OYHB 5B5EE 1JMMA 3L71G 1LTIC 1KTMA 1AA0A 1H0TB 1CW5A 3M0DA 3AE1C 3VOPA 2P10A 4OGQD 4EDFA 1VQ8P 1ZR2A 1W2BO 2G8YA 4K3AA 3BCCE 4D6TJ 1SQQE 1L0NJ 3VMAA 2E42A 1NTKK 2QG4A 1VQNP 4A7PA 2YKOA 3JC22 1PGOA 2N1TD 1EC5A 1VDFA 1ZRTD 2M0BA 1Q82Q 2KNCA 3CXHH 3GG2A 1M57D 1FZCA 4N78D 1NKZB 1EDKA 3PP5A 5AVXB 1KORA 3E1RA 2O1JA 5KAIE 5KAFH 3I5CA 4WVZA 4BRYB 3FX0A 2E74C 1SQVD 3A3YB 3H1HD 1N2DC 2XU6A 4ZKUA 1W2EA 1VQPP 1SVFA 3PH0A 1S72P 1VQKP 3F5HA 1RE3A 3CWBG 4U3FJ 1YQ3C 2K37A 2PGDA 3H1LE 1KILA 3SFEC 2XV5A 1NTKD 1SQXJ 3HRNA 3GHGA 1IK7A 3L71D 4RO0A 1IFPA 2JO1A 3C1LA 2SPZA 5AVWB 1MZ9A 1BSNA 3NFQA 1BE3J 2Q6QA 3HE4A 1LWUA 1PP9D 3GF7A 2OGUA 1PFIA 1PPJD 1NTMJ 1JEKA 2AXTH 2QJPB 1M8OB 2XNXA 3EQ2A 3H1ID 5AW7B 1S5LH 4PV1B 1JMBA 2I1JA 1BGYE 4MN4C 1IC2A 4HH2A 5TISH 1EDLA 4PD4I 1DD3A 1LTBC 1KQFB 3TNUA 2KZIA 3AE4C 1SQBD 2E75B 1Y8AA 1L0LJ 1NTKJ 1FJKA 1SQXD 1T8ZA 3S1KA 2JR8A 3L71J 2W6BA 4AYCA 3CCJP 1K73Q 3CC4P 1EZVD 4GOEA 3LIDA 5C39A 5AW5B 3Q5PA 2YKPA 1YHQP 1KYOH 1LTSC 1D7MA 1N7SB 2N1TC 4UB8E 1NO4A 1NTMD 2HODB 2Q3EA 2QE7H 2LXCB 3B8EB 1ZLLA 3NXSA 4W7YA 5APUA 3TGUG 5GTIE 5KLVG 2Q9IA 2KZJA 2E76C 2FXPA 2IYOA 2O3JA 3AEFC 3AE3C 1KV4A 1YITP 4DZOA 2K3RA 1LP1B 3QWOC 4C7NA 1HGVA 4IFDK 3L36A 1FZEA 1ZXGA 4M3LA 2M8RA 1J1EB 2N9YB 1S1CX 3FGAD 5APSA 2QJYC 3S4RA 2KLVA 2L91A 2Z4EA 2YO2A 2FXMA 5CCGD 4W80A 3NTNA 2J58A 3AE6C 1MFTA 1S2EA 5AVQB 4W7ZA 1N73C 3CCUP 4HB1A 1SQBE 3B5NA 1X8YA 1NTZE 2RH0A 2WMMA 3H1LG 3VMZA 1JOCA 2A45I 2H89C 1L0LE 4DCKA 1PL5A 1S4XA 2R3SA 3JCUH 3JCUE 2B88A 2IFNA 4I7ZC 3UIAA 3U1CA 1KILC 3AE5C 5APVA 3RK3C 2BCCE 4JYBA 3W68A 1MFZA 1VF5D 2JEEA 1LTJB 1BE3E 2V4HA 3EWKA 3VMYA 1FAVA 2YO3A 2B87A 4XFJA 3RBXA 2BCCD 2HODA 3KXDA 2WSSH 3P32A 5CCGC 1BE3D 4WY4C 4YTPC 4GDOA 3L75G 4JQ0D 3W67A 2W6AA 1OVVA 2WSFH 2NPSD 2Y9YA 5AW3B 2K1AA 2IBZI 1LNQA 1NU1D 1OFCX 1SQQD 1GK6A 2FY8A 3A0BH 1RHZB 3AE2C 3CI9A 1W5CE 3CXHD 3OW2O 3CX5H 5KKZC 3H1JG 1VPCA 4IOIH 2YIUB 3HTKA 1QGKB 3TDKA 3TNUB 1IJDB 3VP9A 4ASWA 3FXEA 1AQTA 1U7JA 1K8AQ 3AEDC 2BCCJ 1N7SC 1DD4A 2AXTE 1ZOYC 5CCHA 3EFFK 2QJKC 2R5BA 2HYNA 3GMAA 2E5YA 2IFMA 1LP1A 1SQQJ 3M91A 5CCHD 5APQA 5B5EH 2E76B 3G6EP 1YIJP 2OYHC 1OVUA 1NKNA 1TU3F 5AVZB 5CHXA 4ZNCA 1M1JB 2W27A 4R4MA 3H32B 5AVSB 5L8RJ 2IZ0A 1KYOE 3B71A 1YYCA 1LTAC 1U7MA 2KK7A 3IN6A 3L72G 3A0BE 2Z5HA 1SLQA 3Q1MA 2CPBA 1ZMEC 1KILE 1LTJA 2XKMA 3LIEA 3M0DC 5AW4B 3MD0A 1S3JA 1AQ5A 1M1KQ 3L74J 1JCDA 1EZVE 3CD6P 3TYYA 4GOFA 4K35A 2NPSB 2R3CA 1AVOA 1NTZJ 2H8PD 2FYUG 1LT1A 2B89A 1QL1A 3AEBC 1MKMA 4JYCA 5KJ7D 5KLIC 3WUVA 2D2CD 3G71P 3CMAP 3HE4B 2Y0CA 1OW8A 4DT0A 1S9KD 1T2KC 1KFMA 1OW7A 1PZQA 4WY4B 2OYHA 2B9BA 1JY2P 1M1JA 2ZXXA 1DEBA 1NH4A 2R44A 3V2QA 1G1IA 1GTWA 2E43A 2ZFCA 1LTJC 1P84D 2FKWB 3L74D 4YXDC 4ZKPA 1PP9E 1SFCB 3CCVP 2FFDB 4Y28J 1G1JA 1BCCJ 1WMKA 1X79B 3PJSK 1NTKE 1IFIA 2GUSA 2JDIH 1SQQK 2WPVB 3H1JE 3L70G 3L74E 1L0NG 1GD2E 2OTKE 2POHA 3O8ZA 4H44C 3RK2D 3BCCD 5AW9B 3HD7A 1FJPA 2V7QH 3V2RA 1FU1A 1GL2C 3GHGB 3AE9C 1HBWA 5AVVB 3EFGA 1VQ9P 2ZT9D 2KI7B 3HE5A 1YJNP 4Y99B 2JP3A 2O01J 3KQGA 3H1KG 1L0LD 1LGHB 1G2CB 1N7SA 1NOHA 1SQXE 4XA4A 5APYA 2GA1A 1HTLC 3H1LJ 3SWYA 3VMXA 5GTIH 1YJ9P 2E75D 5AVYB 5E79H 1NVOA 1CI6A 2FBWC 3HD7D 1KC8Q 1RF0C 3WU2H 2E75C 1FZCB 1NTME 3HUSA 2C0WA 4NPEA 2K9JA 3E7KA 1QLED 4ZMDA 2FYNC
chains in the Genus database with same CATH topology
1MV8A 3VP8A 2R5DA 4OH8B 1HUCA 2NPSC 4WB4A 1KZUB 4WY4A 2E42A 1T3UA 2MJZA 1WT6A 4IFFA 1H88A 2C0XA 1T3JA 3KYQA 4N6JA 1A02J 3OJAB 4C7RA 2OARA 5KLVK 3A5TA 1HGZA 4I1LA 3BRTB 3U1AA 1OXZA 2GM4A 1S9KE 1T2KD 3RK3B 1L0NK 4KHXA 3A7OA 3TSIA 1RF1A 5APTA 1FOSF 4LLHA 1E5WA 1JY3P 3M9HA 1JY3N 2IX7C 4JF7A 3VYIA 2WWWA 1GL2B 2KOGA 1LT9A 1NHLA 1J1DC 2WT7B 1RE3C 1J1DB 3A2AA 2WSEH 5APXA 3SWFA 1SQVK 2WPQA 2YNYA 1N7SD 3IFMA 1LT9C 2PAJA 3V2NA 2N1TB 2P2UA 4I2LC 1J2JB 1HH0A 4RESB 3HTKB 3P8CE 3II6A 1KILB 3E1IA 3B5ND 1GW3A 1GW4A 3MUDA 1GK4A 5KTBA 2OYIA 1RE4A 1N73B 1EQ7A 1FBMA 2I1KA 3BATA 2FFDC 3KPEA 4LGDE 2XDJA 1URQB 1GDTA 2H43A 1HWTC 3L35A 3H32A 1KQLA 1M7LA 1AFOA 1KFNA 3NMDA 2FYUK 1JUNA 2P67A 4C46A 1IO4A 5AVUB 5KJ7C 3N7NA 1IFJA 1L4AD 4GT1A 1MUUA 2N9BA 1LTGC 2P1JA 4O9BA 1JY2N 1GU5A 1GD2E 2HFED 3VN0A 1N7LA 5AW6B 3C9IA 2FYZA 2OYHB 4AQRD 1Z56A 2ZXEB 2QM7A 1DH3A 1L4AA 1ZV8A 1JY3O 2HLOA 2A45H 1FZAA 3CLQA 3V2PA 3L4FA 1RF1C 1IFMA 1JTHA 3P7KA 1N86A 2XZRA 2YKQA 5AW0B 1XTGB 3V4WA 2WPSA 1YTZI 4HYTB 2IPPA 1L4AC 3HE5B 3M9BA 2KB7P 3RL0B 2Q7CA 4WY4D 1DX7A 1SFCC 1LTTC 4B86A 3T97A 1A02F 3RK3D 4EOTA 2WTYA 3GHGC 5CJ4A 1M1JC 3LW5H 5AVTB 3BASA 5BU5A 1FZGA 3VTPC 1OWAA 4XE5B 5CCHC 3G3ZA 1LWUC 3B5NC 1HJBA 4AUWA 1RY3A 2KSJA 5CJ0A 2HPCB 3H6PA 1SP4A 1LT9B 1RE4C 3L37A 4Y99C 1NWQA 1FZBA 3OA7A 1J1EC 3MIWA 2O01H 2HG5D 1LWUB 5APWA 2N1TA 3RL0D 3P8CD 2M3BA 1G2CA 1H8AA 2L5GB 4C7NB 2J59M 2O1KA 1QL2A 4GKGA 1FDMA 4DOJA 1CSBA 2BASA 5BU8B 2R32A 1GL2D 1JY2O 2Z5IA 1GZLA 2GUVA 3MGNA 2H7HA 3RK2C 5AW1B 3RK2B 1N73A 2VRSA 1FZFA 2OYIC 3IR9A 1SFCD 3N4XA 2WITA 4I6MC 2A45G 4WBAA 5AW2B 2C9NY 1IFNA 3HUSB 1ZN5A 2WSCH 1CZQA 2JJLA 3M0AA 3P8MC 5AW8B 2WPRA 1IFDA 3M06A 3OAKA 2YMYA 3HUSC 1NU1K 3U59A 3WMM0 2Q5UA 5AVRB 1RF0A 4N3YB 1JCCA 3M9QA 1URQA 1H89A 1GU4A 2WT7A 2NPSA 2LKMA 1JTHB 2HPCA 3V4QA 1HVVA 2C9LY 1SQPK 2KP8A 4N78E 2Q3IA 3R2PA 1URQC 3V5BA 5CCGA 1L4AB 5KJ7A 1YTZT 2WZ7A 4GIFA 4EIJA 1X9VA 4IFMA 2P7JA 2OYIB 1CI6B 1JO5A 3BVHA 1KILD 1IK9A 1SFCA 3RL0C 3B5NB 1URQD 1XTCC 1WRGA 1NTMK 2QM8A 2PP6A 2OYHA 1NAFA 3HD7B 3HD7C 1L0LK 2CPSA 3KDPB 1NTZK 1SQXK 2KYVA 5CMZA 4LC1A 1SQBK 3CL3D 2FFDA 3MTUE 1GL2A 1FZCC 1JMMA 1LTIC 1CW5A 3M0DA 3VOPA 1ZR2A 1NTKK 2YKOA 2N1TD 1VDFA 1FZCA 4N78D 1NKZB 5AVXB 3PP5A 2O1JA 3I5CA 3A3YB 1N2DC 2XU6A 4ZKUA 1W2EA 1SVFA 1RE3A 5BVZA 4C7NA 1KILA 2XV5A 3HRNA 3GHGA 5AVWB 1MZ9A 3NFQA 3HE4A 1LWUA 1PFIA 3EQ2A 1JNMA 2XNXA 2I1JA 1IC2A 4HH2A 1LTBC 3TNUA 1FJKA 1T8ZA 2W6BA 4AYCA 3LIDA 5AW5B 2YKPA 1LTSC 1N7SB 2N1TC 1NO4A 4W7YA 2HODB 3NXSA 5APUA 3B8EB 1ZLLA 2Q9IA 4DZOA 1HGVA 4IFDK 3L36A 1FZEA 4M3LA 2M8RA 1J1EB 5APSA 2KLVA 2Z4EA 2YO2A 2FXMA 5CCGD 4W80A 3NTNA 2J58A 5AVQB 4W7ZA 1N73C 3B5NA 1X8YA 3VMZA 1JOCA 2A45I 1ZR4A 2IFNA 3UIAA 3U1CA 1KILC 5APVA 3RK3C 4JYBA 1MFZA 2JEEA 1LTJB 3VMYA 1FAVA 2YO3A 3P32A 2HODA 5CCGC 4WY4C 2W6AA 2WSFH 2NPSD 5AW3B 3CI9A 1GK6A 1VPCA 3TNUB 3HTKA 1IJDB 3VP9A 1N7SC 5CCHA 2R5BA 2HYNA 5CCHD 2IFMA 3M91A 1RF1B 2OYHC 5APQA 1NKNA 5AVZB 5CHXA 1M1JB 2W27A 3H32B 5AVSB 1YYCA 1LTAC 2Z5HA 1SLQA 2CPBA 2XKMA 1LTJA 3LIEA 3M0DC 5AW4B 3MD0A 1AQ5A 1JCDA 3TYYA 2NPSB 2R3CA 3BRVB 2H8PD 4JYCA 1QL1A 5KJ7D 1T2KC 3HE4B 1S9KD 1KFMA 4WY4B 1JY2P 1M1JA 1DEBA 1NH4A 3V2QA 1G1IA 1GTWA 2E43A 2ZFCA 1LTJC 4ZKPA 2FKWB 1SFCB 2FFDB 1G1JA 1X79B 3TK1A 1IFIA 2GUSA 1SQQK 2POHA 3O8ZA 3RK2D 5AW9B 3HD7A 1FJPA 3V2RA 1FU1A 1GL2C 3GHGB 1HBWA 5AVVB 3EFGA 3HE5A 4Y99B 3KQGA 1LGHB 5AW7B 1G2CB 1N7SA 1NOHA 4XA4A 3SWYA 5APYA 3VMXA 1HTLC 5AVYB 1CI6A 3HD7D 1RF0C 1FZCB 3HUSA 2C0WA 1FOSE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YKO A;  3BRT B;  1JOC A;  2YKP A;  3EQ2 A;  2YKQ A;  3L4F A;  2W6B A;  3BRV B;  3CL3 D; 
#chains in the Genus database with same CATH topology
 1MV8 A;  1Q2N A;  2WVR A;  2R5D A;  4OH8 B;  1HUC A;  2NPS C;  3CXH I;  1KZU B;  4UB6 H;  4WB4 A;  1OZH A;  4WY4 A;  1S5L E;  1NAY A;  1T3U A;  3D6Z A;  2MJZ A;  1BGY D;  1RQV A;  1WT6 A;  4H0L B;  4IFF A;  4H0L C;  1H88 A;  2C0X A;  1T3J A;  1UIX A;  4H44 D;  3KYQ A;  1VL2 A;  2DW3 A;  4N6J A;  1A02 J;  1QVF O;  3OJA B;  4U3F D;  1OMI A;  2I8D A;  4C7R A;  2QJY B;  2OAR A;  2W90 A;  2E74 B;  3RBZ A;  3GF3 A;  5KLV K;  3L70 D;  3A5T A;  1HGZ A;  3TK1 A;  1NTZ G;  4I1L A;  1H0T A;  1BDD A;  3B4S A;  3BRT B;  1LJ2 A;  1OXZ A;  3U1A A;  2GM4 A;  3SFD C;  4ASV A;  1S9K E;  1FOS E;  1OIP A;  2D2C C;  2OQQ A;  1T2K D;  3RK3 B;  4D6T E;  2RMZ A;  1X0T A;  1L0N K;  4KHX A;  3A7O A;  3TSI A;  1RF1 A;  5APT A;  1FOS F;  4LLH A;  3H1I E;  1E5W A;  1SQB J;  1SQP G;  3L73 G;  1JY3 P;  1BE3 G;  3M9H A;  1JY3 N;  1BCC G;  4NPD A;  1YI2 P;  2IX7 C;  2Y0D A;  4JF7 A;  5E79 E;  3H1K E;  3VYI A;  2WWW A;  4BRY A;  1SQX G;  2M5A A;  2ZVN B;  1GL2 B;  2KOG A;  2KUB A;  1LT9 A;  3CWB J;  4H13 D;  1NHL A;  2NZ2 A;  1X22 A;  3CCE P;  4KJM A;  1J1D C;  2WT7 B;  1RE3 C;  1J1D B;  4IL6 X;  2FYU J;  4BWN A;  1Y47 A;  3A2A A;  2WSE H;  1VQO P;  2XND H;  1K04 A;  1IZN B;  5APX A;  3SWF A;  1RQU A;  1SQV K;  1L2P A;  3G4S P;  1P84 H;  2K88 A;  4D6T G;  1EXI A;  2WPQ A;  4KT0 J;  2YNY A;  1N7S D;  1RF1 B;  3IFM A;  1LT9 C;  2PAJ A;  3V2N A;  3L72 J;  1PGQ A;  3BCC G;  3L71 E;  2FYN B;  1VQM P;  1PIX A;  2ZYD A;  2N1T B;  2J5U A;  1R5L A;  2P2U A;  1AVY A;  1FDI A;  2QSI A;  2HR3 A;  2WSC J;  3PHL A;  1J2J B;  1HH0 A;  1ZW0 A;  2IBZ D;  4RES B;  3WU2 E;  3CC2 P;  1BGY J;  3HTK B;  2IYP A;  3CX5 E;  3G9R A;  1VQ4 P;  5BVZ A;  3P8C E;  1QX8 A;  3II6 A;  1VQ6 P;  1KIL B;  3Q3D A;  1SQV E;  1HF9 A;  2LXB A;  3E1I A;  3CX5 D;  3B5N D;  3FXD A;  4TLF A;  3V6I A;  4UB6 E;  1GW3 A;  1GW4 A;  1U57 A;  1YBK A;  1K9M Q;  3O6Q B;  1R5S A;  3MUD A;  3PRJ A;  4U3F E;  1YQ4 C;  1GK4 A;  1NTZ D;  2ZJS E;  3F89 A;  4R4L A;  5KTB A;  1P84 E;  2B87 B;  2OYI A;  3AEG C;  3D71 A;  2QEX P;  1RE4 A;  5CBN A;  1N73 B;  4U7J A;  1EQ7 A;  1DIP A;  1FBM A;  2I1K A;  2KS1 A;  1HJ0 A;  3BAT A;  4PV1 D;  3CPW O;  4PJ0 E;  2YXQ B;  1PV3 A;  1PGJ A;  1OVR A;  1VQL P;  2FFD C;  3KPE A;  4LGD E;  2XDJ A;  1FS0 E;  1URQ B;  3R4Y A;  1GDT A;  2Q1K A;  4WWI A;  1BCC D;  2H43 A;  2KSE A;  1Q86 Q;  3L35 A;  1EDI A;  3H32 A;  4OGQ C;  1HWT C;  3IF4 A;  1L0N E;  1KQL A;  1M7L A;  3H1J D;  4OGQ B;  1ZRT E;  3C8V A;  1AFO A;  3S9O A;  1KFN A;  3NMD A;  2FYU K;  3BCC J;  2P67 A;  4C46 A;  5K5G B;  1IO4 A;  1JUN A;  2W6J H;  3TGU J;  3AEE C;  3LW5 J;  5AVU B;  3GLM A;  3N7N A;  1IFJ A;  1L4A D;  3WUT A;  5KJ7 C;  4GT1 A;  3K5B A;  1FE6 A;  1MUU A;  2N9B A;  1LTG C;  2P1J A;  4O9B A;  3FWN A;  5KLV E;  3AE7 C;  1ZR4 A;  1JY2 N;  1KB9 D;  3T97 B;  1KB9 I;  1GU5 A;  2HFE D;  5M1B A;  3VN0 A;  1VQ5 P;  1N7L A;  3H1L D;  1SQP D;  2FYZ A;  3C9I A;  4L75 A;  2RN0 A;  2PRR A;  5AW6 B;  4AQR D;  4RJT A;  1Z56 A;  1DEE G;  2YMK A;  2ZXE B;  1N8R Q;  2QM7 A;  1DH3 A;  1L4A A;  2BEZ F;  2A06 E;  1NTM G;  1Q90 D;  2PFX A;  1R8E A;  3A0H E;  1FDO A;  1ZV8 A;  1JY3 O;  2HLO A;  2A45 H;  2H88 C;  1FZA A;  3CLQ A;  3H1K D;  4OVN F;  3CCM P;  2BEQ D;  3V2P A;  3L4F A;  4H13 B;  3CCR P;  1RF1 C;  3AE8 C;  1KYO D;  1IFM A;  2QIW A;  3AEC C;  4HKZ H;  1SQP J;  1JTH A;  1SQB G;  1N86 A;  2KNC B;  1NU1 E;  3P7K A;  2XZR A;  4U3F G;  5KLV J;  3MHV A;  2YKQ A;  3KZI E;  5AW0 B;  1EXJ A;  2M5A B;  1XTG B;  1Y9B A;  2ZVO B;  2LR2 A;  4I2L C;  1SQQ G;  4L74 A;  3V4W A;  2WPS A;  5KLI B;  3I55 P;  2OTJ P;  1YTZ I;  1BSH A;  4L73 A;  4H13 C;  4HYT B;  2W8Z A;  2IPP A;  1BDC A;  5EFW B;  1L4A C;  2V7Q J;  2BCC G;  1L0L G;  3L74 G;  3L70 E;  3HE5 B;  4BXL A;  3M9B A;  2KB7 P;  2E74 D;  5TIS E;  4RKU J;  3RL0 B;  2Q7C A;  4WY4 D;  1VQ7 P;  1DX7 A;  1SFC C;  1LTT C;  2W83 C;  3H1H J;  1PPJ E;  4B86 A;  1AJY A;  3T97 A;  3RL0 g;  1A02 F;  1VF5 C;  3D6Y A;  3L73 E;  3RK3 D;  4I7Z B;  1KN7 A;  3ITK A;  4UB8 H;  4EOT A;  4PV1 C;  2WTY A;  4PD4 E;  4PJ0 H;  3GHG C;  4PD4 H;  3TGU D;  5CJ4 A;  3H1H E;  1M1J C;  3LW5 H;  3CWB D;  5AVT B;  3BAS A;  5DJT B;  5BU5 A;  1FZG A;  3VTP C;  1Q7Y Q;  1OWA A;  4XE5 B;  1QVG O;  2AEM A;  2OYO A;  3VP8 A;  5CCH C;  3MUD C;  1NYH A;  3G3Z A;  1LWU C;  2KIK A;  3B5N C;  1HJB A;  4AUW A;  1OX3 A;  3I56 P;  1QEX A;  1RY3 A;  2AEF A;  2FYU D;  2KSJ A;  5CJ0 A;  3H6P A;  3TF5 A;  2HPC B;  1GMJ A;  1SP4 A;  1LT9 B;  1RE4 C;  2KLU A;  3L37 A;  2ZYG A;  3QH9 A;  4Y99 C;  1NWQ A;  1FZB A;  3OA7 A;  2JWD A;  1J1E C;  4D6T D;  3MIW A;  2IDB A;  2O01 H;  3L75 J;  1NU1 G;  5CBO A;  2HG5 D;  1PGP A;  2JWA A;  1LWU B;  3Q2Y A;  5APW A;  2N1T A;  3O6Q A;  3RL0 D;  1ZP0 C;  3P8C D;  2M3B A;  1G2C A;  5H2F E;  2L5G B;  1H8A A;  3SSU A;  2P58 A;  3L70 J;  3L73 D;  3RK3 E;  3CCL P;  5B66 E;  1KMI Z;  1EZV G;  5B66 H;  1OW6 A;  2E5T A;  1EZV I;  2AEJ A;  2J59 M;  4GOD A;  4C7N B;  2O1K A;  1QL2 A;  4GKG A;  1FDM A;  3USS A;  1AV1 A;  4DOJ A;  1JB0 J;  1CSB A;  3A0H H;  2BAS A;  2CK3 H;  3L75 D;  2UWJ E;  1SQV G;  2IZ1 A;  5BU8 B;  2ZT9 C;  2O01 N;  3CWB E;  4YXW H;  2IBZ G;  1PPJ G;  2R32 A;  4JBZ A;  1GL2 D;  3CCQ P;  1JY2 O;  1VF5 B;  1SQP E;  2Z5I A;  1GZL A;  2GUV A;  3MGN A;  2H7H A;  1KB9 E;  1KB9 H;  2MKV A;  2KS1 B;  2YXR B;  3FWL A;  3RK2 C;  2WSF J;  5AW1 B;  3RK2 B;  4EYY Q;  1N73 A;  3KHU A;  1NTK G;  2VRS A;  3H25 A;  5GTH H;  1FZF A;  1JM0 A;  2JKV A;  2M3E A;  1K05 A;  1NGM B;  1KD1 Q;  2RKL A;  3H1I J;  2OYI C;  1JNM A;  1PP9 G;  4H44 B;  1BGY G;  4DJG A;  2K9Y A;  3H1H G;  3CME P;  3IR9 A;  1SFC D;  3N4X A;  2WIT A;  4I6M C;  2A45 G;  1NJI Q;  4WBA A;  5AW2 B;  3IAO A;  5KKZ B;  3CX5 I;  1IFN A;  2C9N Y;  3HUS B;  1ZN5 A;  2WSC H;  3L75 E;  1CZQ A;  5DJU B;  5TJH A;  2ZAE B;  1KQG B;  2JJL A;  3L72 D;  3M0A A;  3TGU E;  4Z1M H;  2E76 D;  3P8M C;  5AW8 B;  4NPF X;  5H2F H;  2QJK B;  2WPR A;  1IFD A;  2WQY C;  3M06 A;  2G3A A;  3OAK A;  3RGU A;  2YMY A;  1RH5 B;  3HUS C;  1NU1 K;  3U59 A;  3WMM 0;  2Q5U A;  5AVR B;  4JPZ B;  4YPC A;  1RF0 A;  3ABV C;  3CC7 P;  3PLN A;  4H0L D;  4N3Y B;  3SWK A;  2QA4 P;  1JCC A;  2Y9Z A;  3Q5S A;  3M9Q A;  5KAF E;  5KAI H;  3CCS P;  2QVA A;  1URQ A;  2A06 G;  1H89 A;  3D70 A;  1GU4 A;  2AXC A;  4OWF A;  3WUU A;  1L0N D;  2WT7 A;  2NPS A;  3L73 J;  4PD4 D;  2IBZ E;  2LKM A;  2NRG A;  1USD A;  1JTH B;  3ZDM A;  2HPC A;  1UII A;  3V4Q A;  1HVV A;  3L72 E;  1KQS O;  5KLV D;  2C9L Y;  1SQV J;  1SQP K;  2KP8 A;  2ZT9 B;  3GW6 A;  3MZW B;  4N78 E;  2Q3I A;  3R2P A;  1EDJ A;  1FC2 C;  1URQ C;  3V5B A;  1T6A A;  2KXP B;  3Q5R A;  2WSE J;  3JSV C;  5CCG A;  1L4A B;  1S5L X;  1SS1 A;  2D2C B;  3BRV B;  2FYU E;  5KJ7 A;  1YTZ T;  3H1J J;  2WZ7 A;  3AEA C;  4GIF A;  4IL6 E;  1X9V A;  4EIJ A;  4IL6 H;  1BCC E;  2Y0E A;  2P7J A;  4IFM A;  2OYI B;  1CI6 B;  2A06 D;  1PP9 J;  2ITA A;  1JO5 A;  1NU1 J;  4L76 A;  2ZYA A;  3H1I G;  1M56 D;  1KYO I;  1P84 I;  4CPG A;  3BVH A;  1KIL D;  1IK9 A;  3PTZ A;  1SFC A;  3MP7 B;  3RL0 C;  3B5N B;  1URQ D;  3KZI H;  1XTC C;  1WRG A;  5GTH E;  1NTM K;  4TT3 H;  2FXO A;  2PP6 A;  2QM8 A;  2QRX A;  1NAF A;  2YIU C;  3CXH E;  1USE A;  3HD7 B;  1E79 H;  3HD7 C;  4HJG H;  1L0L K;  2CPS A;  2QJP C;  1Q81 Q;  3KDP B;  4EI2 A;  2OTL P;  1NTZ K;  1SQX K;  2KYV A;  5CMZ A;  1M90 Q;  4QMA A;  4LC1 A;  1SQB K;  3CL3 D;  2FFD A;  3H1K J;  2K9J B;  3MTU E;  1YJW P;  1GL2 A;  1FZC C;  2OYH B;  5B5E E;  1JMM A;  3L71 G;  1LTI C;  1KTM A;  1AA0 A;  1H0T B;  1CW5 A;  3M0D A;  3AE1 C;  3VOP A;  2P10 A;  4OGQ D;  4EDF A;  1VQ8 P;  1ZR2 A;  1W2B O;  2G8Y A;  4K3A A;  3BCC E;  4D6T J;  1SQQ E;  1L0N J;  3VMA A;  2E42 A;  1NTK K;  2QG4 A;  1VQN P;  4A7P A;  2YKO A;  3JC2 2;  1PGO A;  2N1T D;  1EC5 A;  1VDF A;  1ZRT D;  2M0B A;  1Q82 Q;  2KNC A;  3CXH H;  3GG2 A;  1M57 D;  1FZC A;  4N78 D;  1NKZ B;  1EDK A;  3PP5 A;  5AVX B;  1KOR A;  3E1R A;  2O1J A;  5KAI E;  5KAF H;  3I5C A;  4WVZ A;  4BRY B;  3FX0 A;  2E74 C;  1SQV D;  3A3Y B;  3H1H D;  1N2D C;  2XU6 A;  4ZKU A;  1W2E A;  1VQP P;  1SVF A;  3PH0 A;  1S72 P;  1VQK P;  3F5H A;  1RE3 A;  3CWB G;  4U3F J;  1YQ3 C;  2K37 A;  2PGD A;  3H1L E;  1KIL A;  3SFE C;  2XV5 A;  1NTK D;  1SQX J;  3HRN A;  3GHG A;  1IK7 A;  3L71 D;  4RO0 A;  1IFP A;  2JO1 A;  3C1L A;  2SPZ A;  5AVW B;  1MZ9 A;  1BSN A;  3NFQ A;  1BE3 J;  2Q6Q A;  3HE4 A;  1LWU A;  1PP9 D;  3GF7 A;  2OGU A;  1PFI A;  1PPJ D;  1NTM J;  1JEK A;  2AXT H;  2QJP B;  1M8O B;  2XNX A;  3EQ2 A;  3H1I D;  5AW7 B;  1S5L H;  4PV1 B;  1JMB A;  2I1J A;  1BGY E;  4MN4 C;  1IC2 A;  4HH2 A;  5TIS H;  1EDL A;  4PD4 I;  1DD3 A;  1LTB C;  1KQF B;  3TNU A;  2KZI A;  3AE4 C;  1SQB D;  2E75 B;  1Y8A A;  1L0L J;  1NTK J;  1FJK A;  1SQX D;  1T8Z A;  3S1K A;  2JR8 A;  3L71 J;  2W6B A;  4AYC A;  3CCJ P;  1K73 Q;  3CC4 P;  1EZV D;  4GOE A;  3LID A;  5C39 A;  5AW5 B;  3Q5P A;  2YKP A;  1YHQ P;  1KYO H;  1LTS C;  1D7M A;  1N7S B;  2N1T C;  4UB8 E;  1NO4 A;  1NTM D;  2HOD B;  2Q3E A;  2QE7 H;  2LXC B;  3B8E B;  1ZLL A;  3NXS A;  4W7Y A;  5APU A;  3TGU G;  5GTI E;  5KLV G;  2Q9I A;  2KZJ A;  2E76 C;  2FXP A;  2IYO A;  2O3J A;  3AEF C;  3AE3 C;  1KV4 A;  1YIT P;  4DZO A;  2K3R A;  1LP1 B;  3QWO C;  4C7N A;  1HGV A;  4IFD K;  3L36 A;  1FZE A;  1ZXG A;  4M3L A;  2M8R A;  1J1E B;  2N9Y B;  1S1C X;  3FGA D;  5APS A;  2QJY C;  3S4R A;  2KLV A;  2L91 A;  2Z4E A;  2YO2 A;  2FXM A;  5CCG D;  4W80 A;  3NTN A;  2J58 A;  3AE6 C;  1MFT A;  1S2E A;  5AVQ B;  4W7Z A;  1N73 C;  3CCU P;  4HB1 A;  1SQB E;  3B5N A;  1X8Y A;  1NTZ E;  2RH0 A;  2WMM A;  3H1L G;  3VMZ A;  1JOC A;  2A45 I;  2H89 C;  1L0L E;  4DCK A;  1PL5 A;  1S4X A;  2R3S A;  3JCU H;  3JCU E;  2B88 A;  2IFN A;  4I7Z C;  3UIA A;  3U1C A;  1KIL C;  3AE5 C;  5APV A;  3RK3 C;  2BCC E;  4JYB A;  3W68 A;  1MFZ A;  1VF5 D;  2JEE A;  1LTJ B;  1BE3 E;  2V4H A;  3EWK A;  3VMY A;  1FAV A;  2YO3 A;  2B87 A;  4XFJ A;  3RBX A;  2BCC D;  2HOD A;  3KXD A;  2WSS H;  3P32 A;  5CCG C;  1BE3 D;  4WY4 C;  4YTP C;  4GDO A;  3L75 G;  4JQ0 D;  3W67 A;  2W6A A;  1OVV A;  2WSF H;  2NPS D;  2Y9Y A;  5AW3 B;  2K1A A;  2IBZ I;  1LNQ A;  1NU1 D;  1OFC X;  1SQQ D;  1GK6 A;  2FY8 A;  3A0B H;  1RHZ B;  3AE2 C;  3CI9 A;  1W5C E;  3CXH D;  3OW2 O;  3CX5 H;  5KKZ C;  3H1J G;  1VPC A;  4IOI H;  2YIU B;  3HTK A;  1QGK B;  3TDK A;  3TNU B;  1IJD B;  3VP9 A;  4ASW A;  3FXE A;  1AQT A;  1U7J A;  1K8A Q;  3AED C;  2BCC J;  1N7S C;  1DD4 A;  2AXT E;  1ZOY C;  5CCH A;  3EFF K;  2QJK C;  2R5B A;  2HYN A;  3GMA A;  2E5Y A;  2IFM A;  1LP1 A;  1SQQ J;  3M91 A;  5CCH D;  5APQ A;  5B5E H;  2E76 B;  3G6E P;  1YIJ P;  2OYH C;  1OVU A;  1NKN A;  1TU3 F;  5AVZ B;  5CHX A;  4ZNC A;  1M1J B;  2W27 A;  4R4M A;  3H32 B;  5AVS B;  5L8R J;  2IZ0 A;  1KYO E;  3B71 A;  1YYC A;  1LTA C;  1U7M A;  2KK7 A;  3IN6 A;  3L72 G;  3A0B E;  2Z5H A;  1SLQ A;  3Q1M A;  2CPB A;  1ZME C;  1KIL E;  1LTJ A;  2XKM A;  3LIE A;  3M0D C;  5AW4 B;  3MD0 A;  1S3J A;  1AQ5 A;  1M1K Q;  3L74 J;  1JCD A;  1EZV E;  3CD6 P;  3TYY A;  4GOF A;  4K35 A;  2NPS B;  2R3C A;  1AVO A;  1NTZ J;  2H8P D;  2FYU G;  1LT1 A;  2B89 A;  1QL1 A;  3AEB C;  1MKM A;  4JYC A;  5KJ7 D;  5KLI C;  3WUV A;  2D2C D;  3G71 P;  3CMA P;  3HE4 B;  2Y0C A;  1OW8 A;  4DT0 A;  1S9K D;  1T2K C;  1KFM A;  1OW7 A;  1PZQ A;  4WY4 B;  2OYH A;  2B9B A;  1JY2 P;  1M1J A;  2ZXX A;  1DEB A;  1NH4 A;  2R44 A;  3V2Q A;  1G1I A;  1GTW A;  2E43 A;  2ZFC A;  1LTJ C;  1P84 D;  2FKW B;  3L74 D;  4YXD C;  4ZKP A;  1PP9 E;  1SFC B;  3CCV P;  2FFD B;  4Y28 J;  1G1J A;  1BCC J;  1WMK A;  1X79 B;  3PJS K;  1NTK E;  1IFI A;  2GUS A;  2JDI H;  1SQQ K;  2WPV B;  3H1J E;  3L70 G;  3L74 E;  1L0N G;  1GD2 E;  2OTK E;  2POH A;  3O8Z A;  4H44 C;  3RK2 D;  3BCC D;  5AW9 B;  3HD7 A;  1FJP A;  2V7Q H;  3V2R A;  1FU1 A;  1GL2 C;  3GHG B;  3AE9 C;  1HBW A;  5AVV B;  3EFG A;  1VQ9 P;  2ZT9 D;  2KI7 B;  3HE5 A;  1YJN P;  4Y99 B;  2JP3 A;  2O01 J;  3KQG A;  3H1K G;  1L0L D;  1LGH B;  1G2C B;  1N7S A;  1NOH A;  1SQX E;  4XA4 A;  5APY A;  2GA1 A;  1HTL C;  3H1L J;  3SWY A;  3VMX A;  5GTI H;  1YJ9 P;  2E75 D;  5AVY B;  5E79 H;  1NVO A;  1CI6 A;  2FBW C;  3HD7 D;  1KC8 Q;  1RF0 C;  3WU2 H;  2E75 C;  1FZC B;  1NTM E;  3HUS A;  2C0W A;  4NPE A;  2K9J A;  3E7K A;  1QLE D;  4ZMD A;  2FYN C; 
#chains in the Genus database with same CATH homology
 1MV8 A;  3VP8 A;  2R5D A;  4OH8 B;  1HUC A;  2NPS C;  4WB4 A;  1KZU B;  4WY4 A;  2E42 A;  1T3U A;  2MJZ A;  1WT6 A;  4IFF A;  1H88 A;  2C0X A;  1T3J A;  3KYQ A;  4N6J A;  1A02 J;  3OJA B;  4C7R A;  2OAR A;  5KLV K;  3A5T A;  1HGZ A;  4I1L A;  3BRT B;  3U1A A;  1OXZ A;  2GM4 A;  1S9K E;  1T2K D;  3RK3 B;  1L0N K;  4KHX A;  3A7O A;  3TSI A;  1RF1 A;  5APT A;  1FOS F;  4LLH A;  1E5W A;  1JY3 P;  3M9H A;  1JY3 N;  2IX7 C;  4JF7 A;  3VYI A;  2WWW A;  1GL2 B;  2KOG A;  1LT9 A;  1NHL A;  1J1D C;  2WT7 B;  1RE3 C;  1J1D B;  3A2A A;  2WSE H;  5APX A;  3SWF A;  1SQV K;  2WPQ A;  2YNY A;  1N7S D;  3IFM A;  1LT9 C;  2PAJ A;  3V2N A;  2N1T B;  2P2U A;  4I2L C;  1J2J B;  1HH0 A;  4RES B;  3HTK B;  3P8C E;  3II6 A;  1KIL B;  3E1I A;  3B5N D;  1GW3 A;  1GW4 A;  3MUD A;  1GK4 A;  5KTB A;  2OYI A;  1RE4 A;  1N73 B;  1EQ7 A;  1FBM A;  2I1K A;  3BAT A;  2FFD C;  3KPE A;  4LGD E;  2XDJ A;  1URQ B;  1GDT A;  2H43 A;  1HWT C;  3L35 A;  3H32 A;  1KQL A;  1M7L A;  1AFO A;  1KFN A;  3NMD A;  2FYU K;  1JUN A;  2P67 A;  4C46 A;  1IO4 A;  5AVU B;  5KJ7 C;  3N7N A;  1IFJ A;  1L4A D;  4GT1 A;  1MUU A;  2N9B A;  1LTG C;  2P1J A;  4O9B A;  1JY2 N;  1GU5 A;  1GD2 E;  2HFE D;  3VN0 A;  1N7L A;  5AW6 B;  3C9I A;  2FYZ A;  2OYH B;  4AQR D;  1Z56 A;  2ZXE B;  2QM7 A;  1DH3 A;  1L4A A;  1ZV8 A;  1JY3 O;  2HLO A;  2A45 H;  1FZA A;  3CLQ A;  3V2P A;  3L4F A;  1RF1 C;  1IFM A;  1JTH A;  3P7K A;  1N86 A;  2XZR A;  2YKQ A;  5AW0 B;  1XTG B;  3V4W A;  2WPS A;  1YTZ I;  4HYT B;  2IPP A;  1L4A C;  3HE5 B;  3M9B A;  2KB7 P;  3RL0 B;  2Q7C A;  4WY4 D;  1DX7 A;  1SFC C;  1LTT C;  4B86 A;  3T97 A;  1A02 F;  3RK3 D;  4EOT A;  2WTY A;  3GHG C;  5CJ4 A;  1M1J C;  3LW5 H;  5AVT B;  3BAS A;  5BU5 A;  1FZG A;  3VTP C;  1OWA A;  4XE5 B;  5CCH C;  3G3Z A;  1LWU C;  3B5N C;  1HJB A;  4AUW A;  1RY3 A;  2KSJ A;  5CJ0 A;  2HPC B;  3H6P A;  1SP4 A;  1LT9 B;  1RE4 C;  3L37 A;  4Y99 C;  1NWQ A;  1FZB A;  3OA7 A;  1J1E C;  3MIW A;  2O01 H;  2HG5 D;  1LWU B;  5APW A;  2N1T A;  3RL0 D;  3P8C D;  2M3B A;  1G2C A;  1H8A A;  2L5G B;  4C7N B;  2J59 M;  2O1K A;  1QL2 A;  4GKG A;  1FDM A;  4DOJ A;  1CSB A;  2BAS A;  5BU8 B;  2R32 A;  1GL2 D;  1JY2 O;  2Z5I A;  1GZL A;  2GUV A;  3MGN A;  2H7H A;  3RK2 C;  5AW1 B;  3RK2 B;  1N73 A;  2VRS A;  1FZF A;  2OYI C;  3IR9 A;  1SFC D;  3N4X A;  2WIT A;  4I6M C;  2A45 G;  4WBA A;  5AW2 B;  2C9N Y;  1IFN A;  3HUS B;  1ZN5 A;  2WSC H;  1CZQ A;  2JJL A;  3M0A A;  3P8M C;  5AW8 B;  2WPR A;  1IFD A;  3M06 A;  3OAK A;  2YMY A;  3HUS C;  1NU1 K;  3U59 A;  3WMM 0;  2Q5U A;  5AVR B;  1RF0 A;  4N3Y B;  1JCC A;  3M9Q A;  1URQ A;  1H89 A;  1GU4 A;  2WT7 A;  2NPS A;  2LKM A;  1JTH B;  2HPC A;  3V4Q A;  1HVV A;  2C9L Y;  1SQP K;  2KP8 A;  4N78 E;  2Q3I A;  3R2P A;  1URQ C;  3V5B A;  5CCG A;  1L4A B;  5KJ7 A;  1YTZ T;  2WZ7 A;  4GIF A;  4EIJ A;  1X9V A;  4IFM A;  2P7J A;  2OYI B;  1CI6 B;  1JO5 A;  3BVH A;  1KIL D;  1IK9 A;  1SFC A;  3RL0 C;  3B5N B;  1URQ D;  1XTC C;  1WRG A;  1NTM K;  2QM8 A;  2PP6 A;  2OYH A;  1NAF A;  3HD7 B;  3HD7 C;  1L0L K;  2CPS A;  3KDP B;  1NTZ K;  1SQX K;  2KYV A;  5CMZ A;  4LC1 A;  1SQB K;  3CL3 D;  2FFD A;  3MTU E;  1GL2 A;  1FZC C;  1JMM A;  1LTI C;  1CW5 A;  3M0D A;  3VOP A;  1ZR2 A;  1NTK K;  2YKO A;  2N1T D;  1VDF A;  1FZC A;  4N78 D;  1NKZ B;  5AVX B;  3PP5 A;  2O1J A;  3I5C A;  3A3Y B;  1N2D C;  2XU6 A;  4ZKU A;  1W2E A;  1SVF A;  1RE3 A;  5BVZ A;  4C7N A;  1KIL A;  2XV5 A;  3HRN A;  3GHG A;  5AVW B;  1MZ9 A;  3NFQ A;  3HE4 A;  1LWU A;  1PFI A;  3EQ2 A;  1JNM A;  2XNX A;  2I1J A;  1IC2 A;  4HH2 A;  1LTB C;  3TNU A;  1FJK A;  1T8Z A;  2W6B A;  4AYC A;  3LID A;  5AW5 B;  2YKP A;  1LTS C;  1N7S B;  2N1T C;  1NO4 A;  4W7Y A;  2HOD B;  3NXS A;  5APU A;  3B8E B;  1ZLL A;  2Q9I A;  4DZO A;  1HGV A;  4IFD K;  3L36 A;  1FZE A;  4M3L A;  2M8R A;  1J1E B;  5APS A;  2KLV A;  2Z4E A;  2YO2 A;  2FXM A;  5CCG D;  4W80 A;  3NTN A;  2J58 A;  5AVQ B;  4W7Z A;  1N73 C;  3B5N A;  1X8Y A;  3VMZ A;  1JOC A;  2A45 I;  1ZR4 A;  2IFN A;  3UIA A;  3U1C A;  1KIL C;  5APV A;  3RK3 C;  4JYB A;  1MFZ A;  2JEE A;  1LTJ B;  3VMY A;  1FAV A;  2YO3 A;  3P32 A;  2HOD A;  5CCG C;  4WY4 C;  2W6A A;  2WSF H;  2NPS D;  5AW3 B;  3CI9 A;  1GK6 A;  1VPC A;  3TNU B;  3HTK A;  1IJD B;  3VP9 A;  1N7S C;  5CCH A;  2R5B A;  2HYN A;  5CCH D;  2IFM A;  3M91 A;  1RF1 B;  2OYH C;  5APQ A;  1NKN A;  5AVZ B;  5CHX A;  1M1J B;  2W27 A;  3H32 B;  5AVS B;  1YYC A;  1LTA C;  2Z5H A;  1SLQ A;  2CPB A;  2XKM A;  1LTJ A;  3LIE A;  3M0D C;  5AW4 B;  3MD0 A;  1AQ5 A;  1JCD A;  3TYY A;  2NPS B;  2R3C A;  3BRV B;  2H8P D;  4JYC A;  1QL1 A;  5KJ7 D;  1T2K C;  3HE4 B;  1S9K D;  1KFM A;  4WY4 B;  1JY2 P;  1M1J A;  1DEB A;  1NH4 A;  3V2Q A;  1G1I A;  1GTW A;  2E43 A;  2ZFC A;  1LTJ C;  4ZKP A;  2FKW B;  1SFC B;  2FFD B;  1G1J A;  1X79 B;  3TK1 A;  1IFI A;  2GUS A;  1SQQ K;  2POH A;  3O8Z A;  3RK2 D;  5AW9 B;  3HD7 A;  1FJP A;  3V2R A;  1FU1 A;  1GL2 C;  3GHG B;  1HBW A;  5AVV B;  3EFG A;  3HE5 A;  4Y99 B;  3KQG A;  1LGH B;  5AW7 B;  1G2C B;  1N7S A;  1NOH A;  4XA4 A;  3SWY A;  5APY A;  3VMX A;  1HTL C;  5AVY B;  1CI6 A;  3HD7 D;  1RF0 C;  1FZC B;  3HUS A;  2C0W A;  1FOS E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...