3BRZA

Crystal structure of the pseudomonas putida toluene transporter todx
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
433
structure length
404
Chain Sequence
TQVFDLEGYGAISRAMGGTSSSYYTGNAALISNPATLSFAPDGNQFELGLDVVTTDIKVHGAEAKSSTPYVGPQLSYVAQLDDWRFGAGLFVSSGLGTEYGSKSFLSQTENGIQTSFDNSSRLIVLRAPIGFSYQATSKLTFGASVDLVWTSLNLELLLPSSQVGALTAQGNLSGGLVPSLAGFVGTGGAAHFSLSAGGAVDAVGWGGRLGLTYKLTDNTVLGAMYNFKTSVGDLEGKATLSAISGDGAVLPLDGDIRVKNFEMPASLTLGLAHQFNERWVVAADIKRAYWGDVMDSMNVAFISQLGGIDVALPHRYQDITVASIGTAYKYNNDLTLRAGYSYAQLILPVIPAYLKRHVTFGGEYDFDKDSRINLAISFGLRERVMLRQSHSQINAVVSYSKNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Outer-membrane transport of aromatic hydrocarbons as a first step in biodegradation.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Transport protein
molecule keywords TodX
total genus 90
structure length 404
sequence length 433
ec nomenclature
pdb deposition date 2007-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 3brzA00
2R88A 1T16A 2R4PA 3PF1A 2R4NA 3BRZA 2R4LA 2R89A 3DWNA 3BRYA 3DWOX 3PGUA 3BS0A 3PGSA 3PGRA 2R8AA 2R4OA 1T1LA
chains in the Genus database with same CATH superfamily
2LHFA 2WJRA 2PORA 3VZWX 1ZHYA 3AA0B 2MHLA 3QRAA 2R8AA 4FZLA 4N58A 4QQ1A 3FYXA 5DL6A 1GFPA 4RJWA 1PRNA 5G26A 2WVPA 2XTQA 3KVDD 4F4BA 1QJ8A 5DL7A 4D64A 1Q9FA 2KC0A 3LK3B 2XTRA 3VE1A 1OSMA 4PJ0O 3AA1A 2M06A 4AFKA 3WU2O 1GFQA 1P4TA 3SZDA 3LK2A 4KR8A 5T5FA 1E54A 4RL9A 1T1LA 1MPFA 1ORMA 2IWVA 2R88A 3PF1A 4G75A 4BUMX 3AAEB 3TZGA 3V8UA 4XNKA 3SYBA 1GFOA 2QTKA 4PUXA 3LK41 2FGQX 4LSHA 4B61A 2JMMA 4AKRB 5B66O 4GCQA 3HW9A 2ZLDA 5KAFO 2R4NA 3PQUA 3T24A 3SYSA 4LSEA 5TISO 4AYEC 4C00A 5AFUK 3KZIO 3LK42 5GTIO 5E79O 4JCHA 1QJ9A 2XG6A 5G39A 2ODJA 1MM4A 1H6S1 3DA3A 5DL8A 3JCUO 3BRZA 5IYUA 3UPGA 4K3CA 4C4VB 2YPVA 4AYNA 2N2MA 3BS0A 4O3YA 4D65A 4FZMA 5EE2A 4AYMC 1Q9GA 4FOZA 4AUIA 4N59A 4AYID 4C4VA 8PRNA 1GFMA 4RLCA 1ZHXA 4FESA 4D5UA 3EMNX 2WJQA 2GE4A 2R4OA 5GV0A 2FGRA 3WI5A 2JQYA 3HOLA 2OMFA 2N2LA 3LK3A 1BT9A 2R4LA 4FUVA 5PRNA 4C69X 3T20A 4RJXA 5AFUL 2KDYA 3POUA 1IZNB 4G76A 1IZNA 3POXA 4FQEA 1T16A 2R4PA 1MM5A 2F1CX 1ZHTA 2X27X 2Y0LA 4JFBA 4Z3TA 4AZLA 2J1NA 5B5EO 2W81C 3A0HO 2Y0HA 2Y7SA 3BRYA 3SZVA 5ADXL 4UB8O 3AA0A 2MNHA 4KRAA 3QRCA 4FRTA 2XE1A 4GHBA 3WI4A 4AKMA 4XNLA 4AYDC 1YS5A 2W80C 3A2SX 3AAAA 3GP6A 3AAAB 2KXPB 3AA7A 2KXPA 3AA7B 3K19A 3PGRA 4FSOA 4FRXA 1HXUA 4LSIA 5JDPA 4O3XB 3AA6B 3VY8X 4N75A 5DL5A 1G90A 4N74A 2KZ7A 5KAIO 2Y2XA 2K0LA 2X9KA 3LK2B 2F1TA 3A0BO 1PHOA 2ZFGA 3PRNA 4E1TA 4FSPA 3C5OA 3HWBA 3JTYA 3AA1B 4UB6O 5G38A 4GCSA 2F1VA 2AXTO 2LFUA 6PRNA 1OPFA 5FVNA 1ZHZA 3DZMA 4KR4A 4LSFA 4O4UA 4U9CA 3SY7A 1GFNA 3VE2A 3UAQA 5ADXK 3DWNA 4RLBA 4FZNA 2YNKA 3PGUA 1HXXA 4O4XA 4O3WA 5D5DA 4K3BA 3DA4A 2XE5A 5G3AA 3PORA 3NSGA 2ERVA 2Y0KA 2R89A 4PR7A 3VY9X 2KZ7B 4FMSA 4E1SA 1THQA 3VZTX 5GTHO 4O49A 3PGSA 3PQSA 3UU2A 2J4UP 1HXTA 4O3ZA 2XMXA 2PRNA 4GF4A 1BH3A 3O0EA 3SY9A 3G7GA 5H2FO 3VZUX 1BXWA 1QJPA 2M07A 2K4TA 3HOEA 3AAEA 3RBHA 4FT6A 3T0SA 4CTDA 3NJTA 1ZHWA 1S5LO 2XE3A 3AA6A 2IWWA 4IL6O 4AKRA 3DWOX 4GCPA 2XE2A 7PRNA 2O4VA 3POQA
chains in the Genus database with same CATH topology
2R88A 1T16A 2R4PA 3PF1A 2R4NA 3BRZA 2R4LA 2R89A 3DWNA 3BRYA 3DWOX 3PGUA 3BS0A 3PGSA 3PGRA 2R8AA 2R4OA 1T1LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R88 A;  1T16 A;  2R4P A;  3PF1 A;  2R4N A;  3BRZ A;  2R4L A;  2R89 A;  3DWN A;  3BRY A;  3DWO X;  3PGU A;  3BS0 A;  3PGS A;  3PGR A;  2R8A A;  2R4O A;  1T1L A; 
#chains in the Genus database with same CATH topology
 2LHF A;  2WJR A;  2POR A;  3VZW X;  1ZHY A;  3AA0 B;  2MHL A;  3QRA A;  2R8A A;  4FZL A;  4N58 A;  4QQ1 A;  3FYX A;  5DL6 A;  1GFP A;  4RJW A;  1PRN A;  5G26 A;  2WVP A;  2XTQ A;  3KVD D;  4F4B A;  1QJ8 A;  5DL7 A;  4D64 A;  1Q9F A;  2KC0 A;  3LK3 B;  2XTR A;  3VE1 A;  1OSM A;  4PJ0 O;  3AA1 A;  2M06 A;  4AFK A;  3WU2 O;  1GFQ A;  1P4T A;  3SZD A;  3LK2 A;  4KR8 A;  5T5F A;  1E54 A;  4RL9 A;  1T1L A;  1MPF A;  1ORM A;  2IWV A;  2R88 A;  3PF1 A;  4G75 A;  4BUM X;  3AAE B;  3TZG A;  3V8U A;  4XNK A;  3SYB A;  1GFO A;  2QTK A;  4PUX A;  3LK4 1;  2FGQ X;  4LSH A;  4B61 A;  2JMM A;  4AKR B;  5B66 O;  4GCQ A;  3HW9 A;  2ZLD A;  5KAF O;  2R4N A;  3PQU A;  3T24 A;  3SYS A;  4LSE A;  5TIS O;  4AYE C;  4C00 A;  5AFU K;  3KZI O;  3LK4 2;  5GTI O;  5E79 O;  4JCH A;  1QJ9 A;  2XG6 A;  5G39 A;  2ODJ A;  1MM4 A;  1H6S 1;  3DA3 A;  5DL8 A;  3JCU O;  3BRZ A;  5IYU A;  3UPG A;  4K3C A;  4C4V B;  2YPV A;  4AYN A;  2N2M A;  3BS0 A;  4O3Y A;  4D65 A;  4FZM A;  5EE2 A;  4AYM C;  1Q9G A;  4FOZ A;  4AUI A;  4N59 A;  4AYI D;  4C4V A;  8PRN A;  1GFM A;  4RLC A;  1ZHX A;  4FES A;  4D5U A;  3EMN X;  2WJQ A;  2GE4 A;  2R4O A;  5GV0 A;  2FGR A;  3WI5 A;  2JQY A;  3HOL A;  2OMF A;  2N2L A;  3LK3 A;  1BT9 A;  2R4L A;  4FUV A;  5PRN A;  4C69 X;  3T20 A;  4RJX A;  5AFU L;  2KDY A;  3POU A;  1IZN B;  4G76 A;  1IZN A;  3POX A;  4FQE A;  1T16 A;  2R4P A;  1MM5 A;  2F1C X;  1ZHT A;  2X27 X;  2Y0L A;  4JFB A;  4Z3T A;  4AZL A;  2J1N A;  5B5E O;  2W81 C;  3A0H O;  2Y0H A;  2Y7S A;  3BRY A;  3SZV A;  5ADX L;  4UB8 O;  3AA0 A;  2MNH A;  4KRA A;  3QRC A;  4FRT A;  2XE1 A;  4GHB A;  3WI4 A;  4AKM A;  4XNL A;  4AYD C;  1YS5 A;  2W80 C;  3A2S X;  3AAA A;  3GP6 A;  3AAA B;  2KXP B;  3AA7 A;  2KXP A;  3AA7 B;  3K19 A;  3PGR A;  4FSO A;  4FRX A;  1HXU A;  4LSI A;  5JDP A;  4O3X B;  3AA6 B;  3VY8 X;  4N75 A;  5DL5 A;  1G90 A;  4N74 A;  2KZ7 A;  5KAI O;  2Y2X A;  2K0L A;  2X9K A;  3LK2 B;  2F1T A;  3A0B O;  1PHO A;  2ZFG A;  3PRN A;  4E1T A;  4FSP A;  3C5O A;  3HWB A;  3JTY A;  3AA1 B;  4UB6 O;  5G38 A;  4GCS A;  2F1V A;  2AXT O;  2LFU A;  6PRN A;  1OPF A;  5FVN A;  1ZHZ A;  3DZM A;  4KR4 A;  4LSF A;  4O4U A;  4U9C A;  3SY7 A;  1GFN A;  3VE2 A;  3UAQ A;  5ADX K;  3DWN A;  4RLB A;  4FZN A;  2YNK A;  3PGU A;  1HXX A;  4O4X A;  4O3W A;  5D5D A;  4K3B A;  3DA4 A;  2XE5 A;  5G3A A;  3POR A;  3NSG A;  2ERV A;  2Y0K A;  2R89 A;  4PR7 A;  3VY9 X;  2KZ7 B;  4FMS A;  4E1S A;  1THQ A;  3VZT X;  5GTH O;  4O49 A;  3PGS A;  3PQS A;  3UU2 A;  2J4U P;  1HXT A;  4O3Z A;  2XMX A;  2PRN A;  4GF4 A;  1BH3 A;  3O0E A;  3SY9 A;  3G7G A;  5H2F O;  3VZU X;  1BXW A;  1QJP A;  2M07 A;  2K4T A;  3HOE A;  3AAE A;  3RBH A;  4FT6 A;  3T0S A;  4CTD A;  3NJT A;  1ZHW A;  1S5L O;  2XE3 A;  3AA6 A;  2IWW A;  4IL6 O;  4AKR A;  3DWO X;  4GCP A;  2XE2 A;  7PRN A;  2O4V A;  3POQ A; 
#chains in the Genus database with same CATH homology
 2R88 A;  1T16 A;  2R4P A;  3PF1 A;  2R4N A;  3BRZ A;  2R4L A;  2R89 A;  3DWN A;  3BRY A;  3DWO X;  3PGU A;  3BS0 A;  3PGS A;  3PGR A;  2R8A A;  2R4O A;  1T1L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...