3BSNA

Norwalk virus polymerase bound to 5-nitrocytidine triphosphate and primer-template rna
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
484
structure length
479
Chain Sequence
b'KGTYCGAPILGPGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEPRGKPPKPSVLEAAKKTIINVLEQTIDPPDKWSFAQACASLDKTTSSGHPHHMRKNDCWNGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDLATMIRCARAFGGLMDELKTHCVTLPIRVGMNMNEDGPIIFERHSRYRYHYDADYSRWDSTQQRAVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCTSQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLKEYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGPNHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELDFYVPRQEPMFRWMRFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA dependent RNA polymerase
publication title Structural insights into mechanisms of catalysis and inhibition in norwalk virus polymerase.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Transferase/rna
total genus 148
structure length 479
sequence length 484
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2007-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.100 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Arc Repressor Mutant 3bsnA02
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 3bsnA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3bsnA03
2AQ4A 4PUOB 3BSAA 2IJNA 2IM1A 5L1IA 4F50A 1SH3A 4ZP9A 1RT2A 4PWDA 3LP1B 3UDLA 3BR9A 2JC1A 5DGBA 2IC3A 2VG6A 1LWEA 2OPQA 4JV1A 4DL5A 4TLRA 1S1UA 1CSJA 1HQEB 4RNOA 4HYKA 2VG7B 3N6LA 3FFIA 2AGOA 3DYAB 1KHVA 1QUVA 4RUAA 3IG1A 5KT6A 4R5PA 3G86A 4IFVB 4KE5A 4QW9A 1KLMB 3GIIA 4ECUA 3CJ3A 4NCGA 1S1VB 4DL2A 2FVSA 5C42A 3BQ1A 2BQ3A 2AU0A 1EP4A 1EETA 1S1TB 2R8HA 5HLFB 4IRKA 2BANB 5KFZA 3KLIB 4NLXA 4RW6A 1D1UA 4GC7A 3GV5B 2W9CB 3NBPA 1S0NA 4LQ3A 5KFXA 2V4QA 5KG2A 5EUHA 1U09A 4LQ9A 4XPCA 1TV6A 4J9NA 4WFXA 2E9ZA 4IH6A 1IKXB 2W9AA 4ED2A 3HVWA 5K14B 2YNGA 4QW8A 5L9XA 4FS2A 1DTQB 4DL3A 3RB6A 3Q8QB 4ED7A 4B3OA 2I1RA 4DG1B 3KLHB 4ZPAA 2IM2A 4TYBA 2YNFB 3BSOA 3CWJA 4ZVEA 3T5HA 4ICLA 4KO0B 5DQHA 1RT6B 3LAMA 4LSLB 3KLGB 3KK1B 4FS1A 4NLWA 4K4TA 2AX0A 3MR5A 2W9BB 1QAJA 4JUZA 2FLNA 2VA3A 1IM4A 4KAIA 4Q43A 1QE1B 4GC6A 1JX4A 1HPZA 4H4MB 4LSNB 4TN2A 3TQ1A 2ILYA 3PW5A 3M8QB 1T05A 3DOLA 5KG0A 2XC9A 4ECWA 2QE5A 2VG7A 2BR0A 4ZP8A 3DYAA 3LANA 3GIKA 3V81A 5J2QB 2WCXA 4ED6A 2CJQA 1S97A 3DOKA 3I5BA 2R2SA 4WE1B 3IGNA 1DLOB 3GYNA 2JEJA 2ZKUA 3I0RA 3KMSA 2ALZA 1KLMA 2I5JB 3BGRB 4ID5B 4O44B 1LW2B 3BJYA 3N6MA 2B43A 4Y2CA 4URGA 5I42A 1LWFA 4KKOB 3MR6A 1C1CB 3E01B 1S9EA 2IMWP 3KK3B 4FBTA 4R8UA 5HBMB 5EWGA 4EBEA 2DPJA 4MIAA 3SFUA 5DG7A 1HYSB 4Y34A 1S1TA 4ED8A 3MEEA 5J2NB 2BANA 5CYMA 1JLBA 4RUCA 2OPRB 4TY9A 5I3UB 3QZ8A 3T19A 3RAXA 5F8HA 2W9CA 4ZP7A 3DM2A 5KT5A 1JLAB 2O5DA 4J9KA 1XR7A 2HNYB 3OLBA 4KBIA 1DTQA 5CYQB 4J9RA 2B6AB 5J1EB 4DG1A 2WRMA 4MK8A 4IKAA 1TKZA 5KT3A 3LP0A 4O3PA 1JLGB 3PVXA 1HMVB 3QGGA 4RW8B 3KLGA 2YKNA 3BREA 1IKWB 3KK1A 2W8LA 5FDLA 2W9BA 3PR4A 4NRUA 4RW4B 1S4FA 3GIJA 4URQU 1FKPB 5KG6A 2YNIA 2F8EX 1VRUB 4MFBB 4TQSA 2RDIA 3MEGB 4H4MA 4O3QA 1TKXA 1JLCB 3DMJA 2XI3A 3CVKA 3ITHA 1IKYB 2J6UA 4NLTA 4ZP6A 3FDSA 4ECRA 4NLRA 5JXSA 4KB7A 5KT4A 5J2QA 1VRTB 3DLKB 3EZUA 5KFNA 2IAJB 4WE1A 2R2TA 2FJWA 1RT4A 3H59A 2JEFA 4QWAA 1T03B 5KFTA 4Q44A 2I5JA 4ID5A 4O44A 4K4VA 3M9NB 4Y2AA 2UVVA 1TL1A 3C6TB 5KFDA 5DQIA 1FK9B 2FLPA 4Y3CA 1C1BB 4EO6A 3UPFA 5J2PB 4KKOA 4RW7B 1C1CA 1RT3B 4I2PB 2V4RA 3KK3A 5L1JA 4ZHRB 2WK4A 3OL7A 4ECXA 4K4SA 1S10A 4EYHB 1I6JA 5KFWA 2V0NA 1RDRA 4U6PA 1HYSA 5KFVA 5J2NA 5C25B 5I3UA 1RT1B 4IDKB 4YR2A 4O4GA 2RDJA 1NNDA 1REVB 1TL3B 1HNIA 2D41A 3GV8B 1JLAA 2WTFA 5KG7A 4J9MA 2C2EA 2HNYA 1TKTB 2UUWA 5F8IA 2VG5A 3V6DB 1RTHB 4Q8EA 5CYQA 4RNNA 2B6AA 3NL0A 5DG9A 4G1QA 3C6UA 4ZMMA 2FVRA 1JLGA 2D3UA 3HKWA 3H5XA 1SV5A 1HMVA 4RW8A 3KK2B 2YKMA 3CJ0A 4K4WA 1RTDB 3H40A 4IRCA 3BSNA 2OH2A 4IR1A 1J5OB 4ZVHA 4ECTA 1VRUA 2FVCA 4MFBA 3PW2A 1ZETA 3G6VA 1JLQA 1XR6A 2B5JB 3ICLA 3MEGA 4O3OA 2OPSB 1LWCB 3CDUA 1IKVA 4NLPA 4TXSA 1C0TA 3HVTB 4ECVA 4H54A 3V4IB 3OLAA 2C2RA 3DLGB 3T5JA 4K4YA 2C22A 1VRTA 3QIPB 4RNMA 1JXLA 2IAJA 2JEIA 2BRKA 1TVRB 3MEDB 1N6QB 1NHVA 1JLFB 2EC0A 3KOAA 4YQWA 3RB4A 1T03A 2UVWA 4IFYB 3QO9A 5KFCA 1N5YB 4PQUB 3NGDA 3G6XA 1FK9A 1C1BA 1JKHB 3ISND 3FSIA 3G6YA 4RW7A 1YVFA 5J2MA 1RT3A 4I2PA 1S9GA 3NKYA 2RKIB 4ZHRA 3TAMB 1R0AB 5F8LA 1KHWA 3HHKA 3KLEB 4PUOA 1QAIA 3KMQA 3HVAA 1K1SA 4H4OB 1RA7A 4URSA 2IJFA 5C25A 2GIQA 3LP1A 1JIHA 1RT1A 4IDKA 3KHRA 4Q0BB 1RT7B 3DRRB 5KT7A 1N56A 2XWYA 1R0AA 1REVA 4TY8B 1HQEA 4Q8FA 1TKTA 3V6DA 1RTHA 3ISNC 4NLVA 1RTIB 4TYAA 4M94A 5KG4A 2VA2A 4ECZA 3PR5B 4J9LA 4IFVA 1JLEB 4IH7A 4RW9B 4OL8A 1S6QB 3GIMA 1S1VA 4I2QB 1HQUB 2HNZB 1S1XB 1T3NA 4KSEB 1RTDA 3OHAA 2QV6A 3GV7B 4J9SA 4XPEA 3NMAA 1J5OA 5T14A 3KLVA 2WHOA 3H5SA 5HLFA 2HMIB 1W25A 2OPSA 1LWCA 3KLIA 4J9QA 1RT5B 4TQRA 3KHHA 3V4IA 4ZVGA 3DLGA 2FJXA 1C0UB 5KT2A 4O3NA 3QIPA 4IG0B 4IRDA 1RA6A 3MEDA 1IKXA 2RF2B 3MFIA 1JLFA 3CDEA 4ECYA 5K14A 2WONB 1N6QA 4IFYA 4PQUA 3KLHA 3T1AA 1K1QA 3QLHB 3LP2B 1JKHA 2YNFA 3H2LA 3MF5A 3M9MB 4KO0A 3DI6B 2E9TA 1RT6A 4LSLA 4MKAA 3OHBA 2AWZA 4H4OA 4PWDB 4WFYA 3LALA 3JYTB 3KHLA 2W7PA 4DEZA 2IC3B 1LWEB 1QE1A 4QWBA 1RT7A 3DRRA 4IQXA 1S1UB 3MTKA 4LSNA 5KFHA 2XGPA 2ATLA 3M8QA 5KFMA 5JUMA 3RB0A 2BE2B 5F8GA 4RU9A 3IS9B 4QWDA 1S1WB 4EBCA 1RYSA 1DLOA 1HNVB 1S48A 2BQRA 4FBUA 3BGRA 1N48A 1LW2A 4MK9A 4EBDA 4WZQA 1S6QA 1S0OA 3H98A 4I2QA 1HQUA 5C42B 4ZVFA 4F4WA 1S6PB 2J6SA 3CJ5A 4NLQA 3E01A 5KFAA 5HBMA 2IA6A 3I5AA 3IRXB 5EWEA 3V6HA 2BQUA 4R0EA 4NRTA 4WXWA 3EPIA 3PJWA 4YR3A 3CJ2A 4QWEA 4I7FB 4WFZA 4RW6B 2FLLA 4DL6A 4DL7A 2R2RA 3BQ2A 2OPRA 2R2UA 3NBPB 5KG1A 4F4ZA 3H4BA 3VQSA 2WOMB 1MU2B 3BQ0A 1TV6B 2JC0A 3FRZA 4JV2A 5KFJA 3QZ7A 4EYIB 4IG0A 1SH2A 3OL6A 5F8MA 2YNGB 2RF2A 5F9LA 4F4YA 4B3OB 5KG5A 3PJXA 3CJ4A 1OS5A 5KFPA 3I0SB 5J1EA 3I5CA 3RBEA 1SUQB 4U7CA 4ECSA 1ZTTA 2DPIA 1BQNB 4HKQA 3QLHA 3LP2A 4ICLB 4IR9A 1FKOB 1NHUA 3MR2A 3OSNA 4K50A 3DI6A 5DLGA 1S0MA 4NLGA 3PHEA 1IKWA 1RTJB 2JEGA 3IN5A 4O3RA 4RW4A 3JYTA 2ASJA 3M8PB 1LW0B 1FKPA 1T94A 1HPZB 2HWHA 2WB4A 3UR0A 4KHRA 5EWFA 4DL4A 1T05B 3NAHA 3DOLB 4MK7A 1JLCA 4YP3A 1ZTWA 2YNHB 2IBKA 1IKYA 5EDWA 3GQCA 3V81B 5C24B 4WYLA 2BE2A 5D3GA 4X2BA 2D3ZA 3T5LA 1MMLA 3DOKB 2JLEA 3IS9A 5KFYA 4IG3B 4KV8B 2R8JA 1S1WA 2AX1A 3DLKA 3I0RB 3QYYA 1UWBB 3M9OB 3PW7A 3DDKA 2ZE2B 1HNVA 2C28A 4NLOA 3KNAA 4KFBB 3QGHA 4RZRA 3Q8RB 5I42B 1LWFB 3C6TA 3TVKA 4YR0A 1S9EB 5J2PA 1S6PA 4R8UB 5KFGA 2R8IA 1SH0A 3IRXA 5KFLA 3DRPB 2GIRA 4EEYA 3DLEB 3MEEB 4MH8A 3IGVA 5C5JA 3Q8SB 5CYMB 2W7OA 1JLBB 5HP1B 4I7FA 3H4DA 2AGPA 1HARA 4QWCA 2C2DA 5KFOA 5HROB 3DM2B 2WOMA 1MU2A 4ZPCA 2R8GA 3QGIA 1TL3A 4IH5A 4XO0A 4K4XA 4NLUA 4ECQA 1DTTB 3JSMB 2UUTA 2FJVA 2IM3A 1S49A 4NYZA 1TKZB 2ZD1B 3I0SA 3LP0B 5F8JA 1SUQA 1XR5A 4IOBA 5KFIA 1BQNA 3H5YA 4G3IA 5L1KA 1FKOA 2YKNB 2XCAA 5FDLB 3KK2A 3GILA 4M95A 4F4XA 1RTJA 4ZPDA 3DRSB 3KLFB 5F8NA 3NAIA 2YNIB 1BQMB 3M8PA 1LW0A 2OPPB 1GX6A 2UVUA 2CKWA 3MECB 1RAJA 1TKXB 3V6JA 3DMJB 3T5KA 3PW0A 3ITHB 2B5JA 4NLDA 2YNHA 3D28A 3HVTA 4MKBA 5C24A 3OSPA 5DG8A 2ILZA 3N6NA 4IG3A 4KV8A 5DLFA 1RT4B 2D7SA 4RNHA 1UWBA 3RB3A 5KFFA 3OL8A 1TVRA 2ZE2A 5DGAA 4EO8A 1RYRA 4KFBA 1TL1B 2J6TA 2HNDB 1N5YA 5D3GB 3QIDA 3E51A 2W8KA 3KJVB 3UQSA 5KFKA 1S9FA 2BRLA 4ED0A 3KHGA 4QPXA 2RKIA 3CO9A 4J9PA 3TAMA 3CDWA 3DRPA 3DLEA 3KLEA 1RT2B 4O4RA 5HP1A 4WXOA 1Z4UA 2ASLA 4O4GB 2VG6B 2OPQB 2ASDA 4Q0BA 3MFHA 2XCPA 4ZPBA 1HNIB 4YMEA 5HROA 3RBDA 3FFIB 4TY8A 2VG5B 1GX5A 2IM0A 4K4UA 2FVQA 1WNEA 4WZMA 3D5MA 3Q8PB 1RTIA 3LAKA 1DTTA 3IG1B 4R5PB 3JSMA 4NZ0A 4WYWA 5DQGA 4G1QB 3C6UB 3MR3A 1TQLA 2ZD1A 1JLEA 3EPGA 1N4LA 3BSCA 1SV5B 4RW9A 1C2PA 4NCGB 4Q45A 5F9NA 2HWIA 2YKMB 3FQLA 1TP7A 3PW4A 5KFUA 1D0EA 5L1LA 4O3SA 2HNZA 1S1XA 3DRSA 3KLFA 3SFGA 2FVPA 4K4ZA 4MIBA 1BQMA 4J9OA 3SI8A 1EP4B 1EETB 2AGQA 2OPPA 3RAQA 1JLQB 5KFRA 3MECA 2HAIA 3OL9A 4NLYA 1IKVB 2XGQA 5KFEA 1C0TB 2HMIA 2UVRA 3V6KA 1RT5A 5KFQA 2V9WA 1C0UA 4NLSA 4ED3A 4ED1A 3QO9B 2GC8A 2E9RX 2WONA 3FQKA 5KFBA 2HNDA 2XI2A 3PZPA 5J2MB 3KJVA 1S9GB 4KHMA 5KFSA 3CIZA 4JV0A 3H5UA 4RNFA 5KG3A 2R8KA
chains in the Genus database with same CATH superfamily
3K89A 2EFNA 2B9XA 3UDLA 3QPIA 2MLYA 4ZK7M 4UOCA 1YRXA 1DAXA 1R8BA 1SIWA 2XLKA 4USWA 4BHQA 4ECUA 4NCGA 4LIWA 1CQNA 3BQ1A 4OJ1A 2J9EA 3ZC4A 2P6TA 1CJKB 1T9XA 4DFJA 4R25A 3D0HE 5K8NA 1BXNA 2I1RA 3NY0A 1XC9A 2U2FA 4CP5A 1GAOA 3LAMA 3VAJA 2AX0A 3MR5A 4JUZA 2HSEB 4DR4F 2QN6B 1L3UA 1HPZA 4H4MB 5IT0A 5A0YA 2V2VA 4OX9F 1RACB 4DV5J 2E5GA 2YTCA 4JI7J 4K7QA 5HANA 1LW2B 3QT6A 4JI3F 1IJFB 1Q8BA 2A6OA 2FZKB 2HEKA 1HYSB 1CPZA 3SBMA 2K29A 2QA4G 2W9CA 1SJ3P 4C8YA 4RR5A 3RAMA 3CIMA 2AEFA 1HBOA 1MYLA 4KJIA 2HIQA 2HQGA 2KFNA 3R1LA 3QSIA 3K5MA 4YB6A 1IBLJ 2CPZA 1VBYA 3FDSA 1IBCB 4ZIVA 1VRTB 2M7SA 2J7WA 3T1HJ 4I6YA 5GAGU 1NJZA 1QD1A 4EO6A 1C1CA 1B3TA 2ZKTA 2L9WA 2V0NA 2E7VA 4DI6A 2LU1A 1HNIA 2AYEA 2BA9A 4LFAJ 2BJEA 5ETTA 2B6AA 3NL0A 4OYAA 1JLGA 2K8GA 5FLXU 3H40A 1KNZA 2X3GA 1VBKA 3A8KA 2BJ7A 3ILLA 3HZEA 3K59A 4YQWA 4G65A 4OI0A 2HHHJ 2K7KA 1RT3A 1S9GA 2I8EA 4ZHRA 3SXLA 4DPOA 2AKWB 2B4PA 4ZN1A 1XNQF 3I55S 1NJIT 2ALYB 4KH1B 3AH6A 3F41A 4TYAA 2VA2A 2OAUA 1NKBA 2CG8A 1MROB 3KDOA 4ZLLA 1BY9A 3KHHA 5HJXA 1WC1A 3W5ZA 3J80Y 2JOQA 1IKXA 5CH7B 4A8MP 4OHYA 4PYDA 4MKAA 3QMQA 3A1YG 3LALA 1NRKA 1OYEA 5D4PA 2E1MC 1GMWD 1T02A 4FYVB 3TZWA 1WELA 4B3MJ 3HT0A 1R8CA 2EK6A 5SUHA 5HQLA 2CG4A 1FRKA 1VQ7S 4R0EA 1RHKB 3A8IA 3P5TL 5A8WA 2HRUA 1UWAA 4WFBQ 5BYSA 5F8MA 3PJXA 2KYZA 4U7CA 2BOPA 4ICLB 2JVOA 1WORA 1LW0B 1CS4B 1CULA 2DNGA 3NAHA 5C24B 4KT0C 1VI7A 1Q5YA 1EB0A 4X4NA 3PIOQ 1KRPA 5THWA 3AX3A 4HI2A 4DV1F 3CD0A 3DC2A 1ELOA 1FDAA 2DRAA 2DY9A 3PX6A 2HYIB 2R4FA 1UVKA 4DQIA 3H5YA 2IVMA 4A8QA 4B3RF 4P74A 3KK2A 4C3MA 4BBYA 1RAJA 1VHFA 3AOCA 4NLDA 1N34F 4MKBA 3D68A 4IOCQ 2CZ4A 3N6NA 3ZZRA 1XERA 3CCTA 1N33F 3SSQA 4NA2A 1L3VA 5HJYA 2AJQA 1FE0A 1JK9B 2ASLA 1D09B 2VPXB 1YWXA 1RQ0A 2B7BB 2H51B 2G0IA 1PAUB 3BDEA 4R5PB 1TQLA 1Q78A 1TP7A 1S5ZA 2XS7A 1FX2A 2HAIA 4FVCA 1GXUA 5BYQA 4DSEA 3J81U 2EPIA 3SCIE 1W2IA 2KZZA 2F4FA 4ED3A 3G6ES 3KNGA 4FPIA 1Q8KA 3NWGA 4UF4A 5KFBA 2GHVC 5CABA 3MM7B 1S1UA 2YX7A 2W4PA 3N6LA 5ETRA 4IFVB 2KZMA 4DFKA 2HQ3A 1TUWA 3FCWA 2NUHA 3BKUA 2BQ3A 2A6MA 1EETA 1S1TB 1I94F 4DOZA 3S8SA 3JSBA 4OYPA 3PKMA 4LQ9A 1N5VA 1N5SA 4WFXA 2W9AA 2KI2A 2GGPB 1DTQB 3RB6A 4DSFA 4PCQA 1RAOA 1U8SA 2CPJA 4ME7E 3MTJA 2CNKB 1Q7YT 4DL0C 4OJGA 5ADZA 2W2QP 2MHNA 2CJYB 2ZNYA 4F0MA 4P52A 2VL1A 4JYAF 1HWIA 2WBRA 3SZ2A 1FXRA 4DV4F 4C8KA 2ALZA 4CDIA 5ETQA 2J0WA 3W8GA 4QYRA 4USKA 4EBEA 1A9NB 3KJQB 2VFTA 2ZZMA 2J76E 5M2PA 3T19A 5F8HA 3W63A 4C11B 4J9KA 4PQAA 1YK9A 1HBMA 5DDOC 2MSSA 2UXCF 5L9NA 3Q8VA 3CE8A 4NPOA 1OWXA 5A76A 1U0HA 1X4BA 4JI5F 2M3DA 2GCFA 1VRUB 2VODA 3ZZOA 5LXRA 1TKXA 3NP5A 1X4AA 1LFWA 2C2ZB 1VBXA 5J2QA 2AHOB 5KFNA 1I51B 1HD1A 5KFTA 4K4VA 4HHHA 1C1BB 2KVQE 1P94A 2XLJA 4DQRA 4A4JA 5G4DA 4CYUB 3NNAA 4B02A 1KOOA 3FMBA 3C6UA 3EVWA 4WIQA 4RW8A 1R89A 3FBBA 3CCMS 4CI0B 1H98A 3G5OA 4ED4A 4PG4A 4DPXA 4UUWA 4OZ5A 3EUNA 3D67A 2EC0A 3G6XA 4J5OA 1Q53A 3NKYA 2QSWA 4PUOA 4M5JA 2XWYA 4DUZJ 2FHJD 2QGFB 2UUBJ 4DX5A 5D77A 4IH7A 3D1HA 3U1MA 2WAQD 2NXNA 2DR8A 5D4NA 1J5OA 1F5AA 3SQOP 1RT5B 4I67A 4KQZA 2AJ1A 1XEZA 2RH3A 3MEDA 5AXKA 3CCES 1FVSA 1RLDA 1X4HA 5A8RB 4WTOB 3PO5A 1K1QA 2GVDA 4LSLA 5E3QA 1UFLA 4R0JA 2XMMA 1QE1A 1RT7A 4LSNA 2LEAA 5KFMA 3TZZA 1XMOJ 2IRUA 3HSGA 3O5TB 1HNVB 2BQRA 1S6QA 2BJ9A 2J6SA 3UNGC 3N79A 4NLQA 3E01A 3P96A 1LEOA 1U1RA 3K2YA 3W9JA 2X1GA 3ELHA 1IRQA 4EYIB 3AD7C 4E98A 2CQ4A 3L09A 1RSCA 1VJWA 3I0SB 2XMUA 2HQFA 3E2EA 3BN7A 1S0MA 3IN5A 3JYTA 3M2UA 4PZVA 2KG0A 3AT1B 4C98A 1VQ5S 1EAYC 1RHMB 1MMLA 2MQLA 1GH8A 4G1IA 3I0RB 3PW7A 2ASYA 4JI8F 2V68A 1NH7A 3M30A 2QA4S 3RRGA 1B01A 3UN5A 2DNNA 2D74B 2AGPA 3G8TA 4F2SA 5HROB 1ARQA 4KPYA 4QR1A 2WSEC 1X93A 3M2VB 4IOBA 2MZ1A 1RAGB 4DV0F 2FJAB 1SIZA 2OELA 3CJQA 2CKWA 1OMSA 1NKCA 2LCWA 4FNIA 1EA4A 3OFGA 5DG8A 3ILJA 5HVFA 2ZE2A 3NLCA 1W26A 1HBNA 3TRGA 3NCRA 2QJ3A 3TX8A 2RKIA 3TAMA 3KYLA 5D0RA 2A2BA 4O4GB 4ZPBA 2RQKA 2M70A 4PXEA 2J9DE 5IWAJ 1DTTA 3PM9A 5DQGA 4U95A 4FYXB 4CT8A 1QTGA 3ADAC 4RW9A 3GONA 4AUKA 3PW4A 4KGXB 1WF2A 4XDCA 2AGQA 1IQTA 2Q2KA 3OL9A 2QC3A 1KSPA 4Z37A 3QT5A 2DIUA 2CJXB 2WONA 3MD3A 3FQKA 1QTMA 3CNQP 1FJGJ 3LH2S 1Y3JA 1OJ4A 2R7QA 2W1BA 2RAQA 4RNFA 1M1GA 4PXBA 4XIUA 2X7IA 2JSXA 1IUJA 4DLGA 1F60B 4DX6A 2AGOA 3FZ2A 3NRBA 4Q2MA 1KHVA 3IG1A 2YWFA 1J5EF 3GIIA 3RW7A 2Z30B 3GLJA 4DF8A 1VQNS 4GO5X 1O0PA 3A3NB 1SJQA 1YJ9S 4HR2A 2BANB 3IP0A 5AJ3F 4GC7A 4IO9Q 3HHLB 1NZ8A 4CCHA 2QFIA 3OTDA 2ROEA 3FT7A 4B3OA 2PI4A 4E2FB 3R1HA 2W9BB 3ETMA 2EK1A 2M4MA 1JX4A 3KG1A 2Y8WA 1WKKA 1T05A 2VONA 1UVLA 2V94A 3CCUS 2AJ0A 5E0OA 3N6MA 1RXOB 2R7XA 2PMZD 3MR6A 4R8UA 2LA4A 3CUNA 2KOEA 3D54A 3BZQA 2NR0A 3IRWP 4USMA 2ZVIA 1KR4A 2O5DA 4OYBA 1HNZF 4DR1J 5E3PA 2CADA 4GVBA 1Z2ZA 4DFMA 1TKZA 3M2RA 5K8OA 3KK1A 3M8SA 5AXMA 1PC4A 1N52B 2HGMA 2C2OB 4OZ1A 1X7VA 2XI3A 2J0SD 3GIRA 2K5JA 2QG9B 5IQQA 3C6TB 2V4RA 3DHXA 2ZWOA 1REVB 2XYHB 4JOUA 1XMBA 2NZCA 2ZOFA 3CO0P 2W2NP 2W2PP 1SV5A 3J7A1 2SXLA 1Z1ZA 1UEKA 2ZEJA 4WIIA 4ZVPB 4YS2A 1KLNA 5LSOA 3V4IB 2Z8QA 3HFZB 2JFKA 1J27A 1JXLA 3Q86A 1TVRB 1S6UA 2DISA 3PEHA 3RB4A 1YDLA 2UUAF 4PQUB 4P2SA 4BWJA 1KKHA 2GO8A 3JQMA 1K44A 1RT1A 1X4CA 1R0AA 5A8KA 3A8JA 3V6DA 4OI2A 1JJ2R 2IIHA 1EQMA 1Y7PA 3MMCB 4O0NA 4WU2A 1AUSL 1H0HB 3TUZC 4LRAA 2LXUA 1U49A 3GFHA 2A3JA 4S0MA 3IMQJ 2F8HA 1DQAA 3CDEA 2XMKA 2DNRA 3M9MB 2EKNA 2XTCA 1VQYA 3PX4A 2LP4A 4PWDB 1VQLS 1UVIA 1CVJA 3UW1A 3P8BB 1OPIA 3UE2A 3VAIA 3NGKA 2CQIA 4WZQA 2R7OA 2C3UA 3QFWA 2X3DA 4I7FB 3THVA 2VIHA 1UUJA 1UW4A 3GP9A 2VJVA 4QBUA 3WDOA 3CCRS 2KVIA 1FERA 4C4WA 5C7PA 1OY9A 4F4YA 3DLBA 2DHXA 4OI3A 2HAFA 4K50A 3DI6A 2JEGA 4PXDA 2G4BA 5EWFA 3DDIA 1TFYA 6FD1A 1FD8A 1G4CA 2AX1A 3KNAA 1FDNA 3OR2A 2GPEA 3WQPA 5J2PA 1S6PA 2YXLA 4ZLNA 4MJKA 2GIRA 4LF7F 2W7OA 1X4DA 4QWCA 3MPVA 3OTEA 2B0GA 2E5IA 2MY7A 4C0BA 2BNWA 3JSMB 2GQCA 2YQ3A 4LFCJ 2ZH7A 3IWNC 2YNIB 3MM8B 4ZIWA 3JQJA 4Q2LA 3V6JA 2HBQB 2BJ1A 4DR3F 2B3TB 5KFFA 5DGAA 1KVIA 2FHKA 5D3GB 2W8KA 3UQSA 4ED0A 3TUPA 3CO9A 1GQEA 3TA1A 4DV7F 2OPQB 2ASDA 1R31A 4TKTA 3FFIB 2D68A 2ZC3A 1U4BA 2BOAA 1JLEA 1N4LA 4QZVB 3FQLA 4ZCMA 1AROP 4HACB 1NDLA 3G4SS 3C8YA 1N0UA 3C16B 2DNOA 2DXDA 3QO9B 3HVRA 2E9RX 2UXDJ 4KRWA 1REGX 3DGPB 1RT2A 1AXQA 3CCVS 5DGBA 2VG6A 1SC4B 3S7RA 3OJSA 1X0FA 2QIFA 3CD6S 2P6SA 3Q22A 2KM8B 3F44A 2DR9A 3C46A 2RRNA 5EHHA 1FRXA 2GX8A 4OZLA 2VV5A 1YJVA 3IM8A 1I1GA 2LXFA 3EWGA 3IO1A 1RHUB 1RCOB 6FDRA 4CM2A 3THPA 2HRTA 2G0CA 2YBVA 2M9KA 3MMBA 2I9SA 2MB0B 4TN2A 1EARA 2BR0A 3DYAA 1WHVA 1FTRA 3DOKA 4WE1B 4OMFG 4DPWA 2BABA 4HDHA 1XJWB 5CYMA 3GSDA 3HM9A 4F67A 4DQSA 1VK8A 1T9UA 5CYQB 4DG1A 4IKAA 1B7YB 4N41A 5JVGQ 2LEPA 1HMVB 1S79A 3BREA 1IKWB 2DHSA 5FDLA 1VQKS 4P2FA 2RQMA 1HI8A 5I3QA 3L9ZA 3UO0A 3LOUA 3JS9A 2ZITA 1FHTA 2MXYA 4Y2AA 3W2WA 5KFDA 2FLPA 3B4DA 3OTCA 4CTAB 3A4TA 2CVEA 3GCWP 2DKOB 2O1PA 4DCOB 3GV8B 1YJRA 2DO4A 3QAEA 3N9UC 2RSQA 3SCKE 1WWHA 5E3AA 3MAAA 2C2NA 3IWXA 2CRLA 4I6WA 3ICLA 1LWCB 3CDUA 1QTNB 4NLPA 3AQPA 3ILOA 2QL5B 5GMKa 3AOBA 2IAJA 1U48A 1FFWB 1JLFB 1T03A 1OO0B 1UJ4A 4RW7A 1YBUA 2EXUA 3HHKA 1KHWA 2OLWA 1NLKL 4URSA 2FB0A 4P2XA 5CXTA 1RTIB 1Q82T 3R8YA 3FC9A 3DCAA 1NJWA 4DV3J 3W9HA 2QV6A 2H48B 3SCJE 2PEHA 3H5SA 1RCXB 2ZJQQ 1CJKA 4J9QA 2R7VA 3MI7X 4IG0B 3NS7B 4IFYA 2E66A 1VQMS 2KHCA 3QLHB 3NNHA 3SIPB 3DRRA 2XGPA 2XQCA 4MKYA 1DHMA 2EI5A 5B08A 1WSRA 2CPEA 1RBAA 1LW2A 4MKVA 4I2QA 4TVAB 3K58A 2VFSA 2BQUA 4RW6B 5B0BA 4CM0A 4F4ZA 2YWKA 1MU2B 5ETPA 2BKNA 2KFZA 2ZNZA 1OS5A 4X66J 2KB2A 2FC8A 1FKOB 1YBTA 3OSNA 1KD1T 1JB0C 1FWKA 1XK8A 2KXNB 1QLNA 2D69A 2HWHA 3UR0A 5EX3A 2MKYA 2YNHB 1E6VB 4CLWA 3QJJA 5LJ3Y 3M9OB 1OSCA 3M8ZA 4CQ1A 3OPKA 4X64J 3H4DA 3TYTA 4AQYJ 4KGKA 1NSQA 4NLUA 4X62J 1R27B 1SI9A 3IA0A 5F8JA 4IOAQ 3CXCR 1PKUA 3DRSB 5F8NA 4TNOA 3MCSA 1VQ9S 3SV4A 1Q1KA 3MMAB 1IXKA 2CPFA 2RB7A 1SJ4P 4EMDA 4IG3A 4U8VA 1TL1B 1CJVB 1TZ0A 4N8OA 1Q0NA 4OLOA 3DLEA 3QRPA 3WBZA 4WXOA 1Z4UA 4YEAA 1F9FA 3IBCB 2LA6A 4BC7A 4WP9A 2ZH8A 3HPOA 2R7WA 2OSQA 2P5VA 3Q8PB 2B8QA 4X65J 4X4OA 4OIXA 4F7VA 1RJJA 3BF4A 1C0TB 3O8WA 1UAWA 1X4EA 2LQ5A 1WC6A 2MDAA 5IT9Y 2KHDA 2DY1A 5LJ5Y 2R7SA 3BR9A 8RUCA 2OEKA 1WTFA 3JQKA 4DHVA 4DSLA 2FHOB 5EN1A 1Y5IB 4QPTA 3M6WA 4QW9A 3CCLS 1MW7A 2V8PA 3CJKB 1TK5A 2HHUA 1RISA 3RYLA 5CZXA 5KFZA 3H25A 2A2DA 1AFIA 2VASA 3EDQB 2GIFA 3H2UB 5EUHA 1M1HA 3OD2A 1VS3A 2ERRA 4IH6A 3HVWA 4C0OC 2YPYA 1IBKF 4ICLA 3BS9A 3Q2TC 1F2HA 1U24A 2YKQA 3M32B 1D8YA 2MSTA 4ILRA 3ZO7A 1B0TA 2DGOA 2RILA 2CQHA 4RO0A 2QT7A 2QYCA 3IGNA 2Q3PA 1KVKA 2VQEF 1KLMA 4O44B 1RU1A 4A8KA 3MPUB 2IMWP 2ZOGA 5HBMB 2DHGA 3IC1A 4A8XA 1HLWA 1X8DA 4CLKA 1B4SA 1YJNS 4KBIA 1RZMA 2WRMA 6AT1B 4O3PA 2V8HA 2HFVA 1XIQA 5B0EA 4NRUA 2AJFE 4IYQA 4AXIA 3OQ2A 4X4TA 2R2TA 2JXGA 3H59A 2I5JA 2K2PA 2BA3A 1KVJA 2B9EA 3KK3A 5LXYA 3HZGA 3WC0A 3QWUA 1RP5A 1NNDA 3UN3A 2C2EA 1O51A 3MM5B 4OLPA 1VQSA 2D9OA 2Z2LA 1K47A 1IBMF 3LJPA 2BW7A 1G7CB 1ZETA 3MEGA 3OLAA 2C2RA 3BGFA 3CD7A 1NHVA 1Q81T 1VR6A 1ZAXA 2GJIA 1ZZFA 5C25A 3W5YA 1JIHA 4ZDNA 2RE1A 2EBGA 2XMWA 5IV4A 3PHTA 1RKJA 5AXNA 4IFVA 4EZ6A 4J9UE 2WSFC 1ZOTA 2JDJA 3AXKA 3DLLQ 1HHTP 2YPZA 4TQRA 2AEJA 3BKFA 2YKOA 4HT7A 3QIPA 1XNRF 1NK0A 4I0WA 3MR7A 3UN2A 5LOQA 3OXGA 1YHQS 2E9TA 3G8QA 4H4OA 1SBRA 4ZCLA 3HF5A 2ATLA 2VZ9A 2JXIA 3ULHA 3T6BA 2Y1LB 1U1KA 1DBDA 3K7RA 3TAQA 3VGTA 2NXUA 5IXUA 1FE4A 4MK9A 2NSCA 1XTZA 3VVUA 1NAQA 4WXWA 1X9MA 3H4BA 4W90B 2KDOA 4C11A 3EMTA 1WDTA 2YNGB 4B3TJ 2RF2A 5F9LA 3MM6B 3GJSB 1FFSB 3KKFA 4CO3A 5DS7A 2VICA 5HQ8A 5ETNA 2I2YA 1UZDA 2YQ1A 4NXNJ 1U9PA 3LF0A 3GB0A 3EVOA 4UQTA 3V81B 2OEJA 2F9JA 4X2BA 4AFFA 4OJHA 2J7UA 2DGVA 5E33A 3QGHA 2POKA 2H1YA 3EM1A 2Z0GA 4FXWA 3FCHA 1K9MT 3PACA 3Q8SB 4C8OA 4ED5A 5LSRA 1R8PA 2N7CA 3T9NA 3HD2A 3KJNB 3LQVA 2M0GB 3K57A 3PTWA 5U47A 1WOSA 4QIGA 1BQNA 2C3PA 3D9BA 2OD6A 2RUGA 4J37A 3UD5A 4F4XA 2UP1A 1D9AA 3TANA 3I56S 2AYGA 1F9HA 3KWMA 4E8UA 2PIIA 1KN6A 3CEDA 4EO8A 2J6TA 3ET6B 4LF6F 1S9FA 2FHMA 1ZA1B 3KHGA 4X4PA 3CDWA 5HMXA 3OFEA 1WG1A 4YOEA 3VZIA 5HI7A 3FCVA 2Q43A 1Q95G 4WYWA 4JBCA 4I4BA 1R43A 1TTHB 1V9OA 4MYTA 1PBAA 1RAIB 3MOZA 2HZCA 1MMNA 1X4GA 2YKPA 2DXFA 3V6KA 1RT5A 5KFQA 2V9WA 4RKUC 3ONQA 5H9EJ 5H9EK 3AJDA 2V69A 3BH7B 3H5UA 3DN9A 1V3SA 2FLOA 2B56A 3BB5A 2K1OA 3BGLA 1G6BA 4CT9A 3LTOA 2Q66A 2ZHAA 3AHPA 2UUCJ 4DL2A 4MMOA 3HDSA 3GFZA 4FKYA 2J9DA 3KLIB 4CNYA 5KFXA 4DPTA 4GKJF 5KG2A 1KEKA 2FGOA 4QW8A 4ED7A 4HI1A 3KLHB 5IT4A 4U96A 2CDRB 3CWJA 4DWIA 5DQHA 3KLGB 1QAJA 3BO2A 1NK9A 5H9FJ 4HVZA 4Q43A 5H9FK 4IUFA 2NLWA 4WPAA 2CQ0A 1PG5B 2ZKUA 3I0RA 4V1Ak 2QZ8A 1DFDA 4Y34A 3B4MA 4ED8A 3D6FB 1HA1A 1NEEA 2E5JA 1NHKL 3R2DJ 1JLAB 1XR7A 4KGVB 1VBZA 2CWXA 1D9FA 4F8RA 3SEOA 1PILA 3PVXA 2DNHA 4GRSA 3QGGA 5IOLA 5I4MA 3QWPA 4NLRA 3DLKB 3W62A 3T1YJ 4ID5A 4LF2A 3M9NB 4M1KA 3BDPA 2PN6A 4KKOA 4I2PB 3H20A 2OSRA 4WK3A 1WC3A 1GNKA 4O4GA 3C15B 2UUWA 3VV2B 3RRKA 3OV7A 1NO8A 2XYGB 5CCLA 3VVTA 4K0KJ 3LA0A 2OH2A 3UCUP 4DR5F 4ECTA 3Q0AA 2FVCA 4MFBA 5GAHI 2B5JB 4OZ0A 2VB6A 4ZOSA 4HT5A 2DGWA 3O1LA 3T5JA 4K4YA 4Y00A 2UVWA 2UU9F 4OI6A 1YVFA 5AT1B 1G3OA 3A13A 4YDDB 1YQHA 4L76A 2GIQA 2CJKA 2CJ9A 2BKPA 2Z2ZA 4J9LA 2RNEA 3TARA 1KQGB 1NDPA 1M90T 2HHXA 2HNZB 2R8KA 4PPZA 4WK1A 4ZPVR 2DGQA 1SB6A 4KSEB 1TKDA 1RTDA 2KO1A 1O6XA 3M7VA 1UA1A 3IFEA 1OYDA 3GU0A 4NASA 3MFIA 1N6QA 2DXEA 1F6TA 3I32A 1Y10A 4LF9J 2CYYA 1PBUA 2EWHA 3V2UC 1KP6A 1RWKB 1IR1A 3OBIA 1CLFA 4IQXA 1XQIA 1RB0A 1Q4RA 1LNQA 4DF4A 2AT1B 2LKZA 2OI2A 1RAAB 1PYSB 3CJ8A 4CO4A 2CQ2A 2PMWA 1EIYB 1IM6A 1AT1B 4KHPF 1HQUA 3N5FA 1HBUB 1VYAA 3IRXB 3ZTPA 4LF5F 1OY8A 3H2VE 2XY7A 2DK2A 4K59A 1FRHA 5ETLA 3OFFA 1TV6B 3WZ0A 1HKAA 5FLXY 4TU8A 4JI6J 1VC5A 4GKKF 4ZJQA 9RUBA 3D3CJ 2DCLA 4L72B 1NH8A 3DGVA 3FKBA 4CO2A 2NYHA 1Y9OA 4NLOA 3C6TA 2VBYA 4NXMJ 4Q5VA 1ZPWX 3UD3P 5A2QU 2H1OE 5SZTA 3DM2B 1PJ5A 4DR2F 3N5BA 4ID8A 4K4XA 2EEYA 2W25A 4RBTA 2VOOA 5LL6d 4WP3A 1NMEB 2MKHA 3FBFA 1GX6A 2UVUA 4JI4J 2RUSA 3D28A 3ZZTA 2MJNA 4WP8A 4ES1A 2BACA 4CLUA 1TVRA 1NK6A 2HNDB 2P9GA 3E51A 1RE1B 1FXLA 4OZJA 3MM9A 4O4RA 3EICA 3TVYA 2XBPA 3Q2SC 2XCPA 3RBDA 2RU3A 3W61A 4CH7A 3N28A 5D4LA 4NZ0A 3VAMA 1SIWB 4G1QB 4E0DA 4LF8J 1P1TA 1N36F 4NCGB 1ACMB 3MMCA 4Q45A 2YKMB 4XAKA 5IC4B 4PAAA 3SFGA 1BQMA 3SV3A 4L6V3 1IKVB 3UCGA 4LRBA 1WC0A 2R42A 1X5PA 2MMYA 2IYIA 3BH6B 5DDRC 3U27A 1O5JA 3Q8UA 4PEOA 4PWDA 2DR6A 4CIOA 1G2EA 4DL5A 1K0VA 1CSJA 1HQEB 4HYKA 1GEHA 5BJRA 1QUVA 5KT6A 4RLEA 4RUBA 4LR9A 1S1VB 2CPHA 2JRSA 2Z2MA 3MZIA 1VISA 2R8HA 5LMNF 1U1QA 1EZZB 1WF1A 2E1AA 2W9CB 2JHEA 1WEXA 1U6FA 4XPCA 1HBOB 1WACA 4ED2A 2DTJA 3QQCD 3Q8QB 1N32F 4D8JA 4TYBA 3J7Z5 4NZ6A 1AW0A 4J9VA 1KQKA 2HW3A 4DPYA 2CWKA 2ZZTA 1HR0F 4DMZA 1RWWB 4F3MA 2DJWA 1FNMA 3M05A 1EQ0A 2IMOA 3PCOB 3WC2A 2DNYA 5KAKA 1C1CB 3OXFA 2RBFA 4MIAA 1PIEA 1LK7A 4FN5A 5G0RB 3HFVA 1FRMA 4ZVQB 2MQOA 3TZXA 4NA3A 4J9RA 2B6AB 2XWXA 2CIMA 1D8ZA 5J1EB 5MLCV 1JLGB 3R97A 4DZ6A 1BWEA 4URQU 2YNIA 3MM8A 3J81Y 1S76D 4JI2J 4ZP6A 1H74A 3J7AN 2FJWA 3PV8A 2Y0SD 2G2ZA 1NK7A 4ZPTR 1H7XA 3QRRA 2MKCA 5DQIA 4JV5F 4Y3CA 5D3GA 1RT3B 4ZHRB 2KRBA 4YR2A 2BMBA 3OFHA 4F26A 2C3OA 1AFJA 3PFOA 3K0JA 2FZCB 2G2OA 1XBWA 4WBFA 2Z56B 1L3KA 1MMDA 1S57A 3CJ0A 3CMES 3I6PA 4USJC 5C2GA 4QOTA 4CLLA 2DO0A 2L3MA 2CQDA 4ZJOA 4YUDA 3C14B 3QO9A 2VQFF 3ISND 3K5NA 4Z7YA 5F8LA 4MJWA 2J5AA 2CAXA 4KY3A 3HLUA 2CQ3A 1MG7A 2HHQA 5CAAA 2F4VJ 2HS0A 3J7YI 4UOGA 4J9SA 4EUVA 4N47A 5T7LA 1H38A 2OPSA 5A8WB 1JJ4A 3U7JA 3GXQA 2EFPA 1WD6A 3T1AA 1F0XA 5B0DA 5CZVA 4OYIA 1CULB 2AEMA 2QX0A 1HWUA 4LRCA 1FX4A 1HNWJ 4LFBJ 1RYSA 1BHNA 3HHLC 4DPUA 5KOXA 2F9DA 4QWEA 3QT7A 4DL7A 3IR6B 2YY3A 2D3O1 4JI0F 1MN9A 3FGVA 2AZ3A 2OMLA 3FBEA 2FZGB 3A8EA 4DV2J 4MTPA 5IZHA 1F5CA 1M5SA 3T6JA 4IR9A 1QSYA 4I69A 2MQPA 5DZ6A 1IKWA 5K8MA 3AD8C 4KHRA 4DR6F 3MGJA 3W8PA 4ZVOB 4JP8A 4M5IA 4DU7A 3ENWA 3RBXA 2R8JA 1RABB 4UZCA 3MMJA 5KOWA 1KONA 3EZ5A 5I42B 2MHEA 4B3SJ 3R5BA 3QJPA 2H5IB 1NCLA 4KGMA 3EDRB 1SKUB 2CDQA 2KTQA 3S6EA 4LRDA 3HI9A 3PIPQ 2BNZA 1GMUA 2FJVA 2YX4A 2HHPA 2DHAA 3B54A 5KFIA 1XR5A 2YKNB 1S4EA 2J0QD 1FD2A 4KYZA 2DRDA 2PC6A 1ZH5A 4A8YA 2BE9B 3S01A 2LQBA 3G87A 1UMJA 3A3PB 1WI8A 3I4HX 1MYKA 3CMAS 3WHIA 1TL5A 1U02A 1B7FA 5HP1A 2MKSA 1RHRB 1UJ5A 3QAUA 9ATCB 3S1TA 3PRBA 3D5MA 1RTIA 3AJ2A 1UVMA 5GAGI 2V2QA 4RBVA 4O3SA 2XTEA 5BR8F 1S59A 1GXLA 1EETB 1JLQB 1KFSA 3NGTA 3HCXA 2ZC4A 4ETZA 1XMQF 3CIZA 2D3OR 2ZJRQ 2CZVC 1U1NA 4AL6A 2F7VA 3LP1B 1ICEB 3OXLA 2LVWA 4L3KA 2HPUA 1W2BR 1QSLA 4RUAA 4KE5A 1X0PA 4QYZJ 2HGNA 4CNZA 4QYZK 1OQ3A 2WW8A 4FXEA 3DXBA 1S7IA 4NX9A 4RW6A 1RHQB 4DQPA 1U09A 4J9NA 2QL9B 1HBMB 5K14B 2XZWA 2CNOB 4DR7F 4C8LA 4PG5A 4ZPAA 2YNFB 1FT8A 3A12A 4KO0B 2HZVA 1KWMA 2DNZA 5K5MA 3L3CA 3QT8A 2VG7A 1E6VA 2CXEA 5J2QB 3PFEA 4BWMA 2GO9A 1HNXJ 3VEAA 2FJEB 4URGA 4LF4F 1QY7A 2KJVA 4RWWA 1YBAA 3GMGA 4QIWD 1SJ1A 1G1XA 4NMLA 3HHEA 1RWMB 3HK2A 4CLYA 2HHVA 5K20B 1K8AT 1WEYA 3DLJA 4CRJA 3NGUA 1X9WA 2V4JA 5D4OA 4X84A 1C4AA 3MWBA 4N8NA 4RW8B 4F4KA 3CF5Q 2F8EX 5DM7Q 2EC2A 3D3BJ 4O3QA 3OTOJ 1IKYB 2J6UA 3HJFA 1UP1A 2KH9A 1ZPVA 2PFDA 1VC6A 3VW4A 5ETMA 1TL1A 2B9YA 3HD1A 2BEFA 2B7CB 1CJVA 2RRAA 4K4SA 1RDRA 2V2KA 4U6PA 2W24A 4MT1A 3BN4A 4DFPA 1M0SA 1VIOA 4DUYF 3QGPA 2E5LF 4K5SA 5L38A 4B9VA 3H0PA 3GYGA 3EGWB 1WSVA 4IRCA 4IR1A 4ATNA 1J5OB 1A7GE 3PG9A 3K8WA 1C0TA 4HDGA 3D6MB 3W7BA 2C22A 1NB7A 1C4CA 5IM0B 3MEDB 2BKOA 5KFCA 2GVDB 1UVJA 2DRBA 3ZZ0A 4RWXA 1RA7A 1CJUA 1R7IA 4Q0BB 1RT7B 2K7JA 5KT7A 1TKTA 1VQ6S 1RTHA 1X4FA 5EX0A 3R6GB 3PR5B 3AOAA 1S6QB 1HHQA 1FESA 4YY3F 1D3WA 4DCJB 3CW2C 2K3IA 2MEWA 3DLGA 2IJRA 2Y3YA 2J9CA 3POTB 1VQOS 1WDDA 4WKRA 4I56A 2ZM6J 4D3HA 3TR5A 1HWKA 4WFYA 3JYTB 4BCAA 2CPXA 3CDAA 2KM8C 3DOMA 4CO1A 1VLOA 1M5VC 5KFHA 5B0AA 1Y5LB 1V5IB 3M30B 2NXEA 3VAHA 3M4XA 2L08A 4XDDA 4HH1A 5HBMA 4ES3A 5EWEA 5JJBA 5HL7Q 3N0VA 1EHWA 3AXMA 5M2RA 3AJ1A 5L46A 3RBZA 2HBYB 5KFJA 1GTEA 4FXVA 1YZ6A 1YI2S 3RBEA 4ECSA 3MCNA 1SL1A 1VOMA 3PHEA 1R6YA 4WJBA 1VIXA 5MAOA 1FVQA 4DV5F 3I87A 3NMRA 4LSZB 4JI7F 2BE2A 2HBZB 2ZE2B 3P5BP 1ZM3A 1HBNB 2R3VA 4YR0A 1S9EB 1T8EA 2GMHA 1JLBB 1MWZA 4ECQA 1HWLA 1DTTB 2BX6A 1NK4A 1SUQA 1RKIA 3RR7A 2GHWA 2XCAA 1RTJA 3SCLE 2O67A 3TA2A 1QVGR 3RG6A 1IBLF 3D66A 2FPHX 5KTQA 3T1HF 3N01A 3OR1A 2PO4A 4L74A 2C3YA 4KFBA 1KFDA 4GMKA 5D0EA 4DSIA 4J9PA 2DNPA 3DRPA 3SDEA 2DR7A 2UZAA 2JLFA 4LMZA 4LFAF 4HTJA 2Z58B 3EXYA 1GX5A 2XSJA 5CQGA 2GA7A 4WZMA 3IG1B 4PKDB 2DH8A 2ZD1A 1TU0B 1C2PA 2N7YA 4J9OA 2WVCA 1XN9A 2OPPA 2CQBA 3FK4A 2BV3A 2EFVA 1JNZB 1YLXA 4FVMA 3D0IE 2HHHF 3NGRA 3OT9A 5KFSA 3UVJA 1GXTA 5L1IA 2GJ2A 1ULRA 3Q8YA 3CDBA 4TLRA 4RNOA 2HZAA 5DM6Q 1X9SA 2DEJA 2XYPB 1FFGB 2C3MA 2JJ4D 2W01A 2EFOA 4WU3A 2LEBA 1EP4A 4YHHJ 2YQ0A 3K5OA 2HQCA 1APSA 2PE8A 2PFFB 4CLSA 2IPOB 1VC0A 3VGUA 5LMUJ 4B17A 2YNGA 4FS2A 2Q1LA 4GVBB 3G82B 4J7CA 2EVZA 4EK2A 3M2RB 3TJAA 3KK1B 1H2UX 4PXCA 4P7VA 3O44A 3P6YC 2APOA 3MD1A 3M8QB 4ZP8A 3V81A 4B3MF 1SQEA 2XTJP 1FNXH 1WG5A 3CC2S 2XHWA 3G2XA 2JNJA 4OZNA 2HRYA 7AT1B 3OJUA 2ZH6A 4Z7CA 2FDNA 3GR0A 3IM9A 2HHWA 4I68A 2KT5A 5GMEA 1JLCB 2E44A 1X31C 1DRZA 1SJFA 2FJBB 4M5HA 2KKEA 4Q44A 2W2MP 3HX9A 3R5AA 4TU7A 2KG1A 1RU2A 4GO7X 4Y65A 2F40A 3AWRA 1E6YB 1RT1B 4FYDA 2NXCA 1UPMB 1R0AB 5A8KB 5KG7A 3V6DB 1LFPA 3GJTB 4NCBA 2D3UA 2F3JA 3H5XA 4YB1P 4XTTA 3EGVA 1T95A 3BSNA 2I6WA 4AL7A 2BJ3A 1XR6A 2LECA 1MNEA 4H54A 4KIAA 2CA9A 4AT1B 2HBRB 1ZBTA 2W4DA 4PG8A 1M5KC 4C9DA 3ZTRA 3NGDA 3FSIA 2GVZA 2P8IA 1DY3A 1P1LA 4FXDA 3ZFVA 3KLEB 4DV6J 4Y6IA 4A8OA 2IJFA 2HVDA 4IDKA 3MDFA 1WHXA 2XTDA 3K17A 1SXLA 5HQMA 4HTIA 1SQFA 4OHXA 3DNCA 3M8YA 2KL8A 1TMMA 1S7HA 1BDVA 1X60A 2JLGA 2XSFA 1SKSA 3M6XA 5T14A 2KELA 3KLVA 3J81j 3KLIA 4QCLA 2IDLA 2AW0A 2CQGA 3AQOA 1T9YA 2XMVA 1M5PC 1U1MA 5HSPA 4U7UD 3KLHA 1CJTB 2RQ4A 5ETOA 2H65B 3DI6B 2C2MB 2KN4A 2XY6A 1LWEB 4EU0A 4DR4J 2JX2A 3M8RA 2VKRA 2ZBRA 4OX9J 3VWSA 2W2OP 5E41A 1QDUB 3OR2B 1N48A 3T41A 2CPIA 3L7UA 1FA0A 1S6PB 3CJ5A 5F0WA 4P75A 4JI3J 3PJWA 2R2UA 3NBPB 1WC5A 2ZH4A 3AB2B 4JV2A 2UXBJ 2V9KA 2BW2A 5GADU 1ZTTA 3FMTA 1M5OC 2XZDB 4P10A 4L73A 4OQJA 4U67Q 4MK7A 3FVYA 1ZTWA 4LUBA 5EDWA 3GQCA 3CSKA 3IS9A 1NLAA 5KFYA 3DLKA 2J0XA 1FCAA 2GV1A 1RK8A 4UY8T 3HMJG 1HARA 4KC5A 5KFOA 2I38A 2WOMA 4ZPCA 5L39A 2R8GA 4XO0A 1Y00A 3P4UB 3TA0A 2IM3A 1NXIA 1OM2A 3LP0B 1U26A 2FTRA 4F0KA 3GILA 1H7WA 1RWXB 2MZTA 3UDCA 2X1FA 2B5JA 1OQ6A 3OSPA 3W5XA 3CCSS 1TL7A 3IBFB 1RT4B 4C8NA 4PR6A 3O6QA 3GJRB 3QIDA 3EGZA 2N3LA 4ANDA 4OYWA 3PYEA 4QPXA 2BDPA 2YWGA 4O23A 1NK8A 1RT2B 3VCDA 4OYXA 1DZ5A 2VG6B 3DXSX 1XNQJ 4LT6A 4PPDA 1YZ7A 1B99A 5F9NA 5L1LA 2HNZA 4YHHF 4NLYA 1HI0P 3D6TB 2MKIA 3W9IA 2BM1A 1Q8IA 3AX5A 3W2VA 3KJVA 1VQPS 4RBUA 3LWMA 3FEYB 1SH3A 4DUZF 3MMBB 2UUBF 1JQGA 1VCTA 3BBFA 1BC6A 3RRHA 3DYAB 2NCKL 3BO4A 2VOPA 2CPYA 1T3OA 4IO1A 1HFEL 2FVSA 1HW8A 4H4KC 1HBUA 3KUHA 4EFAC 1D1UA 2H4WB 4LVNP 1S0NA 4B08A 2QLJB 2B9WA 1WC4A 1TUVA 1TV6A 2HK3A 3R7BB 3RUBL 4DG1B 1FJ7A 1RT6B 3NG8A 1S0VA 1AZSA 3U02A 1XMOF 3X1LB 3BV8A 4PWWA 2GMLA 4GVLA 4ED6A 5GAEU 1DLOB 3W2WB 3IAS9 4ZVTB 3UDVA 5EWGA 3J7YU 5DG7A 4ENOA 3NOCA 1F3VA 4DN0A 3DM2A 5KT5A 4DV1J 1GMWA 2JVRA 3KUEA 1NUEA 2G1HA 1Q5VA 2EW9A 3HO1A 3QATA 1ZM2A 4RW4B 4B3RJ 1H2TZ 3TNVA 2BBEA 4A8FA 5BYRA 3QOQA 2DGSA 2ZUGA 2IAJB 1N34J 1T03B 2M8DB 4P9SA 4DZDA 1RLCL 2NZ4A 2BVZA 3SQGB 4RW7B 1NSPA 3RW6A 2Y1JA 3HHNB 1N33J 5J2NA 1RBOB 5HMWA 2E1CA 5I3UA 2H5JB 1V5VA 4TLQA 3HFKA 2HNYA 2LMIA 3T3FA 4G1QA 2G2YA 5DDQC 4N7TA 3KDNA 2YKMA 1A6LA 3CC7S 2YWHA 2MLZA 2PGCA 1ZA2B 1IKVA 3MUMP 1R0BG 2ADCA 1N54B 2IDEA 1JXEA 4RNMA 4X4SA 1BUXA 2M8HA 4IFYB 5IS2A 1FK9A 4NEZA 2IHR1 4ETXA 2MJUA 5B09A 1OPZA 3DRRB 3MURP 5IWAF 4TY8B 1HQEA 2ZHOA 3ISNC 3JAMU 1HI1A 4DJBA 1FWPA 1B0PA 4RU2A 3GIMA 2QSFA 1S1VA 4I2QB 2WHOA 4PABA 1W25A 3M8WA 2UXBF 4ZVGA 1EJ7L 1I94J 2NXJA 2IA0A 1FJGF 4AE5A 5E5NA 2YWWA 3UI3A 1JKHA 3H2LA 3MF5A 4C7QA 3GFYA 3DRXA 2IYGA 1YIJS 5E3CA 4A46A 2IC3B 1LV5A 3I82A 2Y9HA 1AYEA 4JYAJ 1U0SA 4DV4J 5C42B 4ZVFA 4F04B 2IVFB 4YB5A 4YB7A 3G71S 4ER8A 4WFZA 2LLZA 2LQ8A 5G0RA 2H3EB 4DDFA 3FRZA 1NPRA 2EG1A 1S6OA 3OL6A 2MGZA 2H9ZA 5J1EA 4NI2B 3LP2A 2WSCC 2UXCJ 1JWWA 4OHVA 1HW9A 2QFJA 3PRDA 4PRFA 3DOLB 4JI5J 5D6GA 2XZTB 3T5LA 4D3GA 1SPBP 4QIVA 4IG3B 1JJHA 5D78A 1S1WA 4OV1A 4RZRA 3VHQA 2AJ4A 5FJ4A 5KFGA 2ZBCA 1FEEA 2MQNA 1QVFR 3DLEB 1PJ6A 2BM0A 3DHWC 1ZS6A 4DR1F 4F36A 3K5LA 2QRRA 4IH5A 1GFWB 1U6BA 2YWEA 4M5LA 4G3IA 4CO0A 3TP2A 4OV6A 4CLTA 3M8PA 5D8HB 4RX6A 3T9ZA 2HS4A 1T9VA 4KV8A 1UWBA 3VGSA 3C14A 3IR7A 2R7RA 1R8HA 4LBHA 1PARA 1RWVB 3WIUA 1VLYA 1Y3KA 4ES2A 3SMZA 1NDCA 2VG5B 1NKEA 2RS8A 4P71A 1QSSA 2H5EA 4NL5A 3K5PA 5IFMA 3KLFA 4K4ZA 3TEGA 3MECA 4XK8C 1RAFB 5KFEA 4OX7A 4NLSA 2XI2A 5ETKA 3B82A 2XZ2A 3I9ZA 2V50A 1YJTA 3MOJB 3PYDA 3DFEA 3CJTA 1KLMB 1FKAF 2OP5A 2GAGC 3LGMA 2CQPA 1NZAA 3Q89A 3WX4A 4NLXA 2P9EA 1P9YA 2AN7A 4M5DB 1LKZA 2FHJA 2CZ9A 4X4QA 3G9CA 2IM2A 3BSOA 4ZVEA 3IXQA 1T11A 4Q7AA 2FY1A 2DGTA 3VTIA 3O3LA 1UFKA 3EGNA 4PG7A 3PW5A 1FRIA 2OJ3A 1MNTA 2N3OA 1U7LA 1Q79A 2WCXA 3KXDA 2I5JB 2IFXA 5E3RA 3BJYA 5I42A 4JI8J 3KK3B 2DD8S 3SFUA 2HQIA 3RAXA 2FIUA 4MK8A 2FYXA 4HLBA 2XS5A 2YKNA 5A6WA 1KTQA 3PR4A 4DV0J 3GIJA 3PKYA 3M6VA 2BE7D 4H4MA 3MEGB 3MAQA 1K73T 3OUYB 2H3AA 1KTVA 2JEFA 1NBEB 2BYCA 2XG8A 1CG2A 4DBQA 1I6JA 4OJ3A 1HYSA 5C25B 4FF2A 1TL3B 1YX2A 3OVBA 4LFCF 1SQGA 3QNWB 5DG9A 1CQMA 1JXVA 4FP9A 3CTRA 1YJ7A 3NNCA 1JLQA 4PWUA 4ECVA 3OVSA 1VRTA 3KG0A 3QIPB 4WF9Q 1JMTA 1GTHA 2Y1IA 3ENQA 1N5YB 2PI5A 1NDKA 1LQ9A 3GPAA 4H4OB 3LP1A 1N56A 2MKKA 3ZZUA 2VC0A 2ZH2A 2YH1A 4NLVA 2M5YA 1TAUA 3V5RA 4M94A 5KG4A 2AJ2A 4ECZA 4F4AA 4X4RA 2ADLA 3DRYA 2RQCA 4OYOA 1J5EJ 1BQXA 4ZN3A 3GV7B 4DSJA 1LXNA 3H42A 1WHYA 3NCQA 3F0NA 4Z2XA 1C0UB 3R5DA 5AJ3J 2UXDF 2RF2B 5K14A 1MN7A 2YNFA 2O66A 1T7PA 4KO0A 1NK5A 3DU5A 2HFSA 5HN0A 4CH1A 4X4VA 3N4WA 3KHLA 3BGOP 1V6HA 1URRA 1XWLA 4RU9A 2ZWPA 2XHCA 2KT2A 4USVA 4OI4A 4F4WA 3X3UA 3CULA 2C2KB 4ZCIA 1MROA 1FI4A 3EPIA 4DL6A 2BJDA 4NYPA 1U2CA 1SH2A 4FDFA 5KFPA 4F3QA 2RT3A 1HNZJ 1BQNB 1BGXT 1NHUA 1N5TA 2PT0A 2ASJA 1F2GA 2AY0A 1IKYA 2XEXA 1RTZA 2AYBA 4ELVA 1WTBA 2DITA 3DDKA 3Q8RB 3ZZZA 4EWTA 1LWFB 2MY8A 5E2QA 1AB8A 3TVKA 4PG6A 3KJFB 5HO4A 3MEEB 5C5JA 4M5MA 3FSYA 3B78A 2CJBA 3BR8A 4UOHA 4NYZA 4F02A 2OFHX 3L7PA 5L1KA 2ZFHA 3TZYA 4ZPDA 2LYVA 1F1BB 1LW0A 1CS4A 2HURA 3KFWX 3T5KA 3ITHB 2KT3A 5C24A 2ILZA 5AE2A 2Z57B 4RNHA 5IM0A 3OL8A 5H1SV 2XM3A 1PSDA 3LGHA 2UUAJ 1YRTA 4LF1A 2VBWA 1VGYA 3UNYA 4Q0BA 2GQ2A 2RVJA 4MIWA 3KTQA 3LPEA 3CCJS 1WNEA 1H2VZ 1UW9A 1RWUA 4U7UK 2HWIA 4ALZA 3ETOA 2MZSA 3RJMB 4MIBA 2WVDA 1RGVA 2D9PA 1U2RA 3R3TA 1U2FA 2ZJPQ 3C2PA 3POTA 3ZTQA 4O0IA 5J2MB 1IN0A 2HKEA 2CUYA 5KG3A 2AQ4A 2IJNA 4ZP9A 2V8DA 2V63A 4CLFA 1SKWA 3VAKA 5D15A 2MQQA 3IWLA 1GT8A 2ZH3A 4R5PA 2AYMA 2EFQA 2WB1D 4DV3F 2FQQB 1T9TA 4B9UA 5A2QY 2AIRB 4HHJA 2QA1A 4KGZB 2ZH5A 2V4QA 5CD4H 4W98A 5CCMA 3ZNJ1 1TUGB 1ZAWA 1MSWD 2OUGA 3T5HA 2OFGX 2HQDA 1N5QA 5CD4A 3MM7A 2V34A 2VPWB 5D0GA 3VEBA 4ID5B 5DRKA 3M1VB 4Y2CA 1UJ6A 4KKOB 1S9EA 2F8MA 3FSXA 2R9LA 3RZAA 4DLEA 1S1TA 2CFXA 1JLBA 1UKUA 3THTA 4ZP7A 2A18A 4LF7J 4X66F 5HMZA 4Y0FA 4B9LA 3C3LA 4RUHA 2GGPA 1DTQA 1YSJA 2PEBA 2VFRA 2HWTA 3J80U 4EI2A 2DNLA 2CQ1A 1EKSA 1S4FA 1FKPB 5KG6A 4MFBB 4TQSA 4V19X 4F25A 4NLTA 4G1PA 2FC9A 2QTWA 3EZOA 2O01C 1Q16B 3D2WA 1H73A 3UFCX 2V1TA 4DR3J 4LIRA 2GW8A 2XNRA 5M2UA 4X64F 2W4CA 4EYHB 4AQYF 1SCJB 1HD0A 4X62F 4DV7J 3QRQA 3DU6A 1IVZA 2QLBB 2QA2A 4K4WA 1RTDB 1VRUA 2RIJA 4TU9A 3BPDA 1UFWA 4TXSA 2XLIA 2Q6BA 3SYZA 1N6QB 2BJ8A 1C1BA 2NPFA 2Y1RI 1DURA 3KMQA 1K1SA 1QAXA 1KQSR 1V3ZA 4X65F 4CYUA 5B0CA 4L3NA 2Z4PA 5F3ZA 4DS5A 3VR1A 2P2CB 4OL8A 2N4CA 1HQUB 4KR0B 1OY6A 1T3NA 3OHAA 1FF2A 4XPEA 3MUTP 3P49B 2A0FB 2HMIB 2ADBA 5E7OB 4U8YA 2JH3A 3HULA 2ZVSA 4DCPB 4AAIA 3G82A 4K5RA 1K0TA 4FYYB 1FDDA 3GYXB 2AWZA 4A48A 4QWBA 3M8QA 2M2BA 1KC8T 2QLFB 5GVQA 3TUIC 1PGZA 4U9RA 3UR3C 2IA6A 2DHHA 1FEHA 2HHTA 3CB4A 1B28A 1SL2A 5A8RA 2ZH9A 3I5CA 2OEMA 4HKQA 1L3TA 2V5HG 4ILLA 1T94A 2OIHA 1I5OB 1JLCA 4C3LA 4WYLA 1KS2A 2K3KA 1RWNB 3PO4A 3I9V9 1HNVA 2C28A 2DNKA 1AUDA 2X1BA 5IV3A 1WUUA 4EEYA 3MM9B 5DETA 1E6YA 2MYFA 2DH9A 3AD9C 3CT9A 3UWTA 1EKRA 3I0SA 1UCNA 2WVFA 4DN9A 2BZ2A 4EZ9A 2DR5A 2PA3A 3DKDA 3UCZP 1BQMB 3DMJB 2MZQA 3AODA 2LDYA 1HL6A 5LM7E 2I0XA 3FBCA 3TW0A 3KLEA 1WOPA 2AV5A 3TWZA 5HROA 4ZJLA 4YMEA 2VDIA 3NNEA 3PY8A 3VQTA 2ACYA 1KDNA 3MR3A 3M2VA 1D0EA 4QJVA 1LOUA 3JSRA 3I31A 3RAQA 2XGQA 2JBVA 4P73A 1ZM4A 2AZ1A 1FNOA 3W66A 4I6AA 2JL9A 1L3SA 3PZPA 1S12A 1CJTA 1PC5A 2ZBIA 1JJCB 3D0GE 2JC1A 4F2RA 1LWEA 2HFUA 1YKWA 5C2CA 4MAKA 4W92B 4USIA 2YX1A 4F0HA 1DJ0A 5F3TA 1U8WA 4B9MA 1NJYA 1OG7A 1MWQA 3CC4S 1U1OA 4FF1A 4CWBA 3R9LA 5HLFB 2XO7A 4FZVA 3NBPA 1L5UA 2X1AA 2E9ZA 2XO6A 5J1NA 4OFZA 3NOGA 3VF0B 2Y8YA 2G13A 2NPIA 3BPSP 1U1PA 3D1OA 4KAIA 2QO3A 4RJVA 4BS2A 4K8RA 3R7SB 3ZNUA 2PMHA 1ARRA 3GIKA 4JI1J 3HSDA 1BE4A 2HVHA 3BGRB 4P6QA 4Y2IA 2B43A 5DDPC 4KPCA 4C2MA 2BANA 1F5BA 2OPRB 1N88A 4B3TF 3HHLA 3CD5A 3R6LB 4AXJA 2QEXS 1X5TA 3LP0A 3W64A 4NXNF 2W9BA 4LRVA 5A6PA 3L7OA 2HHSA 3MEKA 3CVKA 3AAWB 2MLXA 2VPZB 3FUYA 3TO8A 4ZVRB 1RT4A 4QWAA 4WFAQ 1DARA 5L1JA 2V67A 5B7WA 4ECXA 4CZCA 2M52A 4LRFA 3WIVA 2VBXA 2RDJA 2CNNB 2WTFA 1AA1B 3EE3A 4ZMMA 2RJZA 3QFHA 3HKWA 3AY0A 3OTBA 5DZ7A 2DNQA 1TFWA 4C3KA 1NPKA 5IQ6A 3PW2A 5T7LB 2HK2A 2OPSB 2VHGA 3HVTB 2ABYA 2QMXA 2BRKA 2DYAA 3H90A 4NE9C 3G6YA 2HGLA 4C48A 4FNHA 3MHYA 4UOFA 3B8HA 2LFVA 1RWPB 1CEZA 2DT9A 1UETA 5HK4A 1REVA 4J91A 1WKJA 1OHNA 4QR0A 1TELA 2AMCB 1IWGA 1S1XB 2K1RB 1GK8A 5EGYA 4EGLA 2VBZA 3V4IA 1M1KT 2FJXA 4ZKAA 4RPFA 2GAHC 3JTNA 1R3NA 2ROPA 4PQUA 2JXHA 1ITPA 2QLXA 1GMVA 1RT6A 3OHBA 2FGCA 1IBKJ 3OVAA 2E1PA 5JMNA 2G0JA 2OGUA 1HWJA 4ITSA 2UUCF 3PRVA 1DLOA 4Y2MA 3NS5A 1S0OA 4EBDA 2VQEJ 2FLLA 2R2RA 4ANEA 3VQSA 3SSRA 2E7XA 4M63A 4A47A 2AD9A 1WKLA 1O8BA 5JVHQ 2IBOA 2DPIA 4I1TA 3G96A 4NLGA 4UZBA 4O3RA 2MKJA 2GNKA 4RW4A 2NS1B 2RDDA 1HPZB 5A0YB 4DL4A 4YP3A 2IBKA 4A8WA 3GWCA 4OX6A 3JTOA 4WWSA 2K06A 1U45A 2AF6A 4UW2A 1NJXA 3SQGA 3BGUA 2R8IA 5KFLA 1Q86T 3NXZA 4QU6A 1V3RA 5HP1B 3US5A 3Q83A 4I7FA 4MYUA 2EKYA 2UUTA 4WTYA 3AX2A 2ZHBA 2HVIA 4KTQA 4M95A 3GFXA 4DU8A 1WF0A 3NAIA 1IBMJ 3PW0A 4OX8A 4V19J 2HLUA 3T1YF 3GJQB 3NGSA 1WOOA 2JFDA 1RYRA 3MXHP 4DX8H 1BD6A 1OIAA 1RBLA 2BRLA 1JNRB 2K9IA 4N77A 4AD6A 4NA1A 4ZLPA 4BLGA 1TMJA 3O2IA 1RHJB 2ZBPA 3HT3A 3HHLD 1HNIB 4ELUA 4UQGA 4TY8A 2HFNA 1UTAA 3JSMA 4K0KF 2E7WA 2WVBA 3AB4B 1Z2LA 1LK5A 5KFRA 3B6BA 2UVRA 4FF4A 3QSYB 1FRLA 2ZH1A 3BO3A 2UV8A 3HP6A 2H54B 4NWBA 2XS2A 2FY8A 3HXMA 2ZZNA 1XNRJ 4N5SA 1S9GB 4KHMA 3Q24A 2Y0BB 4F50A 4USHA 4OHWA 3TAPA 2IC3A 2OPQA 3L95X 4JI1F 2VG7B 3FFIA 3ZZPA 1YRUA 1QJHA 3G86A 1RAHB 2HLTA 1I3OB 1OSDA 4OI1A 5C42A 2BUNA 4ELTA 5F0UA 3ZXWA 4X4UA 4HACA 3MAHA 3C16A 2EG2A 5GMDA 2YKAA 2COLA 1IKXB 5L9XA 2V4JB 5HAOA 4LF9F 4NI2A 4K4TA 3DGPA 1F3FA 2CQCA 4YFUA 2ILYA 3GCXP 2E5HA 3QBCA 3DOLA 2CJAA 3LANA 1S97A 2ATCB 3RTVA 4ERDA 5J1PA 3H8YA 3KMSA 3MPDA 3VZHA 2GS8A 4QIEA 5K8PA 3R5CA 4WKYA 5FD1A 4JI6F 2CPGA 1HHSA 1BDTA 5KT3A 2C42A 1Y4ZB 2LQJA 1Y5NB 3HJVA 2GQQA 1EX8A 2RU9A 1H72C 2RDIA 1D9DA 2RHQB 4QR2A 5JXSA 5KT4A 4WE1A 3LGNA 3U1LA 1R0CB 3JB9k 3FMWA 4M5GA 1SL0A 4NXMF 1S10A 4LF6J 4WCEQ 1TAQA 1CJUB 1SJRA 2MTLA 2F5GA 3FRYA 4J9MA 2LDIA 1RAEB 1T9WA 2MZJA 1TKTB 5F8IA 2VG5A 3GSIA 4Q8EA 1RTHB 5CYQA 3CCZA 2FVRA 2PA8D 4YN3B 1HMVA 3KK2B 1P27B 4JI4F 5D0HA 3ZTSA 4P7TA 1P9QC 3DLGB 3LO3A 2JEIA 2QLWA 2MQ8A 3UDEA 4C8ZA 3C66A 3CJRA 4FPRA 4CTAA 3DOMB 3KHRA 4LF8F 4ZLJA 4JB8B 3AA8A 3QJLA 1YJUA 1IWAA 1LWCA 4ZPWR 2V8VA 3VAFA 4IRDA 4M5DA 2ZDOA 1JLFA 4GKJJ 2ZBQA 1UA0A 3D7SB 3VAGA 2QMWA 2OTLS 2WZ1A 1UL3A 3W60A 2W7PA 1FTCA 1U6ZA 4DEZA 5T41A 2DH7A 1S1UB 3V4MA 5JUMA 2ZDPA 3RB0A 2BE2B 5CYJA 3TI0A 4BDPA 4FBUA 3H7HB 2KFYA 5IC6B 1FJCA 3H98A 5AE3A 2YH0A 2RD5C 5KFAA 4NRTA 4QIFA 2ACMA 1ZAVA 1VFJA 3PYGA 4OYMA 5KG1A 3BQ0A 2JC0A 4IG0A 3CJ4A 2GFFA 1SUQB 1U25A 3QLHA 2WW4A 3HKZD 2HVZA 1RTJB 4QQBA 3MCOA 3BKTA 2GZOA 1M5HA 3TEHB 4M8LA 3OUYA 3L4BC 3OR1B 2IVYA 4KFBB 2KJWA 4B9TA 1SH0A 4W4MA 3DRPB 3SDEB 5B0FA 4K2XA 1MU2A 3CGIA 1TL3A 1R6VA 2XSJB 3ENVA 4ILMA 2J8AA 5HMYA 2ZD1B 2J8SA 4DXLA 1FKOA 3HSZA 4JI2F 1U0HB 1UEUA 2L9NA 1PYTA 2OPPB 1RI7A 1TKXB 2VC1A 2J7KA 2NSBA 3F73A 2YNHA 4P2MA 4DR5J 4CLPA 5DO2A 1KQFB 3R2CJ 2RRBA 3KG4A 1MLAA 8AT1B 1P8GA 4AYBD 1N5YA 5KFKA 2UU9J 3UVJB 1A0OB 1NSAA 4K4UA 2DCUB 3LAKA 1S72S 3C6UB 2V6AA 2RMLA 2A2CA 3D1QA 3DRSA 2VFVA 1EP4B 2Q6CA 4PYAA 3MMAA 3GZ7A 1C0UA 1BAZA 2L48A 4ED1A 2GC8A 1H3DA 2WVEA 4UTGA 5ETVA 3LWLA 4PUOB 2IM1A 1R8AA 4NZ7A 5LT5A 2DVIA 2LXIA 1VRQC 2F4VF 2BSQE 1FJEB 4BC9A 3CJ3A 5LSLA 1DQ8A 1UEVA 1VDHA 3EX7B 3AA9A 1FO1A 2AU0A 4G6VB 3F56A 4KHPJ 4M5NA 4IRKA 4LREA 4N56A 4LF5J 4ZVSB 3PYFA 3P45B 2VJUA 4DL3A 1LXJA 4L75A 1QAYA 4OZ3A 2LU2A 3E8OA 4LSLB 1TK8A 4NLWA 2B4UA 4HHUA 2FLNA 2VA3A 7FD1A 1QE1B 4GKKJ 4LSNB 4NEYA 4UUXA 1HNWF 3TQ1A 3SSSA 3TJ8A 5KG0A 3VGVA 2XC9A 4LFBF 1YITS 1Q8LA 5F41A 2W7AA 2KXHA 3GYNA 3CJKA 3ENAA 1LWFA 1IR0A 4FBTA 3E01B 3PXGa 2DPJA 1ZM9A 3MEEA 3PNIA 3BBBA 3QZ8A 3W3SA 2VDHA 2XY5A 3OLBA 1Y11A 4DV2F 3TJ9A 2L9DA 3I4PA 4DR2J 3I96A 1RWOB 4LBPA 1BLUA 3M32A 3M2UB 1UZHA 3ITHA 3JSYA 4FKXA 3BM7A 4KB7A 4B3SF 2ZOMA 5RUBA 4O44A 2UVVA 2FD2A 3MPWA 3UPFA 2GVZB 3NCPA 5KFWA 1PO6A 5KFVA 3C19A 4IDKB 3R7NB 4N76A 2D41A 2DBBA 2N4DA 4I64A 2E1RA 4Y28C 4NMXA 2VUGA 8ATCB 1PCAA 2KKHA 1N36J 4DUTA 2K6LA 2ROGA 3GE9A 3G6VA 4FYWB 4HL9A 1PAEX 4O3OA 2GJFA 3FZBA 4B9NA 3KOAA 1PJ7A 2HIYA 1W7WA 5HATA 5J2MA 2EBEA 2RKIB 3TAMB 1QAIA 1UPPA 3H87C 3MM5A 2VKZG 2A10A 1YJWS 3RR8A 4RW9B 3CPWR 1NPPA 1KOHA 3FJ2A 2F65A 2V8GA 3HSJA 3LPYA 2IRYA 3TUJC 1FRJA 2KXFA 3EYZA 1SKRA 5LMNJ 1VK3A 4O3NA 5B0GA 4ECYA 2WONB 4DS4A 1VQ8S 5BXIA 1N32J 5CA5A 4K2JA 3LUYA 1HR0J 1VMBA 3IS9B 4QU7A 4QWDA 4EBCA 4ZA1A 1S48A 2OKQA 1YTYA 3M1VA 2DEIA 1NB2A 1P6TA 3BEGB 1S77D 1TL4A 3V6HA 3CJ2A 1TR0A 4USUA 2IRXA 2JZ5A 1U1LA 2WOMB 2N82B 4DX7A 4H4KA 4HV0A 4FF3A 4B3OB 5KG5A 2UV8G 3NEKA 1U47A 2KRRA 4HEA9 2HFOA 1F9EB 2QL7B 1DQ9A 2VH7A 1FKPA 1B64A 5IT9U 2WB4A 1T05B 2PSZA 1HNXF 1WHWA 1TL7B 1Q16A 2RHSB 3TX0A 1LWXA 5CHCB 4R8UB 4OHZA 2D1CA 4JV5J 3TOQA 4MH8A 5GAHU 3ZZYA 2KYXA 3JAMY 2DGUA 2G9OA 4NCAA 2NQPA 3MM6A 1S49A 1VQ4S 1TKZB 2RS2A 3CJSA 3IBWA 2CAJA 3OTOF 3PJ9A 4YDXA 3MPYA 5DLFA 2D7SA 4J90A 3RB3A 2HFZA 3W2VB 1X5SA 3A3OB 3KJVB 3W65A 3CCQS 3WX8A 5L8RC 1KBRA 2VQFJ 2E29A 4Y2KA 2XMTA 2QMUB 1HIYA 1RUSA 1SVDA 1ZYQA 2FVQA 1X5OA 3JXOA 3EPGA 1BMQB 1SV5B 1FXDA 2B51A 4ZCKA 2HMIA 2NREA 1IR2A 1IQZA 3NS6A 3J7ZT 3BYPA 3ET6A 3PDNA 3NO7A 2GHPA 2ZUAA 4JV0A 1VHIA 4Q8FA 1AZSB 3BSAA 2FUG9 2R7TA 4DQQA 2XNQA 4JV1A 2WBMA 2X51A 2V1SA 2U1AA 3R5JB 4CO5A 2Z2YB 3P3DA 4NYOA 2MPUA 3D6HB 3GV5B 3ISZA 2O3DA 4LQ3A 3FNNA 1ROFA 2ZM6F 4JI0J 4M5KA 3D4JA 1SC6A 4RL1A 5ITHA 2DIVA 5I3PA 4FS1A 1NSKL 1IM4A 1NM2A 4GC6A 3GG0A 2FJDB 3R27A 4ECWA 2QE5A 3HHDA 4OYZA 2CJQA 4DR6J 3I5BA 2R2SA 2JEJA 3R5GA 4ZVUB 2L41A 2OTJS 1WI6A 2PD1A 2AP6A 3W1YC 3EVMA 1NU4A 5J2NB 4RUCA 4TY9A 5I3UB 2R7UA 2HNYB 3KUGA 1SC3B 4CH0S 3KLGA 2W8LA 1FDBA 1IJEB 3MUVP 3DMJA 3OW2R 2GMJA 2EFGA 4ECRA 2VF3A 1UVNA 3EZUA 3VALA 5AE1A 5GADI 1FK9B 5J2PB 2VU5A 2WK4A 3OL7A 2M88A 1JLAA 2P9CA 2C1EB 4HH0A 2CVIA 4RNNA 2XMJA 3BBCA 4KH0B 3TQEA 3GG1A 4F3OA 4ZVHA 5BR8J 5DJBA 2B4VA 4P72A 3EJMA 3CMQA 3TVZA 2H4YB 4ZITA 2YVSA 2MQMA 1JKHB 5ETSA 2BXJA 4I2PA 3RGIA 1CC7A 4IQMA 1XMQJ 1Y0HA 3HVAA 5AXLA 3GTYX 2DNMA 3FEXB 2VD3A 3C15A 2F63A 2OD4A 2OHDA 1JLEB 4C0HA 2V2ZA 4A8SA 2HG4A 4LVOP 2IY5B 3NMAA 5HVHA 5HLFA 3MCMA 5KT2A 3E3XA 1SC1B 3K8VA 4AL5A 1RA6A 2B4OA 1S99A 2CPDA 2MGZB 7FDRA 1Q7LB 3LP2B 2DGXA 4DR7J 3G8SA 3DDNA 3PEJA 1YGYA 4ZS6A 3MTKA 1T0TV 3ZTOA 5F8GA 1VJQA 1S1WB 1B0VA 4ANCA 3BGRA 4LBIA 2KU7A 1BWVA 2A1BA 2CNLB 1YG0A 5FIIA 3U1NA 3I5AA 4C8MA 4LF4J 3Q23A 4YR3A 2VPYB 3BQ2A 2OPRA 5LMUF 3IR5B 4C97A 4CLZA 4WFNQ 3QZ7A 2OO4A 2HS3A 1N8RT 3RU0A 1TK0A 2VFUA 1H6KX 3MR2A 5DLGA 4NOHA 1RADB 1CC8A 2XB2D 3M8PB 2XMAA 2PDAA 3GR1A 2D3ZA 3DOKB 2JLEA 4KV8B 1URNA 1J2VA 3QYYA 1UWBB 3IR7B 4UT4A 3DLHA 3PX0A 3UD4P 3IRXA 2OMOA 2XULA 3IGVA 5CYMB 2NUUG 2C2DA 1MWYA 1QUPA 2NYIA 3BYRA 3QGIA 3AFGA 2B8PA 4LR8A 1CBKA 4OZ2A 5GAEI 5K9FA 4DUYJ 2E5LJ 2MZRA 5FDLB 1FWLA 1HQ2A 3KLFB 2DB1A 3NWRA 3MECB 4LJMA 2LQ9A 3HVTA 3ILIA 1WG4A 2QYGA 3JTPA 3IAM9 4DSKA 3M6UA 1QM9A 2G1DA 1WEZA 4UY85 3MFHA 2F1FA 3LW5C 2HVEA 2IM0A 3MAAB 4USTA 3BSCA 5KFUA 2Q79A 3FEZA 1B70B 4C6AA 1S1XA 2K1RA 2FVPA 3SI8A 3CCWA 4YY3J 1WJ9A 1PYOB 5HVGA 4LR7A 2HNDA 4DV6F 1ZZNA 2JWNA 1N0VC 3EXCX 4B9SA
chains in the Genus database with same CATH topology
1GXTA 2EFNA 5L1IA 2GJ2A 5LJ5Y 1ULRA 2B9XA 3UDLA 3BR9A 3D0GE 2R7SA 2JC1A 1WTFA 4F2RA 3CDBA 1LWEA 3QPIA 4TLRA 4DHVA 4RNOA 4DSLA 4MAKA 4W92B 2FHOB 5DM6Q 1X9SA 4ZK7M 5EN1A 1Y5IB 4UOCA 4QPTA 1YRXA 4USIA 2YX1A 1DJ0A 3M6WA 4QW9A 1DAXA 1R8BA 1MW7A 3CCLS 1SIWA 5F3TA 2XLKA 4BHQA 3CJKB 4ECUA 1NJYA 4B9MA 4NCGA 1TK5A 4LIWA 1OG7A 2C3MA 3CC4S 1RISA 2HHUA 2JJ4D 1U1OA 4FF1A 1CQNA 3BQ1A 2EFOA 4OJ1A 4WU3A 2LEBA 2J9EA 3RYLA 1EP4A 3K5OA 3ZC4A 5HLFB 5CZXA 5KFZA 2P6TA 2XO7A 3H25A 2A2DA 1AFIA 2VASA 4FZVA 1APSA 2PE8A 3H2UB 3NBPA 2PFFB 1L5UA 5EUHA 4DFJA 1VS3A 4R25A 3D0HE 5K8NA 2X1AA 1VC0A 2ERRA 2E9ZA 4IH6A 3HVWA 4B17A 2YNGA 4C0OC 2Q1LA 4FS2A 5J1NA 2I1RA 4OFZA 2EVZA 1XC9A 3M2RB 1IBKF 2U2FA 4ICLA 3VF0B 1GAOA 3BS9A 3LAMA 3KK1B 3VAJA 3Q2TC 2G13A 2AX0A 3MR5A 1H2UX 2NPIA 4PXCA 1U24A 2YKQA 4P7VA 1U1PA 3M32B 4JUZA 1D8YA 3O44A 3D1OA 4DR4F 3P6YC 2MSTA 4ILRA 4KAIA 2QO3A 1L3UA 4BS2A 2APOA 3MD1A 1HPZA 4H4MB 1B0TA 5A0YA 5IT0A 3M8QB 2DGOA 4OX9F 2RILA 2PMHA 2CQHA 4ZP8A 3V81A 3GIKA 2E5GA 4B3MF 2QT7A 2YTCA 2QYCA 3IGNA 2Q3PA 2VQEF 1KLMA 2HVHA 3BGRB 4O44B 1LW2B 4P6QA 4Y2IA 2B43A 5DDPC 4A8KA 4JI3F 1IJFB 2IMWP 2ZOGA 1Q8BA 5HBMB 1SQEA 2DHGA 3IC1A 4C2MA 1HYSB 1CPZA 2BANA 1F5BA 2OPRB 4A8XA 1FNXH 2QA4G 2W9CA 1WG5A 3CC2S 1SJ3P 2XHWA 4C8YA 1N88A 4B3TF 3RAMA 1X8DA 3HHLA 3CIMA 4OZNA 1HBOA 2HRYA 1YJNS 3CD5A 4KBIA 4KJIA 4AXJA 3OJUA 2QEXS 2WRMA 1X5TA 3LP0A 4O3PA 2ZH6A