3BSNA

Norwalk virus polymerase bound to 5-nitrocytidine triphosphate and primer-template rna
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
484
structure length
479
Chain Sequence
KGTYCGAPILGPGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEPRGKPPKPSVLEAAKKTIINVLEQTIDPPDKWSFAQACASLDKTTSSGHPHHMRKNDCWNGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDLATMIRCARAFGGLMDELKTHCVTLPIRVGMNMNEDGPIIFERHSRYRYHYDADYSRWDSTQQRAVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCTSQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLKEYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGPNHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELDFYVPRQEPMFRWMRFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA dependent RNA polymerase
publication title Structural insights into mechanisms of catalysis and inhibition in norwalk virus polymerase.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Transferase/rna
total genus 148
structure length 479
sequence length 484
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2007-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.100 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Arc Repressor Mutant 3bsnA02
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 3bsnA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3bsnA03
3BSCA 3UR0A 1MU2B 1S6QB 2WONB 1U09A 3DRSA 5I3UB 4KAIA 4RUAA 2BANA 3SI8A 2B43A 1RYSA 1IM4A 3C6TB 2EC0A 3I5CA 5C25B 3NBPA 5F8IA 2VG5A 2VA3A 1JLCA 3V4IA 2E9ZA 1JXLA 2HNYB 2IM2A 3D28A 3MR3A 1JIHA 3UQSA 2VG6A 3H4DA 5HROA 2IC3B 1QUVA 2BR0A 3FFIB 3BREA 3BQ0A 4WYLA 3M8QA 2FVRA 4KBIA 2BQUA 5DLFA 2IJNA 4O3RA 1TKXA 3CDWA 1RA7A 1JLQB 2HMIB 5F8MA 4Q0BB 3DI6A 2WOMB 3KLIA 3LP0A 5KG3A 4QWDA 3H4BA 4ED2A 5F8GA 4EO8A 2OPSB 2R8KA 1S9EB 3KLEA 3IRXA 3GIJA 3ITHA 3OHBA 1EP4A 1NHUA 1LWFA 3FDSA 3LP2B 3KJVB 3G6VA 5D3GA 1CSJA 3QIDA 3MEEA 4IH7A 5KFJA 2R2RA 1IKWA 1TVRA 3DLKA 4I7FB 1TKTA 4RW4B 4J9SA 5J2QA 2C2RA 3PHEA 1JX4A 4QWEA 3H59A 3OHAA 3Q8RB 3RB6A 2AWZA 3FSIA 1JKHB 1S1XA 4RZRA 4WFXA 1S1VB 2HNZA 1J5OA 4M95A 2FVCA 3DRPA 3OLAA 1TKZA 3Q8QB 3I5AA 2VG7B 3RB3A 1HYSB 1S1TB 1FKOA 1N6QA 1RT6A 1BQMB 3MEGA 4ECXA 4MFBA 4IOBA 1DLOB 1D1UA 3TAMB 4WE1A 3ICLA 4IH5A 1RTDA 4ZVGA 2UVRA 4XPEA 3GV8B 3DYAB 3PW7A 2IJFA 3V81A 4NLXA 4WFZA 1HARA 5L1JA 5EUHA 2QV6A 5DQHA 5CYQA 5F8JA 2OPRA 4ID5B 4O3PA 1R0AA 4WYWA 1RT7B 1RTHB 3KMSA 4XO0A 4LSLA 1KHVA 3JYTA 1HNVB 1N56A 3PJXA 1S48A 1DTQB 1FKPA 3CVKA 1S97A 5L1KA 2AX0A 5FDLA 4K50A 4Q45A 5F9LA 3M9NB 2IM1A 2W9CB 4X2BA 4TY9A 4NLQA 4RNFA 1C0UB 4ECSA 1RT2B 4ZHRB 4ECUA 4FBUA 3G6YA 1T03A 3KLHA 3C6UA 3QIPA 1HPZB 5EWEA 5KT7A 3BQ1A 5C5JA 4TN2A 3IGNA 2ZD1B 5KFQA 4LQ3A 4ED3A 5J2PB 3MFHA 5J2MB 1UWBA 4I2PA 4ECZA 2OPQA 5EWGA 2XWYA 2R2TA 2YKNB 1LWCB 4H54A 1LW2A 5DQGA 4J9PA 4F4WA 5KFWA 3OL9A 2D7SA 3RB0A 3QLHB 3SFGA 3ISND 2UUTA 4F50A 3HVTA 3KLGA 1TL1B 2R8JA 4IG3B 4KO0B 4R8UB 1VRUB 2E9RX 4H4OA 4O44A 3GIKA 1XR5A 3PW0A 4NCGB 3PR4A 2W8LA 3NAHA 3CIZA 3H98A 5C24A 1HQEB 3UDLA 4Q43A 2ILYA 3HKWA 4ECVA 3RAQA 1LWEA 4DL6A 3PZPA 3QGIA 1VRTA 2O5DA 2DPIA 3TVKA 4TYAA 3IS9B 3MECB 1FK9B 1S1WB 2FVQA 4PWDA 5KFMA 4PQUA 2W8KA 4ZVEA 3OLBA 2XI2A 1GX5A 3KK3A 3SFUA 4RW8B 4ICLB 2BE2A 3N6LA 4NLOA 4Y3CA 3BGRA 2R8HA 3V6KA 2B6AA 4K4WA 5KFEA 3DRRA 4TLRA 4O3NA 3NAIA 3E01B 4H4MB 4QW8A 3T19A 3MEDA 5JUMA 5I42B 1RTIB 2CKWA 4WZQA 2D3ZA 3DLGA 1BQNB 4YP3A 3KK2B 4WXWA 4M94A 2IAJA 4TXSA 5F9NA 5L1IA 2C2EA 3D5MA 5HP1A 3NKYA 3M8PB 5KT5A 1RTJB 5HBMA 1DTTB 4XPCA 3MR2A 2R2SA 3NL0A 4RW7A 3OL8A 4OL8A 3PW4A 1N4LA 3CDEA 2GC8A 3DM2B 3HHKA 1SUQA 2AU0A 3DMJB 4IQXA 2YKMA 5K14B 3T5KA 1JLAB 2V4RA 4GC7A 3KLFB 3BQ2A 1S0MA 2WCXA 5KT6A 4IFVB 4PUOB 5KFXA 4ZPDA 1TV6B 3QO9B 4G1QB 4O4GA 1QAIA 2HWHA 3PR5B 1JLBB 1EETA 2YNHA 3I0SB 4ZPCA 1S6QA 1MU2A 2WONA 3DOKB 5K14A 5I3UA 2ALZA 3MR5A 4NLGA 4HYKA 5CYMB 4DEZA 4U6PA 1C1BB 3C6TA 5C25A 2XC9A 2W9BB 1JLFB 1N5YB 2HNYA 4YMEA 1S0OA 4FBTA 1Z4UA 3NMAA 2VA2A 4KHMA 1JLGB 2IC3A 5DG9A 3FFIA 4RNOA 4ECQA 2V9WA 2YNGB 3T5LA 5DG7A 2YNFB 4K4ZA 4RW9B 1JLQA 2HMIA 3N6MA 4O3QA 3N6NA 5J2NB 2J6UA 2WOMA 4Q0BA 4WZMA 2IMWP 3MR6A 3CDUA 4K4VA 3DLEB 1IKYB 2OPSA 1S9EA 1T05B 4DG1B 3LP2A 5KG4A 5L9XA 3KJVA 2UUWA 2WRMA 3UPFA 3CWJA 4I7FA 4RW4A 4MIBA 1WNEA 1C1CB 1RT1B 5KFRA 4EBEA 4NLDA 1S0NA 4EO6A 4IG0B 5KFNA 3T5JA 4KHRA 4LSNB 1JKHA 3V6JA 1S1VA 1SH0A 1REVB 4ED6A 1IKVB 4J9MA 4IRCA 2OH2A 4ECYA 4Q8FA 5JXSA 2B5JB 3Q8PB 4ECRA 3RAXA 2VG7A 1TL3B 2YNIB 1S1TA 4TQSA 4MK9A 1HYSA 3V6DB 1TP7A 1BQMA 2BQ3A 4Q8EA 4K4TA 1DLOA 4LQ9A 2WB4A 3TAMA 4TY8B 5KFHA 4ZP8A 3M9OB 4J9LA 5HLFB 2I5JB 1K1QA 1HQUB 2BRLA 1KHWA 1RT4B 3DOLB 3IGVA 4J9OA 3OL7A 1NHVA 1KLMB 3H5YA 5J1EB 3DYAA 4IDKA 2RDIA 4J9RA 2RKIB 1RT3B 1T03B 4MKBA 2UVUA 3JSMB 2UVVA 4RNNA 4RW6B 1SV5B 3CO9A 3IG1B 1QAJA 4ID5A 3PW2A 3LALA 2JEFA 1HNIB 1RTHA 1RT7A 4YR0A 1HNVA 3LANA 1DTQA 4MKAA 4O3OA 1XR6A 1IKXB 1S6PB 1ZTWA 4KFBB 5KFPA 3VQSA 3I0RB 5C42B 5DG8A 2WTFA 4NLRA 2W9CA 1C0UA 1RT2A 4ZHRA 4ZP6A 4ZVFA 3GIIA 1GX6A 3QZ8A 1HPZA 5KFBA 1ZTTA 2CJQA 3FRZA 4NLPA 4RU9A 3MF5A 2ZD1A 4MIAA 4I2QB 4DL3A 5KT2A 5J2PA 5J2MA 4QWBA 5L1LA 4KKOB 3H5UA 2FVPA 2YKNA 1LWCA 1MMLA 5KFVA 2AGPA 2ZE2B 3QLHA 4DL5A 3G6XA 3KHRA 3T5HA 5KFIA 1QE1B 5F8HA 1TL1A 4NLVA 1S1UB 4IG3A 1LW0B 1OS5A 4ZP7A 2WHOA 1VRUA 4KO0A 4R8UA 1C2PA 2QE5A 2UVWA 4NCGA 3KHHA 4IRDA 4Y2AA 1HQEA 4QPXA 4IKAA 1S9GB 3GV7B 2FLNA 3IS9A 3MECA 1FK9A 3T1AA 1S1WA 4R5PB 2XI3A 3H5SA 4ZMMA 3IN5A 1NNDA 3EZUA 4GC6A 1D0EA 4IR9A 4RW8A 4ICLA 3I5BA 1RT5B 1K1SA 2J6SA 4G3IA 3H40A 3PW5A 3DDKA 2ATLA 4KV8B 4RNHA 2ASDA 2WK4A 4IRKA 2FJWA 1HMVB 5F8NA 1S9FA 1XR7A 2JEIA 1RAJA 2HNDB 5I42A 3E01A 4H4MA 4ED0A 3RBDA 2V4QA 4F4XA 1RTIA 1JLEB 3G86A 2OPPB 5KFSA 4ECWA 5KFCA 2JLEA 1W25A 1BQNA 2RF2B 3KK2A 4B3OB 3H5XA 2C2DA 4O3SA 3M8PA 3E51A 1RTJA 4EBCA 1DTTA 3CJ5A 2C28A 3QGHA 3LP1B 4FS2A 4K4UA 3CJ0A 2F8EX 3DM2A 2BRKA 4EYHB 3DMJA 4IFYB 1C0TB 3BJYA 2E9TA 1JLAA 3BSOA 3KLFA 3KK1B 4NRTA 4IDKB 3PVXA 4IFVA 4PUOA 3DRSB 3BSNA 1TV6A 3QO9A 4G1QA 4KSEB 4DL7A 3QYYA 2BANB 1JLBA 4MK8A 3Q8SB 3NGDA 2XCAA 3TQ1A 4HKQA 3I0SA 3DOKA 3NBPB 2ILZA 1JLCB 3V4IB 1I6JA 4NLSA 5CYMA 5KG6A 1C1BA 5KFAA 4TQRA 4Y34A 2VG6B 4Y2CA 5HROB 2W9BA 2DPJA 1JLFA 2W9AA 4Q44A 1N5YA 5EDWA 5KT4A 3M8QB 2W7PA 1JLGA 1TKXB 1ZETA 3EPGA 2IBKA 5DLGA 4URGA 3DI6B 4U7CA 3KLIB 2YNGA 3LP0B 5KFGA 4EBDA 5DGAA 5KT3A 2YNFA 2AGQA 4RW9A 4YR2A 2ASJA 3KLEB 3IRXB 5J2NA 3ITHB 2BQRA 1SH2A 1EP4B 1LWFB 4O4RA 3QGGA 4WFYA 3DLEA 3ISNC 1IKYA 5D3GB 4EEYA 3MEEB 4MK7A 5KG7A 1IKWB 1TVRB 2D41A 3DLKB 4DG1A 3V6HA 1T05A 1TKTB 1TQLA 4TYBA 2JC1A 5J2QB 4RNMA 5KFZA 4NLYA 1RT1A 1C1CA 5KFUA 4ED8A 4K4XA 1S1XB 3KNAA 4NLTA 2HNZB 1J5OB 3HVAA 3FQKA 2FLLA 3DRPB 4IG0A 3GIMA 4LSNA 3H2LA 5KFOA 1RA6A 1TKZB 4ED1A 1FKOB 1REVA 1RT6B 1N6QB 1IKVA 3MEGB 3FQLA 4URSA 2B5JA 4MFBB 4F4ZA 2YNIA 4NZ0A 1TL3A 3V6DA 4WE1B 2YNHB 4EYIB 2V0NA 4ZVHA 4IR1A 1RTDB 4RUCA 4J9KA 4TY8A 5HLFA 5DGBA 2I5JA 5KG2A 1HQUA 3V81B 1RT4A 2W7OA 3DOLA 2R2UA 4KE5A 1KLMA 4ED7A 2IM3A 3KMQA 2XGQA 3EPIA 5J1EA 4ECTA 4NLUA 5CYQB 2RKIA 2OPRB 4URQU 1RT3A 4FS1A 1R0AB 3JSMA 3KHGA 4LSLB 3JYTB 2FLPA 4RW6A 1SV5A 3IG1A 3KHLA 5F8LA 1FKPB 4J9QA 3KLVA 1HNIA 4QWAA 3GYNA 2GIQA 5FDLB 4J9NA 4QWCA 1YVFA 4NRUA 1S4FA 5KFFA 5EWFA 1IKXA 1S6PA 3BR9A 3C6UB 4ZP9A 3QIPB 4KFBA 3I0RA 5C42A 3KLHB 2AGOA 4YQWA 1T3NA 4DL4A 4MH8A 1UWBB 2XCPA 4I2PB 3GQCA 3CJ2A 2GIRA 2OPQB 1N48A 3GILA 4I2QA 1LW2B 4ZPAA 4JV2A 2ZKUA 2I1RA 4KKOA 2XGPA 4NYZA 2JEJA 3MFIA 2HAIA 1T94A 3HVTB 2ZE2A 3KLGB 4YR3A 5KFKA 2JC0A 4WXOA 4H4OB 4O44B 4R0EA 3OL6A 1QE1A 5KFYA 3RBEA 2C22A 1S49A 2FVSA 1S1UA 1LW0A 3LAMA 5C24B 4KB7A 1LWEB 5KFDA 4K4SA 1VRTB 4NLWA 3M9MB 3BSAA 3LAKA 1S9GA 2AQ4A 4PWDB 5KFTA 4JV0A 4PQUB 4R5PA 3KK3B 2AX1A 4DL2A 2R8IA 2BE2B 1S10A 4JV1A 1RDRA 3OSPA 5KG0A 3BGRB 2IA6A 5KFLA 2B6AB 1RT5A 4IH6A 3DRRB 4KV8A 3CJ4A 1HMVA 3MEDB 2R8GA 2JEGA 2J6TA 3CJ3A 3QZ7A 2HNDA 2ASLA 3DLGB 3OSNA 3RB4A 3HVWA 2IAJB 1JLEA 2HWIA 2OPPA 5HP1B 4K4YA 1RYRA 2D3UA 2RF2A 5HBMB 5KG1A 3GV5B 4B3OA 2FJVA 4RW7B 3KOAA 1SUQB 5KG5A 2YKMB 3LP1A 2RDJA 4JUZA 2FJXA 3PJWA 5T14A 4QW9A 4IFYA 1C0TA 3MTKA 4O4GB 5DQIA 4F4YA 2VG5B 4ZPBA 3KK1A 1EETB 2IM0A 1SH3A
chains in the Genus database with same CATH superfamily
1SQEA 3D68A 1U1OA 3D0HE 3D28A 1QUPA 3FFIB 3BREA 2GQ2A 3BGUA 2IJNA 1FNXH 4ZS6A 5IT9Y 2OPSB 3OHBA 2RQ4A 3N79A 1TUGB 4OZ5A 5B0CA 1WDDA 1CSJA 1HW8A 2XULA 4I7FB 3NWGA 2C2RA 3H2VE 3FGVA 4LRCA 1HYSB 1UEVA 4ER8A 5D4LA 2I38A 1K8AT 1MYKA 1HD0A 1XN9A 1LQ9A 1E6VB 2Y3YA 4LJMA 3UO0A 4I56A 1R0AA 2DNYA 2KRBA 2AY0A 2XY6A 1S97A 3EVOA 4Q45A 3C15A 4NLQA 2NSCA 4DPYA 5GMKa 3QIPA 3L09A 4DV2F 3IGNA 4OZNA 4NOHA 4ED3A 4YOEA 5IOLA 3SZ2A 1N52B 2UUTA 4OV6A 3HVTA 3NRBA 1KVKA 4PPZA 1RTZA 4O44A 1CQMA 3HHLC 4ECVA 2B7CB 1LWEA 2DISA 4X64F 3N5FA 1F0XA 5KFMA 1GX5A 4RW8B 2R8HA 1RJJA 3N9UC 3E01B 3A8JA 4YP3A 5ETMA 1XNRF 3BR8A 1RTJB 4A8KA 3QAEA 5GAGI 3CD6S 2NUHA 2V4RA 4PRFA 3TJ9A 3BQ2A 2RNEA 2XEXA 4B9MA 3BBCA 4WFBQ 4ZPCA 2A10A 6FDRA 4B3SF 1UEUA 2D3O1 1QDUB 2W4DA 1WG1A 5EGYA 4ILLA 3GG0A 1SC1B 1JLQA 4PG6A 3CDUA 1HBNA 3LP2A 1U6ZA 3EVWA 3UWTA 2C2ZB 3CWJA 4RW4A 4MIBA 3AJ1A 5KFRA 2FLOA 3P49B 1C4CA 4ECRA 1TP7A 1GMWA 1MN7A 4M5KA 3M05A 4X4OA 1RT4B 3IGVA 1JWWA 2RKIB 2V69A 3TA1A 1RT3B 3MM5B 4Q2MA 3GZ7A 2HZVA 2J0SD 4W98A 1TELA 1C0UA 2FC9A 4USHA 3W5YA 4C4WA 3LTOA 4PABA 3GMGA 4PWWA 4KKOB 2FVPA 4KQZA 3CSKA 2GV1A 4QYZJ 4IG3A 5LSLA 2XBPA 2FJEB 4M8LA 4OIXA 5E3CA 2VJUA 3TAQA 3KTQA 3HD1A 1YWXA 3BM7A 4WWSA 5LOQA 2LXIA 4ICLA 3HDSA 4CO4A 2KJVA 3EZOA 2RS8A 2QJ3A 2ZBIA 3WZ0A 4AT1B 1ARRA 2VASA 3AX2A 2BACA 4JI6F 2F8EX 3MD3A 2ACYA 2MKCA 2ZH6A 3AD9C 3LW5C 5DS7A 4NEZA 1TV6A 4I1TA 2XCAA 3GJQB 3HD2A 3EMTA 1KRPA 5KG6A 3UD4P 4KHPF 1PYOB 4NWBA 4UUWA 5F3ZA 2IBKA 3DI6B 2C3MA 1PG5B 5KFGA 4ZLJA 3KLEB 3QGGA 1KEKA 5KG7A 1IKWB 2LCWA 1TKTB 3K7RA 4N77A 5D4OA 4NLTA 2XMWA 3BF4A 2V94A 2YPZA 1TL3A 2XHWA 2RUGA 1MROB 1W26A 1ACMB 3DDNA 4LSLB 5B09A 1VQOS 2DR5A 1CS4A 4NRUA 2DNNA 3C6UB 2E1RA 3QJPA 2ROEA 4C8MA 1T3NA 1WHWA 1Y7PA 5I3QA 4OHZA 3HMJG 3NG8A 1EQMA 2VBZA 3KLGB 1TMMA 3W5ZA 2MEWA 3DXBA 1B64A 5KFYA 5C24B 2A18A 2MGZB 1YI2S 3DRXA 5E3QA 1WACA 3G5OA 4DV0F 2O3DA 2PT0A 2CZ4A 2XNRA 2JFKA 1ZM4A 4WJBA 3M6VA 3N28A 2Z2ZA 5HQLA 4ZPTR 2H65B 1TR0A 3MOJB 2E1MC 3MEDB 2KYXA 2ZH3A 2OPPA 3MGJA 4DFJA 4RW7B 3AY0A 4RPFA 2YKMB 2FJXA 1X4GA 4ZPBA 4B3TF 1OG7A 3S8SA 2E9ZA 3J7YU 1OY8A 2XZ2A 1NK4A 2BR0A 1X4EA 2FVRA 1VI7A 2YKQA 4O3RA 3G8TA 2IRXA 2ZVIA 4FYDA 3HHLB 3FDSA 4MT1A 2XM3A 2HQFA 4Z37A 2DGQA 1D8ZA 3GE9A 4L3NA 3EYZA 1X4DA 3OHAA 4ZPWR 2YWKA 1J5OA 3A8EA 4Y00A 3OLAA 1TKZA 2IIHA 2DBBA 1HKAA 3ICLA 4IH5A 2JH3A 5KAKA 3JB9k 4XPEA 2IJFA 2NPIA 3CO0P 1IVZA 1HNVB 2NZCA 5FIIA 3ZZUA 3US5A 4DV6F 2IM1A 4TY9A 2RBFA 1KFSA 2KRRA 2XSFA 2ZHOA 4B08A 3RJMB 5A8KA 3ETMA 1LW2A 4UQGA 2XLKA 1M5SA 3M30A 1TL1B 1A6LA 3QFWA 1DRZA 3TZXA 3JSYA 4EI2A 4DL6A 2DEJA 1VFJA 2FVQA 3MPDA 1ZAXA 2RRBA 3BZQA 4NLOA 3SV4A 3V6KA 2KU7A 2HURA 1PC5A 3QSIA 2JWNA 4RBTA 3HM9A 5RUBA 3NL0A 4OL8A 4HLBA 3BBFA 1JLAB 1S0MA 3FBBA 4FNIA 2WBMA 4LF9J 4CH1A 3GSDA 1C1BB 2XC9A 3RRHA 1JLFB 5HO4A 1T7PA 4DFMA 1U1QA 2YVSA 3CJTA 2QLWA 1UVNA 2HMIA 2R4FA 2N4DA 4DQRA 1QLNA 1HNWF 2WRMA 2Z8QA 5AE1A 4IG0B 3C19A 2B5JB 1HNZJ 1BQMA 2JXGA 4B3MF 2CQDA 3DYAA 3H90A 4P71A 1WOOA 4NE9C 1CJTA 1P9YA 2AV5A 3M32B 1J2VA 3D3BJ 3A4TA 4ZP6A 3CJ8A 4YB7A 2DITA 1D8YA 2HHHJ 4AL5A 1VLYA 4G65A 2HBRB 3JQJA 3JSBA 4ZIVA 3G6XA 4I68A 5A6PA 2OMOA 5IT0A 2CQHA 4OI2A 2V4JB 4UOGA 3BGOP 3EZUA 4FYWB 2YWGA 4CDIA 3DDKA 4RNHA 2JSXA 2QLJB 2IA0A 1SKUB 4PXCA 2JLEA 2ERRA 1Q95G 3D9BA 1Z2ZA 2VPYB 4IUFA 3KLFA 2LLZA 3NGDA 1EHWA 2HLTA 2XMMA 1JLCB 2WVEA 2LQ5A 4Q44A 1OWXA 1JLGA 3OPKA 4RW9A 1EP4B 1VR6A 3EVMA 3ISZA 4WFYA 5HANA 1ARQA 4DSLA 3AOAA 1WOSA 2QGFB 2L9WA 2BJ1A 5KFZA 1TAQA 4NLYA 1W7WA 1GMWD 2RMLA 2VC1A 4KJIA 1RT6B 2F63A 3ELHA 1I51B 4DX7A 4JOUA 4ZVTB 4PEOA 1IUJA 1IM6A 5CYQB 1Q82T 3P6YC 3MM8B 2W2OP 1NKEA 4J9QA 1SC6A 5B0DA 2MJNA 1HI1A 4QWCA 3U27A 5C42A 3I0RA 1S79A 2LMIA 3CJ2A 1FRHA 1NDCA 1S76D 4DR7J 4C8OA 3MZIA 3OT9A 5A8RB 1S9GA 3VAMA 4JYAF 3HJFA 4F2SA 3OUYA 2BE2B 1R27B 5KFLA 1ZM2A 4DV1F 1HBOA 3NCPA 4CZCA 3CPWR 3OSNA 2RVJA 3A1YG 4DV2J 4OJ1A 3MM6A 2R9LA 1FVQA 3JSRA 4RX6A 2DNOA 3V5RA 3MURP 3DRSA 4RUAA 1U09A 4DF4A 3UCZP 4DPUA 4K5SA 2X1FA 2UZAA 2C3OA 2VG6A 2EBGA 1N54B 1HWLA 1BQXA 1YK9A 2P9EA 3IXQA 1TKXA 2ZH7A 2R7VA 5F8MA 3H4BA 4EO8A 1S9EB 1IBLJ 2CA9A 2BDPA 2DCUB 4PQAA 1S59A 5AXNA 3TR5A 1S77D 1XNRJ 2AWZA 1HHSA 1HWKA 2ZDOA 1S1TB 5EX3A 1QVFR 3FEYB 3JQMA 2OMLA 2UVRA 4MIWA 1UA0A 2W24A 4B3SJ 4Y2IA 4XO0A 3SBMA 1KHVA 2RS2A 2MHEA 3CVKA 1RKJA 3MCOA 4NI2B 3PXGa 4FBUA 2HFVA 2C2MB 2QL7B 5DDRC 4ES2A 1DAXA 3MFHA 2EBEA 1LWCB 4H54A 1MYLA 5CD4H 4I67A 2R8JA 1AA1B 5DDQC 3HSDA 3UDLA 1RB0A 2OFHX 2K06A 2F4VJ 4NXMF 2KJWA 3GTYX 3CUNA 1B0PA 4K4WA 4LF4J 1FDBA 5I42B 3MAQA 1RTIB 2HGNA 4LRAA 1BQNB 3KK2B 2C2EA 1SKSA 4XPCA 2HHWA 4LIWA 2Q3PA 3C16B 2VBXA 1QAIA 3QO9B 4DL0C 1YBAA 3DOKB 4NLGA 1SQFA 1Q8IA 3W66A 2CNOB 1NJWA 3FFIA 4Y28C 3T5LA 5DG7A 6AT1B 1N33F 3MR6A 2OPSA 2HLUA 1T05B 2W2QP 3J7ZT 4I7FA 3HFZB 3KKFA 4NLDA 5CAAA 3AHPA 4J9VA 1H74A 3V6JA 1X5PA 1X4HA 4JI6J 1SI9A 1HYSA 2G0JA 3R1LA 2GX8A 3M9OB 2M7SA 3CW2C 1GH8A 1K1QA 3UNYA 4ELTA 4J9RA 2LKZA 1E6VA 5ETLA 3CO9A 1MLAA 4JI4F 4O3OA 4JP8A 4OJHA 1KTVA 2NR0A 1WD6A 4DSKA 2DGWA 1WF1A 4NLPA 3B78A 1B70B 3CJQA 1ZAWA 3I4HX 2EI5A 1WC6A 3KHRA 2ZJRQ 4FXDA 4FP9A 2CAXA 3TYTA 5LMUF 4C0HA 3IFEA 2ATCB 4A8SA 4R5PB 2M8HA 2Z2YB 3SDEB 4RW8A 3I5BA 4N7TA 2WK4A 2HNDB 3E01A 4KH0B 4CI0B 3BV8A 2NXCA 4ZN1A 5GAEI 1LK7A 1RTJA 4WP9A 1NH8A 4HI1A 3VALA 1YJUA 4IFYB 1JJ4A 3NS6A 3CTRA 1KOHA 5I4MA 2CWKA 4Y34A 2BV3A 1Q8BA 2J9EA 2VD3A 3EPGA 4URGA 4K0KF 2AGQA 4U8YA 4F0HA 4A8YA 2O67A 3AX5A 2FHMA 1UEKA 4ZCKA 4G6VB 2XO7A 4LF1A 2F40A 2B9EA 1RHUB 3KYLA 2KVQE 5IZHA 4BC7A 3RW6A 1ZS6A 1RT4A 1Q79A 4FDFA 2XGQA 2FHJA 4ECTA 2RKIA 4URQU 1RT3A 3MM5A 2HAFA 2XWXA 4ZLLA 4K59A 5FDLB 3PFOA 3TAPA 3Q22A 5HJYA 5FJ4A 3Q2TC 1X4FA 2HS3A 3H20A 5A8WB 4DR2F 2AJ4A 4IQMA 1MN9A 4KKOA 3MFIA 2HAIA 1NSKL 2F7VA 2ZC4A 3MPUB 2BSQE 3QRQA 2G0CA 4KIAA 1YJTA 3MCSA 2XB2D 2AX1A 1RHMB 1ZM9A 3TI0A 3OSPA 3BKFA 2G2YA 2QIFA 3A3NB 4LFAF 1RU2A 4ZK7M 2WVCA 3RYLA 3H25A 3CF5Q 2COLA 3VGUA 4K4YA 3LF0A 4OX6A 1JMTA 2ZBCA 4OMFG 1U25A 2IM0A 1ZYQA 2WONB 1MU2B 4C9DA 3OTBA 3BQ0A 3IAS9 2GHWA 2ZH4A 1RA7A 3DI6A 3R6LB 4QWDA 4WPAA 3KLEA 3MTJA 4XDDA 3I32A 1IKWA 1TKTA 1AUDA 2QG9B 1AT1B 5CZXA 3PHEA 3TUJC 2FHKA 3FC9A 1ZA2B 2NXEA 2VG7B 4ETZA 4X84A 2BJ3A 4KYZA 1UVKA 2R7QA 3GU0A 3PW7A 1MROA 2CNNB 2VB6A 4M5DB 4LSLA 3CD0A 1FESA 2DGTA 1WSVA 2KG1A 1GMUA 1TK5A 4X2BA 3PFEA 3E8OA 4JI8F 3C6UA 3NGKA 2KFZA 5C5JA 1O0PA 1SIWB 5GADU 2EK1A 1HNWJ 2XWYA 1XNQJ 1RWOB 3IR5B 1T3OA 2PI5A 3KUEA 1YIJS 2UUBF 2AYMA 5DDOC 3PO5A 3KLGA 4IOAQ 3R5CA 5L9NA 3MPVA 4AD6A 1IR1A 3H98A 5C24A 2MGZA 1NM2A 2DYAA 4U95A 3J7A1 2FZCB 3NCQA 4B3MJ 3NGTA 4B9NA 2QFJA 2VFRA 3SFUA 1FDDA 1JJCB 2PIIA 3MEDA 2D3ZA 1VIOA 3M8PB 4HHUA 4O0NA 1UA1A 1R43A 4AAIA 4RW7A 4F3MA 1F2HA 3PW4A 3DM2B 4DUYF 2YKMA 5K14B 4AE5A 2J7UA 2WCXA 1RWPB 2K7JA 1SKWA 3W8PA 1I94F 2GVDB 1F6TA 3OFGA 1A0OB 5FLXU 4U6PA 2CIMA 3BO2A 4BHQA 1RUSA 1KSPA 1M5OC 1RWWB 1FE0A 2LFVA 1U1RA 5DG9A 2V9WA 5LT5A 1KN6A 4WZMA 5B7WA 1YJ7A 1P27B 3HHLA 5LSRA 4FNHA 3PRVA 2DD8S 1FFSB 3J81Y 2HVZA 4USIA 5BR8J 1S72S 4IRCA 4ECYA 1D9AA 2MQMA 4TQSA 2VBYA 1G6BA 3L7PA 3O2IA 3NMRA 2C2NA 4J9LA 2HS0A 3JSMB 4RW6B 3G96A 4LT6A 4DR5J 3OVSA 1NSAA 1HNVA 3R5DA 3R27A 4P52A 2MZRA 5KFPA 2EFVA 1FWLA 3HJVA 5G0RB 4FXEA 2B4OA 4RBUA 3VQTA 3ILJA 5GAGU 1TL1A 4LF2A 2QE5A 2HKEA 2UVWA 1OY9A 4ZVSB 1SVDA 3RR7A 3CIMA 3ZTOA 4U67Q 4P2MA 4DFPA 2V8VA 4ZMMA 4J37A 4PYDA 1RCXB 2BZ2A 2ROGA 3H40A 2DGUA 4P6QA 2VPXB 6FD1A 1KVJA 3Q24A 2IVMA 1PBUA 4LRDA 4DOZA 3NGSA 3HFKA 4EBCA 2VPZB 4ZVQB 1JLAA 2V8PA 4MK8A 1M5HA 4KGVB 4E2FB 4TQRA 1C1BA 1JLFA 4UTGA 5HK4A 2JFDA 4JYAJ 2ROPA 1ZETA 1RCOB 5KT3A 1URNA 3FMBA 1KOOA 1WORA 3KNAA 1SPBP 2W01A 2HIQA 4IG0A 2E7VA 2Q2KA 2B5JA 4MFBB 4OFZA 2W25A 5CABA 2WB1D 1Y00A 1QAXA 1RBOB 3CXCR 2DO4A 2LVWA 1FJCA 3K5PA 4J9NA 1ZM3A 1GXUA 3M32A 3K59A 4C0OC 1V5IB 2AGOA 1BLUA 2AP6A 1J27A 3Q83A 3O44A 1BE4A 4NYZA 2NYIA 4NPOA 3CCVS 1FXRA 2AZ1A 3PYFA 2DHHA 4BWJA 2OJ3A 1UJ5A 3FUYA 2JVOA 3BKTA 2V4JA 3EICA 4DX8H 1YG0A 4DL2A 1R89A 3AQOA 1WHYA 2SXLA 5B0EA 4R0JA 5M2PA 3NCRA 4P7TA 3FSYA 4X4RA 1MSWD 2QT7A 3ZNUA 5HBMB 2EC2A 1EX8A 5D4PA 1SUQB 2RDJA 1LK5A 4QW9A 4YB6A 4CM0A 3G8QA 4KAIA 1OSCA 3D3CJ 4X4PA 5C25B 2YH0A 1JLCA 4ZCMA 3G82B 3UQSA 3PKMA 4NXMJ 4UW2A 4WYLA 3MM9B 1TKDA 2VHGA 4FF4A 2ZVSA 2IDEA 1EP4A 2ZOGA 3GFYA 2XS7A 3UN2A 4B02A 3EGNA 2GIFA 4M95A 3Q8QB 1WEXA 2KXFA 1RT6A 1Y4ZB 5AE2A 1UFWA 2FHJD 1X93A 3M8SA 4WFZA 1XIQA 2I2YA 3WBZA 5CYQA 4ID5B 3MM8A 1P1LA 4WYWA 1RTHB 3KMSA 1FXDA 3GCXP 3NS7B 5SUHA 3EGZA 2IJRA 1MMDA 1FE4A 5J2PB 4DI6A 4J9PA 5A2QU 5AT1B 4DR1F 8RUCA 2L41A 3CMQA 3GIKA 3LO3A 4RR5A 1T9XA 5J1NA 3POTB 3CJKB 5A8RA 2W8KA 2BE2A 1IBKF 4OHYA 4HH0A 5IS2A 1M5PC 4M94A 4WXWA 3Q8UA 2QC3A 3PACA 3OFEA 5K9FA 3DMJB 1ZZNA 2NLWA 5D77A 5HMWA 5E2QA 3HHNB 3I0SB 3W5XA 3D4JA 1Q1KA 4FKYA 3MR5A 5LMUJ 2W9BB 3FRYA 4DPWA 2MMYA 2MDAA 4X66F 2JNJA 4TU8A 3PO4A 5J2NB 2RHSB 4EFAC 2XSJB 1S9EA 1VBZA 5KG4A 3I56S 2C3YA 3D54A 1RT1B 3J7Z5 3LGMA 1R6YA 1A7GE 1REVB 2DEIA 3GWCA 3Q8YA 1S1TA 5LMNF 2W4CA 2KKEA 4TY8B 3GYGA 4Z7CA 2UV8A 3T6BA 1KLMB 4YFUA 4JV5J 3L7UA 4C97A 4KFBB 4NI2A 4DSIA 3GIIA 5KFBA 2CUYA 2BBEA 4FXWA 2FY1A 4ZVPB 4LFCF 1YJRA 1LWCA 2LEPA 3NNCA 3CD5A 2AJ1A 1DARA 1HR0F 3LOUA 1N34F 1NPPA 1C2PA 1V5VA 1H7WA 1UTAA 4KT0C 3B4MA 3M8ZA 2CZVC 3MOZA 1RT5B 4D3HA 4WKYA 3AWRA 3PW5A 1XJWB 2PMHA 1RAJA 2JEIA 5I42A 1EA4A 1RTIA 1JLEB 2B8QA 5KFSA 4DX6A 1BQNA 3KK2A 3T1YF 4DR2J 2EKNA 1ZOTA 3DLHA 4OHXA 3C16A 3HULA 3NEKA 3QO9A 4KGKA 4M5JA 5E3RA 4OHVA 3DOKA 1I6JA 4OLPA 2H51B 4KR0B 2ZNZA 2GGPB 3I82A 3CCZA 2YWHA 3HHLD 1RADB 3ZZTA 5L38A 1TMJA 2V5HG 4DV7F 2LXUA 1T05A 1Y5NB 1RWKB 4CO2A 3DRPB 3W9HA 1S5ZA 2L9DA 2X1BA 3LGHA 3MEGB 3O6QA 3AA8A 3ENQA 2DR9A 2V0NA 8ATCB 2WW4A 3A13A 4CLZA 2HHXA 3DFEA 3GFHA 3KWMA 5L39A 1S4FA 3PTWA 3SQGB 1KDNA 5AXMA 2MSTA 4USJC 1Y3KA 1NLKL 1T94A 2KXHA 3QMQA 1XMQF 3DC2A 2V1SA 4H4OB 1S4EA 3DOMB 3K8VA 3K5LA 4KB7A 3VEBA 3ZXWA 4K4SA 3QJJA 5H9FK 3DU6A 1PO6A 4CT8A 4R5PA 4C8LA 4C2MA 1VBYA 3SDEA 1WTFA 2ABYA 2HQGA 1XWLA 3OTDA 4FVCA 2RQCA 2WSFC 5IWAF 2HNDA 1RAIB 2KTQA 2KM8C 1RYRA 3D66A 2DGXA 2BM1A 2K2PA 2N82B 4CLTA 2QMUB 4A8XA 4DFKA 1QSSA 2A2CA 2UUBJ 4IFYA 3MHYA 3MTKA 2VG5B 4UF4A 1SH3A 1S6QB 4P2SA 2VA3A 2P9GA 1LKZA 3SMZA 1JIHA 3H4DA 3BPDA 1JK9B 1WSRA 4RLEA 2EFPA 4ETXA 2DGOA 4QQBA 1RWMB 3G6VA 2H5EA 2IHR1 5HVFA 1JKHB 4OJ3A 4DUYJ 2MB0B 4C3LA 2VBWA 3S7RA 4ZVGA 1I94J 4NX9A 3THVA 1FXLA 2C1EB 3ZO7A 2YBVA 4LBIA 5FDLA 3AD8C 5M2UA 1RT2B 1RLCL 5L46A 2QEXS 5A8WA 1H2UX 1FDNA 4ATNA 2KO1A 4PG5A 2RD5C 2D1CA 4A8WA 4ED5A 2KN4A 2HBQB 4C6AA 2KB2A 2J76E 1HW9A 1BWVA 2GS8A 3VAIA 3QBCA 4ZKAA 1EAYC 4ZVEA 4CNYA 1FERA 1VQ4S 3ZC4A 4DZDA 3GJSB 1KNZA 1P94A 4F02A 2HHTA 4DV4F 3IA0A 5KT5A 1DTTB 3MR2A 2FGCA 4OI0A 1NDLA 2N3LA 4BBYA 4ZPDA 1V3ZA 2WONA 1MU2A 1CULB 5H9EJ 4E98A 1S0OA 3PIOQ 1DFDA 3PKYA 4RNOA 2ZHBA 2G13A 2NS1B 3TRGA 1X5TA 3TEGA 2L3MA 3ETOA 4QIGA 4ZCIA 1C1CB 2BABA 3WX4A 4OI6A 4PXDA 2QFIA 2WZ1A 4ED6A 1FEHA 3M1VB 2VG7A 3DKDA 2JOQA 2LP4A 3V6DB 4USTA 4LQ9A 5B0BA 4FYVB 1TUWA 1U02A 5J1PA 1U49A 2KHDA 2CPGA 2MY8A 2X1AA 3QPIA 2QYGA 4M5DA 4MKAA 1DY3A 5DG8A 2WTFA 3TVZA 5GAHI 3PEHA 1SIWA 5KT2A 5GVQA 2B9YA 2ZKTA 2JRSA 2UXBF 3D6TB 2DNHA 1WI8A 2UUAF 2QTWA 4F04B 3KJFB 3QT5A 4DSEA 5KTQA 1BD6A 2A3JA 1Q16B 3H5SA 1NPKA 1NNDA 5T41A 2PEBA 4G3IA 3R5GA 2HHPA 2BJDA 3P5BP 2V4QA 2HPUA 2OI2A 1O8BA 3H5XA 2W2MP 3M8PA 1VQ8S 2BE7D 3DM2A 4K7QA 1FI4A 1FRMA 1IJFB 4HDHA 4EWTA 1V6HA 3H8YA 2GVDA 4NLSA 3IWNC 3IBFB 4DQQA 2J9CA 4XIUA 3RTVA 2VQFF 1B3TA 1SL1A 3LP0B 4YR2A 3GYXB 4DBQA 1LWFB 4I69A 1K0VA 4L73A 4EK2A 5HQ8A 2VODA 1KVIA 1PJ6A 3FCVA 1K47A 1YHQS 2XTCA 2G4BA 3EGVA 4GVBB 4AL6A 1FKOB 3DRYA 4W92B 5CCMA 3VAHA 5KG2A 5CZVA 1UMJA 3Q8VA 3JSMA 4YN3B 1NBEB 3NY0A 4RW6A 3KLVA 4FZVA 1F5AA 2IVFB 1YVFA 4ZN3A 2D9OA 4G1PA 4C98A 2GMHA 3W7BA 2R7RA 3SSRA 3GQCA 3H7HB 5G0RA 3AT1B 3R5AA 1MNEA 4RUBA 4YR3A 5JJBA 2N7YA 2VFTA 2HFZA 2MYFA 2XNQA 1P6TA 3M9MB 3BSAA 4OQJA 2K7KA 1Q8KA 1FX4A 5IXUA 2R8GA 3WX8A 2J6TA 3CJ3A 1Q78A 4DR4F 3BPSP 2IAJB 5LXRA 1CC7A 2MQNA 5I3PA 1KC8T 4BLGA 1ROFA 4ILRA 5T14A 1GMVA 3NP5A 2HW3A 4F4YA 3HHDA 1HHQA 2B0GA 3VWSA 1UZHA 1T0TV 3MM7B 4DSJA 4B3RF 3TP2A 4WFAQ 5HSPA 1A9NB 1YRTA 3MDFA 1U2FA 4Y0FA 3TARA 2A6OA 1SQGA 3UN3A 4USWA 3VEAA 2QO3A 3HSJA 2V8DA 1NK0A 1WG5A 5THWA 4X65F 1XERA 2Z30B 1UFKA 4JI5F 1X9WA 3CJSA 1PAUB 2MZQA 2YX4A 2JJ4D 1VDHA 2BVZA 4RL1A 2MQOA 4MFBA 1FJGJ 3MWBA 1NB2A 5KOXA 1U4BA 2ZOMA 3VAJA 5L1JA 2RSQA 1UJ4A 2JXHA 1RHKB 1P8GA 3JTPA 2DR6A 3PJXA 5F9LA 2GAHC 1RZMA 1HPZB 1RWUA 1TUVA 3BQ1A 2R2TA 3N01A 2D7SA 2XQCA 3ADAC 4EGLA 2W4PA 4WK3A 2PA3A 1HQEB 2ILYA 2ZC3A 2NXUA 5A0YB 4ZJLA 1WKLA 1Q4RA 1ELOA 1R7IA 2KELA 1FFWB 1FRLA 2MQLA 4TLRA 2PI4A 1M5KC 3D7SB 4L74A 2UU9J 1UW9A 3NKYA 3MPYA 3KJQB 5HBMA 2GC8A 4LFCJ 1SUQA 3JTNA 3RAMA 1HR0J 1N34J 2JHEA 2ALYB 3CCTA 4LF7F 5IQ6A 2VIHA 5C25A 3GR1A 4PAAA 1CPZA 3G82A 1Z4UA 4M5MA 3NMAA 2AKWB 3C46A 3PRBA 3MM9A 4N8OA 2I6WA 1XBWA 1IKYB 4OZ0A 2XYHB 1O5JA 1RABB 3UCUP 3T1YJ 2IRYA 1YZ7A 4L6V3 1TL5A 3W63A 1YTYA 2HZCA 5HLFB 4LREA 3DOLB 3H0PA 2YKAA 4CWBA 2J0XA 4ID5A 1RTHA 2GJIA 4YR0A 3GFZA 2J8AA 3FZBA 3P3DA 3PX0A 2A0FB 2K1RB 4RU9A 2P6TA 5J2PA 1NAQA 4RWXA 1BC6A 3GJRB 5KFVA 1LNQA 2ZM6F 1FKAF 3IWXA 1F3VA 2ZZMA 2KT2A 4DPXA 4K2XA 2HBYB 3POTA 3CJKA 2AZ3A 4HTJA 2WBRA 2PA8D 4CLUA 2Q66A 3B4DA 4GC6A 2PMWA 3HT0A 1PYSB 2J6SA 2R7OA 4LBPA 2ASDA 1XR7A 3PX6A 2ZEJA 2XMJA 3RBDA 5LJ5Y 2LQJA 5AJ3F 2C28A 2MKSA 1PJ5A 4JI3F 2WVFA 3DMJA 1OQ3A 4RU2A 3GP9A 3VTIA 3Q8SB 3I0SA 4LFBF 3CMAS 3GONA 2W9BA 3NWRA 4DUZF 2HVIA 2GHVC 1Q7LB 1MG7A 3VAKA 5J2NA 3ITHB 1NJXA 4O4RA 2XSJA 5D3GB 4EEYA 5J2QB 3B82A 1F60B 1RT1A 2YQ1A 1S1XB 2AHOB 1QD1A 2X7IA 1NLAA 1REVA 1PGZA 2PDAA 4F4ZA 4EYIB 1EARA 4PZVA 4TY8A 1T9TA 4B9VA 2R2UA 1KLMA 2IM3A 3KMQA 3LWMA 2GHPA 3TQEA 3S1TA 3VF0B 2E44A 3KHLA 4YEAA 1KWMA 5E3AA 4EU0A 1VHFA 5EWFA 2K29A 4KFBA 2B7BB 5H9EK 3CEDA 2DKOB 3CCUS 3W60A 1N48A 4YS2A 1N5QA 2RU9A 3L95X 4WBFA 3P5TL 2F3JA 1F9HA 3N4WA 1YSJA 1U9PA 1RP5A 2DB1A 2XLJA 1WC0A 1Q53A 1EZZB 4JV1A 4XAKA 3PM9A 3FSXA 1RT5A 4IH6A 4WFNQ 4ZPVR 2M0GB 4HACB 3F41A 2PFFB 1YRUA 1IXKA 1JLEA 1X4AA 5HP1B 2H54B 2MLXA 2HSEB 1R6VA 1FDAA 2JDJA 4C0BA 1OO0B 2F65A 3FBFA 3TJAA 1NK6A 1RBAA 4M5NA 1NK7A 2VU5A 2ZJQQ 4OI4A 4LRVA 4ZA1A 1RYSA 1U6BA 2BXJA 1HD1A 2GGPA 4Z2XA 5E3PA 1U1PA 1OJ4A 4JI2J 4C3KA 1OM2A 1SL2A 4ENOA 1B7YB 2C42A 1JX4A 4QWEA 4DV4J 1RWNB 2O1PA 4F4KA 1CJVB 3DRPA 2XS5A 2Z56B 1UVMA 5D0GA 3MEGA 4IOBA 3TAMB 3QAUA 4LMZA 2V1TA 3ILLA 5HQMA 1BXNA 1VBKA 4O3PA 2RE1A 3UCGA 1RT7B 1Q86T 3OW2R 3M9NB 3CD7A 1N32J 2HYIB 4RNFA 4ECUA 2HEKA 3SQGA 4TN2A 5KFQA 2AEJA 2KHCA 1QVGR 4F4WA 1MMNA 4WKRA 3RB0A 2OGUA 2DK2A 1ICEB 1WKJA 4H4OA 4IOCQ 3DOMA 4I64A 3I6PA 3SIPB 3TVKA 1BGXT 3LPYA 5F0WA 4YDDB 4Y3CA 5FLXY 2CPEA 1U45A 1SXLA 1V9OA 3EM1A 3T19A 4GKJJ 4A46A 2N4CA 3FMWA 3IR6B 2QN6B 1T11A 1B4SA 3G2XA 1Z1ZA 2E5LF 2OSQA 2UXBJ 4IFVB 1TAUA 3SSQA 1S6QA 2K9IA 1EKSA 3NO7A 3W1YC 5CYJA 1FX2A 4YY3J 3NOGA 2OHDA 2HVEA 5LJ3Y 1FTRA 1D09B 3B54A 2CQ0A 3HLUA 3KUGA 3KG4A 1WNEA 3VHQA 4NMXA 4KHRA 2V34A 4LSNB 1JKHA 4UOCA 3CGIA 5HMYA 2E5JA 2MKIA 4QCLA 1X9MA 2W1BA 2D3OR 4ZP8A 1RLDA 1R8AA 5CD4A 2K8GA 2CQ1A 4LR7A 1RGVA 2KT3A 3IG1B 2YY3A 1X7VA 3AAWB 3TJ8A 2B4PA 1FT8A 1RT2A 2VQEF 3FRZA 5CQGA 5CCLA 4I2QB 5K20B 4P74A 3DCAA 1UW4A 4DU7A 2KT5A 4KPCA 1BY9A 2DCLA 2YX1A 3WC0A 1ULRA 4QR0A 2AEMA 4NYOA 3MMAB 4BS2A 1H0HB 2DT9A 3SCJE 5F8NA 4F8RA 4RJVA 2Y8WA 1QJHA 2KH9A 2H5JB 2Y9HA 1EQ0A 3BYRA 2L48A 4N5SA 1DTTA 3QGHA 4QIFA 1NSPA 2LA4A 2HK3A 4HVZA 2BEFA 2BANB 2BUNA 1CULA 1FJEB 3QWPA 2MTLA 4P2FA 5D0EA 3HVRA 3M8QB 1F2GA 2PC6A 3CDAA 4N8NA 4R25A 3KLIB 4AL7A 2ASJA 1KS2A 4N47A 1SH2A 3CCLS 2DH8A 4DS4A 4N41A 2XMVA 1PBAA 3DLKB 3WC2A 2JC1A 4DR4J 2G2ZA 4ED8A 1C1CA 2FB0A 2DHSA 5ETNA 3K57A 3M6XA 2HNZB 4EZ9A 4DHVA 4OV1A 3GIMA 5KFOA 3M1VA 3UFCX 5ETSA 3MAHA 1M5VC 3BBBA 3PDNA 1L3UA 3V6DA 4PXBA 4J9KA 2ASYA 3OXGA 3V81B 1GTEA 4B3RJ 3O8WA 1H2VZ 4NLUA 2OPRB 4ZJQA 3JYTB 1Q5YA 2R7TA 4UY85 3I55S 4QBUA 2JZ5A 5E7OB 3M2UB 2OKQA 2HQDA 4X65J 4PG8A 3CE8A 2AW0A 3RBXA 2ADBA 4JV2A 2ZKUA 4JI5J 4FKXA 4C11B 2C22A 3EWGA 2CPDA 3RUBL 4DN0A 4NLWA 1V3RA 2BE9B 4PWDB 3EXYA 2LYVA 3NNHA 1YITS 1Q16A 2QLBB 1X0PA 2M70A 4D8JA 1WDTA 5DETA 4LSZB 2D3UA 5IV4A 3DGVA 3HI9A 3OTOJ 3PJWA 1U1NA 4F3OA 2JXIA 2IDLA 2WSEC 2KOEA 1IM4A 1IQZA 2VZ9A 2HNYB 3L4BC 1ZAVA 3N0VA 1CJKB 2C3PA 4Q0BB 3LP0A 2Z57B 3AOBA 4F67A 1LWFA 3G87A 3TW0A 1R0CB 4RZRA 4WFXA 1NZAA 1NDPA 4GVBA 3U02A 1FKOA 4QIVA 5A2QY 3BO4A 1VISA 2VPWB 3ZTQA 4NL5A 4B9SA 4LF7J 1HARA 2QV6A 2VH7A 4CO5A 4LRBA 1N56A 4OYXA 2AX0A 4QR2A 3JTOA 2CQPA 2LEBA 2DY9A 4DX5A 1WC1A 3K89A 1WELA 2J9DA 3R6GB 4F25A 1XR5A 5H1SV 2H9ZA 4MMOA 3VVTA 3RAQA 2HBZB 4OYPA 3OLBA 3MR7A 3JQKA 2OUGA 3HX9A 2GMJA 4Z7YA 2Z58B 1RWVB 4H4MB 2IAJA 2MKYA 2V8GA 5C2CA 3UW1A 4WF9Q 4YB1P 4CT9A 2CPIA 3P4UB 1G7CB 5KFXA 3VGTA 2ZM6J 3AODA 4DXLA 1AFIA 1V3SA 1VGYA 2LU2A 3MM7A 4DEZA 1F3FA 1JJHA 1QY7A 3TX0A 4XK8C 1L3SA 1T02A 2OTLS 3CJRA 1KQFB 2AD9A 3VVUA 1IR2A 3NNEA 2DGSA 1F5BA 4J91A 3TWZA 3ENVA 1JXEA 1URRA 1FRIA 3BN7A 4HR2A 4JI3J 1FWPA 2OP5A 2BQ3A 5KFHA 3R9LA 2XTDA 1F1BB 2FYXA 1IN0A 1U1KA 5J1EB 1CC8A 4C8ZA 2DJWA 4DUZJ 3QGPA 4LR8A 4NCAA 3PV8A 1VHIA 1DBDA 1HPZA 2CJQA 3W65A 4QWBA 4JB8B 1VS3A 2RRAA 2ZE2B 4LF8F 1UJ6A 1B01A 1WOPA 1HQEA 3JS9A 4CP5A 3GV7B 4HHHA 5A0YA 2YWEA 3FEZA 3CCES 3FBEA 3DXSX 2J5AA 4KV8B 2FJWA 1S9FA 4QYRA 1B0TA 4Y6IA 2Z0GA 2Z4PA 3DN9A 3KJNB 1PSDA 2BRKA 1C0TB 4CLFA 1KBRA 4DL7A 3ZTSA 4F2RA 5HI7A 4WP8A 3P8BB 1U8WA 3M8WA 2CQBA 1YJ9S 2EG2A 4X64J 4F3QA 2G9OA 2RUSA 1IKYA 4QYZK 5LM7E 2XZTB 2D41A 5GAHU 3S01A 4HT5A 1QTMA 3H87C 4K4XA 4X4QA 4CLWA 2BM0A 1FRKA 2BA3A 2IBOA 1W2BR 2CPYA 2BMBA 1Q5VA 1FCAA 2HG4A 4WE1B 4IR1A 2ZITA 5HLFA 1B0VA 3DOLA 2QZ8A 1R8CA 3D1OA 1DQ8A 4C8NA 3VW4A 1NEEA 1NO8A 4FVMA 2R3VA 1ZA1B 9ATCB 4USKA 2K1RA 1H38A 4ME7E 4LF5F 2U2FA 4LF9F 4DPOA 4F26A 3RBEA 3OD2A 3LAMA 4OYZA 2IVYA 3KNGA 4CQ1A 1FWKA 2CVIA 4PQUB 3CCRS 1KONA 1RDRA 4RBVA 4HL9A 3BH7B 2KYZA 2JEGA 4V19J 1UFLA 4QZVB 2HWIA 2KZZA 3QRPA 3VZIA 5T7LB 1WG4A 2HFUA 2FJDB 4U7UK 4JUZA 2MQPA 3DLLQ 1SC3B 2RQMA 2YNHB 3UR0A 5I3UB 3QT6A 1KR4A 1JNRB 4UOHA 4P75A 3MR3A 2IC3B 1QUVA 2CG4A 2EFOA 4OZ1A 1VQ7S 5L8RC 1VOMA 2WOMB 2R8KA 3ITHA 1NHUA 5D3GA 3QFHA 4IH7A 3V2UC 5J2QA 1NMEB 2RU3A 3AD7C 3CCWA 1S1XA 1S1VB 4CO3A 2P8IA 4FN5A 5G4DA 3TZYA 2E5LJ 2YX7A 2R7XA 5EUHA 3G6ES 3FCWA 1TK8A 1G4CA 3RZAA 5F8JA 3H2UB 4KTQA 1UVIA 1OPZA 2UXDF 3AJDA 5L1KA 4H4KC 4K2JA 4KHPJ 3AXKA 4N56A 3VGSA 3U7JA 5J2MB 4F0KA 1WC5A 3BYPA 3UD3P 4OX9F 4L72B 3PW0A 1XC9A 3RR8A 1SJRA 2DIVA 3BB5A 3HHEA 2YXLA 4DR3F 1FJ7A 1IJEB 5GADI 1XMOF 1B28A 2NXJA 4HACA 3T41A 3PG9A 2V2QA 2VQEJ 4EUVA 3D5MA 5HP1A 3G71S 3CULA 1AXQA 5A76A 4IQXA 1RU1A 3T5KA 1VQ5S 4DQIA 4F7VA 4HDGA 3UVJB 2HWHA 1YZ6A 4ZJOA 1REGX 4DN9A 2CADA 2HIYA 1S0VA 2RILA 1U48A 4DV0J 2KVIA 2NPFA 4JI0F 4DR7F 1HL6A 2DR7A 1T95A 1TL7B 2IYIA 4EBEA 1SCJB 3BDEA 5KFNA 3T5JA 2FJBB 1CJVA 3M2VB 5B0FA 3RAXA 2HQ3A 3IR7B 2HRTA 1Q8LA 1F9EB 3TAMA 1SJFA 4J9OA 1NHVA 2V6AA 4ED4A 3A8IA 4B3TJ 4QU7A 4CLSA 1RT7A 4C8YA 2EKYA 1LV5A 2GQCA 1XR6A 1RAEB 2HFSA 4XDCA 2HRYA 5C7PA 3CCSS 3CC2S 5MAOA 3QZ8A 2VL1A 4LBHA 3MF5A 4P72A 3VZHA 1BHNA 3H5UA 4UZCA 1AUSL 4U8VA 2YTCA 3OR2B 4P2XA 1T9WA 3B6BA 1LW0B 1OS5A 4ZP7A 3D6FB 2ZZNA 5AE3A 4IRDA 4P10A 2ADCA 2JX2A 2OTJS 3IN5A 1IBLF 3W9JA 2VDHA 3UN5A 3UDCA 4AUKA 4DPTA 2VKRA 5JMNA 4DV6J 2CXEA 4FS2A 2DNGA 2M5YA 3TX8A 1EB0A 1YKWA 3E2EA 1OQ6A 4IFVA 2BKNA 4MYTA 4KSEB 4ZCLA 2DR8A 2G1DA 3V4IB 3L3CA 3W3SA 2OELA 5HROB 5LSOA 4OI3A 3EXCX 1LFPA 4F36A 4C48A 3BEGB 4EBDA 2BQRA 3R8YA 1RISA 3AA9A 1SJ3P 1WI6A 4MKYA 3ZZOA 4RWWA 4LSNA 3TNVA 2F4VF 1D3WA 3J80U 2W7OA 4ANCA 3EPIA 4LF4F 1UAWA 3IG1A 4C7QA 4ELUA 2EXUA 5KFFA 1T03B 1H6KX 1QTGA 2PD1A 4I2PB 2GIRA 2IRUA 4I2QA 3UDVA 3LJPA 2RIJA 4V1Ak 1T9YA 4GO5X 5KFKA 3IC1A 2GJ2A 2FVSA 4UOFA 1LOUA 2AQ4A 2LQ9A 1JQGA 2VC0A 3VGVA 1X5OA 1S10A 2IA6A 3MAAB 4FPIA 4USVA 3MMAA 1GK8A 2GMLA 2HQCA 5E0OA 3UR3C 3TVYA 2OAUA 5KG1A 4ZDNA 2FJVA 1HLWA 1U7LA 4QIEA 2BOPA 3DGPB 5IFMA 5IC4B 2GZOA 1NZ8A 4P73A 1EETB 2V63A 1BDTA 2BANA 1N5VA 3W61A 3C6TB 5F8IA 2DRBA 5ETTA 3M8QA 3RBZA 3GCWP 3ILOA 3KLIA 1K0TA 3AB2B 2MHNA 2NCKL 1IBMF 5E33A 5KFJA 1FA0A 3DLKA 2MY7A 2HNZA 2VV5A 4M5HA 3ZZZA 3M8YA 2HHUA 1OIAA 3CNQP 1VC5A 2CJAA 1VC6A 1FRJA 2EFQA 4I4BA 1WJ9A 2XTEA 3OFFA 5JVGQ 3V81A 4NLXA 1RACB 2OPRA 3VR1A 3JYTA 4A8OA 4BCAA 3D6HB 5EWEA 5BYQA 2ZD1B 3M2UA 4NASA 1IQTA 2BOAA 5EWGA 2A6MA 2QLFB 3Q0AA 3FBCA 4F50A 4C11A 3TANA 3HPOA 2PMZD 4RUHA 4AQYF 4Q43A 2BKOA 3ET6B 3IS9B 4PWDA 4O23A 3WHIA 4I6AA 3M8RA 3OV7A 2U1AA 2YQ0A 1MWYA 2GPEA 2HFOA 2DH9A 1PARA 1L3TA 4NXNF 4LF8J 3QOQA 4PWUA 1JLBB 2CNKB 3BDPA 4NEYA 4MKVA 4TVAB 3MD1A 2V67A 3KXDA 4KY3A 2HNYA 4DCJB 3OBIA 4P9SA 4KC5A 2LDYA 1CJKA 3GJTB 3N6MA 4Q0BA 1GQEA 2E5IA 1G2EA 2E1CA 4DG1B 3LWLA 1XK8A 5CA5A 3I96A 1SKRA 1UKUA 3UPFA 1EKRA 1NUEA 1NJZA 4DV1J 3KUHA 1IKVB 3ZZRA 2YNIB 3HCXA 2EPIA 2ZBRA 4F4AA 2WB4A 1HQUB 2BRLA 1KHWA 3OL7A 3T9NA 1UUJA 1U24A 4MKBA 2UVVA 4RNNA 3T1HF 3K5MA 2M4MA 2XMTA 5AXKA 4NLRA 1BUXA 1FD8A 3FNNA 2JVRA 1HIYA 2LQ8A 2X51A 4MIAA 5L1LA 4DUTA 2LEAA 1LXJA 1MMLA 2HRUA 1UVJA 3E3XA 3IM8A 1KD1T 2F8MA 2B56A 1S1UB 2WHOA 3TA2A 2W7AA 3QT8A 2AT1B 4IKAA 1OSDA 1RKIA 2MQQA 3PY8A 4PG7A 4H4MA 1SC4B 1RAHB 2C2OB 1TK0A 1L5UA 4WU3A 1S99A 4O3SA 4LF5J 1VRQC 3DDIA 4K4UA 2DY1A 1FO1A 3GFXA 5F41A 1AW0A 4EYHB 4ANDA 1H98A 2DNZA 3I87A 4DMZA 1VQNS 2IFXA 2E1PA 2F8HA 3NBPB 2Y8YA 4DU8A 2DPJA 5KT4A 3DNCA 2W7PA 1I3OB 5DGAA 1RWXB 1XNQF 5GMEA 3ISNC 1D9FA 1RI7A 3NGRA 3MEEB 2RDDA 3V6HA 2KDOA 4CLYA 3PIPQ 5KFUA 4IO1A 4NA2A 1HNXF 2CVEA 3H2LA 1YDLA 2HVDA 1T9UA 4URSA 2I9SA 1QAYA 3BN4A 5D15A 4RUCA 1I5OB 1X0FA 3EDQB 4PPDA 1CEZA 1VQPS 1K44A 4FF3A 5J1EA 2UUCF 1HI0P 4FS1A 2K1OA 2BX6A 2F9JA 5DDPC 2FLPA 2CNLB 1FKPB 1FRXA 3GYNA 1OYEA 3IBCB 4CO0A 3WQPA 2ACMA 1UPPA 2VFSA 1HA1A 3QSYB 2D69A 2OPQB 2QL9B 1N33J 2H4YB 2NQPA 2I1RA 1DZ5A 2JEJA 3MMJA 2HWTA 2WVDA 2ZBPA 2ZE2A 2JC0A 4WXOA 3WDOA 4R0EA 3ZTRA 3KDOA 5B08A 3BGRB 3CC4S 3DRRB 2UXDJ 4KV8A 2HK2A 3GXQA 3DLGB 5BR8F 4JI4J 4M63A 2V68A 2VOPA 2KFNA 2A1BA 1WHXA 1C0TA 1YGYA 4OX9J 3SI8A 1GNKA 3MI7X 4DR5F 1FD2A 2PN6A 4LRFA 2MLZA 1DURA 2GVZB 4ES1A 3ZZYA 3TZZA 4LIRA 2RT3A 4J5OA 4DR3J 2YKPA 5KG3A 4ED2A 1X4CA 3FEXB 4G1IA 4WIIA 4KGZB 1XMOJ 3KJVB 2AMCB 1VK3A 2H3AA 2R2RA 2DH7A 4J9SA 3IMQJ 5ETRA 2Z2LA 3FSIA 4Y2KA 1BMQB 3W9IA 1FNOA 4WE1A 1RE1B 2GQQA 4B9TA 3AFGA 1CLFA 4LUBA 3IM9A 4HEA9 3BO3A 1VQLS 1B7FA 1H73A 1S48A 3NS5A 1RSCA 2GO9A 5DO2A 2W9CB 1TFYA 5U47A 4LQ3A 4K0KJ 1WWHA 1C4AA 4ECZA 4JI0J 4C3MA 2YKNB 5DQGA 1JB0C 3BKUA 1PIEA 3MMBB 2FTRA 1N8RT 2DXEA 4R8UB 1VIXA 5ETKA 4NCGB 2W8LA 2JLGA 1AB8A 2DPIA 1FK9B 1UWAA 1UPMB 1IR0A 4PQUA 1IRQA 2LXFA 2GA7A 4LVNP 1M90T 1H7XA 3NAIA 4QW8A 2CKWA 5IV3A 4ZITA 1U1LA 2K6LA 1I1GA 4GKKF 1AFJA 5T7LA 1PCAA 3JAMU 4DWIA 1N4LA 3CDEA 3TZWA 2AU0A 4OZ3A 4PUOB 1M1KT 4G1QB 4X62F 5K5MA 2YNHA 2ALZA 5I3UA 2J0WA 2XY5A 1DQ9A 1VQ9S 3OJUA 4KHMA 1PAEX 2IC3A 2D68A 4RKUC 4K4ZA 3GLJA 2WOMA 2C3UA 2EFNA 4K4VA 4MTPA 2KG0A 4LFAJ 3DHXA 1NDKA 2P2CB 3W62A 4EO6A 5D0RA 1S1VA 1ZPWX 2AJQA 1N36F 4CTAB 3UNGC 2B9WA 1VQSA 3VAGA 2J7WA 1LFWA 4OI1A 3H5YA 1DQAA 2RDIA 1SV5B 3PW2A 4E0DA 2QL5B 1KQKA 2L9NA 3LPEA 1IKXB 1S6PB 4I0WA 3L9ZA 2DNPA 4YHHF 1NK9A 3PYGA 5J2MA 1DJ0A 4X4SA 1P1TA 3M2RB 3OTCA 3MUVP 2D9PA 4QJVA 3AOCA 4DL5A 1QE1B 5F8HA 5HVHA 1NH7A 2Q1LA 1ZPVA 3IP0A 1XMBA 3QATA 3T1AA 2V8HA 3PCOB 2XI3A 2P5VA 2M88A 2YKOA 4DZ6A 2Q79A 1O51A 2Y1RI 2ATLA 1YJVA 4C8KA 2DRAA 1YJWS 4GRSA 5KFCA 1NJIT 2RF2B 3U1NA 2C2DA 4JI8J 3GG1A 7FD1A 3OVBA 2E9TA 2CJXB 4NRTA 1T9VA 3BSNA 3UVJA 3QYYA 2DRDA 2ILZA 1UZDA 4Y2CA 5HMXA 3IO1A 4U7CA 4KGXB 2DNLA 5SZTA 1SIZA 3IRXB 4FF1A 2FPHX 4NZ6A 2Y1IA 4MK7A 1TVRB 1TTHB 3ENWA 3F56A 1TQLA 4TYBA 1X60A 1JNZB 1TL7A 2CFXA 2FLLA 2EFGA 1N6QB 3M2VA 4WTOB 3HT3A 2C2KB 1Q81T 3IR7A 1VC0A 2CDRB 1RTDB 3ZFVA 2DO0A 3SXLA 4B9LA 2FC8A 2VDIA 2XZWA 5A6WA 4OX7A 3KHGA 3NGUA 1S7IA 1GTHA 3TOQA 4Y65A 3K58A 2ZHAA 2LA6A 4CO1A 4YQWA 4M5GA 2ZBQA 1UWBB 1IBMJ 3EUNA 1SJ1A 4A4JA 1Y11A 2PGCA 3KFWX 3OR2A 1LW0A 1CG2A 2BYCA 4J90A 4M5LA 4TU7A 2IY5B 1Z2LA 1IWAA 2WW8A 4O0IA 3HO1A 3G9CA 2ZWPA 3V4MA 4HHJA 2B6AB 1M1GA 2CPZA 1LEOA 2FD2A 1H3DA 2QMXA 3SQOP 1HWIA 3OFHA 3THPA 1RAFB 3RB4A 5CH7B 2XMKA 3TO8A 3R97A 2F1FA 2GW8A 5KG5A 3H42A 3A12A 3R7NB 3OR1B 2NXNA 4ZIWA 4JV5F 2B43A 4AQYJ 4J7CA 2K3IA 5D4NA 2EC0A 3V4IA 5DM6Q 2NYHA 3MMCB 5HROA 2MZSA 5K8MA 5F0UA 2BQUA 1HHTP 3X3UA 2VFUA 4ID8A 5E5NA 4ZVRB 3NOCA 3HK2A 4ZLNA 4TU9A 1CBKA 1YBUA 3EGWB 2QA4G 3RB6A 2DTJA 3DLBA 2F4FA 2W2PP 5AXLA 4NXNJ 2ADLA 2OLWA 4U7UD 1Y9OA 3OXFA 1QM9A 2XG8A 1X8DA 5IT9U 3D0IE 3O3LA 1SB6A 1RXOB 3OTEA 4WCEQ 1RAAB 4PKDB 1XQIA 2X3DA 1T03A 1OYDA 4I2PA 2FQQB 2RJZA 3OL9A 3QLHB 3SFGA 2XTJP 4KO0B 5D0HA 2Y1LB 1VRUB 2E9RX 4KPYA 3PR4A 1S7HA 3CIZA 2O5DA 2VONA 4CYUB 4TYAA 1BDVA 1S1WB 2ZH9A 2B51A 2XI2A 5BYSA 1GAOA 3T1HJ 3MAAA 4IO9Q 5KFEA 2CZ9A 3W64A 3WIVA 3NLCA 3W2VB 4WZQA 3UDEA 1PILA 5L1IA 3J81j 1DHMA 2VKZG 3IRWP 4I6YA 3DGPA 4X4NA 4GC7A 4H4KA 4NA1A 2HS4A 1EETA 1WEYA 2FY8A 5K14A 2UP1A 4QU6A 1P9QC 3C6TA 4BC9A 1HWJA 1KFDA 1N5YB 4XTTA 1YX2A 4QOTA 2PE8A 1NKBA 3FT7A 3FK4A 4O3QA 4ILMA 1N5SA 2CPJA 5L9XA 2QX0A 3D1QA 2K3KA 2Y1JA 4Q8FA 1TL4A 3Q8PB 1RAGB 3R1HA 4DDFA 3M4XA 3MCMA 4LVOP 4JI1F 5HL7Q 2KM8B 3P45B 2UVUA 2NUUG 2MLYA 1HNIB 1CJUB 4UQTA 4ALZA 2X1GA 1RHRB 3FVYA 2H3EB 2E1AA 1E6YB 2ZD1A 3D0GE 3W8GA 3R7SB 4E8UA 1K73T 3LQVA 2WSCC 1HNXJ 5GAEU 3MPWA 2P6SA 4QPXA 3ET6A 4USMA 3IS9A 5ITHA 2UUCJ 5D78A 1K1SA 3RG6A 1TFWA 5ETPA 3G86A 1NPRA 4ECWA 1EIYB 4JI7F 3E51A 3CJ5A 1APSA 3LP1B 3CJ0A 2MKHA 3GIRA 1TU0B 3EX7B 1FTCA 4IDKB 4Q5VA 5BYRA 4DR1J 1VCTA 1JLBA 3DLJA 4HKQA 3VCDA 4UZBA 3Q86A 2R42A 3HSGA 5GMDA 5EDWA 3EDRB 2ZUGA 1Y5IB 3T6JA 5IM0B 5LL6d 2CPFA 2EEYA 5H9FJ 2XZDB 4DG1A 4ZVUB 1IBKJ 3QJLA 3THTA 3PJ9A 4RNMA 1HBMB 2OEJA 3IAM9 1NRKA 2VJVA 1AZSB 4DV5F 4ED1A 2OSRA 1IKVA 2MZ1A 3CMES 3R7BB 2YNIA 2MJUA 1HQUA 5DZ7A 4DCPB 1VQMS 1ZZFA 2FZKB 4ED7A 2JLFA 3IWLA 1U8SA 2MSSA 5M2RA 1ZBTA 5F8LA 3KLHB 4ZP9A 2LDIA 2H1YA 2CQ4A 4X66J 2EVZA 2BNZA 3GILA 1NCLA 4UUXA 2MKKA 1HBUB 3C14B 3HSZA 3OL6A 1IWGA 1S1UA 2LECA 4DSFA 1VRTB 2YWWA 3M6UA 4JV0A 5LMNJ 2NZ4A 4OX8A 3KK3B 3UE2A 5KG0A 1U2RA 3N5BA 2ZDPA 2BJEA 5FD1A 2CQIA 3AH6A 2J0QD 2ASLA 3W2WB 4ZOSA 1L3VA 2H4WB 3SCKE 3GV5B 2AJFE 2HGLA 2J8SA 2ZJPQ 3GSIA 4PCQA 4O4GB 4PG4A 2GO8A 4CLLA 3BSCA 1KQSR 1GT8A 1PKUA 2CPHA 1FEEA 3I5CA 3NBPA 2IPOB 3MXHP 1JXVA 5BXIA 2FJAB 5DLFA 4AYBD 1SBRA 1Q7YT 1JJ2R 2BKPA 2MZTA 1GEHA 5F8GA 3GIJA 1S57A 3MEEA 2WAQD 4NCBA 1QTNB 8AT1B 3D67A 4OYMA 4GKKJ 4Q7AA 1UVLA 1DLOB 1D1UA 3JXOA 5DJBA 4X62J 1BAZA 1KTQA 4W4MA 4DCOB 1WC4A 3K5NA 1WTBA 3QRRA 2QA1A 1DTQB 1FKPA 2ZH1A 4IYQA 1MNTA 4ZHRB 4DQPA 2CJYB 4AFFA 2VICA 4N76A 3U1LA 2OPQA 4DV7J 4K5RA 5CHCB 2ZH8A 4NA3A 1N36J 3NAHA 3HKWA 4QIWD 1OPIA 4L75A 1H2TZ 2XY7A 3MECB 2CG8A 2DNKA 1NK5A 4CCHA 2VFVA 3BGRA 2JL9A 3DRRA 3EE3A 4O3NA 1KKHA 3DLGA 1YRXA 2DGVA 4YHHJ 1S6OA 4TXSA 2LU1A 4YDXA 1N0VC 3EZ5A 3B8HA 3D1HA 4CLKA 2NREA 5KT6A 2QRRA 3PR5B 3J7AN 1R8HA 1XMQJ 4B9UA 5CYMB 2GVZA 2AF6A 4YMEA 4FBTA 2YNGB 3MUMP 2BJ8A 2YNFB 3DU5A 5HMZA 4A8FA 3DLEB 2KZMA 2AYEA 1YBTA 3KJVA 1CVJA 2PFDA 1OMSA 3I4PA 5IWAJ 2CPXA 2DXDA 2OEMA 2OH2A 5JXSA 4X4TA 3AXMA 1NKCA 3SCIE 2OFGX 2I5JB 2H48B 3PEJA 1U0HB 5IT4A 2EWHA 1WF2A 2W9CA 3CB4A 2G1HA 1GX6A 2H1OE 4DL3A 1KQGB 2HGMA 2YKNA 2FGOA 2XMAA 3MMBA 1VJWA 4R8UA 2BNWA 3C2PA 4NCGA 3KHHA 4CLPA 2CJBA 1HWUA 2CQCA 2QMWA 1FK9A 2H5IB 2HZAA 4DJBA 2ZWOA 1Y0HA 1HMVB 1PYTA 5ETQA 3DHWC 1W25A 2O01C 3QT7A 4B3OB 4GVLA 4DR6F 1M0SA 3GR0A 3HZEA 4UT4A 2I8EA 1FJGF 2KI2A 3KK1B 3G4SS 4LF6F 1H72C 4PUOA 4G1QA 3Q23A 2GAGC 2CJKA 1O6XA 3CDBA 2AYGA 1J5EF 4MAKA 2W9AA 4QR1A 5BJRA 3J80Y 3K17A 5DLGA 5EX0A 2QYCA 2JBVA 1G1XA 5IQQA 3P96A 2V9KA 2CYYA 2V2KA 4DLGA 4BWMA 3KG0A 3WIUA 3HFVA 2DVIA 3QNWB 3FQKA 3GPAA 2GJFA 2K5JA 3FQLA 4NZ0A 4F0MA 4CTAA 3PHTA 4PYAA 3ZTPA 1RHJB 2UXCF 3J7YI 1FF2A 3S6EA 4ELVA 2AJ2A 1R0AB 4OLOA 1SV5A 3ULHA 2UU9F 2GIQA 2F5GA 4OYOA 2KL8A 3C15B 4WIQA 4K8RA 1IKXA 1S6PA 3BR9A 3QIPB 3R2DJ 2G2OA 1NB7A 2XCPA 4MJWA 2YWFA 4ZPAA 4LR9A 3M2RA 2R7UA 3QWUA 3HVTB 4O44B 1QE1A 3TA0A 4OHWA 1WUUA 1LWEB 4DF8A 1B99A 2B4UA 1QSLA 1KLNA 2RQKA 3PX4A 3QZ7A 4FYYB 3M7VA 1FVSA 1MW7A 4W90B 2RF2A 2D74B 3KOAA 3RW7A 2X3GA 1NHKL 3K0JA 1UP1A 1M1HA 1AYEA 1IBCB 2DNMA 2ZH5A 2VG5A 5ADZA 2UUAJ 3Q89A 2J9DE 4KBIA 3CDWA 1JLQB 1OHNA 3UD5A 1HBNB 3AJ2A 5F3TA 3IRXA 3U1MA 1FHTA 3LP2B 1N5TA 4A8MP 3CCQS 1TVRA 2M8DB 4RW4B 4DV3F 2Z2MA 4S0MA 4A8QA 3Q8RB 2DNRA 2FVCA 2B8PA 1N6QA 2L08A 2B4VA 3L7OA 3HP6A 2CJ9A 5ETOA 1RTDA 1VMBA 3GV8B 1S6UA 3CT9A 1MWZA 2FZGB 4TNOA 5DQHA 4KH1B 2HHVA 3VAFA 7AT1B 4KRWA 1C0UB 2VQFJ 2AJ0A 5DM7Q 1UWBA 1YQHA 1ZH5A 5KFWA 4EMDA 4A47A 4IG3B 2E29A 3SCLE 2A2DA 2M3DA 3OJSA 2O66A 3PZPA 3D6MB 4JI1J 4ANEA 4ICLB 2E66A 3R5BA 3N6LA 2G0IA 2CQ3A 1SJ4P 2I0XA 4HH1A 2B6AA 3ZZ0A 3T3FA 1F9FA 4CM2A 2MPUA 2KKHA 2M2BA 3M6WA 5JUMA 3SEOA 5F9NA 2AEFA 3CCJS 2R2SA 2YQ3A 3OL8A 1VK8A 3HHKA 4Q2LA 1WKKA 3HXMA 4ERDA 3OR1A 3ENAA 1TV6B 2W2NP 2KFYA 4WP3A 4AXIA 4ES3A 3MMCA 2VA2A 4ECQA 1NJYA 3OVAA 7FDRA 1RK8A 2IMWP 2MQ8A 2F9DA 3R2CJ 2UUWA 2UV8G 1S0NA 4JI7J 3BGFA 4HT7A 1SH0A 2DHXA 1UETA 1TL3B 4MK9A 4FPRA 4Q8EA 2FUG9 4TLQA 3MUTP 2PEHA 2XS2A 4L3KA 1QAJA 3AB4B 4FYXB 2JEFA 4X4UA 5KOWA 1CS4B 4NZ7A 2Q6CA 3FZ2A 2MZJA 3Q2SC 3BH6B 1FNMA 2HHSA 5B0AA 3ILIA 2AGPA 3QLHA 1HFEL 5KFIA 2MXYA 5K8PA 4DV5J 4KO0A 1VRUA 4TKTA 2CQGA 4JI2F 2FLNA 4CYUA 4OYBA 1S1WA 4IR9A 4IRKA 1WC3A 2HHQA 4ED0A 1VYAA 4GO7X 4P7VA 2ZFHA 3W2VA 2OPPB 2OEKA 4JBCA 2CQ2A 1YLXA 3KDNA 5JVHQ 4OYAA 2WVBA 2OD6A 3I9ZA 3K5OA 4NMLA 3BSOA 1HI8A 2Y0SD 1Y10A 4OJGA 1N32F 1U2CA 1N5YA 2CDQA 3MCNA 5K8OA 1SL0A 3BS9A 2GCFA 3O1LA 4PR6A 2HFNA 3SYZA 1RAOA 5HN0A 2E5HA 1VQKS 1J5OB 3HVAA 4OZ2A 4HV0A 1RA6A 1TKZB 3A8KA 3AQPA 3R3TA 2OIHA 2QSWA 2FIUA 4ZVHA 3I9V9 5DGBA 3SV3A 4OYIA 3A3PB 3NXZA 4KE5A 2B9XA 5HAOA 1HQ2A 2XO6A 5MLCV 5K8NA 4GKJF 1HNIA 1VLOA 4QWAA 1CJUA 2RH3A 4YB5A 2ZOFA 4DL4A 1E6YA 2XHCA 3NNAA 5A8KB 2MKJA 1LW2B 2XGPA 4EZ6A 2XYGB 3M30B 1X31C 1L3KA 4YUDA 1NU4A 1XEZA 1XTZA 4U9RA 5KFDA 5HJXA 3K2YA 4YY3F 2XLIA 1Y5LB 2PO4A 4BDPA 2R8IA 2VOOA 4OYWA 3LH2S 3OXLA 4NYPA 2N7CA 3CJ4A 5HATA 1UL3A 5LXYA 2BW7A 4WU2A 1U0SA 4MJKA 1U1MA 4Y2MA 1R31A 1FFGB 3QQCD 1SJQA 3LP1A 3LGNA 3PRDA 5DQIA 1PJ7A 4IDKA 2A2BA 2P9CA 1JXLA 2IM2A 1VQ6S 2YH1A 1R3NA 3K8WA 3F44A 2XMUA 2HMIB 3FMTA 1X5SA 3HF5A 5IM0A 4X4VA 1R8BA 3QIDA 3F0NA 2POKA 9RUBA 1HBMA 3H59A 1NSQA 3GB0A 1AZSA 1N0UA 3I5AA 3RB3A 1BQMB 2M52A 4ECXA 4B17A 5AJ3J 2HQIA 2IYGA 3DYAB 4UY8T 2VF3A 3G8SA 1CJTB 1CQNA 4LFBJ 3ZNJ1 5C2GA 3C8YA 3PNIA 2RHQB 2LQBA 2YPYA 4K50A 3RGIA 3I31A 4HTIA 4ECSA 2DHAA 5EHHA 3G6YA 3KLHA 2BJ9A 5KT7A 4WTYA 2E7XA 3AX3A 3EJMA 2NSBA 2BJ7A 1HBUA 3C14A 3ISND 2BW2A 4CH7A 4RO0A 3JAMY 2E5GA 3QGIA 4WK1A 2ZH2A 1VRTA 1ITPA 4CH0S 1MWQA 3KK3A 5DRKA 4KGMA 4U96A 2GNKA 1RBLA 2OD4A 1N88A 2DXFA 3W2WA 3OQ2A 5D8HB 4I6WA 3RU0A 1BWEA 3KLFB 4O4GA 1PC4A 3FCHA 2J7KA 2N3OA 3TUZC 4HYKA 1EJ7L 1JLGB 4RW9B 3N6NA 2J6UA 1LXNA 2BA9A 1UCNA 2ZZTA 3MEKA 1F5CA 4USUA 2RB7A 4DR6J 1U47A 4J9MA 4PXEA 4L76A 4LF6J 4K4TA 2AN7A 1DLOA 1VJQA 2QA4S 1K9MT 4CNZA 2QA2A 1J5EJ 3LALA 2AYBA 2V50A 1U6FA 3LANA 1DTQA 1GXTA 5CXTA 5D6GA 3J81U 3VQSA 3I0RB 5C42B 1VQYA 4ZHRA 4ZVFA 4AXJA 1ZTTA 1GFWB 3OTOF 3A3OB 4MYUA 1QSYA 3C3LA 3UI3A 5E41A 5DZ6A 3PYDA 2ZNYA 3TUIC 3T5HA 4NLVA 1WEZA 1G3OA 1R8PA 3FKBA 2M9KA 2V2ZA 1U26A 4Y2AA 1S9GB 3VV2B 4V19X 2UXCJ 3MECA 2FDNA 3OUYB 5IC6B 1D0EA 3LUYA 1HBOB 4DLEA 1NK8A 4F4XA 4OZLA 3MM6B 2B3TB 2Q43A 3TUPA 5EN1A 1X9SA 4ITSA 1Y3JA 1HNZF 4M5IA 4M1KA 3BJYA 2V2VA 3PVXA 2EK6A 3DRSB 4FF2A 3TQ1A 5CYMA 5KFAA 2VG6B 2EW9A 2RRNA 3HZGA 2AIRB 2Y0BB 1Q0NA 3ZZPA 1AROP 1TKXB 2QSFA 2YNGA 3RRGA 2YNFA 1D9DA 3DLEA 4ZVOB 1GXLA 2QLXA 2HHHF 1R0BG 4D3GA 3T9ZA 2OO4A 3X1LB 4A48A 1T8EA 4CIOA 4ZLPA 2FHOB 2CWXA 2DHGA 3SSSA 3C66A 1YJNS 2GFFA 1NXIA 2APOA 3CCMS 2I5JA 1TZ0A 3LA0A 1U0HA 3BGLA 4FXVA 1S12A 2DIUA 5B0GA 4J9UE 2Q6BA 4CRJA 4HI2A 4MH8A 3TEHB 2KXNB 3RRKA 3IBWA 2IMOA 1W2IA 4DV3J 2XYPB 4GMKA 3CC7S 1RQ0A 1WF0A 1S49A 2E7WA 1X4BA 2R7SA 2EG1A 3O5TB 2DNQA 3LAKA 5ETVA 5KFTA 2CAJA 1LWXA 3HKZD 2R7WA 4DS5A 3KG1A 1KP6A 1RHQB 1HMVA 1OY6A 4OZJA 3PYEA 3HVWA 3FJ2A 4QPTA 5HVGA 3R5JB 4B3OA 3F73A 2VUGA 3D2WA 2PSZA 2ZUAA 4DQSA 2HVHA 2CRLA 1WHVA 2RAQA 1VBXA 3KK1A 3ONQA 1ZTWA
chains in the Genus database with same CATH topology
4JV5F 1SQEA 3G8QA 4KAIA 2B43A 1OSCA 2WSEC 2K3IA 5D4NA 4X4PA 2KOEA 1IM4A 2EC0A 5C25B 1U1OA 1IQZA 2YH0A 2VZ9A 1JLCA 3V4IA 5DM6Q 2HNYB 3D0HE 3D28A 4ZCMA 3MMCB 3UQSA 5HROA 3PKMA 1QUPA 1ZAVA 3FFIB 2MZSA 3BREA 4WYLA 3N0VA 4UW2A 5K8MA 5F0UA 2BQUA 2GQ2A 3BGUA 2IJNA 3MM9B 1FNXH 1HHTP 1TKDA 4FF4A 2C3PA 3X3UA 4Q0BB 3LP0A 2ZVSA 4ZS6A 5IT9Y 2OPSB 2VFUA 4ID8A 3OHBA 1EP4A 4F67A 5E5NA 1LWFA 2RQ4A 3N79A 3HK2A 4OZ5A 5B0CA 1CSJA 4TU9A 2ZOGA 3EGWB 3GFYA 1HW8A 2XS7A 2XULA 4I7FB 3NWGA 2C2RA 4B02A 3TW0A 2QA4G 3EGNA 3RB6A 2DTJA 4RZRA 4WFXA 3DLBA 1NZAA 4M95A 3H2VE 5AXLA 3FGVA 3Q8QB 1WEXA 1HYSB 2ADLA 2OLWA 1FKOA 1UEVA 2KXFA 1RT6A 1Y9OA 3U02A 1Y4ZB 5AE2A 1UFWA 3OXFA 4QIVA 5D4LA 2FHJD 5A2QY 3BO4A 1QM9A 2XG8A 2I38A 2VPWB 3M8SA 1K8AT 4NL5A 4B9SA 1X8DA 4WFZA 1HARA 2I2YA 1HD0A 1XN9A 3WBZA 1LQ9A 1E6VB 2QV6A 2VH7A 3D0IE 3O3LA 4LJMA 4CO5A 5CYQA 1SB6A 4ID5B 4I56A 3MM8A 1R0AA 1P1LA 2DNYA 4WYWA 1RTHB 3KMSA 3OTEA 1FXDA 2KRBA 1N56A 2XY6A 4WCEQ 4PKDB 1S97A 2AX0A 4Q45A 4NLQA 5SUHA 4QR2A 2NSCA 5GMKa 1T03A 3JTOA 3QIPA 3EGZA 3L09A 2CQPA 4DV2F 1MMDA 3IGNA 2LEBA 4OZNA 4NOHA 1FE4A 4ED3A 5J2PB 4YOEA 4I2PA 4J9PA 3SZ2A 1WELA 2RJZA 4DR1F 3OL9A 1N52B 2J9DA 3QLHB 3SFGA 2UUTA 3HVTA 2L41A 3NRBA 4PPZA 4KO0B 4F25A 1VRUB 2E9RX 4O44A 3GIKA 1XR5A 3LO3A 1CQMA 5H1SV 4KPYA 3PR4A 1S7HA 2H9ZA 4MMOA 3CIZA 3HHLC 4ECVA 2B7CB 3RAQA 1LWEA 2DISA 5J1NA 3POTB 4X64F 2O5DA 2VONA 3CJKB