3BSNA

Norwalk virus polymerase bound to 5-nitrocytidine triphosphate and primer-template rna
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
484
structure length
479
Chain Sequence
KGTYCGAPILGPGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEPRGKPPKPSVLEAAKKTIINVLEQTIDPPDKWSFAQACASLDKTTSSGHPHHMRKNDCWNGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDLATMIRCARAFGGLMDELKTHCVTLPIRVGMNMNEDGPIIFERHSRYRYHYDADYSRWDSTQQRAVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCTSQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLKEYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGPNHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELDFYVPRQEPMFRWMRFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into mechanisms of catalysis and inhibition in norwalk virus polymerase.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Transferase/rna
molecule keywords RNA dependent RNA polymerase
total genus 148
structure length 479
sequence length 484
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2007-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.100 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Arc Repressor Mutant 3bsnA02
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 3bsnA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3bsnA03
4RZRA 3GILA 2IBKA 1IKXA 1S4FA 4ECZA 3HVWA 2IM2A 1SUQA 4I2PA 1HMVA 1T03B 1C1CB 2HWHA 2OPSA 3LP0B 4H4MB 4ECXA 2OPQA 3NKYA 3NGDA 4TYBA 2BE2B 1IKVA 4ICLB 5KFHA 4MFBB 3TAMA 3TQ1A 2I5JB 3H5UA 3H98A 3V6DA 4KB7A 4MIAA 1J5OA 4ECWA 3OL8A 1MU2A 2D7SA 5I3UA 3CIZA 3CJ3A 1KHVA 3RB0A 1JLAB 4KSEB 3QZ7A 5DGAA 2YNIB 2VA3A 2JLEA 3KMQA 1HPZA 3N6LA 4RW4B 2R8JA 2FVSA 2XC9A 4IRDA 2HNDA 4QWCA 2WOMA 4ZHRA 4DG1B 1QAIA 3SFGA 3FFIA 4ZPDA 4YQWA 2YNGA 4IG3A 1JLQB 4ZP9A 2ZE2A 4ZP8A 1TL3B 1HYSA 4PWDB 3PJXA 2ASJA 5KFEA 2ILZA 1C1BA 2ATLA 3I5BA 1RT4A 3QLHA 3M9MB 3BQ0A 5F8GA 2BE2A 4LQ9A 5CYQA 3VQSA 4IH7A 4ED3A 3C6TA 2ASLA 4LQ3A 1RT3A 1EETB 3KHHA 4EEYA 1JXLA 2I5JA 2FJWA 2ZD1A 4O3PA 3LP1B 4J9NA 3V6KA 5KFBA 3BSCA 3V81B 1LWEA 3CDEA 2XGQA 2UVUA 4K4WA 3I5CA 1RT2B 1S48A 3I0SA 4QWBA 5J2PA 4Q8EA 3G86A 4HKQA 1LW2B 1RDRA 4RU9A 3FDSA 5D3GB 2JC0A 4JV2A 1TKZA 3DRSB 5C42A 1R0AB 2HNYA 4ED0A 1C0TB 1JKHA 4R8UA 3EPIA 2JEIA 1S6QB 4ZPBA 5KFOA 2FLPA 1S1TA 4NLGA 1SH0A 1HQUA 2D3UA 4KHMA 2XCPA 4IFVA 1HYSB 4RW6B 4RW7B 4I2QB 1NHUA 4O3OA 5KFXA 3ISND 4TY8A 3JSMB 1S0NA 3DI6B 3E51A 4U6PA 4KV8A 4KO0A 3N6MA 4DEZA 3KHGA 3GIKA 5HP1A 1LWFA 5CYQB 4G1QB 3H59A 1HNIA 4KBIA 1JLGA 2GC8A 3I0RB 4IDKB 5KFZA 1UWBB 5KFWA 3G6YA 3QGIA 4ED8A 1S6PA 3IGVA 2YNFA 5I42B 4QWEA 3V4IA 5KFTA 3DRPB 2AGQA 4Y3CA 1N6QA 1D1UA 4TQSA 1JLCB 4ZMMA 3IS9A 1XR6A 1T94A 4H54A 2J6UA 3Q8SB 1RTIA 1VRTB 4Q45A 1TKTA 4IRCA 2IC3B 4LSLB 4RW9A 1RT1B 1RA7A 5J1EB 3RB4A 3KLFB 3OL6A 4JV1A 3KLIA 2ALZA 2R2SA 3LALA 4ED1A 3RBEA 3CDWA 4ECUA 3KK1B 1IKWA 4ED6A 4RW7A 3GIMA 1JLEA 3HKWA 3OLBA 3DLEA 4NLUA 3GYNA 5J2NB 3IN5A 2WONA 3LP0A 4MKAA 4EYHB 5HLFA 2J6TA 2FVRA 3BSNA 1LWFB 4ICLA 3TVKA 2OPRA 2YNHB 4KFBA 5J2MB 3TAMB 4FS1A 3PR5B 4M95A 3ICLA 1XR5A 1S10A 5DG7A 4FBTA 1EP4B 5KG4A 3T19A 4OL8A 5KFFA 4O3RA 3T5HA 4WXWA 5C24A 3PW5A 4O3NA 4M94A 3MTKA 4QPXA 3HVAA 4WZMA 3H2LA 1SV5B 1QUVA 2DPIA 4RNOA 3D28A 3E01A 4NLXA 4EBCA 2YKMA 4NCGB 5JUMA 4O4RA 3IGNA 4EO8A 3DDKA 3OL9A 5KFDA 4EBDA 5HROA 2HMIB 2IC3A 4H4OA 4O3QA 3N6NA 1BQNB 3KLFA 3GV7B 2O5DA 4J9KA 1QE1A 2UVWA 2UUWA 1IM4A 2ZE2B 2XWYA 1SH3A 3FQKA 2D41A 1RT6A 4WE1A 5L1KA 5J2QB 2XCAA 4PUOA 1FKPA 2HWIA 4ED7A 4J9RA 4F4XA 4XPEA 1HARA 3NL0A 3RBDA 4O4GB 3KLGA 3BJYA 4DL7A 3RAXA 5KFQA 5J2MA 1Z4UA 3HVTB 2IA6A 3ITHB 2E9TA 3MF5A 4NLOA 5KT4A 4B3OA 3H40A 3KJVA 2W9AA 1S9EB 3DRRA 2B5JA 2XGPA 2W7PA 2BANA 2CJQA 3FRZA 4R5PA 1LWEB 5HBMA 4QWDA 1S1WA 2UUTA 2RKIA 4ECTA 2YKMB 4NCGA 3M9NB 3IRXB 4MIBA 2W7OA 3DOKA 2R8IA 4R0EA 4KE5A 1JKHB 4H4OB 2WB4A 1S0MA 3DMJA 2XI2A 3MEGB 2VG6A 2AX0A 3MR2A 3GQCA 3GIJA 1DTTA 5F9LA 1HNVA 1OS5A 1RTDB 1JLBA 5EWEA 3RAQA 3DI6A 1HQEA 1REVA 2VG7A 4NLDA 4H4MA 3Q8RB 2CKWA 1S1VB 1BQMB 5KFUA 4QW9A 3DLKA 1HNIB 1DLOA 2ASDA 2AGPA 1S1XA 2IMWP 3CJ5A 4ED2A 3M8PB 4F4ZA 1S49A 1S9EA 4X2BA 1GX5A 1MU2B 3KLVA 3DRRB 3LP2A 3MEDB 5KFKA 5EWGA 4GC7A 4KKOB 2FJVA 3DRPA 5FDLB 3CJ0A 2V4QA 1XR7A 1RT7A 1YVFA 4I7FA 3PZPA 3DYAA 1JLAA 4EO6A 2R8GA 4IRKA 4NLYA 4IFYA 4MKBA 1KLMA 4MK7A 3KK3A 3DLGB 5DQGA 2R2RA 1HPZB 4ID5B 5KG7A 3IRXA 4WFYA 2J6SA 1N5YB 5KT6A 3JYTB 3PW0A 1I6JA 2BRKA 4QW8A 1JLFB 1KHWA 4YR2A 3MR6A 4WFZA 1GX6A 4ZPCA 2E9ZA 1RT5A 4J9PA 3MR5A 2OPPA 3KNAA 1TQLA 3KOAA 4WFXA 4WYLA 3DLEB 4HYKA 2BQ3A 3NAHA 1HMVB 5HLFB 2RF2A 2JC1A 5KFCA 3MEEA 3PVXA 3BSOA 2C22A 4WXOA 4IG0A 2ZKUA 5KFLA 1TV6A 3H4BA 5K14A 3HHKA 3DM2B 4K4VA 4Q43A 2JEJA 1VRUB 4KKOA 5C24B 1FKOB 1RT7B 1T03A 1RT2A 5CYMA 1KLMB 4DL5A 3DOLB 1LWCB 3QGHA 4ID5A 4TYAA 4EYIB 4NLRA 1TKZB 3RB3A 2FVQA 3JYTA 3MECB 4DG1A 5KFSA 3CVKA 3H4DA 2B6AB 1BQNA 2YNGB 4TQRA 3QIPB 3OL7A 1JIHA 1TL1A 3KLEA 1WNEA 3T1AA 4K4TA 1IKXB 4RW6A 1TL3A 1SUQB 4I2PB 4TY8B 4YR3A 4PWDA 4WE1B 1IKYA 1C1CA 2OPSB 4XPCA 4KV8B 3Q8PB 5J2QA 1FKPB 3MEEB 2C2DA 5HP1B 2VG5B 1S9FA 1LW0B 1RA6A 3OHAA 3V6HA 2GIRA 1TV6B 4NLVA 3C6TB 1RTJB 3LANA 4O44B 2QE5A 1UWBA 5K14B 2AQ4A 5KT2A 1S0OA 2B5JB 4FBUA 2YNFB 3V4IB 5I42A 4NLTA 3OSNA 2D3ZA 4LSNB 4IKAA 1FK9B 2IJFA 2F8EX 5CYMB 3IS9B 3EZUA 4MH8A 4TXSA 3G6VA 2AX1A 1S9GB 2RDJA 3QZ8A 2C2EA 3DOKB 1K1QA 2WOMB 3CWJA 4ZHRB 2DPJA 2W8KA 2UVRA 3MECA 1K1SA 1R0AA 3EPGA 3FFIB 3PW4A 4RNFA 1U09A 5J1EA 4R8UB 3UQSA 5KT7A 1JLQA 4URGA 2W9BB 1JX4A 1S1TB 3LAMA 1TL1B 3KK2A 4DL6A 2HNZA 4RW8B 3BQ1A 4ECQA 4NLPA 3IG1A 5J2NA 1HQEB 1REVB 1C1BB 1BQMA 1RT4B 2VG5A 3BSAA 3QLHB 2WHOA 3DLKB 5KFNA 3D5MA 1DLOB 3KMSA 1EETA 2IJNA 4ZP6A 3CJ4A 4MFBA 2JEGA 5KFYA 3LP1A 3QYYA 3PW7A 3BREA 4RUAA 3MEDA 5KG2A 5FDLA 5KG0A 1FK9A 2BRLA 2R2UA 4Q0BA 4RNNA 3KLHA 3UPFA 5F8IA 2EC0A 3I0SB 5KG1A 3OSPA 3DLGA 4F4YA 2FLLA 4PQUB 5DLFA 2V0NA 4TN2A 1RYRA 5D3GA 5EDWA 1RTHA 3DRSA 5C42B 2HNDB 4J9SA 4F50A 2FLNA 4O3SA 5KG3A 1TKTB 3MFHA 1RT1A 4JV0A 4IG3B 2AGOA 2HAIA 4IR1A 5KFJA 5KG5A 4RW8A 3CDUA 1ZTTA 4I2QA 3MR3A 1RT6B 2IAJB 3OLAA 4NRUA 4NYZA 4WZQA 3H5SA 4DL3A 4ZVHA 4KHRA 2WK4A 1MMLA 1S1UB 3PW2A 3HVTA 2OPRB 2YNHA 4KFBB 4IDKA 5DQIA 1RT3B 4XO0A 2FVPA 3DM2A 2ZD1B 3BGRA 1S6PB 4WYWA 4U7CA 5F8JA 1S97A 2BANB 1DTQA 5F8NA 3V81A 4NRTA 3PJWA 1C2PA 1S1WB 2RKIB 4URQU 4PQUA 3PR4A 1N56A 3DOLA 4ZPAA 4Q44A 3RB6A 4URSA 1W25A 4FS2A 2B43A 1RTIB 5KFAA 5DLGA 2FVCA 3MFIA 3H5YA 5DG8A 2HNYB 4J9OA 2HMIA 4YMEA 1S6QA 5KT3A 4KAIA 3KLIB 1HQUB 4ZVEA 3LAKA 1T3NA 3KLEB 3SI8A 1TVRB 5C25A 3UR0A 1IKWB 3GIIA 2BQRA 4K50A 5F8MA 1JLEB 2GIQA 5F9NA 3GV8B 3T5JA 1ZETA 1IKYB 3CO9A 2WONB 2IAJA 4Q8FA 1SH2A 2W9CA 4F4WA 4KO0B 1CSJA 4GC6A 2I1RA 2OPQB 1NNDA 1NHVA 5L1LA 1IKVB 4QWAA 4G1QA 1S1XB 1RTJA 4O44A 3KHRA 2W8LA 1JLGB 3I0RA 3OHBA 4DL4A 4IQXA 3V6DB 1EP4A 3BGRB 5DQHA 4JUZA 5C5JA 4DL2A 1J5OB 5T14A 1TP7A 2R8HA 5I3UB 1DTQB 1N6QB 3NBPB 3H5XA 3DYAB 1SV5A 5DGBA 2QV6A 4IFYB 3C6UA 3SFUA 4YP3A 2YNIA 3E01B 2IM3A 2RDIA 4RW4A 2R2TA 2JEFA 2IM1A 5HROB 2IM0A 4IH6A 3ISNC 5EUHA 1QE1B 3FQLA 3M8QA 1D0EA 1C0UA 2VG6B 4Y2CA 3PHEA 1TVRA 2V4RA 3BQ2A 3M9OB 4MK8A 3KK1A 4EBEA 4K4ZA 1DTTB 3IG1B 5KFRA 1N48A 1JLBB 4NLSA 2W9CB 4PUOB 4ZVGA 2VG7B 3NMAA 1T05B 1ZTWA 2C28A 3ITHA 3Q8QB 3KJVB 2OH2A 4ZP7A 3LP2B 4G3IA 2V9WA 3NBPA 5L1JA 2E9RX 4ECRA 5HBMB 3T5LA 4Q0BB 4I7FB 2ILYA 3KLHB 3C6UB 5JXSA 5L1IA 2BQUA 5J2PB 4RUCA 3FSIA 4Y34A 1LW2A 2FJXA 3QO9B 1RTHB 3KHLA 3GV5B 1N5YA 4Y2AA 3BR9A 2B6AA 3CJ2A 1C0TA 2WRMA 5EWFA 4IOBA 2YKNB 3MEGA 3M8QB 1RYSA 3QIPA 3QGGA 4YR0A 4K4YA 4MK9A 3G6XA 1C0UB 3T5KA 3V6JA 5KFPA 2UVVA 1QAJA 1TKXB 4IFVB 1HNVB 5L9XA 5KFGA 1RTDA 4RNMA 3JSMA 4ECSA 5DG9A 1S1VA 4TLRA 5KT5A 2RF2B 2VA2A 1LW0A 1S1UA 4IR9A 1T05A 4O4GA 3KLGB 4IG0B 2C2RA 3M8PA 4IH5A 4B3OB 4J9MA 1N4LA 1VRUA 4ECVA 4LSNA 5F8LA 4NZ0A 3UDLA 4R5PB 1FKOA 4NLQA 1JLCA 4K4XA 4RNHA 4TY9A 5KFVA 3KK3B 3NAIA 1RAJA 1S9GA 2XI3A 1LWCA 5KFIA 5KG6A 4ECYA 3QO9A 4J9QA 4ZVFA 1VRTA 2BR0A 2W9BA 4K4SA 4LSLA 1JLFA 2AWZA 2YKNA 4RW9B 2AU0A 2R8KA 4K4UA 4J9LA 2WCXA 3DMJB 2WTFA 5F8HA 3KK2B 3QIDA 1RT5B 3I5AA 2HNZB 4NLWA 5C25B 5KFMA 2OPPB 1TKXA
chains in the Genus database with same CATH superfamily
4RZRA 3AB2B 2IBKA 1IKXA 4PPZA 1UJ5A 1UZDA 3HVWA 2IM2A 1SUQA 2VONA 2OO4A 1C1CB 3LP0B 3D68A 2DR7A 2OPQA 1VI7A 1ZPVA 5G4DA 3NGDA 4GVBB 1HR0J 4MFBB 3IBCB 1KFDA 3QQCD 4PG5A 2C2KB 2FD2A 2QLBB 4L74A 3NG8A 1NMEB 3P8BB 1J5OA 3OL8A 3HJFA 4N8OA 2UU9J 1ZA1B 3MURP 2KRRA 4DSFA 2KELA 4C11B 5HVGA 2RIJA 1JLAB 3QZ7A 2KFZA 3E8OA 4CTAA 5DGAA 2D69A 3VGUA 1HPZA 2R8JA 4RW4B 3PRDA 3G8SA 2HNDA 3Q86A 2WOMA 3H20A 3ZC4A 4QWCA 2EG1A 2DISA 4RPFA 4OI1A 3J7ZT 2J8AA 4YQWA 3LTOA 4MT1A 4QCLA 1CS4B 2GQ2A 4LRDA 3MTJA 1TL3B 2FHMA 4NZ6A 3FCHA 3GB0A 3T6JA 4BHQA 4B3TF 4LF4F 4PWDB 1A9NB 2V8VA 2YPYA 1XMQF 2ASJA 3DLHA 2EKNA 5A6PA 4LFCF 5A2QU 3QLHA 1K8AT 5F8GA 2BE2A 3IM9A 3CJKB 3VQSA 4IH7A 3W66A 3ZZRA 4ED3A 2K1RB 3LW5C 2HFNA 2OFHX 4M5MA 3UN3A 2MQPA 1TELA 1S0VA 3C15B 2NREA 1U1MA 1IBMF 5L46A 4DSLA 3OR1A 4P71A 3BGLA 2J9EA 1B0VA 1YJ7A 2UVUA 4ZVSB 3EGZA 4OZ2A 4A8QA 1TK0A 1EKSA 2UXDJ 1GXUA 2CRLA 4HKQA 5HMWA 1LW2B 1JMTA 2DHGA 2HFSA 2YX7A 4UOHA 3RBZA 4OYOA 2JC0A 4JV2A 2UXBF 1X5PA 2RUSA 5C42A 1R0AB 2DY9A 1T02A 3AD9C 1JKHA 1WHXA 2E1AA 2HG4A 1S6QB 4L75A 4NI2A 4NA3A 2JDJA 1S1TA 3N4WA 2UUCF 2LEPA 2ZZMA 1A7GE 3J81U 1Y00A 1SJQA 4IFVA 1YZ6A 2VOOA 2JBVA 1FDDA 2G0CA 3BGUA 5CHCB 1WTBA 1FRKA 4B3TJ 4OX9J 4ZIVA 3AB4B 2QSWA 3K17A 3MPVA 4K5SA 2FIUA 3W60A 1S59A 5L39A 2FHJD 1P8GA 1HNIA 4KBIA 5T41A 2GC8A 2CQ4A 1IUJA 2WBRA 1ZZFA 1NLAA 3M8ZA 5KFWA 4ED8A 4N8NA 5HK4A 2ZH9A 2B9WA 3IGVA 5I42B 4KJIA 1R8PA 2MZQA 4O0NA 3TWZA 2AGQA 3H90A 2ZH8A 3M6WA 1GTEA 4X62F 1CQMA 3EDRB 2V8GA 3C2PA 2H1OE 1WF2A 1HQ2A 5LM7E 2ZUAA 4WU3A 5IFMA 3WC2A 2J9DE 1OIAA 1KOHA 4DLGA 4B02A 5ETTA 2J8SA 1V5IB 5BYRA 3DLBA 4H54A 3HFZB 1RTIA 1QUPA 4HTIA 4IRCA 2CZVC 4RBUA 2IC3B 2MKKA 3HK2A 5EX0A 1NU4A 3GR0A 3I9ZA 1FNXH 4F4KA 3OL6A 4JV1A 1ICEB 4UQGA 2R2SA 3LALA 4LBPA 1WC3A 3FJ2A 1RHKB 2EW9A 3OFEA 5IC4B 1VLYA 4AUKA 4X64F 2ABYA 4RW7A 1Q4RA 3PRVA 3GYNA 4TU8A 3IN5A 2BNZA 3TOQA 3LP0A 4QIGA 4UF4A 3TVZA 4X4QA 2FVRA 2H3EB 1LWFB 1ZH5A 2RS8A 4DS5A 2OPRA 4EUVA 1KQFB 2OLWA 4MYUA 2HPUA 4FBTA 3V5RA 1R0CB 1EP4B 2RILA 4C8YA 5KG4A 3JS9A 3O1LA 4OL8A 1UCNA 2H65B 4WXWA 3PW5A 4C98A 2AIRB 1KS2A 1UPMB 2RU9A 4YFUA 2HFZA 1YG0A 1QUVA 1KRPA 3UR3C 1UVIA 3VAIA 2DNRA 4OYXA 4UUXA 5I4MA 4NCGB 4EBCA 3KG4A 2XNRA 2R7RA 2HK2A 1XN9A 1CJVB 2IVMA 3CSKA 3IGNA 3DDKA 3OL9A 5IWAJ 2H3AA 4EBDA 4ZVRB 3B4DA 3N6NA 5LSOA 2O5DA 3QJPA 1YJTA 3AT1B 4HHUA 4U8VA 1PAUB 2ZE2B 1FI4A 3OXFA 5GADU 3T41A 2ZC3A 2XWYA 4LR9A 2LXIA 1IBMJ 1SH3A 2VPZB 4HH1A 2XULA 3FQKA 3H7HB 4ZCKA 2ZH6A 4TKTA 5KT4A 5L9NA 1NKEA 2E29A 2DCLA 3R7BB 5JVHQ 1G1XA 2MPUA 2KL8A 2H5EA 2RU3A 4WF9Q 4XPEA 1HARA 3G87A 3FCVA 1X4DA 3C8YA 2DITA 4WFAQ 4NA2A 3BPSP 3ITHB 4X65J 4DR4J 2PE8A 4I69A 3MMCB 2W9AA 2XYGB 2XGPA 2W7PA 4OYIA 4NA1A 2DGOA 1LWEB 3S8SA 3HPOA 5HMYA 1W2IA 1DQAA 3K57A 2MQMA 2P6TA 1VQ8S 2AV5A 2AYEA 2DBBA 4HH0A 3QJLA 1KQSR 2W7OA 3RYLA 2RE1A 3U02A 3VR1A 2R8IA 3DOKA 3IXQA 5F41A 3WQPA 2CDQA 2HHQA 2M5YA 2W4PA 1M1HA 2WB4A 1HBNA 1TMMA 1F5AA 2PEBA 3CMQA 3H25A 2IDEA 4YUDA 4DV2F 2VG6A 1Q8LA 5HO4A 5CAAA 3CF5Q 1N36F 2CJ9A 4FNHA 2HEKA 3GQCA 3DGPA 3AJDA 3SEOA 4KH0B 3GIJA 4DLEA 2XB2D 3G8TA 1OWXA 3L3CA 3RAQA 3LPEA 3SZ2A 3Q8RB 2F7VA 4KYZA 1U24A 4NLDA 2CKWA 4A4JA 1BQMB 5GAGI 4DUZJ 1AZSB 2E5JA 2P9EA 3DLKA 1FFWB 2E7WA 3C14B 3G82A 3PEJA 1HNIB 1DLOA 2CPZA 3BPDA 4XDCA 2H4WB 2BUNA 4JI6J 4LF6F 1NHKL 1NSKL 2C2OB 2ACYA 4DUTA 4ED2A 1S9EA 4X2BA 1N54B 3EM1A 4NPOA 2LQ8A 3AH6A 3BV8A 5EWGA 2RS2A 1BC6A 5T7LB 1QJHA 2LXFA 5FDLB 3CJ0A 1DY3A 2LXUA 3WDOA 1RT7A 3L9ZA 2V4QA 1F5CA 2CQCA 4DFJA 1JLAA 1X4BA 1RUSA 3BM7A 2R8GA 1M1GA 4NLYA 2M2BA 1MYLA 2BA9A 4D8JA 3A8IA 3LO3A 4MK7A 4MKBA 4XDDA 4DSKA 3GSIA 1KKHA 3OBIA 1QDUB 3IRXA 2X1FA 1RK8A 2BZ2A 4ERDA 1GFWB 2X3DA 3SXLA 5D0HA 3QAUA 2EKYA 4W4MA 1NEEA 4ZLJA 4QW8A 1Q5VA 2L48A 3MR6A 1PBUA 3EPIA 1GX6A 4ZPCA 3A8EA 1KDNA 2CZ4A 2R7UA 1SL1A 2JSXA 4WYLA 1LNQA 4DV7J 3NAHA 2HSEB 3KYLA 5LMUF 1KQGB 1W7WA 2RF2A 3PX4A 4OFZA 5KFCA 2KZMA 1RKJA 3FMTA 4WXOA 2ZKUA 2ATCB 2K1RA 4AFFA 3HHKA 3VGVA 1FWLA 1H98A 4K4VA 3IR7A 3AQOA 4Q43A 4ZVQB 2JEJA 1VRUB 4WFNQ 1DAXA 3V2UC 3M30B 1VQYA 2F5GA 4F0MA 3O8WA 3QRRA 2A2BA 1RSCA 3OD2A 2FJEB 2VC0A 4FYWB 3MAHA 4LF6J 3JQMA 1QVFR 4OHYA 1NSAA 3JYTA 1RBLA 1HWKA 5A8KB 1XTZA 3AOCA 3NCRA 3CCZA 3IBWA 4DV4J 2YKOA 1NPPA 3G96A 2YNGB 1T9UA 2E5GA 2BACA 4ER8A 1QSLA 2DH7A 1JIHA 4LMZA 2R9LA 1WNEA 3T1AA 2DCUB 4RW6A 1RBAA 2GQQA 3HCXA 2LFVA 4I2PB 5CCMA 4YY3J 2NQPA 4YR3A 1IKYA 4ZN3A 1T3OA 2HIQA 4FPIA 3W9JA 3MEEB 1OSCA 3TZXA 3MPYA 2M4MA 2GX8A 5IM0A 2KH9A 3BYRA 3MMJA 1RA6A 1TUGB 2L9NA 1EQMA 1WOOA 4V1Ak 3PXGa 1UTAA 1RU1A 2WSFC 4ELVA 1RTJB 3TZYA 1MROB 2X1GA 2AQ4A 2AJQA 2QA2A 2CFXA 1VOMA 1XNRF 4PABA 5I42A 1MG7A 3N0VA 3PACA 4F02A 1RHJB 4CNYA 2F8EX 5D6GA 1FESA 3NO7A 1HBUB 1M5KC 1EB0A 5CYMB 3W1YC 2AY0A 3BGFA 2KVIA 2QYGA 2MJNA 2YKQA 4TXSA 2CQ0A 4JI4J 3D54A 1TL4A 1S9GB 2C2EA 3DOKB 1IXKA 3CWJA 5E7OB 3NGTA 5B7WA 4DUZF 2UVRA 1OY8A 3FFIB 3PW4A 4RNFA 1P1TA 4C3MA 4UUWA 4R8UB 5KT7A 5A8RB 3TP2A 1U2RA 3OW2R 1XNQJ 3WC0A 4QU7A 1M5SA 2HNZA 1RAAB 2CWKA 4RW8B 1FKAF 1EJ7L 4NMXA 3X3UA 1UA1A 5J2NA 1WOPA 3IBFB 4HDHA 2GPEA 2HRTA 1BQMA 5DJBA 4QIEA 1SKSA 2YX4A 8ATCB 3DLKB 5IXUA 1KP6A 2JNJA 2VF3A 5H9FJ 4FF4A 3F44A 3O5TB 2MY8A 4CO2A 3H2VE 2JEGA 2BMBA 1SC1B 3A12A 3HSDA 3TZZA 2LU1A 1OYEA 1TZ0A 1UA0A 2X7IA 3BREA 3KFWX 3MEDA 1Z1ZA 2HKEA 4AAIA 5KG2A 4Z7CA 4HR2A 3K5LA 1FK9A 2JFDA 3M8RA 1JQGA 2G1HA 2Q1LA 1L3KA 2R2UA 3UPFA 3I0SB 1H38A 1I3OB 1PSDA 5KG1A 3DLGA 3HSJA 4KH1B 2B4PA 2IPOB 2XWXA 3FZ2A 1WF0A 2Q43A 1X5OA 4KT0C 2A10A 3MD1A 4F50A 2D3OR 4DDFA 2FLNA 3CC4S 2DJWA 2AKWB 1TKTB 1WACA 4DR3F 1RT1A 2VICA 4ATNA 4IG3B 2JWNA 1CJTA 3O3LA 4OYPA 2Z58B 3CGIA 2LMIA 2CNNB 4QPTA 2RQMA 4Q2LA 2O01C 2R7QA 6FDRA 1ZTTA 1CPZA 2IJRA 1HNWJ 1PGZA 4RJVA 1NZAA 3RW7A 1RACB 1XEZA 4NRUA 4NYZA 1URNA 3TO8A 3PRBA 1CC8A 4DL3A 3PW2A 4ZVHA 2GFFA 1MMLA 4N47A 3VZIA 2I6WA 3HVTA 4WTOB 2YNHA 3MD3A 5DQIA 2FVPA 1RT3B 1B7YB 4XK8C 4HTJA 3DM2A 4QQBA 4O0IA 2ZD1B 2HHTA 3PG9A 4X4NA 2Z0GA 1CJUA 1LFWA 3G8QA 3T6BA 2BANB 5F8NA 3LUYA 3PJWA 3P96A 2FDNA 2XHWA 4Y0FA 2YWHA 3CMES 2DNMA 3PR4A 4PQUA 1HI1A 3N5BA 5JVGQ 1PCAA 1N56A 4URSA 4AYBD 4F67A 5FD1A 1U7LA 2GHWA 2B43A 3LF0A 2FGCA 3KJNB 3UFCX 3MFIA 4BWJA 2MQLA 1V9OA 1CLFA 4YMEA 1D9FA 4J5OA 2UV8G 3L7PA 4KAIA 1HQUB 3GIRA 5AE2A 1HW9A 1Y5IB 2V68A 3ZZOA 4X4OA 1FJGF 5C25A 2HW3A 4IQMA 4K50A 1JLEB 3ZNUA 1YKWA 4X64J 1WC5A 1IKYB 3CCUS 4Q8FA 5LXYA 2AU0A 2POKA 1M5VC 3JTOA 4HACA 1CSJA 2LVWA 2J7WA 4WP9A 1PAEX 3CMAS 2HRYA 5HMZA 3I9V9 1UJ4A 2RRNA 3D6FB 3PYDA 1X4GA 4OZ0A 3ZZ0A 1RTJA 3D3BJ 3FMBA 1Q16A 3OHBA 3HD2A 1XC9A 3BGRB 5C5JA 3R27A 2LQJA 3CO0P 1TP7A 2R8HA 5FLXU 1N6QB 1BHNA 3CCMS 3H5XA 3VVUA 4DPTA 3DKDA 4DX8H 1YI2S 4OI6A 3RR8A 5F0UA 3C6UA 5HQ8A 1R8CA 2OHDA 2K6LA 1R7IA 3E01B 3M2UB 2MTLA 5FIIA 3PKYA 2E1PA 2L08A 3B8HA 4JI1F 5K8NA 3NLCA 1YTYA 2DNZA 3RRKA 1QTMA 2UXDF 3VAFA 2K3KA 5HROB 4DX7A 3QFHA 2IM0A 4Q2MA 3ISNC 5BYSA 2COLA 5EUHA 3Q24A 5J1PA 3T9ZA 2AP6A 4PXBA 2EFGA 4IUFA 4CZCA 4DZ6A 1D0EA 2Z57B 1TVRA 3BQ2A 3KK1A 1RKIA 4K4ZA 1DTTB 3IG1B 5KFRA 3OR2B 4EGLA 5C2GA 1NJXA 1JLBB 2UUCJ 1VK8A 2GA7A 4PUOB 2OMOA 2KT5A 3MAAB 1VQ7S 2D3O1 1WD6A 1RLCL 3BO3A 3SCLE 3CXCR 1L3UA 2BE7D 2DGUA 3GXQA 5ETRA 2C3YA 3M30A 2V9WA 4W90B 4ED5A 2QA4G 4N41A 5HBMB 3A3OB 4USIA 1UPPA 2G13A 3TAPA 5L1IA 3QMQA 5J2PB 1AW0A 3BF4A 3T1HF 2E5LJ 1LW2A 1W2BR 4F0KA 1RTHB 3GYXB 1G3OA 4HL9A 3BR9A 1P6TA 1N5YA 5IT9Y 4BWMA 2WRMA 3OTCA 2VFSA 4IOBA 3NGUA 5EWFA 4DPWA 2YX1A 1NPRA 3JTNA 5A2QY 3V6JA 1C0UB 2M88A 3HSGA 4LF8F 1QM9A 4F4AA 3SBMA 2EPIA 3MM7B 1TKXB 2EK6A 1JJCB 3H8YA 4IFVB 4OHXA 5KFGA 3HM9A 4RNMA 4DQPA 2V2ZA 3CNQP 4QIFA 2NUHA 4NYOA 4TLRA 3K5NA 3TUIC 3NS5A 1PKUA 1D3WA 2DNKA 1LW0A 2O67A 2VA2A 2PMZD 3MWBA 1X0PA 2FQQB 2L9WA 4O4GA 3KLGB 4IG0B 2QYCA 3W5ZA 4GKJJ 3RJMB 3M8PA 4DUYF 3UD3P 1TTHB 3S7RA 3CW2C 2B4UA 3M6UA 4NEYA 4P72A 5D78A 3SSQA 3ZTSA 3J81Y 2X3GA 3HHLC 3MGJA 5L8RC 1JWWA 4WTYA 3AX2A 3D0IE 4B3MF 5F3ZA 2RH3A 4RNHA 1ZS6A 4FF3A 3KK3B 3P49B 2OI2A 1KWMA 1EHWA 5KTQA 1JXEA 1S9GA 2XI3A 4ECYA 2NLWA 2LECA 1NB2A 2V63A 3ILLA 1IQTA 1RAEB 3MPWA 3MXHP 3J80Y 1GMUA 2A2CA 2AWZA 3D67A 1OO0B 3Q8YA 4OYBA 2J0SD 2HBRB 5D0RA 4K4UA 1Q78A 3KUEA 4Y28C 2WTFA 3WX4A 3QIDA 3I5AA 1FNOA 4DV6J 2HNZB 4NLWA 1QAYA 3TX0A 1S4FA 2ZOGA 2C2MB 3DNCA 3OPKA 1VQSA 2Y9HA 1HMVA 3D4JA 1NKBA 1KVIA 1XJWB 2LLZA 1NH8A 2HWHA 2OPSA 2V94A 3IWXA 3R5AA 4Y00A 1YJUA 4I64A 4ECXA 1TFYA 2BE2B 3DXSX 2VPXB 1MW7A 4YHHJ 1FE4A 1LXJA 2F1FA 5KFHA 3T1YF 1IBLF 4ZS6A 5A8WA 3TQ1A 3CD7A 1X9SA 3H98A 5E0OA 2CPDA 1PARA 2DNLA 2GMLA 1VYAA 4KY3A 3WBZA 3CDAA 2RQKA 2KB2A 3DGVA 1RXOB 5EN1A 2KDOA 5DDOC 3CD0A 1U0HA 4KSEB 3AAWB 2KXNB 2JLEA 3LWLA 4DR6F 2DNNA 3PFEA 5GMDA 4IRDA 3OJUA 1IBLJ 4ZHRA 2H5JB 1E6VA 2ZNZA 4OX6A 3T3FA 2RRAA 1QAIA 5L38A 3SFGA 2YWWA 4ZPDA 2NCKL 4PXDA 5A0YB 4IG3A 2ZE2A 2K1OA 3MCNA 3TJ9A 1J2VA 3VWSA 1BWVA 1SB6A 1SL2A 1JJ2R 4L76A 5B0GA 4C8LA 2A0FB 2ERRA 2B3TB 4KPYA 3WZ0A 2XZTB 2A18A 3BKTA 5B09A 1C1BA 3TA0A 3I5BA 3CD5A 1CQNA 1RT4A 4YP3A 1IBKF 4LQ9A 2FLOA 3C6TA 3FEYB 2MQNA 2FJWA 3CPWR 1SIWA 2I5JA 4BLGA 4O3PA 2R7WA 2AJ1A 3LP1B 3UVJA 4ZJLA 3TUZC 3UI3A 1O5JA 2E5HA 2GIFA 4ES1A 1RU2A 5KFBA 3BSCA 1BAZA 1LWEA 1R8HA 3CDEA 4K4WA 2BABA 1RT2B 1PYTA 4QWBA 4FYYB 4X4TA 5J2PA 1PBAA 5GAHI 4Y2KA 4RU9A 1KOOA 3IM8A 4BCAA 1SJRA 2HQGA 4C0BA 5D3GB 3VAKA 1F60B 1RHMB 1WHVA 1YBAA 2HQIA 3DRSB 3R8YA 2HNYA 3R5CA 2JEIA 2ZUGA 4QJVA 5K9FA 2FLPA 4NLGA 4RUBA 1HQUA 3ILJA 2NS1B 4JI3F 4U96A 3BZQA 1CJKB 2XCPA 2MB0B 4L3KA 1B28A 5IC6B 1U6BA 1G2EA 2DEJA 5KFXA 1OM2A 4O3OA 3ISND 3WIVA 3GR1A 2ZDOA 2ALYB 4EMDA 4KO0A 3N6MA 2RT3A 4U6PA 3KHGA 3GIKA 4KQZA 2VASA 9RUBA 5CYQB 4NXNJ 4ZOSA 4RR5A 5ETNA 2CQGA 1AUSL 3I0RB 1HWJA 4OZ1A 5KFZA 2DNOA 2AJFE 1UWBB 2D9PA 4PCQA 3AD7C 3G6YA 4AE5A 2JLFA 1SJ3P 4OV6A 4DR1J 4WWSA 1YSJA 1WSRA 1N6QA 5HAOA 5KFTA 4YEAA 5CABA 4DCPB 5RUBA 5C7PA 4TQSA 1HNZJ 1H2UX 5CA5A 1UFLA 2JXIA 3BDEA 2DR8A 4H4KA 2L41A 1WUUA 2OD4A 5U47A 4YS2A 3TZWA 4JV5J 4FYVB 2MKIA 3Q8SB 3M2VA 4KGKA 4L3NA 2J6UA 2MZSA 4OQJA 5AXMA 4DS4A 4OYAA 3RB4A 5J1EB 3C16A 3GTYX 3KLIA 5G0RA 1LK5A 4J37A 3DXBA 4ED1A 1B3TA 1DHMA 1T0TV 4G6VB 3GIMA 3MM5B 3DLEA 1JXVA 4NLUA 3GJTB 2HFUA 4M1KA 2WONA 4ANEA 2VHGA 4EYHB 5HLFA 4JI5F 2DK2A 4WCEQ 1Y0HA 3DDIA 3W62A 5M2UA 3UWTA 1BDVA 4ICLA 2AD9A 4UTGA 4A8WA 3TAMB 3TVYA 3PR5B 1XR5A 2CQBA 5DG7A 2F9JA 1X4AA 1S10A 4RLEA 5HVHA 2VJUA 4X66J 5LJ5Y 2XQCA 4USWA 3T19A 3NY0A 1Q8IA 3T5HA 1FRLA 2SXLA 4O3NA 2QMWA 4M94A 3BH7B 3PYEA 3DCAA 1HI0P 4FZVA 1SV5B 3MDFA 2DPIA 3FNNA 2F4FA 4LJMA 1I1GA 2DHSA 2XMKA 4ZIWA 4A8FA 5KFDA 4X65F 4DR4F 1FT8A 2VFUA 5MAOA 2ZHBA 4B3RF 1NSQA 2MHNA 3KLFA 2EFQA 3ISZA 4OZLA 1QE1A 4QYRA 2X1AA 1K0TA 2CVEA 4HI2A 2JFKA 3GCWP 1NSPA 2DO4A 2KRBA 4DV3J 3BR8A 3R97A 1F2HA 5FJ4A 2ZFHA 1SCJB 1PIEA 4XAKA 1NK9A 3FEXB 3K89A 1M90T 1BE4A 1NDPA 2XCAA 1FKPA 3MUVP 4J9RA 1X4HA 4ILRA 4MJKA 5DM7Q 3NL0A 3C14A 4DL7A 2YBVA 4J90A 5LT5A 5J2MA 1X5TA 3KNGA 2E9TA 3MF5A 4NLOA 3SQGA 1SQEA 1TAQA 2AF6A 2PFDA 3UVJB 3KJVA 3H40A 2EBEA 2XYHB 4QBUA 1S9EB 1YITS 4OZNA 4JI5J 4U7UK 3M05A 3VGTA 3NWGA 3FRZA 3MR7A 1CULB 2ZJRQ 2DGVA 4X62J 1N34J 4DFPA 3EX7B 3GSDA 2GQCA 4DJBA 4A8KA 4KC5A 1RADB 2VUGA 2YKMB 3IRXB 2HHUA 1V6HA 1VQMS 1G6BA 1J5EF 2JZ5A 3GFHA 3PV8A 1GAOA 3MEGB 5D0EA 4BDPA 2PEHA 1K47A 1UP1A 2KXFA 2AYBA 2ZHAA 2AX0A 3X1LB 1FRMA 4X4VA 3KKFA 2LQ9A 2W1BA 4LF2A 4QOTA 2XY7A 1RTDB 3I6PA 1S99A 3DI6A 3OQ2A 2KFYA 3MR2A 1T11A 4DR1F 1B64A 1S1VB 4USJC 4OJHA 5KFUA 5DDPC 2D74B 2ASDA 1S1XA 4RUHA 3MCSA 5BXIA 4K7QA 1QY7A 3OFGA 2IMWP 2FZGB 2VD3A 1S49A 2NXCA 1GX5A 3HHDA 4WU2A 3VV2B 4B17A 3MEDB 2M9KA 2JX2A 1P9QC 1MN7A 2EFNA 2NYIA 2KHDA 2P2CB 2V6AA 2W25A 3P5TL 4I7FA 1Z2ZA 5K8PA 4C2MA 1SL0A 4IRKA 4GKKJ 2J5AA 3DLGB 5DQGA 2UUBJ 1HPZB 2IRXA 4ID5B 3GG0A 5KG7A 1ITPA 4WFYA 3AQPA 2J6SA 2AEFA 4LREA 1UW9A 3JYTB 2P9CA 2Z2LA 1WDDA 1X8DA 3CJQA 4PZVA 3FBEA 1I6JA 2V67A 1HWIA 1JLFB 1KHWA 1BMQB 3ET6A 4YR2A 2G2YA 2M7SA 2QX0A 4A46A 3ZTPA 1N33F 1MN9A 5B08A 4EZ6A 2RQ4A 1TL7A 4I6YA 3R7SB 3KNAA 3D0GE 3DLEB 4DV1J 5HLFB 3DU6A 2ALZA 1NM2A 2H4YB 2JC1A 1RQ0A 2CVIA 4RBTA 3L09A 4E98A 3HF5A 3AY0A 1MROA 3H4BA 2ZVIA 3DM2B 1ACMB 3H0PA 3SV4A 2CA9A 3IR6B 4PQAA 4Y65A 4N76A 2GNKA 4KKOA 2ZVSA 2IDLA 4NEZA 1FKOB 2IBOA 4YB7A 5SUHA 1L3SA 4C11A 1F0XA 2KO1A 2ZBIA 2V8HA 1RT2A 1B4SA 2B8QA 2F40A 4O23A 4OI4A 1KLMB 2FHKA 1B0PA 1UEVA 2W4CA 2LP4A 4TYAA 5HMXA 4M63A 3FEZA 5D4NA 3RR7A 2Q66A 1Q7YT 4DG1A 3CVKA 4S0MA 2B6AB 3LGHA 2VFTA 3H4DA 5CCLA 1F1BB 1UAWA 2P9GA 3D0HE 4L72B 3CCTA 4QR1A 2IIHA 3QIPB 1TL1A 2G0IA 1EZZB 1Q0NA 2OGUA 2V9KA 3KLEA 1CJKA 1XMQJ 1IKXB 3WX8A 5MLCV 3SYZA 1HLWA 1TL3A 2PMHA 1Z2LA 2L3MA 3IWLA 4M5IA 4CT9A 1VBYA 1C1CA 4XPCA 3VAJA 1FKPB 4RL1A 4NL5A 3QNWB 1H2VZ 2DGXA 3OHAA 1RAGB 4YHHF 3LANA 4O44B 5K14B 1RLDA 4ZA1A 2QMXA 4CYUB 1NJZA 4EK2A 4DSEA 2H48B 2B5JB 3NP5A 5B0FA 4LFAJ 1ZPWX 7FD1A 2AZ3A 5IS2A 2D3ZA 4M5NA 4DPOA 2D68A 4IKAA 1FK9B 1GTHA 1I51B 2IJFA 5E3CA 1P94A 4CM2A 3G6ES 1TFWA 4ZVOB 4B08A 5LOQA 5ETLA 4WFBQ 3EZUA 2ZH2A 4FXDA 2PA8D 4KR0B 3G6VA 4YB1P 3SSSA 3QZ8A 1UETA 3POTA 1C4AA 3MECA 1K1SA 1CEZA 3TJAA 1R6VA 2HRUA 2GCFA 3KUHA 3Q89A 1U09A 5J1EA 1WTFA 5IZHA 3TEGA 2W9BB 4URGA 2WZ1A 3PKMA 2GJIA 1S1TB 3NCQA 4E8UA 1QSYA 3W8PA 2C3MA 3KK2A 4OYMA 4M5LA 2DHXA 3HHLA 1NDKA 3ETMA 2E1RA 3IG1A 1LFPA 4A48A 4ILMA 1I94F 3OV7A 1KTVA 4HVZA 3IAS9 3L95X 4G1IA 2W2QP 2RRBA 3MCOA 3QLHB 1VQPS 2BEFA 3H87C 2FYXA 2MKSA 3KMSA 1EETA 1Q1KA 2VODA 2HIYA 5KFYA 4YOEA 2ZH5A 2EC2A 3TJ8A 3PW7A 4WK1A 3C15A 1CJUB 1GH8A 3ZTOA 2RDDA 5KG0A 3FBFA 4B9NA 1KVKA 5BYQA 3BKUA 4RNNA 4Q0BA 3ZTQA 1WKKA 5B0DA 3G4SS 2B4VA 4PG8A 1VQLS 2KYXA 5SZTA 2FLLA 5DLFA 2NZ4A 3NGKA 2HHSA 1RTHA 4Z2XA 5C42B 3CTRA 5BR8F 3W65A 3CDBA 5KG3A 3J7YU 4DV1F 2Q6BA 3ET6B 3V4MA 1IM6A 2AJ0A 4UY8T 3AX3A 5AXKA 1H72C 3CDUA 2MZJA 1XBWA 3MR3A 1ZOTA 2PFFB 4CM0A 4Z37A 4CO0A 2IAJB 1WEYA 3D9BA 1OHNA 3H5SA 2WK4A 3U1LA 5GAGU 2OPRB 4IDKA 5THWA 3T1YJ 1SJ4P 2QLFB 2GAGC 3JTPA 3SSRA 3OUYA 1FX2A 3BGRA 3BYPA 3W63A 2OKQA 4WYWA 1I94J 5GAEI 4WKRA 4AT1B 2J9CA 5D0GA 2CJAA 3V81A 3RRGA 2XHCA 2EBGA 2CJYB 4Q44A 4C48A 3KG0A 4FS2A 4F3QA 2B7CB 2NPIA 3N28A 5HN0A 1RTIB 3TA2A 3VZHA 5DLGA 4U67Q 4C8KA 3Q2TC 5DG8A 5D4PA 4J9OA 2M8DB 3Q0AA 3RRHA 2DIUA 2YVSA 4OX9F 1R8BA 2AT1B 4LBHA 4RWWA 3D2WA 4ZVEA 4ALZA 2JVOA 5LMUJ 3KLEB 4P73A 1B0TA 3BN7A 3UR0A 1IKWB 2GVZB 3UD5A 3GIIA 1KD1T 5F8MA 3NNAA 2BJ1A 3PTWA 5F9NA 3OR2A 2XMAA 2L9DA 2CG4A 2YWFA 1WELA 4LFAF 2OIHA 2XLIA 3DLJA 3W2VB 4P2MA 4NCBA 5LSRA 4F25A 4DU7A 1SI9A 2Z2ZA 3FRYA 3G2XA 4G1QA 4QWAA 3G71S 2XS2A 4O44A 1Y5LB 4ME7E 1JLGB 2QSFA 4ITSA 1FJEB 4LF9F 3OTBA 5H9EJ 4RKUC 3VF0B 2OSRA 4P7TA 2BBEA 1RWOB 4OI2A 2DIVA 3P6YC 2NUUG 1DTQB 1C4CA 4OV1A 1GMWA 4LFBF 5ITHA 2N82B 3SFUA 3RW6A 1P27B 2YNIA 4V19J 2W2PP 2IM3A 4JBCA 1VC5A 2FPHX 2EFOA 2RDIA 2FC9A 4I4BA 2K06A 2QL7B 2IM1A 2R7VA 2DR5A 4IH6A 2VBXA 3ETOA 1U47A 3ENVA 5FLXY 3I55S 2F4VF 4FVCA 2QG9B 1C0UA 4DMZA 1LQ9A 3MM7A 1D8YA 2VC1A 2R42A 2HBZB 1Q86T 1VDHA 3IFEA 2W9CB 4ZVGA 1S7IA 3NMAA 3BN4A 3O6QA 4N5SA 2MGZA 2C28A 2HLUA 2U1AA 3ITHA 3Q8QB 1NB7A 4B3SJ 2DY1A 1VISA 2OH2A 1R3NA 2M3DA 2P8IA 3ADAC 3AOBA 3LP2B 3PM9A 4CLFA 4ZN1A 4G3IA 1PJ5A 3AA9A 3JXOA 5E41A 3L7OA 1X0FA 5L1JA 2CJBA 4Q0BB 4QYZJ 3MZIA 4LVOP 2GO8A 3QBCA 3RBXA 3EZ5A 3BB5A 3ILIA 1YJ9S 2XNQA 1NDLA 4NASA 4DL0C 1SBRA 4A8OA 3N79A 4Y34A 2JOQA 1AFIA 4HV0A 2QA1A 3QO9B 4CO4A 2D1CA 4A8SA 4PXCA 4KHPF 1NZ8A 1Q53A 5ETKA 4USMA 3PEHA 3NWRA 2B6AA 2LA4A 3CJ2A 1C0TA 2XMJA 3K5OA 2XTDA 2N4CA 2C3PA 3GMGA 4F36A 2OJ3A 3M8QB 4OZJA 4YR0A 4MK9A 2OP5A 1QAJA 2H5IB 4ILLA 3A3PB 2V8DA 5L9XA 4FXEA 1OYDA 2MY7A 1HNXF 1BXNA 3O44A 1TUVA 2EVZA 1AZSA 2FZCB 3QFWA 4ETZA 1LV5A 1S1UA 1T05A 4LRCA 3LWMA 5HSPA 4CYUA 4L6V3 4ZVPB 4B3OB 1R89A 2YWEA 2Z2YB 2F8HA 4PG6A 1ZM9A 1VRUA 2LEAA 2HVIA 1RCXB 5ETMA 2YXLA 1PC4A 4ETXA 3VAGA 1FX4A 2WBMA 4R5PB 2KG1A 3HHNB 1O51A 1TUWA 2RMLA 4PG7A 3PX6A 1L3TA 3NAIA 1RAJA 1U26A 2IRUA 1LWCA 2HZVA 1MNEA 3EJMA 5E33A 2IMOA 4KGXB 2GS8A 5ETPA 5K5MA 1OSDA 4ZVFA 3QWPA 3UNGC 1VRTA 3OVSA 2W9BA 5BJRA 1O8BA 1NK5A 5A0YA 4CWBA 2PD1A 2R8KA 1JNRB 1U25A 3DMJB 1N32F 1RT5B 3T5KA 1RYRA 4O3SA 3FZBA 1JB0C 2OPPB 5KFMA 4QIWD 4E2FB 4OZ3A 4ECZA 4USHA 3ZFVA 4I2PA 3SMZA 2Y0SD 4W98A 4K8RA 4WKYA 5AXLA 4H4MB 1MWYA 1R0BG 3NKYA 3KDNA 5AT1B 2CDRB 4TYBA 5B0BA 4X4UA 1H0HB 2WAQD 4ICLB 1J5EJ 3PO5A 1BD6A 3TAMA 1FWPA 1NCLA 3MM9A 1OG7A 1S6OA 3H5UA 3V6DA 4USKA 4MIAA 1PILA 3EZOA 3PFOA 2D7SA 1H73A 4NCAA 1SC6A 1Y3JA 1WKLA 1Q79A 3CIZA 4ZLPA 4CH7A 2ZZTA 1KHVA 3RB0A 4DV5F 4KRWA 3HLUA 1X31C 1GQEA 2YNIB 4P10A 2VA3A 3NOGA 3ULHA 3AXKA 3MMAA 1IBKJ 2FVSA 2GAHC 2BW2A 4DN0A 1ZYQA 2QL9B 5A8KA 1VQKS 1WC4A 1R27B 4Z7YA 2PI4A 3ONQA 4NI2B 3ELHA 4LF7F 2YWGA 2LEBA 3P5BP 1VHFA 1JLQB 2NPFA 3HZGA 3K8WA 4DQSA 4ZP9A 2MSTA 2JL9A 2XMMA 4BC7A 4DX5A 1GXLA 2O3DA 2Z56B 1GXTA 3PJXA 3W61A 5KFEA 2G1DA 1M0SA 2ILZA 3E2EA 3AFGA 3IAM9 4FN5A 4CLLA 1WKJA 3M9MB 2KM8C 3BQ0A 5CYQA 2OELA 5B0AA 4AD6A 2ASLA 2XLKA 4LQ3A 1KONA 1RT3A 4MKVA 1X60A 1YDLA 3SQGB 3KHHA 2ZD1A 4N56A 4EEYA 1FD2A 5JMNA 4J9NA 2YKAA 2XSFA 5IQQA 5E3PA 4XIUA 1N33J 1UWAA 3NGRA 4U8YA 4A47A 3EMTA 2DGQA 1BDTA 3KWMA 1S48A 2BJ9A 1F9HA 1WI6A 1YBUA 4Q8EA 3G86A 1UVLA 1NJIT 3CIMA 1RDRA 5A6WA 2E1CA 3GJRB 1RAOA 1TKZA 4ANDA 1F5BA 4GKKF 1FXRA 1C0TB 2B0GA 4CLPA 3I56S 2HAFA 4ZPBA 2RAQA 2V69A 2XZWA 4KTQA 4TVAB 2D3UA 3W8GA 1NK0A 3NRBA 3OJSA 4WP8A 2XZ2A 2V1SA 3NNEA 1FRHA 4RW7B 4I2QB 1NHUA 2KJWA 1U2FA 2BKOA 4TY8A 5IOLA 3W2WB 4CLWA 3JSMB 3DI6B 3E51A 1S0NA 1V3RA 1AYEA 4HACB 4KV8A 4PKDB 1MSWD 2HZAA 3KG1A 1LWFA 2K9IA 2DXFA 2MYFA 1WSVA 3BKFA 4G1QB 2CPGA 1IR0A 2LDIA 4UQTA 3VTIA 2UUAJ 3OFHA 3F73A 2J7KA 3CD6S 2ASYA 3QGIA 3J81j 2VBWA 1N32J 3D7SB 3EGVA 3AA8A 1S6PA 3K58A 3V4IA 3OR1B 3TQEA 4JI2F 1D1UA 2MZTA 2X1BA 2FJDB 2DNQA 3R7NB 1IWGA 1U8SA 2DT9A 2Y0BB 4JI6F 1SVDA 3IS9A 4DHVA 4DBQA 4ZMMA 1T94A 4M5DB 3TI0A 4NMLA 1PC5A 2VQFJ 2ZBCA 1WG4A 2V4JA 1U2CA 1VRTB 1TKTA 1GK8A 4U9RA 2IYGA 1ELOA 2V5HG 1F3VA 1RA7A 1RT1B 1NRKA 1HNWF 1H2TZ 1SQFA 2PGCA 4AXJA 3J7Z5 2DRAA 4U7UD 2NXJA 4CRJA 3RBEA 2V2VA 3ENWA 1B01A 4ZVUB 2AJ2A 3CDWA 1H74A 3VEBA 1WDTA 1WEXA 3KK1B 4ECUA 4ED6A 2EI5A 3U27A 4UW2A 1JLEA 1X5SA 2XYPB 3A1YG 3OT9A 3T9NA 5D15A 5C2CA 4MKAA 1U1PA 1T03A 4F2RA 3BSNA 1N88A 2C42A 3PNIA 3MHYA 3TVKA 2BOPA 1O6XA 4KFBA 4I6AA 1N5VA 2QC3A 2VDIA 4FS1A 4TLQA 2LQ5A 2V2QA 3ICLA 3J80U 3EWGA 4RX6A 3J7AN 4ZJOA 5J1NA 3A4TA 5KFFA 4O3RA 5C24A 3UD4P 3HFVA 3NNCA 3MTKA 4AL5A 4DN9A 3H2LA 1FO1A 3JSRA 2QL5B 2EFVA 4DR3J 2M0GB 2HHHF 1GT8A 4C0OC 2YKMA 1HIYA 2V2KA 4DR2F 1S72S 3CUNA 1U1NA 2HMIB 4DR7J 2CNLB 3W9IA 1BQNB 3DHWC 3D1QA 2R7OA 4FKYA 5ETOA 1FF2A 4P52A 1T9VA 1RB0A 5HATA 3GV7B 1GEHA 2BX6A 3L4BC 1FD8A 4CDIA 2O1PA 2MQ8A 5JJBA 2ZKTA 3M7VA 3D6TB 3EGWB 1AA1B 4I0WA 4X66F 3J7A1 2BW7A 1G4CA 2VBZA 3GE9A 4HHHA 1WC1A 2D41A 1HNZF 4C4WA 3FBBA 3HT0A 1BQXA 4OX7A 4F4XA 4Y2IA 3RBDA 3RAXA 4O4GB 3KLGA 1RWXB 3I87A 1Z4UA 3ZXWA 4IOAQ 1ARRA 1L5UA 3CT9A 4B3OA 4C6AA 4QR0A 3GONA 3ZNJ1 1RCOB 2B5JA 2RQCA 2R7TA 5B0EA 2VH7A 4R5PA 1VLOA 4DQIA 1VQ6S 1YJNS 4QWDA 1FJCA 1S1WA 2UUTA 2RKIA 4OZ5A 1S77D 2N7YA 4DR5J 3H2UB 2OTLS 8RUCA 1IR1A 1DARA 3JSBA 9ATCB 4R0EA 2ZH7A 2GMHA 2DNGA 4KE5A 2UZAA 3R2DJ 1AUDA 4H4OB 2UUAF 1UFKA 5HVFA 2DB1A 1S0MA 3DMJA 2XI2A 2JXHA 2I2YA 1IR2A 4AL6A 2WW8A 1V5VA 2XY6A 2DO0A 2WVDA 1OY6A 2LKZA 3B4MA 3HHLD 1HNVA 1OS5A 4KPCA 1JLBA 4LSZB 4USUA 3UCZP 4IO1A 2VPWB 2VG7A 1TU0B 1KSPA 3MM8B 4WJBA 4BC9A 3K7RA 1SXLA 2H54B 4JI7J 3HO1A 2AGPA 4OI0A 4LF1A 1Q7LB 4LBIA 3PO4A 2J0WA 3CB4A 5K20B 3RU0A 2VFVA 3DRRB 2QN6B 3A8JA 4PYAA 3KLVA 5DETA 1VBZA 3VCDA 4JYAF 3GFYA 4KKOB 3DRPA 3NCPA 2K7JA 1Y10A 1XR7A 1YVFA 3M1VA 3DYAA 3SDEB 4EO6A 3GFXA 2G9OA 2D9OA 2CQ2A 4IFYA 1KLMA 4IYQA 2A3JA 2IHR1 2QIFA 3KK3A 2R2RA 1RI7A 5IT4A 4EU0A 4I68A 1FFSB 3S1TA 5IQ6A 2RHSB 3GP9A 2AMCB 5KT6A 3Q22A 1N5YB 2CQIA 2QFIA 2QGFB 1EA4A 3Q8UA 3PW0A 5K8OA 1HBNB 4HI1A 2DH8A 3W5XA 2MEWA 5AE3A 4WFZA 1S57A 1SIZA 2QJ3A 2XO6A 4JI0J 3QT8A 5HANA 4ZCIA 3DGPB 4J9PA 3MR5A 3ILOA 2V1TA 3P3DA 3M32B 1IN0A 1TQLA 1T9WA 4RBVA 4TNOA 2WVFA 5HJXA 2E66A 4HYKA 5DZ7A 3R6GB 1HMVB 4CO1A 2KG0A 4K0KF 3MEEA 5IM0B 3BSOA 3RTVA 2C22A 2BA3A 4QZVB 4IG0A 5KFLA 1NKCA 5DDRC 1O0PA 4GVBA 1WG1A 3R6LB 5IWAF 5K14A 5A8WB 1KNZA 5GMKa 1XNQF 4LFCJ 1X4CA 4CLKA 2E1MC 5K8MA 5CXTA 4FYDA 3EICA 1YBTA 3M6XA 3MMBB 2GZOA 2F65A 4LRFA 5C24B 2Y1JA 1RT7B 2RNEA 3IA0A 4B9TA 4ES2A 2J7UA 3DDNA 5CYMA 1VCTA 2LYVA 4B9SA 1X7VA 3IR5B 3BDPA 2KI2A 2CPXA 1RHQB 1X4FA 2G0JA 3NMRA 4EZ9A 1TKZB 2FVQA 2R4FA 3AJ1A 2ZITA 5IV4A 3HHEA 2M70A 1WJ9A 2V50A 2YY3A 3MECB 3HJVA 2MKCA 4OX8A 4K0KJ 1BQNA 2R3VA 5A8RA 4LT6A 1RWPB 2C3UA 3OL7A 1AB8A 1D9AA 1H6KX 3KDOA 3LGMA 2ADCA 4QYZK 2IY5B 4MTPA 2Z4PA 5CYJA 1IVZA 1SUQB 4TY8B 2PT0A 4PWDA 4WE1B 5J2QA 2OPSB 3JQJA 4FPRA 4KV8B 5CZXA 2QFJA 2WB1D 4UZBA 3I96A 2IYIA 1HYSA 3IC1A 1U02A 3B78A 1FFGB 3NXZA 1V3SA 2GIRA 4JV5F 1TV6B 4NLVA 1XERA 1UWBA 3Q8VA 1SIWB 4P74A 2AJ4A 5AE1A 2VQEF 3CCVS 3K2YA 2XMTA 3CCES 3V4IB 4NLTA 2PDAA 3DHXA 2NR0A 2RSQA 2DKOB 2W4DA 2VIHA 4DV2J 1DBDA 2DYAA 2UXCF 1FRIA 1FXDA 2PN6A 4MH8A 1R6YA 4M5DA 2XG8A 2QO3A 3W9HA 2AX1A 1FWKA 2VV5A 1FRXA 1SC4B 2WOMB 3VHQA 1G7CB 1ZM2A 2F8MA 1DURA 3THPA 1R0AA 1S7HA 3EPGA 2DR9A 3GYGA 2BXJA 3W64A 1F9FA 1PG5B 1MWQA 2YWKA 4DL6A 3QSYB 1TK8A 2MDAA 3BQ1A 1T9YA 2MKYA 2AN7A 4P6QA 3MEKA 1F6TA 4F8RA 1HQEB 1REVB 1IBCB 2DNYA 2Y1IA 3JB9k 3MM8A 1RT4B 2VG5A 4CO3A 1YJRA 2WHOA 2J76E 4NXNF 5I3PA 4DSJA 1UVKA 2ZJPQ 4MFBA 2HFVA 2RUGA 2HBYB 3CJ4A 5D4OA 3LP1A 3TYTA 4YY3F 3OUYB 1HI8A 5DS7A 1QTGA 2BM0A 1R8AA 1M5HA 3W5YA 3GJQB 1N34F 2BRLA 3HI9A 1K44A 4B9UA 4P7VA 2EC0A 5F8IA 2GJFA 2YTCA 4PQUB 3OSPA 4ELTA 4DPYA 3HP6A 4FF1A 4LRVA 2OD6A 2V0NA 4TN2A 5D3GA 2WVEA 3ZZUA 5EDWA 3DRSA 4J9SA 3M6VA 2Y3YA 3B54A 2ZBQA 1VQ9S 4N7TA 3FK4A 5A76A 1JJ4A 2XTCA 4C8OA 2CZ9A 3GCXP 2KZZA 3MFHA 2HHHJ 4JV0A 1MLAA 2HVDA 2AGOA 1VBKA 3AJ2A 4IR1A 2MZ1A 4JI8J 1D8ZA 5KG5A 3OFFA 3M32A 3W7BA 1DFDA 4DSIA 2DH9A 3PX0A 2HFOA 4FXWA 1RHRB 1RBOB 3MI7X 4DI6A 3OLAA 4YB6A 1KC8T 4WZQA 2W2MP 4F2SA 1TAUA 2H51B 3OXLA 4KHRA 1S1UB 2MKJA 3R1HA 1JJHA 4DV7F 3EXYA 2HQDA 3TAQA 2KJVA 2ZC4A 1Q16B 4N77A 4X84A 4J7CA 4P2XA 2I38A 1T9TA 4U7CA 3RAMA 5F8JA 1XK8A 2XTJP 3GPAA 2MHEA 4PR6A 4D3HA 2HHVA 2GJ2A 1N8RT 1S1WB 2RKIB 5KOXA 4FNIA 3M8SA 3MPUB 3M2UA 1S6UA 3DOLA 4OMFG 2GW8A 1W25A 3F41A 3UCGA 3C19A 2ZBRA 2Y1RI 5KFAA 2BYCA 2W24A 3UN5A 3UO0A 2FVCA 4GVLA 3H5YA 4KIAA 4DV5J 2VFRA 4G65A 4K2JA 2UXBJ 4B3MJ 4OHWA 1S6QA 3PDNA 2B8PA 1GNKA 3KLIB 5G0RB 1T3NA 2HYIB 2KHCA 2W01A 4WK3A 1TVRB 2MLYA 4JOUA 3UN2A 1FVQA 3SCJE 2GIQA 1HBOA 3GV8B 3FGVA 2ZH4A 3T5JA 1KR4A 1IJFB 2VKRA 2WONB 3CO9A 5DRKA 5DZ6A 2IVFB 3BEGB 2W9CA 4F4WA 2DRBA 4PAAA 2XMVA 3MAAA 2KXHA 1VHIA 4DZDA 4GC6A 3HSZA 2B9EA 1NHVA 4DF4A 4OHVA 5L1LA 1IKVB 4CI0B 1SPBP 4ZLNA 1S1XB 3W3SA 2ZH1A 1SJ1A 3KHRA 1F9EB 1V3ZA 4P2FA 5AJ3J 1EP4A 3V6DB 4NX9A 5DQHA 4DV3F 3QT7A 1NJWA 2FHOB 2HQCA 2JHEA 2Q3PA 3D66A 2OFGX 5DGBA 2E44A 3HZEA 4IFYB 4YDDB 1XNRJ 3QGPA 1YJWS 1YRXA 2QZ8A 1KFSA 3ZTRA 3TANA 2IFXA 1FEHA 3MUMP 2J0QD 2R2TA 1N5QA 3I32A 1HHSA 2FY8A 2LQBA 2HLTA 1QSSA 2DEIA 1UVJA 2FB0A 2VG6B 4Y2CA 4J9UE 2BNWA 1FVSA 1TL7B 4F3OA 1MNTA 3M9OB 3QT5A 3AXMA 4LR7A 4MK8A 1YK9A 3CCJS 3DLLQ 3VEAA 4GKJF 2A1BA 4WIIA 4BBYA 4NLSA 1XMOJ 4RO0A 1YIJS 3CJ8A 2LDYA 4C7QA 4OIXA 1ZA2B 3G82B 3PCOB 2AYMA 4C8NA 1ZTWA 1WF1A 3KJVB 1BY9A 3U7JA 2F9DA 3I4PA 1NO8A 4CP5A 3VQTA 4ZP7A 1VRQC 2K7KA 3MMBA 1UEUA 2PI5A 3NBPA 4OJGA 2XS7A 2KFNA 4ECRA 2KN4A 4WIQA 3T5LA 4I7FB 2ILYA 2I9SA 3KLHB 4B3RJ 2HHWA 5JXSA 3QSIA 2V34A 2VBYA 4RUCA 2CQ1A 2CWXA 3NOCA 5HL7Q 1J27A 2PO4A 1N5SA 2J9DA 2MZRA 2KM8B 1VQOS 1CJVA 1RABB 1RISA 2CAJA 3MOZA 1VBXA 4CIOA 1Y7PA 1PYSB 1ZZNA 1RYSA 3QIPA 3QGGA 3G6XA 4K4YA 1HHQA 5B0CA 5KFPA 5HI7A 4LUBA 3LOUA 4CNZA 1RTDA 5D4LA 4DQQA 2KOEA 3RG6A 3JSMA 1H7WA 2VZ9A 4DXLA 5DG9A 3CULA 1S1VA 1HD1A 4L73A 2RF2B 3NS7B 4M8LA 4WPAA 3ENQA 4J9KA 4AL7A 1SKUB 4M5HA 3ZZZA 4CLUA 5AXNA 4UZCA 2C2RA 4P75A 1VFJA 2Y8WA 1N4LA 4MMOA 2CADA 1XIQA 4ZITA 2AEMA 2HWTA 2Q2KA 4NZ0A 1B70B 4ZCMA 3UDLA 1APSA 4NLQA 2MQQA 1CVJA 4JYAJ 5KFVA 2VQEJ 3FT7A 1WHWA 4DU8A 3D1HA 5KFIA 1RWKB 3VGSA 2HHPA 3SCKE 3D6MB 1UUJA 5CZVA 4Q5VA 3C46A 2KT3A 2BR0A 4LSLA 1JLFA 2FZKB 2YKNA 1N0VC 3QATA 4RW9B 3SQOP 3WHIA 4F0HA 1FCAA 2WCXA 3HMJG 3KK2B 2DNPA 4AQYF 1L3VA 4PYDA 2MSSA 1PJ6A 2B4OA 4TY9A 1B99A 2U2FA 3GILA 3EGNA 2MKHA 4A8MP 2XY5A 3QPIA 3LA0A 1T03B 3C66A 4FKXA 2ZEJA 3GG1A 2MLXA 1EKRA 3MM6A 4H4KC 4EWTA 5IV3A 2JLGA 4DF8A 4ID8A 1DZ5A 1IKVA 3BGOP 3QAEA 4LIRA 3UE2A 4IO9Q 4CLZA 2VB6A 5HJYA 4A8YA 2I5JB 2XBPA 4KB7A 3FVYA 2E7VA 1EARA 2HQ3A 4LR8A 1UMJA 1HA1A 1MU2A 2JH3A 4ECWA 5I3UA 3TARA 1HL6A 1RAIB 3HX9A 1SKWA 1N52B 2OUGA 2DVIA 4DQRA 3CJ3A 3BO4A 1H3DA 2DNHA 3CJTA 2PC6A 3KMQA 2P5VA 3N6LA 2XC9A 1H7XA 3POTB 2QT7A 2BJEA 3HULA 4DG1B 5E3AA 4CLSA 4X4SA 3PIOQ 2HVHA 3FCWA 1XMOF 3FFIA 1NUEA 2CJKA 2YNGA 2K5JA 3A13A 2Z30B 1OQ6A 2K3IA 2P6SA 2Y8YA 4ZP8A 3R3TA 1BGXT 3AX5A 1MYKA 2OTJS 2FJBB 1Y3KA 3TUPA 3W2WA 4YB5A 5EGYA 3TR5A 1K73T 1YQHA 2ATLA 3N5FA 2FUG9 1QTNB 3V6HA 3CE8A 2JRSA 1UZHA 2KKHA 3GZ7A 2BOAA 1EETB 1KBRA 2BSQE 3MCMA 3P4UB 2PA3A 4OLPA 4XTTA 3BO2A 1JXLA 3IR7B 3V6KA 3HDSA 4LFBJ 3V81B 1DJ0A 2BKNA 1XQIA 2CUYA 1HBUA 2KYZA 2XGQA 2FC8A 1T7PA 2CPEA 3I5CA 2AW0A 2E5IA 3I0SA 3CCSS 2NZCA 2RVJA 3QOQA 3RUBL 3FDSA 3KUGA 2DR6A 1Y11A 2VOPA 4YN3B 3ZZTA 4JI4F 2G2ZA 4ED0A 4R8UA 3DRXA 2AYGA 5KFOA 4DFMA 3CJSA 4JP8A 3RZAA 1SH0A 2HS3A 3MAQA 4KHMA 1MMDA 4ANCA 3CCQS 1Y9OA 5DO2A 1HD0A 5I3QA 2B9XA 4RW6B 4DUYJ 8AT1B 3CCLS 1RAHB 3DOMB 1HYSB 1FTCA 2ZWOA 2B56A 4JI0F 1FXLA 1ARQA 2FHJA 1R43A 4K2XA 4DEZA 3DU5A 2B7BB 3PHTA 3JAMU 5HP1A 1NK8A 4PRFA 1YWXA 3FBCA 3H59A 1VMBA 2XO7A 1JLGA 4IDKB 3UDCA 4HT7A 2HVZA 1QD1A 4CH1A 1I5OB 4NZ7A 2HS0A 3M8YA 4UOGA 2DGWA 1D09B 1M5PC 4QWEA 2YNFA 4JI2J 2JJ4D 3DRPB 1URRA 4Y3CA 1Q82T 1KTQA 3RGIA 1IJEB 1JLCB 1KLNA 3VVTA 2XS5A 4USVA 3LPYA 5AJ3F 2ZWPA 4JI3J 2ACMA 2BM1A 1XR6A 1A0OB 1OJ4A 3FUYA 1YX2A 4D3GA 1TL5A 2GHVC 2PMWA 2IA0A 4Q45A 2FGOA 4LSLB 4RW9A 5M2RA 3PIPQ 3KLFB 1X93A 3P45B 3UDVA 3EVMA 3KJFB 2XSJB 2JXGA 2B9YA 4F7VA 1FTRA 1UL3A 1VK3A 7AT1B 4QIVA 1PO6A 1EQ0A 3BBBA 3VALA 1S5ZA 1IKWA 1XWLA 2GVZA 4OHZA 5DM6Q 3EVWA 2WW4A 2QMUB 4DV4F 3HKWA 3OLBA 1MMNA 4AQYJ 2CIMA 5J2NB 3K0JA 3LH2S 1T8EA 2J6TA 3NGSA 4GMKA 2MGZB 1VIOA 1NJYA 2YQ1A 1F3FA 2LU2A 2VU5A 2YNHB 4LVNP 5J2MB 4DR7F 4M95A 3LQVA 5GAEU 4GO5X 2QA4S 1TKDA 4C9DA 3KXDA 3ENAA 1AROP 2XLJA 1RWVB 3KJQB 3IMQJ 4MIWA 4C3KA 5GAHU 4QPXA 1AXQA 1N0UA 4WZMA 1U6ZA 3HVAA 4LRAA 2EFPA 4Y2MA 5HP1B 1S76D 4RNOA 3D28A 3E01A 4NLXA 5ETQA 3EVOA 1IQZA 1AFJA 1VS3A 2WVCA 5JUMA 4O4RA 1X4EA 2DHAA 1N5TA 2YKPA 4RWXA 2RB7A 4EO8A 3HXMA 3M2VB 4DR2J 1VC0A 2GMJA 2Y1LB 2C2ZB 5HROA 3KTQA 2IC3A 1Q8KA 2OEMA 1ZAWA 2OEKA 4H4OA 1YLXA 1HW8A 4O3QA 4DR6J 1U1RA 2UVWA 2UUWA 3PYFA 1RTZA 2Z8QA 1IM4A 3F0NA 4PPDA 1R31A 1WG5A 3B82A 4MKYA 1RT6A 1UEKA 4WE1A 5L1KA 5J2QB 1DRZA 2QTWA 4ZJQA 4PUOA 2HWIA 4ED7A 3R5DA 3BBFA 1A6LA 2IA6A 3BJYA 5KFQA 5IT9U 3HVTB 3ZZYA 4CO5A 2CAXA 1HBMA 2BE9B 4CH0S 4FXVA 2UUBF 2YH0A 3DRRA 3S6EA 1N36J 1Q8BA 3DFEA 4USTA 1TK5A 2BANA 2CJQA 2GVDB 1GMWD 3EE3A 3G5OA 3M1VB 5HBMA 3SDEA 4HEA9 4ECTA 2CJXB 5LXRA 4UOFA 3K5MA 2YQ3A 4NCGA 3M9NB 4W92B 4MIBA 3M4XA 5E5NA 2ZJQQ 4JI1J 2G4BA 3IWNC 4LF9J 2MXYA 2C1EB 1JKHB 2KU7A 3A8KA 5GMEA 1RP5A 1IRQA 2HGMA 5EHHA 4CT8A 4UT4A 1E6YA 3Q2SC 2HZCA 3GU0A 4PWUA 1HHTP 4ELUA 3R5GA 1DTTA 4C0HA 3M2RB 5F9LA 1NAQA 3DOMA 1EAYC 5EWEA 2N3LA 1U0SA 5GVQA 1QLNA 3QT6A 1HQEA 1REVA 1U1KA 2BDPA 4H4MA 5EX3A 2CYYA 2QEXS 4QW9A 4EI2A 3H42A 4DOZA 2DGTA 1NPKA 5E2QA 4K59A 2DD8S 2AEJA 2W7AA 4GRSA 4FVMA 1ZAXA 2HQFA 4MAKA 1AT1B 3HD1A 3CJ5A 3CC2S 3DRYA 3M8PB 3QJJA 4F4ZA 3LP2A 1NDCA 5KFKA 1MU2B 4GC7A 1WEZA 5HQLA 4IR9A 2FJVA 1FEEA 2J0XA 3R5JB 4ENOA 1CULA 3UCUP 2C2NA 3PZPA 2MLZA 1NH7A 1FDAA 1VJWA 4KGMA 1MWZA 3GJSB 1M1KT 3AWRA 4R25A 3I82A 1K0VA 3T1HJ 2R7XA 3EYZA 2EXUA 2GGPA 2M8HA 4E0DA 4BS2A 1WOSA 1VQNS 2F63A 2E5LF 2BRKA 3F56A 3CEDA 1U45A 1QAXA 1U8WA 2E9ZA 1RT5A 4DR5F 1PJ7A 3OXGA 2OPPA 3AHPA 4I1TA 3KOAA 5LSLA 4WFXA 1OMSA 3Q83A 4CQ1A 2BQ3A 1X9WA 5LMNF 1K9MT 4B3SF 3EXCX 5LL6d 4LF8J 1Q81T 4LF5J 2Q79A 2Z2MA 3PVXA 2XMWA 3DN9A 3WIUA 4UY85 2Q6CA 4V19X 1LKZA 1UVNA 1TV6A 3R2CJ 4F04B 3FKBA 2HHXA 2UU9F 4A8XA 1LXNA 2ROGA 3CCWA 2RBFA 1FERA 2FTRA 3S01A 1BLUA 1CG2A 3IO1A 4HT5A 3VAHA 5T7LA 3UNYA 3HKZD 4CLYA 1Q5YA 4FDFA 1RHUB 2VKZG 3HVRA 2CNKB 4DL5A 3DOLB 1LWCB 3QGHA 1U6FA 1U9PA 4ID5A 2BJ3A 4JB8B 2DRDA 4NLRA 1BUXA 4EYIB 3ZZPA 3RB3A 4TU9A 1TR0A 1E6VB 5KFSA 2BKPA 2LA6A 4DCJB 3EDQB 4DX6A 3D3CJ 3AODA 4TQRA 2DXEA 3J7YI 3FC9A 3AD8C 2CPYA 2HK3A 2K8GA 3BH6B 4YDXA 1FJ7A 2A6OA 4K4TA 2HS4A 2CQDA 1WWHA 3HHLB 1NBEB 1UKUA 1WC0A 2IVYA 2VPYB 1TMJA 3BBCA 2G2OA 4NWBA 3THTA 4ZKAA 3Q8PB 1RGVA 4J9VA 4DV6F 2A6MA 2C2DA 2VG5B 1S9FA 4JI7F 1Y4ZB 3CCRS 2O66A 1LW0B 4OLOA 1S12A 4PG4A 3SV3A 1D9DA 3FSYA 3C6TB 1HBMB 3MM9B 2QE5A 2APOA 5KT2A 3R5BA 1S0OA 4ZPWR 4FBUA 2ZM6F 2YNFB 1ZM4A 3OSNA 2W2OP 1IWAA 2XEXA 4LSNB 3Q23A 2GVDA 3N01A 3PY8A 2UXCJ 1SJFA 3K5PA 2MJUA 4AXIA 2QRRA 4ZCLA 3I31A 3IS9B 4LRBA 1CC7A 2ROEA 4PWWA 3MMAB 2RDJA 5CD4H 1W26A 1K1QA 1NLKL 4LIWA 2V4JB 5DDQC 4ZHRB 3US5A 5E3QA 1YJVA 2W8KA 2DPJA 3MOJB 1UFWA 1FHTA 1S4EA 5H9FK 1JX4A 3UQSA 1JLQA 4HLBA 3LAMA 4DPUA 1TL1B 1HFEL 1B7FA 2RJZA 2BVZA 2AZ1A 4IOCQ 4ECQA 1FA0A 4NLPA 5LJ3Y 2ZM6J 2GO9A 1U1OA 1C1BB 1FDNA 2OMLA 2OEJA 2ADBA 3PJ9A 1QVGR 4PEOA 3BSAA 2A2DA 1UVMA 4I56A 4OJ1A 5KFNA 1RWMB 3D5MA 2EK1A 1DLOB 1KEKA 2IJNA 4ZP6A 1DQ8A 1FNMA 1HWLA 2CQPA 4C97A 3R1LA 3QYYA 4R0JA 4J91A 3QRPA 2GV1A 5ADZA 4RUAA 4KHPJ 2QLWA 1HWUA 4DFKA 3UDEA 2CQHA 2RHQB 5FDLA 1Y5NB 1VIXA 1ZBTA 3IP0A 1XMBA 2MMYA 4OJ3A 1LK7A 2NXNA 1LEOA 3KLHA 1U0HB 2CPJA 4F4YA 3BS9A 2RD5C 3THVA 4FYXB 4QR2A 1SQGA 2C3OA 2GGPB 4DPXA 4CCHA 2HNDB 2NSBA 1WHYA 5LMNJ 4HHJA 5IT0A 4LF4J 2NYHA 2DGSA 3I4HX 4B9MA 2CPFA 2HAIA 1HNXJ 1VC6A 1M5OC 4RU2A 5KFJA 1YRTA 1YRUA 1F2GA 4MJWA 4RW8A 1RE1B 2ZOFA 2YPZA 4I2QA 4JI8F 2CPHA 1RT6B 1HBOB 2X51A 4P2SA 5ETSA 4OYZA 3JSYA 1DQ9A 2ADLA 2NSCA 1KQKA 3TUJC 1SC3B 2NXUA 1RZMA 3CJKA 4KFBB 1EIYB 4F3MA 1VJQA 2KKEA 2HURA 4XO0A 2V8PA 2ZZNA 1ULRA 2UP1A 3O2IA 4LF5F 4C8MA 2ZH3A 1S6PB 3QRQA 2KTQA 1OQ3A 2R7SA 2WSCC 1S97A 1DTQA 3SIPB 1Q95G 4ZK7M 4NRTA 1C2PA 1NXIA 1VQ4S 4I6WA 2W2NP 1VGYA 4Q7AA 4URQU 4NXMJ 3SCIE 2KVQE 2F4VJ 4ZPAA 5KAKA 3RB6A 5F3TA 2WSEC 4C8ZA 3EUNA 3NS6A 3QWUA 1JK9B 4P9SA 2NXEA 2XM3A 3NEKA 1U1LA 3CJRA 3JQKA 1FDBA 2E7XA 2HNYB 2ZOMA 3OTOF 3A3NB 2HMIA 5KT3A 1YGYA 3E3XA 1CJTB 3N9UC 1E6YB 3LAKA 4KGVB 5D77A 1T9XA 2N7CA 3U1NA 3SI8A 2PSZA 1UJ6A 2ZHOA 2VL1A 3M2RA 2VJVA 2BQRA 3C3LA 5ETVA 1FE0A 3MM5A 1ZETA 4M5GA 3HT3A 1HR0F 3TA1A 2WVBA 2IAJA 1SH2A 4PXEA 4ZVTB 4B9LA 1U1QA 4KO0B 2K29A 3DC2A 1ZM3A 2I1RA 2OPQB 1NNDA 3OVAA 3LGNA 1PYOB 3FMWA 4DL4A 4C3LA 2W8LA 3I0RA 4OI3A 2N4DA 1S79A 4IQXA 1GMVA 1RWWB 1X9MA 1SKRA 3VAMA 2YQ0A 1ZAVA 2CG8A 2CPIA 2OSQA 4JUZA 3L7UA 5T14A 3K59A 4DL2A 1J5OB 5I3UB 2FY1A 1P9YA 3NBPB 1FJGJ 5CH7B 4ES3A 1ROFA 3D6HB 3DYAB 5HQMA 5M2PA 4DV0J 2FJAB 1SV5A 2HGLA 2QV6A 1U4BA 1KVJA 2MQOA 4CTAB 2UV8A 2XMUA 1WC6A 4RW4A 2JEFA 3TEHB 2GHPA 3VW4A 4K5RA 3ZO7A 2PIIA 4ZDNA 4MYTA 2BV3A 5GADI 2ZNYA 1QE1B 3FQLA 3C16B 4DCOB 3M8QA 1YHQS 6FD1A 1BWEA 2OAUA 1UW4A 3PHEA 1CS4A 2V4RA 5E3RA 1OPIA 4EBEA 1N48A 2EWHA 2IRYA 2H9ZA 1HKAA 4NYPA 1REGX 3OTEA 4ZPTR 4ZPVR 1WI8A 4LF7J 2VDHA 2VG7B 1LOUA 1YZ7A 1RAFB 2CXEA 2QLJB 4WP3A 3W2VA 4NOHA 4X4PA 4I67A 5D8HB 3AOAA 3MUTP 1T05B 2CNOB 4KGZB 3TNVA 3NNHA 1OPZA 3PYGA 1U49A 2M52A 3FSXA 7FDRA 2N3OA 4QU6A 4B9VA 3D1OA 3HFKA 3G9CA 5KOWA 2E9RX 4UOCA 2KT2A 3MPDA 3C6UB 4GO7X 2BQUA 2QLXA 4CLTA 2HBQB 4ED4A 3FSIA 2FJXA 3CC7S 5CQGA 3KHLA 3GV5B 4Y6IA 4Y2AA 4DV0F 4FP9A 2YKNB 3MEGA 5CD4A 1JNZB 1OY9A 2UVVA 5H9EK 4EFAC 2HVEA 3GWCA 4G1PA 4ZLLA 1HNVB 2DTJA 1EX8A 2CQ3A 3R9LA 3U1MA 4ECSA 5BR8J 4TU7A 1KN6A 5F0WA 2EG2A 1FRJA 2LCWA 3MM6B 3TW0A 5KT5A 1T95A 2BJ7A 2B51A 4M5JA 2HGNA 2F3JA 5H1SV 3TX8A 4FF2A 1P1LA 3IRWP 4M5KA 3MMCA 4IH5A 3UW1A 4F26A 2VQFF 4J9MA 1NK6A 1WORA 1U48A 2BJDA 2AHOB 4ECVA 4LSNA 5F8LA 2ZBPA 3GLJA 4HDGA 2XTEA 4OYWA 4X4RA 1FKOA 1RJJA 1JLCA 2ROPA 3OTDA 3OTOJ 4K4XA 1RWNB 1VR6A 2XZDB 3M8WA 1NK4A 2EEYA 5KG6A 3JAMY 4NE9C 3LJPA 2YH1A 3QO9A 4J9QA 1VQ5S 2DXDA 2I0XA 1LWXA 3B6BA 3GFZA 6AT1B 4DWIA 4NXMF 1RWUA 4K4SA 2BJ8A 2JVRA 1CBKA 3OVBA 2K2PA 2ZDPA 3K8VA 4J9LA 1NK7A 5F8HA 4WBFA 2DHHA 2XSJA 2H1YA 3TRGA 4U95A 5C25B 2I8EA 1TKXA
chains in the Genus database with same CATH topology
4RZRA 3AB2B 2IBKA 1IKXA 4PPZA 1UJ5A 3HVWA 2IM2A 1SUQA 2VONA 2OO4A 1C1CB 3LP0B 2DR7A 2OPQA 1VI7A 1ZPVA 5G4DA 3NGDA 4MFBB 4PG5A 1KFDA 2FD2A 3NG8A 1J5OA 3OL8A 3HJFA 4N8OA 3MURP 4DSFA 2KRRA 4C11B 2RIJA 1JLAB 3QZ7A 2KFZA 3E8OA 4CTAA 5DGAA 1HPZA 2R8JA 4RW4B 3PRDA 3G8SA 2HNDA 4QWCA 2WOMA 3H20A 3ZC4A 2EG1A 2DISA 4OI1A 3J7ZT 2J8AA 4YQWA 2GQ2A 3MTJA 1TL3B 2FHMA 4NZ6A 3FCHA 3GB0A 3T6JA 4BHQA 4LF4F 4PWDB 1A9NB 2V8VA 1XMQF 2ASJA 3DLHA 5A6PA 4LFCF 3QLHA 1K8AT 5F8GA 2BE2A 3CJKB 4ED3A 3VQSA 4IH7A 3ZZRA 2K1RB 3LW5C 2HFNA 2OFHX 2MQPA 1S0VA 2NREA 1U1MA 1IBMF 4DSLA 3OR1A 3BGLA 2J9EA 1B0VA 2UVUA 3EGZA 4A8QA 1TK0A 1GXUA 2CRLA 4HKQA 5HMWA 1LW2B 1JMTA 2DHGA 2UXBF 2YX7A 2JC0A 4JV2A 1X5PA 5C42A 1R0AB 1T02A 1JKHA 1WHXA 2E1AA 2HG4A 1S6QB 4NA3A 3EPIA 2UUCF 2JDJA 1S1TA 3N4WA 2LEPA 1A7GE 1Y00A 1SJQA 4IFVA 2VOOA 2JBVA 1FDDA 2G0CA 3BGUA 5CHCB 1WTBA 1FRKA 3AB4B 2QSWA 3MPVA 4K5SA 2FIUA 5L39A 2FHJD 1P8GA 1HNIA 4KBIA 5T41A 2GC8A 2CQ4A 1IUJA 2WBRA 1ZZFA 5KFWA 4ED8A 4N8NA 2ZH9A 2B9WA 3IGVA 5I42B 4KJIA 1R8PA 2MZQA 2AGQA 2ZH8A 3M6WA 1GTEA 4X62F 1CQMA 3C2PA 2V8GA 1WF2A 3WC2A 5IFMA 4WU3A 2J9DE 1OIAA 1KOHA 4DLGA 4B02A 5BYRA 3DLBA 4H54A 1RTIA 1QUPA 4HTIA 4IRCA 2CZVC 4RBUA 2IC3B 2MKKA 3HK2A 5EX0A 1NU4A 3GR0A 3I9ZA 1FNXH 4F4KA 3OL6A 4JV1A 4UQGA 2R2SA 3LALA 3SZ2A 3FJ2A 2EW9A 3OFEA 4AUKA 1VLYA 4X64F 2ABYA 4RW7A 1Q4RA 3GYNA 4TU8A 3IN5A 3TOQA 3LP0A 4QIGA 3TVZA