3BSNA

Norwalk virus polymerase bound to 5-nitrocytidine triphosphate and primer-template rna
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
484
structure length
479
Chain Sequence
KGTYCGAPILGPGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEPRGKPPKPSVLEAAKKTIINVLEQTIDPPDKWSFAQACASLDKTTSSGHPHHMRKNDCWNGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDLATMIRCARAFGGLMDELKTHCVTLPIRVGMNMNEDGPIIFERHSRYRYHYDADYSRWDSTQQRAVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCTSQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLKEYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGPNHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELDFYVPRQEPMFRWMRFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into mechanisms of catalysis and inhibition in norwalk virus polymerase.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Transferase/rna
molecule keywords RNA dependent RNA polymerase
total genus 148
structure length 479
sequence length 484
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2007-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.100 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Arc Repressor Mutant 3bsnA02
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 3bsnA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3bsnA03
1N5YA 1HNIB 3FSIA 4IFVA 4KFBA 3LAKA 2AX1A 1RT3B 4ZMMA 5KG7A 2D3ZA 3NBPA 1C1CA 3QYYA 2R2SA 3LP1B 5JUMA 4ZVEA 3DOKB 4RW9B 3UDLA 4YR2A 1JLQA 1TL1A 3T5HA 1BQMA 4MFBA 1SH2A 4LQ9A 3DLEA 3H40A 2HWIA 2W8KA 2C2RA 3RB3A 3KJVB 1VRTB 5DGBA 2VA3A 3N6NA 4H4OA 4MIBA 4RW7A 3GILA 3IS9B 5J1EA 2W9CB 4KB7A 3HVTA 1RDRA 4O44A 2QV6A 2XGPA 3IS9A 2W9CA 1LWEA 1XR7A 4J9NA 4IKAA 1RTHB 2IJNA 1QE1A 4Y2CA 2WRMA 3HVAA 3UQSA 2IM0A 4TY9A 4ZPDA 1VRTA 2HNYB 5KFIA 1VRUB 4O3NA 2OH2A 2DPJA 3PHEA 4QWAA 3KJVA 4DL2A 5KFPA 4XO0A 4TN2A 4YMEA 4DL4A 3DMJB 3ISNC 2HWHA 1RTIB 3I0RA 4EBEA 1RYSA 5KFEA 4MKBA 3CWJA 4WE1B 4OL8A 2I5JB 4QW8A 3ITHA 1DTQB 4J9KA 2OPSA 1RT3A 3I0SB 4DEZA 2IA6A 5K14A 4Q8EA 3V81B 1JLAA 2BANB 1NHVA 3ISND 3PW4A 1DTQA 3LP1A 3MR3A 2V9WA 4EBDA 3DM2A 2IC3A 3KMSA 4RW4B 2F8EX 1S1TA 3M9NB 3KHHA 3T5KA 1S9GA 4PUOB 5D3GA 4ECZA 2HNZB 3Q8PB 1RT4A 3GV7B 4JV2A 2XI2A 1TV6B 1W25A 4IG0A 4IRCA 4F4WA 1JLEB 3QLHB 5CYMB 2FLLA 4Y2AA 5I42B 2IM2A 4LSLA 3BSAA 4EBCA 5KFDA 1ZTTA 2UVRA 2OPRA 5I42A 5KG5A 4RW7B 5C42A 5KFOA 3LP0A 4ECYA 3SFUA 1TQLA 3BQ1A 1FKPA 1OS5A 4JUZA 3G6XA 1IKYA 5F8MA 1S0NA 4ZP6A 1S1XA 4KSEB 4MK8A 2FVPA 2BE2A 2YNFA 1JLQB 1TL1B 5F8JA 3TAMB 5DQGA 4EYIB 5L1JA 4Y34A 4MH8A 3TVKA 3QGIA 4NCGB 4K4SA 3RAQA 2ALZA 1HYSB 1TKTB 3C6UA 3N6LA 5F8GA 2WK4A 3IRXB 3M8QB 2XCAA 3NGDA 1SUQB 2VA2A 2AU0A 5J2QB 4IDKB 3BR9A 4FS1A 1T03B 4R8UB 3H5SA 3OLBA 3DLGA 3Q8SB 3DI6A 4KV8A 4ED8A 3I0RB 4DL6A 4JV0A 1KLMA 4NZ0A 2JLEA 2BE2B 3FQKA 4TY8A 1N5YB 2EC0A 4NLYA 3DOLA 4NLDA 3QZ7A 3KLEA 2W9BB 5DLFA 3KLIA 4O3RA 3PW2A 5KT4A 2HNYA 2BQ3A 3CDEA 1RT1A 3KMQA 3HVWA 2JEJA 4FBUA 2JEIA 3ICLA 4ZHRA 5HBMA 5FDLB 5L1LA 1HQUB 4WXWA 4HKQA 3IG1B 1RTDB 5C24B 5C5JA 2RDJA 3KLFB 4DL3A 1KLMB 4NYZA 2YKNB 3C6TB 1TKZA 5KFVA 3KK3B 2RKIB 3BQ2A 1DTTB 1K1QA 4NLOA 1NNDA 1JIHA 1S9GB 3DLGB 2VG5B 4IFYB 5HLFA 2C2EA 2HNDA 5HROB 3KLVA 4QWDA 3Q8RB 5DQIA 2VG5A 4URQU 3KLHB 3QGHA 1HMVB 3V81A 4FBTA 5EDWA 2FVCA 4ICLA 2XWYA 4K4YA 4WFXA 1IKXA 1HYSA 4J9MA 3PJWA 4RW8B 1HNVA 5KT5A 2DPIA 5KFRA 4ED0A 4U6PA 4I7FB 3DRSB 4WYWA 3IGNA 3MEDB 1IKWB 1EETA 1RT7A 3BSNA 3BJYA 3KHLA 3TQ1A 5L9XA 3KLGA 1REVA 3NAIA 1S1WB 4URSA 1C2PA 3OLAA 3PZPA 3MEEB 4KHMA 4KE5A 5I3UA 1IM4A 1HPZB 4O3SA 3DLKB 4KAIA 4I2PB 3CIZA 2WONA 1MU2A 4O4GA 4I2PA 3EPIA 2GC8A 4TY8B 3G6VA 1JKHB 1LWFB 1S1VA 1FKOA 2QE5A 5CYQA 2J6UA 2UVWA 2ATLA 1SUQA 1ZTWA 1RT4B 4MKAA 4KKOA 2HMIA 3NMAA 1JLBA 5KT6A 3FFIB 3VQSA 3UR0A 3EZUA 4NRTA 3E51A 4LSNA 3LANA 4ED3A 1N4LA 5F8HA 3FFIA 4ICLB 4IFYA 3OHAA 2FJVA 4DL5A 2R8JA 2OPPA 2VG6B 4IH7A 2WTFA 4ECXA 3C6TA 2I5JA 4RW6A 1JLCB 4MK9A 5HLFB 2BQRA 5L1KA 2FVRA 3IG1A 1N56A 1S1UB 4ID5A 1EP4B 2JEFA 5J2PB 3KLFA 3MFIA 5KT2A 1RA7A 3DYAB 4QWBA 1FKPB 4RNMA 3DLKA 4RZRA 3MR2A 1T05A 2WCXA 5CYMA 2YNGA 4RU9A 4J9OA 2BR0A 2AQ4A 2B43A 1GX6A 4O44B 5HBMB 4O3QA 3GV8B 2OPRB 4J9SA 4MIAA 1C1BA 3IGVA 3H5XA 1Z4UA 3QLHA 1IKWA 1EETB 3OL8A 4DG1B 4F50A 2B5JB 2ZD1B 1DLOA 2R2UA 3CDWA 3KLIB 1S1WA 1K1SA 4WZMA 5KFLA 1S9EB 4ECVA 1S6PB 3T1AA 1IKXB 3PR4A 4NLGA 3BGRB 3T19A 2C28A 4WYLA 1TL3A 5J2NA 4KO0A 3RB0A 4R8UA 1S1TB 1D0EA 1C1CB 1S6QA 1TVRA 5J2MB 1JLBB 1JLAB 2BANA 3I5AA 4IH5A 4HYKA 3D28A 1RTIA 2FLPA 3SFGA 4EO8A 1C0TB 4X2BA 3UPFA 4EYHB 1SV5B 3E01B 3H59A 4Q44A 4YR0A 2C22A 5KT7A 1RT6B 3BQ0A 4ECRA 3V4IB 4G1QA 4J9QA 1RT5A 5FDLA 4M95A 2ZE2B 2HAIA 3RB4A 1N48A 3I5BA 1UWBB 3LAMA 4NLVA 3NL0A 2J6SA 3SI8A 2V0NA 4NLPA 5DQHA 1RT1B 1BQNB 1LW0B 4QPXA 4U7CA 3MR6A 5JXSA 1CSJA 3CJ3A 2W9BA 3MTKA 5KG0A 1N6QA 1RT5B 5J2PA 5KFKA 5KFMA 5KFQA 3IN5A 1JLEA 4M94A 2XCPA 1LW2B 2YKMB 4QW9A 4Q43A 3KLEB 3RBEA 1JLCA 4WFYA 1FK9B 5KFUA 1RT2A 4RW9A 3H98A 4KHRA 4KFBB 4Q0BA 4IG3B 1JLGB 2IM3A 4PWDA 4FS2A 4LSNB 2IC3B 4RW4A 3PW5A 3V6HA 2YKMA 1DTTA 4IFVB 2W7PA 3CO9A 5DG8A 2OPSB 3I0SA 2ILYA 4H4MA 3GIJA 4F4ZA 1S6PA 3PW7A 4XPCA 3GIKA 1S9EA 5EWGA 3HHKA 5KFJA 3MF5A 2BRKA 4ECWA 3NKYA 1LW2A 4ED6A 2AGPA 1DLOB 3FDSA 3M8PB 3KNAA 1HQUA 3FQLA 4RUAA 1RAJA 1HQEA 3NAHA 4ED7A 2WOMB 1QAIA 3D5MA 3HVTB 3QIPB 2WOMA 4G1QB 2JC0A 2YNGB 2BQUA 1HPZA 3KOAA 3OL7A 4H4OB 3CJ4A 5KFTA 2FJWA 3M8PA 1J5OB 2IM1A 4EO6A 2R8GA 3V4IA 1KHVA 5F9LA 1RT7B 1C0TA 1S1UA 1U09A 4ID5B 4K4WA 4TXSA 3DOKA 3EPGA 2V4RA 3JSMA 1TP7A 3G86A 3LALA 4ECSA 4NLQA 1JXLA 2GIQA 3H2LA 4RW8A 3DLEB 5KFHA 4NLTA 5KG2A 3OSNA 5J2QA 3NBPB 3DRPA 2ASLA 2R8KA 4NRUA 1JLGA 5EWFA 4PWDB 3BSOA 3M8QA 3CDUA 5K14B 3RB6A 1QAJA 3V6DB 5F8LA 2UUTA 2YNHA 3DRPB 2AGQA 1S6QB 5KFBA 2FJXA 4NCGA 5HP1A 2W7OA 5J2NB 2HMIB 1S0OA 5KFSA 5KFYA 2B5JA 4ZVGA 5DG9A 4J9RA 4TYBA 3JYTB 1FK9A 3OSPA 1S1XB 5EUHA 4RNOA 5KFFA 3DRRA 4I2QA 2I1RA 4RUCA 3QO9B 4TQSA 3Q8QB 2ASJA 1FKOB 1S4FA 1R0AB 5KG1A 3DDKA 3DYAA 1T05B 1WNEA 1MU2B 1UWBA 4O4GB 4DL7A 2RF2B 1VRUA 2W8LA 4KBIA 4TQRA 1LW0A 4RNHA 5KT3A 2R8HA 2FLNA 3GIIA 1SH0A 3QO9A 2W9AA 5DGAA 1ZETA 2IBKA 1TV6A 2CKWA 2V4QA 4K50A 1IKVA 4RNNA 2FVQA 4ZP7A 1RT6A 4IR9A 3MECA 1S97A 1S0MA 4NLWA 1C0UB 2AGOA 5J2MA 4TYAA 4ZPBA 2JC1A 1BQMB 4MFBB 5F8IA 4PQUB 5DLGA 4WXOA 2IAJA 1MMLA 2YNIB 4ZVHA 4Q0BB 3GYNA 5KFWA 4KKOB 1HNIA 2YNIA 1TVRB 3QGGA 1I6JA 1RT2B 2XI3A 5F9NA 4IR1A 4J9PA 4QWEA 4WE1A 4G3IA 3H5UA 3BSCA 5KFAA 4PUOA 5KFGA 2IJFA 2RKIA 3TAMA 4ECUA 3DMJA 3GV5B 2OPQA 1N6QB 3QIDA 4IOBA 3FRZA 3RBDA 2UVUA 4ECQA 1J5OA 4LQ3A 4DG1A 1JKHA 1LWFA 1QE1B 4K4TA 4NLRA 1JLFA 2RDIA 1S9FA 1C1BB 3QIPA 3PR5B 2UUWA 4ZHRB 3G6YA 1REVB 5J1EB 5KG6A 3MR5A 1EP4A 3I5CA 1HARA 5KFXA 4I2QB 4R0EA 1LWCB 5KG3A 3H4DA 1SV5A 3E01A 4RW6B 3LP2B 3CJ5A 4NLXA 4K4UA 3M9OB 4H4MB 3DRSA 3MEDA 2R2TA 3KK2B 2OPPB 2VG6A 1JX4A 4NLUA 1D1UA 2VG7A 3HKWA 1HNVB 2E9RX 2IAJB 4IDKA 3DM2B 4IH6A 2C2DA 4Q45A 2VG7B 1C0UA 3OL9A 4KO0B 3OL6A 1HMVA 2D3UA 3BGRA 3C6UB 3PJXA 4YQWA 4GC6A 4B3OB 3LP2A 5HROA 2JEGA 5C24A 4K4XA 3KK1B 3GQCA 1T3NA 1LWCA 3MECB 2ZD1A 3CVKA 1TKZB 4TLRA 3KK3A 4R5PA 4ED2A 1RTJB 4EEYA 1S48A 2B6AB 3PW0A 3H5YA 4MK7A 1S10A 1XR6A 1QUVA 2WONB 1RTDA 2WHOA 2R2RA 2IMWP 1TKXA 1T94A 3T5JA 3RAXA 3LP0B 1S49A 1RTHA 5C25A 1TKXB 2ASDA 4WZQA 2RF2A 1XR5A 4O3PA 2ZE2A 4K4VA 2WB4A 4LSLB 5C25B 2B6AA 3MFHA 1JLFB 2AX0A 3JYTA 1HQEB 5F8NA 1RA6A 4F4YA 1RYRA 4I7FA 2ILZA 4YP3A 3DRRB 4ED1A 3H4BA 2D41A 3KLGB 2ZKUA 3CJ2A 1T03A 4R5PB 2UVVA 4B3OA 2YNHB 4IRDA 1YVFA 4ECTA 3IRXA 4J9LA 3KLHA 5HP1B 4IRKA 4F4XA 5KG4A 5T14A 5DG7A 2HNDB 2E9TA 3OHBA 1GX5A 3V6KA 2BRLA 4IG3A 3V6DA 1TL3B 2AWZA 2O5DA 1TKTA 2E9ZA 3ITHB 2XC9A 4PQUA 1IKVB 5L1IA 3M9MB 3PVXA 4QWCA 5CYQB 4O3OA 3V6JA 2CJQA 4ZPAA 5KFNA 1IKYB 4Q8FA 3JSMB 3KK2A 2XGQA 3QZ8A 4K4ZA 3GIMA 4GC7A 4NLSA 1S1VB 3KHGA 2YKNA 4Y3CA 2YNFB 5C42B 5KFCA 3KHRA 3BREA 3MEGB 5EWEA 4URGA 4WFZA 4RNFA 4YR3A 1KHWA 3CJ0A 2R8IA 4O4RA 1BQNA 1R0AA 1NHUA 4XPEA 3MEEA 1LWEB 5I3UB 4H54A 2FVSA 3N6MA 4IG0B 4ZP8A 4ZP9A 4ZPCA 4ZVFA 2D7SA 3T5LA 4JV1A 3MEGA 1RTJA 2OPQB 5KFZA 2J6TA 2HNZA 2GIRA 3DI6B 4KV8B 1SH3A 5D3GB 3KK1A 4IQXA 3DOLB
chains in the Genus database with same CATH superfamily
1M5HA 1UEKA 3HT0A 3P49B 1CJVB 3HD2A 2DH9A 4IOAQ 2BX6A 4WFBQ 1UVNA 2YPYA 1RT3B 4ZMMA 1UVKA 4TKTA 2XY5A 1C1CA 2Q79A 3QYYA 2HWTA 1BC6A 5IT4A 2J7UA 2EBEA 3DOKB 4KHPF 4RW9B 4S0MA 3FNNA 3UDLA 4YR2A 1JLQA 5B0FA 4ILMA 3T5HA 4C9DA 4MFBA 1L3SA 3DLEA 2A0FB 3H40A 2HWIA 3MXHP 1UEVA 2GW8A 3L7OA 5GAEU 5IV4A 4ER8A 2G0JA 1PGZA 1GXUA 2W24A 3ZZRA 3GILA 3HP6A 3NNEA 3ILOA 1M1KT 3UDEA 3HVTA 1DQ8A 4O44A 5AE3A 1QM9A 4K59A 4ZCKA 2XSJA 3KTQA 3C14A 3JSYA 1QE1A 4TY9A 2Z2LA 3UQSA 2IM0A 2HURA 1BXNA 2ASYA 2HNYB 3N5FA 5L46A 3PHEA 7FD1A 4QWAA 4DL2A 1KOHA 5KFPA 2AJQA 1VS3A 2HFSA 1VISA 5L38A 4YMEA 4OHXA 4CTAB 2F63A 1U0HB 3QSIA 2DR6A 5LT5A 4CT9A 4E98A 5KFEA 2MQOA 2HPUA 1LNQA 1Y3JA 3BH7B 3L4BC 4QW8A 4TNOA 2LDIA 4KGXB 3ITHA 4CLFA 2OPSA 1RT3A 3I0SB 3NXZA 4FVMA 2GJIA 4DEZA 4BCAA 1NHVA 1UJ4A 4MIWA 4OYBA 3LP1A 2FY8A 3N4WA 2CPGA 1IM6A 2AP6A 1S1TA 3I87A 4GVBA 4L75A 4DV1F 1RKIA 1PBUA 4M5NA 1CBKA 4OX6A 4ECZA 1OY6A 2M8HA 2O67A 2UXBJ 2HQFA 1XMQJ 1B0VA 1Y5LB 2DT9A 4FF2A 1R8BA 2QL9B 4W90B 5ETMA 3ULHA 3T1YJ 2PFFB 3QT7A 2HKEA 2AKWB 4WTYA 3EXCX 2FLLA 2GHWA 1T95A 4AUKA 3ZZOA 5IXUA 2UVRA 2A1BA 4Y2MA 5ETKA 7FDRA 2DHSA 5I42A 2D3OR 1ZAVA 3DHXA 5C42A 2VASA 2XZWA 3SFUA 1IN0A 2KYXA 1OJ4A 2QGFB 5ETVA 5HVGA 3OTOJ 1RLDA 1M5PC 4LF5F 3G6XA 1S0NA 4HVZA 4ZP6A 2XMMA 3D0GE 4KSEB 1DFDA 2CJXB 4ME7E 2EEYA 5FIIA 1JLQB 5F8JA 2UXDJ 3PV8A 1JJHA 1OG7A 2DGWA 4ZLPA 4MH8A 5B7WA 5L1JA 2IA0A 1KFDA 2D9PA 3DOMB 3FEXB 2IVMA 3GSDA 1UA1A 4BS2A 2KVQE 4K4SA 3BKTA 4FP9A 4EU0A 1TK8A 2ALZA 2VPWB 4MYTA 1QVFR 3N6LA 1C4CA 2VQEJ 3IRXB 4P2XA 2MHEA 5DDRC 5K8OA 2MKIA 3CJ8A 5MLCV 3OTCA 5B0AA 1U1PA 3BR9A 4LSZB 3KNGA 3W64A 3H5SA 4V1Ak 3CCJS 3RW6A 2GVZB 1LXJA 3DLGA 2RDDA 1UUJA 2X1FA 3KG1A 4DL6A 3IR6B 3T9ZA 2HHSA 1FD2A 3Q2TC 4KC5A 2LDYA 1VC6A 1RAHB 4NLYA 4NLDA 5ETPA 2AW0A 4ELVA 4OX9J 5DLFA 2K8GA 2KHDA 3ET6B 2QLXA 3HHDA 3W62A 3PW2A 3MAAA 2DIUA 1YBAA 1YK9A 1FJGF 3SQOP 5J1NA 3HVWA 3NOCA 2E5LF 1CJKB 3ONQA 2JEIA 2VODA 3ICLA 4RWWA 1FDDA 4J9VA 4ZHRA 5CZXA 2MZQA 5FDLB 4CWBA 5HJYA 1HNXJ 1TU0B 3HVRA 4J90A 3FJ2A 3JTPA 4WXWA 2ADLA 4KT0C 2HRUA 4DU8A 2R7XA 1EHWA 1WHWA 4NA2A 4C3KA 3CCZA 1J5EF 2HFZA 4NYZA 2YKNB 3KK3B 1ZM3A 3SDEB 2RKIB 3P45B 4NXMJ 3BQ2A 3MM7A 3OVSA 3L7PA 4NLOA 4P7VA 1JIHA 2VG5B 1OYEA 5K8NA 1IXKA 2HNDA 2K2PA 4NWBA 3HF5A 5LJ5Y 5HROB 2CJYB 2VC1A 2Z58B 4BC7A 4PAAA 5AXMA 3R2DJ 2IY5B 1ZA2B 3KLHB 3K89A 1Q16A 4DR2J 3AX3A 4HH1A 2H3EB 4DDFA 2MGZB 1KSPA 3CCQS 3OR2A 5BR8J 3CCRS 3DRSB 1RT7A 3KHLA 2IVYA 2VUGA 2XS5A 4MYUA 3KLGA 1IR0A 5BYRA 2HQGA 3FEYB 2ZJRQ 1S1WB 4URSA 1IBMJ 3GR0A 4JI0F 4P2SA 2DKOB 2F9DA 2YXLA 3NGUA 4KHMA 3GPAA 1HPZB 4YUDA 1FJEB 3CULA 5A8RB 5ETRA 1TMMA 3F44A 1UKUA 3CIZA 3M8ZA 2HZVA 4RUBA 3ZZ0A 2RT3A 3UCUP 2AEFA 2YH1A 3R1HA 4I2PA 3EPIA 3CUNA 4TY8B 1U1RA 4B9VA 1FKOA 4PYAA 4H4KC 4A48A 2P9CA 4XAKA 3L95X 4FDFA 1RWKB 3AB4B 2X1BA 2NPFA 2J6UA 1HBOB 1X60A 2Y3YA 3I96A 4M5JA 1TFYA 3DXSX 3MUMP 1LXNA 2NCKL 3FCWA 2WVBA 4NASA 4KPYA 1N34J 2HHHJ 4A47A 2UV8A 2LQ5A 1PILA 3JQJA 1T8EA 3BN4A 1Q78A 4NEYA 3W65A 1KQGB 2EVZA 2RBFA 3FFIA 3NCQA 5CH7B 3O6QA 3W66A 2LEBA 2CNKB 2DR5A 2HYIB 2R8JA 3CD6S 2XSFA 2WTFA 2KOEA 1YKWA 3DXBA 1M1HA 1RBLA 2I5JA 3HI9A 1EZZB 1GMUA 2COLA 1Y3KA 2J9CA 3FKBA 4X65F 1N0VC 3DKDA 4FYWB 2MXYA 2PGCA 1OQ6A 1S1UB 1WKJA 2J9EA 1WEYA 2M3DA 3W2WB 1GTEA 1UPMB 2YKAA 1RA7A 4E0DA 1FJ7A 1Q8BA 5CYMA 2RD5C 4J9OA 1ROFA 5EX0A 3GV8B 1UFLA 3S7RA 5HBMB 2ZHOA 3MMAB 4ANDA 1SJ4P 1KTQA 1RHUB 1NJIT 1U6ZA 5D4NA 3I4PA 3QLHA 4F50A 4I68A 1AUDA 1ZS6A 1IRQA 2AYBA 1Q86T 2GO8A 2Z4PA 2KXFA 3KJFB 2GFFA 3D2WA 1DRZA 2HLTA 1SQFA 3CCTA 2W01A 5E3RA 1FFSB 1X4BA 1TL3A 3E8OA 2KI2A 2HFVA 2NZ4A 1S1TB 4N7TA 1D0EA 1C1CB 2BE9B 5J2MB 3CCVS 2AZ3A 2RUGA 1JLBB 3HHLA 3HM9A 1P6TA 4HYKA 3K8WA 1SIWA 3PHTA 3W7BA 3SFGA 3CMES 1FWPA 1FWLA 2BBEA 3G9CA 3UPFA 3EGNA 1X5TA 5HVFA 3ZC4A 3FT7A 4KH1B 2DB1A 3HHEA 5ETOA 2VJUA 3EGZA 1SV5B 1WD6A 4OZLA 4YR0A 2CG8A 1OWXA 3AWRA 3A3OB 5CQGA 1JB0C 3GE9A 1B64A 2N3LA 2ZOGA 5FDLA 4P73A 5HK4A 2L3MA 2DHHA 3NL0A 2PA8D 4PXEA 3PYGA 2XZ2A 1Q79A 4NLPA 3TZYA 5DQHA 3BPSP 3GONA 2DRBA 4U7CA 4OI2A 1Y0HA 3CJ3A 1M5VC 1RWPB 2MZSA 2OLWA 1N5VA 2K7KA 1RT5B 1X31C 2XTEA 3MTJA 5KFKA 3DU6A 4CLUA 2N4CA 3ADAC 5KFMA 4B9MA 2VPZB 2LKZA 4QW9A 2O66A 1W2IA 2HQIA 3BBCA 4FPRA 3M2RB 3SEOA 1N33J 3RRGA 5GAEI 1MYKA 1BWEA 4CDIA 4RW9A 1X5SA 4KHRA 1PKUA 2XG8A 4KFBB 2IM3A 2B8PA 4CP5A 2IC3B 1H7XA 3BZQA 4LJMA 3WX4A 1X4CA 2FJBB 1Y7PA 2H48B 3PW5A 2KJWA 2YKQA 1FEHA 1DTTA 3TJ9A 2ZVIA 3P96A 5DG8A 4G1IA 1JWWA 2OAUA 3F56A 4I1TA 3GIKA 3K5NA 3HHKA 1X4AA 4J5OA 3MAHA 3MF5A 1U24A 1ULRA 2KT2A 4ECWA 1DLOB 1U0SA 2BM0A 3KNAA 1FDBA 3M8PB 1HQUA 1FCAA 3MM9B 2CFXA 4DI6A 1ZYQA 2LA4A 1ZZFA 1R0CB 2BA9A 3B54A 2XMVA 2WOMB 1FD8A 2E5GA 2CRLA 1KWMA 3EM1A 1P9QC 3FSXA 1H2TZ 2EC2A 2CJBA 5I4MA 3OL7A 2ZDOA 3CJ4A 3LPYA 4HACA 2WVCA 2KKHA 4USIA 1A0OB 2KXNB 1VQ5S 1EKSA 1VFJA 2KH9A 2NQPA 1EQ0A 1K44A 2CQPA 2AEJA 3JQMA 4TXSA 3EPGA 2GZOA 4LF1A 4MMOA 5FD1A 2YWWA 4JI5F 1TP7A 2ZZMA 4KIAA 4L72B 2DR7A 1JXLA 2PT0A 2GIQA 1NHKL 2E5HA 2HG4A 5J2QA 5LOQA 3HJVA 2EFOA 3DRPA 4PWDB 2RIJA 3AOBA 3CDUA 1N88A 5K14B 1VQ9S 1GFWB 2YNHA 2WSEC 1RCXB 1P1TA 4F67A 4NCGA 2E1RA 2G0CA 3S8SA 3R2CJ 1CQMA 4JOUA 3EVWA 2LCWA 3CD5A 5KFSA 4J9RA 1EIYB 1DBDA 2V67A 5K8MA 2Z2YB 2Y9HA 3OSPA 2R4FA 1S1XB 1M0SA 2CQ2A 4FNIA 3CMQA 1S59A 2PN6A 4DV3J 1QTNB 2LEAA 4Y28C 3QO9B 4TQSA 2VL1A 2XSJB 2CPFA 3DYAA 1G1XA 1MU2B 1RISA 1UWBA 2WAQD 2MQPA 3J81j 2KT5A 5JVHQ 3RRKA 1CJTB 1NBEB 4P2FA 4TQRA 5IWAF 1BDTA 2W8LA 2DNPA 1VK8A 4RNHA 3VGUA 2R8HA 3VAGA 5AJ3F 4ELUA 2HW3A 1SH0A 3QO9A 2P9EA 2L08A 2ABYA 1LQ9A 2C1EB 3LW5C 4OYAA 5GAGU 5DGAA 1Q81T 2JWNA 2CKWA 1FDNA 3GCWP 3IR5B 4YB6A 4RNNA 3R5DA 3CEDA 3MCOA 1HW9A 2IDLA 2Y1JA 2FVQA 2VFTA 2XULA 3EGWB 3MECA 2N7CA 1S12A 1DZ5A 2V5HG 1C0UB 3TP2A 4ZPBA 2UU9F 3PO5A 5F8IA 4QJVA 3EZ5A 3TI0A 3HULA 4LF7F 1MMLA 2YNIB 1B3TA 2E1AA 1WEZA 2RRBA 4X84A 3IC1A 4ZVHA 2CJ9A 4DN0A 2ZZTA 1TVRB 4YDXA 4KRWA 2G1DA 2XI3A 2ZVSA 3RYLA 3OBIA 5F9NA 4QWEA 4J9PA 4ELTA 3QFHA 4C48A 4G3IA 4UY8T 4JV5F 2GJ2A 4F0HA 4DU7A 4OX8A 3TAMA 4LRAA 2UUBJ 4CTAA 3GV5B 2OPQA 1F9HA 3CGIA 4ES2A 1N6QB 2E29A 4P10A 2V94A 3WBZA 3T3FA 3QAUA 4FYXB 3NNCA 4LQ3A 4X62F 2H5JB 4K4TA 2LXIA 4G6VB 3HSDA 5HANA 3Q86A 4A8KA 1HNZF 2BM1A 2CPDA 8AT1B 2PA3A 4USWA 5CD4A 1XERA 3GFZA 1Q8IA 4NX9A 2MLZA 4QBUA 3G6YA 2FJVA 1Q4RA 3FUYA 5J1EB 1TK0A 2VFSA 1FTCA 1EP4A 1I94J 1UFKA 1HWKA 4OV6A 1HARA 5KG3A 1LWCB 2DEJA 1IVZA 4DXLA 2VKRA 4KY3A 3LP2B 2J76E 2M2BA 4H4MB 4OJ1A 2R2TA 1NKBA 1U1MA 4DV7J 4HEA9 3HKWA 2HVDA 2IAJB 1NPRA 5A8WA 3M32B 5DS7A 3TEHB 9ATCB 2VG7B 5CAAA 3OL9A 3ZFVA 2CVEA 3ELHA 2CG4A 1HMVA 2EK6A 2KDOA 3C6UB 3MM7B 5B0CA 2XO6A 5H9FK 2JZ5A 2C3MA 2OSRA 3QNWB 3NNHA 4OHWA 5B0BA 5HROA 4WWSA 4TVAB 3KK1B 1LWCA 2Y1LB 1GNKA 2VDIA 2ZD1A 4I6WA 3WX8A 2BMBA 3G71S 3KK3A 4CRJA 4R5PA 4NYPA 4JI8J 1FEEA 5HQLA 3KWMA 3H5YA 1S10A 2OEMA 1QUVA 4OLOA 1RTDA 3D4JA 4JI1J 2FPHX 2WHOA 4LF4J 1T94A 1OY9A 2Q3PA 2K29A 4PKDB 2PFDA 3RAXA 2K1OA 1RTHA 2IIHA 4LREA 5F3TA 5C25A 3C3LA 4YY3F 3PACA 1XR5A 1LK5A 1IQZA 4LSLB 5HQMA 1RADB 5HMXA 3WZ0A 1LFWA 3Q8YA 1HQEB 4F3OA 1V3ZA 2QLBB 4USVA 4I7FA 1X5PA 2ZOFA 3HFKA 1KKHA 4LFAJ 1L3UA 4FYDA 2XS2A 2D1CA 1WOSA 2NXCA 2Y0SD 4A8XA 4JYAJ 1NDCA 3KLGB 1AFIA 4DUZF 1NKEA 4R5PB 2UVVA 4F3MA 3O1LA 4B3OA 2BJ1A 2VV5A 5HVHA 2OTLS 1M5OC 2WBMA 1NLKL 3TW0A 2DNRA 2RHQB 4ZKAA 2UV8G 4IRKA 3I9V9 5KG4A 2ZH4A 2YX1A 2Q1LA 3D0HE 1GX5A 3VALA 2BRLA 3WC0A 3V6DA 1TL3B 4UOHA 1O51A 3TWZA 5D6GA 1TKTA 2E9ZA 4CIOA 3CCMS 3IBFB 1CS4A 1KR4A 2HQCA 5CYQB 2FZGB 3N79A 1UW4A 2CJQA 3V6JA 1FDAA 3O5TB 1RWMB 4K4ZA 1U4BA 4LFCJ 4Q2MA 5THWA 2YKNA 3W5YA 5C42B 3I6PA 4X64J 1YG0A 4CLZA 5F0WA 2B4VA 1HNWF 2NXJA 2G2OA 5D15A 1VDHA 2RILA 5E7OB 3TX8A 4RNFA 3CJ0A 2HS3A 4HT5A 1XWLA 4NI2B 1ZM2A 3M2VB 3BPDA 3MEEA 4H54A 2I9SA 4IG0B 4LUBA 3MUVP 4DV6J 3CD0A 3W2WA 8ATCB 1JMTA 1RTJA 2OPQB 1WSRA 2L9DA 4DV5J 1SL0A 2OTJS 3MAAB 1HI0P 4ANCA 2GIRA 4KV8B 4LBPA 4HL9A 2KRRA 2DYAA 4FXEA 2RU9A 2KKEA 3JSBA 3MM6B 1YJ7A 5HJXA 4JI7J 3A13A 3PKYA 1SC3B 1O0PA 2CIMA 3THTA 4DZDA 2J9DA 3OV7A 1SIWB 3BO2A 4IFVA 3GYXB 4Z37A 4RO0A 2N7YA 2GHPA 4C98A 1S77D 5B0EA 4D3GA 5MAOA 3NBPA 3R6GB 2DNHA 5GAHU 2AMCB 2KELA 4X66F 1UPPA 1PIEA 2E1PA 1NH8A 2YQ1A 1KS2A 1TL1A 1UZHA 2KZMA 3V5RA 1BQMA 2BKNA 2IJRA 4LQ9A 3BKUA 1TTHB 3MR7A 4LBHA 4CLPA 2W8KA 3DLHA 3RB3A 4XK8C 1QDUB 5EHHA 4FXVA 3W1YC 3ZZPA 3Q0AA 2VA3A 4H4OA 4CLKA 3OTBA 2GMJA 3M8SA 4KB7A 3PM9A 1BQXA 5ETSA 3LQVA 4F0KA 2QV6A 4J9NA 2FJAB 2ZITA 2QT7A 2V6AA 1ZA1B 1AUSL 2C3UA 2V8PA 2B9EA 2WRMA 2A2CA 2WW8A 1RE1B 3W9IA 4NCAA 2J7KA 4DX6A 2A6MA 1JNRB 4TN2A 2BACA 3IR7A 3DMJB 3W61A 4B08A 5K8PA 2NR0A 5JJBA 2DXDA 3I0RA 1RYSA 3AX2A 1TUVA 3EE3A 2AY0A 1D8ZA 4MKBA 5CZVA 5KOXA 1SKWA 3CWJA 4NXNJ 2EPIA 3PX4A 2I5JB 3PRVA 3OW2R 2LP4A 3UD3P 3OFFA 3I32A 2R7SA 1DTQB 4J9KA 1NK8A 2MKYA 2RSQA 5K14A 3RJMB 3V81B 1JLAA 4B3TF 3GJTB 3IP0A 4P75A 4CO2A 3MR3A 2HVEA 1HHSA 3FCVA 3AHPA 4RW4B 4WFAQ 1SB6A 1WWHA 3UWTA 1S9GA 2H3AA 1VBZA 3M2UA 4M5KA 2HNZB 1APSA 2BKOA 2BDPA 4I56A 4MT1A 2L41A 4Q7AA 2HHQA 4N76A 2HLUA 2XMUA 2MMYA 3HSZA 4F4WA 4K2JA 1DY3A 2DGOA 1SJFA 4Y2AA 1LEOA 2Z56B 2YVSA 4LSLA 1ZTTA 1HW8A 2HVHA 5IT9Y 4AD6A 3DDIA 2CA9A 3HZEA 4OZ3A 4DPTA 1Z2ZA 4DR3F 4RW7B 5A0YB 3Q89A 3J80Y 2BJ7A 5KFOA 3G4SS 2MYFA 4ECYA 1D3WA 2ZBCA 4C8NA 4CNYA 4WKYA 1GK8A 4BBYA 4WKRA 3ET6A 1KN6A 1IKYA 2K06A 1YJ9S 1SJRA 3JTNA 2YH0A 2JH3A 2JVOA 2BNZA 5ETLA 3PO4A 4PRFA 4DR6F 2KN4A 4DCPB 4A8YA 1NB7A 1BGXT 2WW4A 5DQGA 1LFPA 2FD2A 3TVKA 2E7VA 2HBRB 1X4GA 2DIVA 2VBYA 4DV6F 2MQMA 3W3SA 1TKTB 3SV3A 3C6UA 1OSDA 2WK4A 1UZDA 2XCAA 3NGDA 1SUQB 2DNLA 1OY8A 1RLCL 2GVDB 3KUEA 4FS1A 1KNZA 2LQ8A 4R8UB 1HNWJ 2HHTA 3Q8SB 2UUAJ 3GXQA 1LK7A 3BV8A 3RTVA 5K9FA 4ED8A 1T3OA 1VJWA 5AXKA 2B9XA 4I6AA 2FIUA 2EKNA 2JLEA 2Q66A 1NSAA 2EC0A 2IMOA 2P5VA 2Y0BB 1AT1B 4WK3A 2BQ3A 1YJTA 2PE8A 1RT1A 3ENAA 4ZJLA 1HBMA 5FLXU 2MSSA 5CABA 2JEJA 1FXRA 4FBUA 1RU1A 1FESA 3CCUS 4MJKA 2J5AA 2UUCF 2HHUA 3LWMA 6FDRA 1CJKA 4OZ1A 1U8SA 5HMYA 4I0WA 4WIIA 5GMEA 1UA0A 4C8KA 4IOCQ 3IG1B 4MTPA 2NZCA 1S76D 1XNRF 4DUZJ 2MPUA 3PFOA 1I51B 1P9YA 5C24B 2F4FA 1L5UA 1RTDB 3KLFB 4JYAF 5DO2A 4WK1A 4LVOP 1KLMB 4DL3A 3C6TB 1RUSA 5KFVA 4JI4J 4LFAF 1UWAA 1HWLA 2F9JA 1NNDA 3DLGB 1FRLA 1HKAA 1S9GB 1J27A 1SIZA 2DH7A 2B9WA 4L76A 2C2EA 3KLVA 1Q5YA 3HD1A 3Q8RB 5DQIA 4URQU 3AOCA 1VMBA 3QGHA 1HMVB 4RL1A 5DZ6A 3V81A 1N54B 2XZDB 4ICLA 5AT1B 5IM0A 1EX8A 4WCEQ 4K4YA 1IKXA 3QSYB 4B9NA 2EG1A 3PJWA 3R5CA 4GKJJ 1WI6A 5KFRA 4ED0A 1FVSA 2H1YA 4U6PA 2FGCA 1H73A 4YS2A 4WYWA 1NU4A 3IGNA 5L9XA 1NSKL 1DHMA 3VCDA 2IYIA 1REVA 3NAIA 2J8AA 4LRBA 4OI1A 4CM2A 2KG0A 1C2PA 5AXLA 1AB8A 3MEEB 4O3SA 1U6BA 2HEKA 3FMBA 4IUFA 4OI0A 2GGPB 1AW0A 2MZTA 3K5PA 3ZZTA 2NUUG 4O4GA 2H1OE 5EN1A 2GC8A 4AT1B 4L74A 4ZVOB 4PPDA 3SQGA 2H4YB 1OSCA 3QRQA 2JOQA 3MCSA 2ZKTA 4LBIA 5IC6B 1AA1B 1N5QA 4QIEA 4C97A 5IQQA 3BN7A 2CAXA 4P9SA 2ZJQQ 2DNQA 2Z30B 1SUQA 4RBUA 5D78A 1F5CA 1I94F 4KKOA 4Y6IA 3LA0A 3W60A 5KT6A 3FFIB 3VQSA 2M52A 1GEHA 2JVRA 3EZUA 1KEKA 5EGYA 5BYSA 3E51A 2N3OA 4LSNA 4X4RA 2V2QA 4PZVA 2ZH3A 4ED3A 5F8HA 4M5IA 4ICLB 2BJ3A 4C0OC 1E6YB 1R27B 5IM0B 3OHAA 2ZH7A 2OPPA 2AHOB 4DL5A 3P3DA 4X62J 1VQLS 2M8DB 2AJ2A 3C6TA 2M88A 3W5ZA 3KYLA 1UL3A 4DX5A 1NK0A 2V2ZA 1JLCB 4RW6A 1NSPA 3CDAA 3TA1A 2BQRA 3FCHA 3M6XA 2FVRA 3IG1A 2PEBA 1N56A 2UUBF 4B9TA 1SJ3P 4A8SA 4A8QA 5J2PB 3D54A 3KLFA 1XC9A 1WSVA 4F2SA 3HK2A 3SBMA 1VI7A 4V19X 1VC0A 1NK4A 3OFHA 3DLKA 4DPWA 1HBMB 3M2VA 4YDDB 3I56S 4O44B 1REGX 2J9DE 1AXQA 2OPRB 3H0PA 3R7NB 2BJDA 3I82A 4OI4A 5A8RA 3H5XA 4QU7A 1Z4UA 1Q8LA 3D67A 5E3AA 4X4VA 1MWQA 2ZD1B 3ZTPA 3CDWA 1MWYA 2V34A 4Q2LA 3MCNA 1HWIA 1S1WA 4LF4F 4WZMA 1UJ6A 3THVA 5C2CA 3M1VB 3T1AA 2J0WA 4F7VA 3PR4A 5AJ3J 3BGRB 2C28A 1S5ZA 5IWAJ 1VC5A 3N01A 4R8UA 3NCRA 4FPIA 4GO7X 2XLJA 4DPUA 5H9EK 4N8OA 2W2OP 1NUEA 4X4UA 2BANA 3I5AA 3KG4A 1SKUB 4IH5A 4UZCA 3D28A 2YQ3A 3GB0A 4ZPVR 3MZIA 4P74A 1RP5A 4EO8A 3GP9A 2ROEA 2W4PA 5B08A 3OJUA 4DV3F 2LU2A 4F02A 4Q44A 1NJWA 1V3RA 1SI9A 4JP8A 2KXHA 4W98A 3BQ0A 2VC0A 3MM8A 3OT9A 4WP9A 2WBRA 4PG4A 1O6XA 2HBYB 3UCGA 3ZTOA 4M95A 2DHGA 2LQ9A 2ZE2B 1U7LA 3TVZA 3I5BA 3CCLS 3LAMA 2J6SA 4ED5A 3SI8A 1MW7A 1YZ6A 3JXOA 4O23A 2Z57B 3ZO7A 4QPXA 4YB5A 1QAXA 4DZ6A 4CYUA 2CZVC 3IRWP 5KG0A 2KB2A 1N6QA 1X0PA 5J2PA 3GJSB 5CCLA 4JI5J 2V8VA 1U47A 4HV0A 2XCPA 3Q24A 1N5SA 4D8JA 2YKMB 4Q43A 3CC7S 4ILRA 1JLCA 4RBTA 1BDVA 3EVOA 3IO1A 5E3QA 5KFUA 2M9KA 1YWXA 4ZIVA 3TJAA 2C3PA 3M6WA 3UCZP 4OZ5A 3H98A 3H25A 4OYPA 2OUGA 4IG3B 1WI8A 1JLGB 1NZ8A 4LF8F 2U1AA 4LSNB 1VOMA 4RW4A 4CH7A 4ZLNA 4NL5A 4ERDA 2HHXA 1R43A 4LR7A 1RWXB 2E5IA 4DFKA 3Q23A 3NNAA 2YX7A 4ZVRB 3RU0A 3UDCA 2XQCA 2ZJPQ 4F4ZA 4H4MA 1XQIA 1HFEL 1XBWA 1K47A 1PC5A 3F0NA 2YWEA 3M1VA 3OTDA 2W4DA 2UZAA 5GMDA 5EWGA 2DGTA 4XPCA 5KFJA 4UZBA 3KDOA 4OX7A 5IFMA 4X4SA 4DF8A 2AGPA 1LW2A 1YIJS 4OJHA 4U96A 3BB5A 2LFVA 3FQLA 4RUAA 2J8SA 4C7QA 5SZTA 3BGUA 2CQ3A 2OHDA 1PJ6A 3ENVA 3MURP 4DX7A 3N0VA 1QAIA 2KFZA 3HVTB 3QIPB 5K20B 2KT3A 4LF8J 4G1QB 1JXVA 2K9IA 5BJRA 1GXLA 3KOAA 2BE7D 1NCLA 4H4OB 5KFTA 3AB2B 2FJWA 3EZOA 1ZZNA 4GVLA 1TAQA 1A9NB 3K57A 2R8GA 1KFSA 1GMWA 1N33F 1YDLA 1D9FA 5F9LA 1R8PA 4LRVA 1C0TA 2XHCA 1S1UA 1U09A 2XHWA 3D7SB 3TJ8A 2XEXA 1VHFA 2MJNA 3DOKA 1U6FA 2V4RA 2QSWA 3D1QA 4NLQA 4RW8A 3BEGB 2XNQA 2WVDA 3OFGA 5KG2A 3OSNA 3L09A 1IWAA 1B0TA 3NBPB 1DARA 2CQ1A 4NRUA 1JLGA 1LWXA 5DJBA 4ZS6A 5F0UA 1FNXH 3RB6A 1NK7A 1FRHA 8RUCA 1Z1ZA 3DRPB 3W63A 3C15B 4EFAC 5KFBA 2PSZA 2FJXA 1FX4A 2WB1D 2W7OA 2POKA 3UW1A 5KFYA 2QFIA 2B5JA 4L3KA 3PDNA 1QD1A 4L73A 2XY6A 4TYBA 3K17A 4CLYA 1FK9A 1KVKA 5IQ6A 2EW9A 3HHNB 2EKYA 1T02A 4I2QA 1H3DA 3Q8QB 3HX9A 1FKOB 2HRYA 1S4FA 3MMCA 1U26A 1Q7YT 4M5MA 4C8OA 5GAGI 4NA3A 4Z7YA 1CJTA 2ZNZA 1T05B 2ZUAA 4O4GB 4DL7A 2RF2B 2M70A 3TEGA 4WPAA 4RJVA 2NS1B 5CHCB 2FHKA 5KT3A 2FLNA 4CO4A 2IYGA 3GIIA 1BWVA 2W9AA 3S1TA 2K5JA 2LU1A 4ZOSA 1RGVA 4PXBA 3THPA 1TV6A 2V4QA 1RBOB 4WF9Q 3R1LA 1RT6A 4CLLA 4IR9A 1S97A 1S0MA 1BMQB 3C2PA 3MEKA 2I8EA 4K5RA 2HGMA 3GFHA 3OXGA 1BQMB 1CS4B 3G87A 5DLGA 3H2UB 2MTLA 1NLAA 4DUTA 4AL5A 3CIMA 1VLOA 1YRTA 1WDDA 1S57A 2HRTA 2QL5B 1ZAWA 2RB7A 1I6JA 1NPPA 3OTEA 4ID8A 2BKPA 2VICA 4WE1A 4K0KJ 3IWLA 3CJKB 3TUZC 1XMBA 4DCOB 4PWUA 3BSCA 5KFAA 5KFGA 3GFXA 4X65J 1SQEA 2HGNA 2XNRA 3QIDA 2WSCC 2HS0A 2FDNA 3FRZA 3FZ2A 4IOBA 4ECQA 3QJPA 4DG1A 3MUTP 1A7GE 4NLRA 1MNTA 2RDIA 2X3GA 5BXIA 4TU8A 2DK2A 4ES3A 1S9FA 1VQ8S 4XTTA 2DGUA 2HFNA 2YY3A 2CQ0A 2VBWA 4ZHRB 4RX6A 4MKYA 5C2GA 4QU6A 1BD6A 2XM3A 2P6TA 1UP1A 3T6JA 3H4DA 2B51A 1UCNA 2VF3A 4UOFA 3B78A 1SV5A 3GZ7A 3PRBA 3TZWA 1IWGA 2LXUA 4ALZA 2QN6B 3Q8VA 5D8HB 5DM7Q 3CJ5A 5E0OA 4K4UA 1EA4A 1S79A 1T9XA 3DRSA 1U1QA 2SXLA 2VG6A 3M2UB 4DF4A 4X4NA 4YB7A 4NLUA 1NRKA 5IOLA 3ETMA 2CQCA 2VG7A 3DHWC 1HNVB 2IBOA 2VKZG 3R9LA 3JAMY 1MSWD 1WG1A 3DM2B 4IH6A 1YX2A 2IRUA 2OD4A 4Q45A 3DLLQ 3NMRA 1S99A 1C0UA 5HQ8A 3DGPA 2MZ1A 3OL6A 2B7BB 2ATCB 2C2MB 1O8BA 2D3UA 2HK2A 1FNOA 3BGRA 3OFEA 4QQBA 3LP2A 4DSEA 2QMXA 2ZH2A 3IFEA 3GQCA 2FTRA 4J9UE 2FB0A 3CCSS 2L48A 4K2XA 4ED2A 3GWCA 5BR8F 3G8TA 2DXFA 1X9WA 3MMAA 4TU7A 2WONB 1D8YA 2D68A 2CPHA 2ZWOA 4OZJA 4C2MA 5E3PA 2Q2KA 2WZ1A 3T5JA 4V19J 1Q82T 4K0KF 4UT4A 2HVIA 1TKXB 1TMJA 4WZQA 3PX6A 2RF2A 2YTCA 3QWPA 4PCQA 4O3PA 4A8OA 3TUJC 1M5KC 5C25B 2DRDA 2OELA 3R5BA 2AX0A 2MY8A 3PG9A 2GQQA 3MFHA 4M5DB 5F8NA 3AXKA 2HHWA 2FJDB 4F4YA 2XMAA 4NXMF 4DQIA 3FRYA 2ILZA 4BHQA 4OHZA 2K6LA 3J7Z5 3TVYA 3H4BA 1NSQA 4ED1A 1J5EJ 1NEEA 4JI4F 1Y00A 2ZKUA 1F0XA 3AY0A 2ZUGA 3DNCA 2VDHA 4NOHA 3CJTA 5B0GA 1NDKA 5E5NA 5GADI 4ILLA 4ECTA 3LGHA 1HD0A 1MN7A 2HAFA 1XJWB 4J9LA 5GAHI 1HNXF 2AD9A 4OYXA 3R7BB 2UUCJ 3V6KA 2E5LJ 4ZDNA 2ERRA 1IR1A 2O5DA 4KH0B 1VQNS 3ITHB 3M32A 4OZ0A 4F4AA 1X9SA 1FJGJ 2VU5A 3D66A 4OX9F 5L1IA 2RQMA 4RR5A 4QWCA 4EGLA 4FVCA 1SL2A 3FBEA 4C8ZA 1N32F 2BW2A 1OIAA 3JSMB 3GIMA 4B9UA 5A6WA 4NLSA 4HACB 3KHGA 1PG5B 2W7AA 3KHRA 2C2NA 2UUAF 3BREA 2JSXA 3EVMA 3MEGB 5EWEA 4M5HA 4WFZA 3O2IA 4YR3A 1KHWA 1A6LA 1BY9A 1RSCA 1BQNA 2CQIA 2YWFA 4JBCA 2HZAA 5JVGQ 1R0AA 2FVSA 3N6MA 3SMZA 2KG1A 4ZVFA 2D7SA 1SL1A 2O01C 1M1GA 2H9ZA 3MEGA 3GLJA 1KVIA 2J6TA 2QO3A 2ZBQA 1WEXA 5K5MA 3CSKA 5IV3A 3DI6B 5D3GB 2X3DA 4IQXA 2E5JA 1F5AA 3DOLB 4BC9A 4XIUA 4OI3A 2ADBA 1N5YA 4QR2A 3HFVA 3CF5Q 2X7IA 4LF5J 3OTOF 3FSIA 4DR6J 1Q16B 1XK8A 2QX0A 3NCPA 4OQJA 5KG7A 4FYVB 4ENOA 4CO5A 5I3QA 4DR7F 4DR3J 3F41A 3LP1B 1RTZA 4Y0FA 2KO1A 1AYEA 4KGVB 1KQFB 1R0BG 1HD1A 1NH7A 3ILJA 1GAOA 3LPEA 4UUWA 5HATA 1QSLA 1CJVA 1TUGB 3QT6A 1F2HA 2K1RA 1MLAA 2GS8A 3SCKE 4DOZA 1H38A 3QJLA 2I38A 2R7TA 2C2RA 4P52A 3PYFA 1XMQF 3HLUA 1ICEB 1VRTB 3W9HA 2F1FA 1RHQB 2ZZNA 4OZ2A 3N6NA 4Y00A 4MIBA 1G7CB 3R6LB 4RW7A 5A0YA 3ENQA 2PO4A 2EFQA 3IS9B 5D77A 5IT0A 3M6UA 5A2QY 1RDRA 2V4JA 2J0QD 4P2MA 2W9CA 4TU9A 2H51B 4B3TJ 2MKCA 1XTZA 4ZN1A 4Y2CA 3MM8B 5KFIA 3ZNUA 3MM9A 4DCJB 4ZPDA 1VRTA 3TR5A 2IRYA 2A18A 2RAQA 2OH2A 2DPJA 3KJVA 4W92B 2R7VA 1X4FA 3MD3A 3VAIA 4NXNF 2OGUA 2PIIA 2K1RB 4PXDA 4DL4A 3ISNC 5D0EA 3TA2A 3ZXWA 2GVZA 3UI3A 3D3BJ 4OLPA 3CD7A 2FY1A 4OL8A 2OMOA 1WC0A 1KONA 1OO0B 2CUYA 3AD7C 1H6KX 2IA6A 4Q8EA 3HJFA 4OFZA 2BANB 3H90A 3ISND 1DTQA 2VB6A 4CH0S 2V9WA 4C8YA 4YOEA 1CLFA 3DM2A 3KMSA 1JJCB 2IC3A 3KHHA 1FNMA 3T9NA 4DSJA 2CVIA 1T11A 1WORA 3GMGA 1RABB 1ARQA 4LRCA 5D0HA 2NYHA 5D3GA 1KQKA 5H1SV 2KTQA 3LH2S 2AEMA 3GG0A 3IBWA 3MPUB 2GX8A 3RBZA 2RRAA 3H42A 3HZGA 1W25A 3UN5A 5HN0A 3NP5A 3MPDA 4WFNQ 3ETOA 5D0RA 4YN3B 5LM7E 1SKSA 1RBAA 1N52B 4ZITA 4E8UA 2K7JA 5CYMB 1FERA 4X66J 1W2BR 4KHPJ 2IM2A 3BSAA 3PJ9A 4PQAA 2ZFHA 3R8YA 2BEFA 3ISZA 4FZVA 5KG5A 3LP0A 1G6BA 5GADU 3BQ1A 2OO4A 3OUYB 1FKPA 2PMZD 3PIOQ 3U7JA 4LR8A 3TZXA 5LXYA 4USUA 3DLBA 4JI7F 2QZ8A 3NLCA 4HDHA 4B3SJ 3GR1A 2CDQA 3TAMB 4EYIB 2AYGA 4Y34A 2XYHB 4DV5F 2GNKA 2O3DA 1YRXA 2H65B 5HMWA 4A8FA 3VAKA 1HYSB 2LLZA 4DFPA 3M8QB 3VAJA 2MQQA 2BV3A 9RUBA 1ARRA 3C16A 2AU0A 4IDKB 1T03B 2V2VA 1MMDA 3DOMA 4ED4A 4X64F 3DI6A 3I0RB 1B99A 2GMLA 4LFCF 1Q8KA 3H7HB 5E33A 1SC4B 2BJ9A 2GCFA 3FQKA 1LKZA 1RHRB 1OQ3A 3I31A 4TY8A 2XO7A 3T1HJ 5SUHA 2EG2A 3NS7B 1UVIA 3QZ7A 3KLEA 4IQMA 4O3RA 3RUBL 3TNVA 5DDQC 2HNYA 4ATNA 5KT4A 2NREA 3CDEA 3A8EA 1HBNB 4B3RJ 3TUIC 2FHMA 4WU2A 4C11B 4M5LA 5HBMA 3BS9A 4N41A 2Y8WA 2Z8QA 3QRRA 5L1LA 3RR7A 1I1GA 3MMCB 1OPIA 2D69A 1UVMA 1SC1B 4UQTA 1WELA 4ZVQB 1B0PA 3KXDA 4CNZA 5C5JA 4NMXA 4OYMA 3RAMA 3QT5A 2RDJA 4AQYF 1BAZA 2KRBA 2DGXA 1TKZA 3BM7A 2XTDA 3FC9A 3U1LA 4DQSA 4QCLA 1EAYC 3CT9A 1CJUB 4IFYB 4Y2IA 3NGTA 4BLGA 2JFDA 3C19A 4DV4J 1WTBA 4YY3J 3R27A 1ZPWX 1W26A 4F3QA 3PYDA 3QOQA 2H5EA 3ENWA 2ZBIA 5LL6d 1KLNA 4FBTA 2XWYA 3SDEA 1WF0A 4WFXA 1ITPA 1HI1A 1X5OA 4J9MA 4JI1F 3X1LB 3NRBA 4RW8B 4EI2A 4F26A 2BYCA 2DPIA 1TL7A 4JI8F 3VGVA 4JI6J 3MMJA 2ACYA 4I7FB 2NLWA 1HBOA 3BSNA 1URRA 4PWWA 3BJYA 1F3FA 2RQKA 2AYMA 4ZCMA 2ZHAA 3TUPA 3J81Y 1YRUA 2K3IA 4NPOA 4DSFA 1B28A 2DO0A 5I3UA 4KE5A 1FJCA 1IM4A 4BWMA 3KKFA 4KAIA 1OHNA 5U47A 4F04B 2WONA 2JXHA 3HDSA 1D9DA 3AAWB 1MU2A 1M90T 2Z2MA 2GGPA 1T7PA 4DBQA 4DV7F 4B9LA 3VZHA 3LJPA 1X7VA 1JKHB 2OKQA 3MDFA 1BUXA 2FZCB 1QSSA 2P2CB 2QE5A 5CYQA 4FYYB 3U1MA 3VVTA 2L9NA 1WF2A 1X4HA 2UVWA 5DM6Q 3B8HA 4DQPA 4NMLA 2ATLA 1ZTWA 1RT4B 1OYDA 4MKAA 2CJAA 2HMIA 2DJWA 2G9OA 3NMAA 5AXNA 1OMSA 1R7IA 2VBZA 4DLEA 1YITS 1ELOA 3UR0A 1U1LA 4NRTA 2MKHA 3PY8A 2GHVC 1ZH5A 2EK1A 3LANA 2EFGA 1N4LA 1DQ9A 1VJQA 1HNZJ 1Y11A 4JI3F 5AE2A 2VG6B 1U1KA 4Z7CA 4IH7A 5JMNA 4ECXA 3D6MB 1GMVA 2DNZA 1ZOTA 2E66A 4ZLJA 1AZSB 1VIOA 3BGOP 4LF6F 3NY0A 2QYGA 3JS9A 4M63A 1VGYA 5L1KA 2F4VF 4NCBA 4R0JA 1YHQS 1EP4B 1RJJA 1Y5NB 1XN9A 4LMZA 4JV5J 2QL7B 1RHKB 5A76A 3MFIA 3RW7A 1R89A 2J7WA 1PARA 5KT2A 2KHCA 4H4KA 1NJXA 1T05A 3Q83A 1FKPB 4RNMA 3MR2A 1CG2A 3HMJG 2KL8A 5T41A 4F8RA 4RU9A 1BHNA 2BR0A 2B43A 1GX6A 1NXIA 1YQHA 2AJ0A 3IWXA 1RACB 5B0DA 2UU9J 1C1BA 4LF7J 2HS4A 3P8BB 2EI5A 3QMQA 1IKWA 1EETB 3OL8A 1TR0A 2KJVA 4DG1B 2B5JB 1CULA 1DLOA 4NI2A 2DISA 4CZCA 5EX3A 1TL7B 1K1SA 4ZPTR 1S9EB 2IFXA 1UAWA 3JTOA 1YJVA 4U7UD 3NS5A 1KBRA 3E2EA 3T19A 1MROB 4WYLA 3RB0A 4KO0A 1V5IB 3JQKA 3TANA 2MHNA 1S72S 4F2RA 2BUNA 1HI8A 1O5JA 2FC9A 1S6QA 1UTAA 3GJRB 4RBVA 4F36A 3J81U 4FF4A 2CAJA 1JLAB 3C8YA 5A6PA 3GU0A 4NE9C 4P72A 2E1CA 3L3CA 1U2FA 1VYAA 1WOPA 3M05A 4WTOB 4EYHB 1FX2A 4LR9A 4OJ3A 1VQ4S 3AD8C 2MQLA 4L3NA 2C22A 1VQPS 4Q5VA 3QGPA 5KT7A 1FVQA 1RT6B 4CO3A 4DPOA 2V8GA 4RU2A 1RU2A 5F3ZA 1P27B 5KTQA 4G1QA 2CPZA 1RT5A 3ILLA 3V4IB 2ZH8A 4UY85 2B4OA 2ZC4A 2HAIA 3RB4A 1UWBB 4NLVA 1V3SA 3CMAS 1P8GA 1TELA 2V0NA 3TOQA 3W8GA 5RUBA 1P94A 3S6EA 1LW0B 4ZVUB 2HBQB 2X1GA 2CQ4A 2VH7A 3IXQA 3ZTQA 2HK3A 2W9BA 5ETTA 3AOAA 3MTKA 4OIXA 2VONA 4USTA 3KFWX 5M2UA 3IN5A 3BGLA 2VFUA 2XB2D 4DLGA 4M8LA 2V1SA 4CLTA 1FK9B 3CE8A 3TQ1A 1WC3A 1FFWB 2BA3A 1JK9B 1GT8A 2CWKA 2F65A 2OEKA 4PWDA 3DRYA 4FS2A 4OYWA 2A3JA 4CT8A 3A3NB 2JXGA 3I4HX 4AXIA 4M1KA 2XYGB 1DQAA 2YKMA 2W7PA 1T9TA 3CO9A 1T9VA 1GTHA 2ILYA 1D09B 2ZWPA 3GFYA 1QJHA 3FGVA 5LSLA 1HLWA 4UF4A 5CCMA 1Q5VA 1XMOF 1EJ7L 1FF2A 3MPYA 3NKYA 1ZM4A 3RZAA 4FKXA 1TL4A 3FK4A 4LFBF 2C3YA 4M5DA 3DN9A 4OHYA 2NUHA 2PEHA 2QFJA 2Z2ZA 3N5BA 3RRHA 3D5MA 2AF6A 3A12A 4U67Q 4AE5A 4EUVA 2JC0A 2BQUA 1HPZA 3EGVA 4I64A 4M5GA 2FLOA 3CJQA 3CO0P 3WHIA 3M8PA 3M30A 4LVNP 1J5OB 4FF3A 2AJ1A 3WIVA 4EO6A 3K59A 2DBBA 2KVIA 2DVIA 2DXEA 4HHUA 3V4IA 3D6FB 3QATA 3VW4A 1WC5A 2G1HA 2JXIA 3OQ2A 4ID5B 1RAGB 2JDJA 1R6YA 3JSMA 3LALA 1AFJA 4ECSA 3J80U 4GRSA 4CH1A 1TUWA 4U8YA 3VAHA 4NLTA 6FD1A 4K8RA 5IT9U 2XMJA 1G2EA 3A8JA 4P71A 3NWGA 4QIVA 2R8KA 3M8QA 1QAJA 1J2VA 4YEAA 4NZ6A 2DNOA 4DL0C 4X4PA 2AGQA 2AJ4A 1S6QB 2JLFA 1GMWD 1VIXA 2YWGA 5GMKa 2YQ0A 3MHYA 2DCLA 2CYYA 5J2NB 3NO7A 1WF1A 4HR2A 4FF1A 3VQTA 1RWUA 2FYXA 1RAAB 4BWJA 3T41A 4DWIA 2DNKA 3GG1A 5EUHA 1U48A 4PEOA 3MGJA 5KFFA 4YB1P 2PI4A 3MD1A 3GCXP 2I1RA 4ZVPB 3IMQJ 4N47A 3VEAA 3OUYA 2ASJA 4FXDA 4QR0A 3C66A 2APOA 1U1NA 4OZNA 5ADZA 2LQJA 1WNEA 3O3LA 3TAPA 2YX4A 3MCMA 3MWBA 1KP6A 3ZNJ1 1QUPA 4KBIA 3BKFA 1LW0A 1S6OA 2FQQB 2CPJA 3ZZYA 3FBCA 3AD9C 1IUJA 2RU3A 3VF0B 2EFNA 1PAEX 1Q1KA 3LF0A 3G2XA 4F25A 3SV4A 2ZNYA 3D1OA 3W2VB 3BDEA 2GAHC 1IKVA 2FUG9 4ZP7A 3G96A 4I4BA 1UVLA 4NLWA 2BVZA 1G3OA 3P4UB 2AGOA 5J2MA 3NGKA 4TYAA 4DJBA 3CC2S 2OSQA 4MFBB 5A2QU 2GVDA 3UN2A 4PQUB 4WXOA 2AN7A 2IAJA 3H20A 1PCAA 1IQTA 3PEJA 3EYZA 3AJ1A 3NEKA 3TA0A 1HNIA 3QGGA 4HHHA 4C3MA 1RT2B 4WU3A 4IR1A 3PX0A 1EKRA 4LIWA 2W25A 5IZHA 3H5UA 3CCES 2RQ4A 4O0IA 1F6TA 1WHXA 2G2ZA 3K7RA 2RKIA 1VBXA 3P5BP 4ECUA 2NSCA 2B7CB 3QFWA 4KPCA 2DITA 3PFEA 3Q2SC 1FXLA 3UFCX 1T0TV 2FHJA 1UW9A 2XTCA 2UVUA 3UVJB 2CPEA 1NK6A 3KUHA 2M4MA 3M30B 4KGMA 4XDDA 5HSPA 4GMKA 1J5OA 2UP1A 2CJKA 1LWFA 3GTYX 5A8KA 2A2BA 2GAGC 3JB9k 2Y1IA 4F4KA 1C1BB 3DCAA 2UUWA 2P8IA 3N9UC 2KFNA 2FJEB 1REVB 1RAEB 1FRKA 2U2FA 1N34F 3PNIA 2DGSA 3MR5A 2CDRB 2JJ4D 4OHVA 2VBXA 3I5CA 3IA0A 3E01A 4RW6B 3H87C 1RKJA 3TO8A 3QAEA 4HI2A 3SSSA 4CO1A 4Z2XA 3M9OB 2CXEA 3MEDA 3IWNC 5DETA 2OPPB 1JX4A 2PDAA 4HTIA 4C0BA 3R5JB 1MWZA 2E9RX 1RHJB 2PI5A 1VQOS 2BJ8A 3LUYA 4DHVA 2C2DA 1R8HA 2ZHBA 3G82A 2DR8A 4PPZA 1WUUA 3PJXA 3O44A 4GC6A 4PG6A 4JI0J 2F40A 1F1BB 1CQNA 2DNNA 4E2FB 2RE1A 3MAQA 3ZZUA 4NA1A 1VQ7S 1IBMF 2F8HA 1MYLA 3CCWA 1L3KA 1N36J 3SQGB 1FXDA 1TKZB 4DR4F 1WG5A 2MZRA 1FHTA 4ZPWR 1RTJB 4EEYA 1S48A 2B6AB 3PW0A 1DAXA 1VHIA 4G1PA 2R2RA 1TKXA 4DR2F 3E3XA 1S49A 3DGVA 1VBYA 4USHA 2ASDA 3M8WA 4K4VA 4DSLA 2B6AA 2LEPA 1JLFB 2VPYB 4A4JA 4KJIA 2V2KA 2CNOB 1RYRA 3OD2A 4YP3A 4W4MA 3CW2C 2H5IB 3AFGA 3C16B 5IS2A 2BJEA 1T03A 1YJNS 3HT3A 2YNHB 4PG5A 4JV0A 1YVFA 2DNMA 4ETZA 2QJ3A 3NG8A 3J7AN 3KLHA 2B4UA 2ALYB 3HFZB 1YBTA 3SCIE 1Y4ZB 1VQ6S 4QIWD 5T14A 4EMDA 1PSDA 3AA9A 4R25A 2NYIA 1SJ1A 1LV5A 3D0IE 4IG3A 3VTIA 1Z2LA 1NAQA 2MB0B 3T6BA 2AWZA 1KQSR 3SSRA 1QSYA 1FRMA 2M5YA 4RUHA 2FGOA 1IKVB 3M8RA 1SPBP 5T7LA 4B02A 1KVJA 4I6YA 1PYOB 2PC6A 2HFUA 3GYGA 4O3OA 2OFHX 1IKYB 1BE4A 4Q8FA 3KK2A 2XGQA 3QZ8A 4GC7A 3QQCD 1S1VB 4ZN3A 4Y3CA 2YNFB 1S0VA 4EZ9A 4DX8H 3QJJA 4OI6A 4URGA 4ETXA 1VQMS 2DH8A 1QVGR 4WP3A 2D3O1 2DRAA 1Y9OA 2R8IA 4DR1F 4UTGA 2QYCA 5A8KB 1NHUA 2GV1A 2IRXA 1PC4A 1LWEB 3H2VE 3BBFA 2VQEF 1XNRJ 3VWSA 4ZP8A 1NDLA 4C3LA 1UEUA 4ZPCA 1TKDA 2ZC3A 5L9NA 2W2NP 1FE0A 1XNQJ 1RWNB 3V2UC 2XTJP 3VR1A 2CPIA 2QLWA 4OV1A 2HFOA 2N82B 2UXDF 3OVAA 1HIYA 3B4DA 4OJGA 1SH3A 3UVJA 4D3HA 3KK1A 2V69A 1YTYA 3RG6A 3UR3C 4FN5A 2MGZA 1WJ9A 2CQHA 5CXTA 1HNIB 3SYZA 3M7VA 2P6SA 3POTB 4MKVA 4KFBA 4JI2F 3LAKA 2AX1A 2O1PA 2ZH6A 2J0SD 4LF9F 2G0IA 2CQGA 2D3ZA 4L6V3 2Q6BA 3TQEA 5A8WB 3GSIA 2R2SA 5JUMA 4QYZJ 4OMFG 1UMJA 3HCXA 1UVJA 1MROA 3A8IA 3JSRA 5D4PA 4ZVEA 1X4EA 3T1YF 4DSIA 1B4SA 3IR7B 2YWKA 1SH2A 4USKA 1YZ7A 4C6AA 4J37A 5DDOC 3KJVB 1U02A 2UXBF 3AJ2A 5DGBA 2HSEB 3B4MA 2W4CA 2Z0GA 7AT1B 3ZTSA 4DV1J 2W9CB 5J1EA 4DR5J 1FRJA 2QSFA 2VFRA 3OR1A 3F73A 1NKCA 4CYUB 2XGPA 3IS9A 1LWEA 1XR7A 1Q53A 4IKAA 1RTHB 3KG0A 2IJNA 5HO4A 1PAUB 1IBKF 3HVAA 1VK3A 1VRQC 5LSRA 1T9WA 1VRUB 3A1YG 4O3NA 1PBAA 1U2RA 5I3PA 3J7ZT 2WVFA 3U1NA 4XO0A 2FC8A 3OPKA 4PG8A 2GIFA 4IO9Q 2MY7A 2XLKA 3M8YA 2HWHA 1RTIB 2VFVA 4EBEA 1RB0A 4AAIA 1URNA 4HT7A 1MNEA 2C2OB 1IR2A 4WE1B 3GIRA 5DZ7A 2OIHA 3C46A 2NSBA 1Q95G 2MKKA 3CPWR 1R8AA 4A8MP 4RPFA 2C2ZB 1IBKJ 3HHLB 3BO4A 2ZBRA 4U95A 2ZH9A 3PW4A 1HHQA 5CYJA 4EBDA 2D9OA 2F8EX 3M9NB 3T5KA 1U25A 4XDCA 3MOZA 4DR5F 4PUOB 2H4WB 2JNJA 2R42A 2ZDPA 3I55S 3Q8PB 3OJSA 2A10A 1RT4A 3EJMA 3GV7B 3G6ES 2R7WA 4JV2A 5ETQA 2XI2A 1TV6B 3TYTA 2V8HA 2F3JA 1ZM9A 3WQPA 3RGIA 2HHVA 4IG0A 3TAQA 4IRCA 1WKKA 2XMWA 2GMHA 1JLEB 3SSQA 4X4QA 3QLHB 4EWTA 4DQQA 1DJ0A 2FZKB 2OD6A 5I42B 3AT1B 4EBCA 5KFDA 2OPRA 4C8MA 3MI7X 4F0MA 2M7SA 5C7PA 4LF9J 2QLJB 3FBBA 1SC6A 1TQLA 1WC4A 4JI2J 2RH3A 2BZ2A 2HZCA 2LYVA 1OS5A 3OXLA 2V4JB 1F9EB 4JB8B 4JUZA 5H9EJ 5F8MA 4Y2KA 1U8WA 1S1XA 2FVPA 4MK8A 2QA4S 2BE2A 2YNFA 4KQZA 1TL1B 1HBUB 2QC3A 1FRIA 3LO3A 4O0NA 1NB2A 1TZ0A 3QGIA 2ROGA 1XNQF 3AXMA 3LOUA 4NCGB 5LMUJ 1YBUA 2Q6CA 3C15A 2CPYA 2R7QA 3RAQA 1IBLF 1HA1A 1NK9A 4CQ1A 3U02A 5F8GA 1B01A 2HVZA 3FMWA 4ZJQA 1E6YA 1VQKS 4DR1J 1X0FA 2B0GA 1PJ7A 4U8VA 2QEXS 2XS7A 1RAIB 2VA2A 1EB0A 5J2QB 3G5OA 1L3TA 5CA5A 2JHEA 3OLBA 3UNGC 4DMZA 4KV8A 1K0TA 4QPTA 2L9WA 4DPXA 5HMZA 2ZM6F 1TFWA 1N0UA 2JL9A 1KLMA 4NZ0A 2DY1A 2BE2B 4FNHA 3DOLA 3IAM9 2YKPA 4P7TA 2W9BB 2HHPA 3KLIA 2AJFE 2DNGA 4DUYF 4GKKF 1MMNA 4QYZK 2DEIA 3VZIA 2BNWA 2V9KA 3MPVA 2XY7A 3KMQA 1KTVA 2VOOA 3J7YI 2QMWA 1JXEA 1E6VA 4N8NA 3LGNA 4ZJOA 1QTGA 2NXNA 2W2MP 2A2DA 5E3CA 4PR6A 2HIYA 3Q8UA 4C11A 4B3MF 2QA4G 1U49A 1HQUB 4USMA 1CC7A 2RS2A 4HKQA 2GPEA 3EUNA 4QIFA 3FMTA 3RBXA 1KRPA 1VLYA 1HQ2A 3IBCB 4N77A 1T9UA 1S4EA 3V4MA 3FEZA 3PIPQ 4ZCIA 1XMOJ 5LJ3Y 1DTTB 3OR2B 2VQFF 1K1QA 5HLFA 4K5SA 3CC4S 2DHAA 1YI2S 4QWDA 2YPZA 1NK5A 2VG5A 5LXRA 1WTFA 4U7UK 5EDWA 4HDGA 2FVCA 3TX0A 1IJEB 1HYSA 3NGRA 2HQ3A 1CC8A 3EDRB 1G4CA 1HNVA 3K8VA 3FBFA 3M2RA 5E41A 5KT5A 3J7A1 4DS4A 4DR4J 3MEDB 4CI0B 3EX7B 4J7CA 2AYEA 2CZ9A 1IKWB 1EETA 1EQMA 1SBRA 1VQSA 2QIFA 3CJSA 3EDQB 1RHMB 4HTJA 4KR0B 5H9FJ 3W5XA 2MQ8A 4UOCA 3OLAA 3K5LA 3PZPA 2XMKA 3B82A 4DFMA 2MLXA 3UD4P 3DLKB 1K0VA 1NMEB 4I2PB 4OYZA 2ZEJA 4FKYA 2PD1A 2RS8A 3UE2A 1TAUA 2XLIA 4AL6A 3BF4A 3G6VA 1LWFB 1BLUA 1S1VA 1WOOA 1D9AA 2OMLA 5KOWA 1VBKA 2DD8S 3IAS9 5J1PA 4TLQA 5LMNF 2VIHA 3RR8A 1M5SA 4WP8A 1RZMA 4AFFA 1JLBA 4EK2A 3PYEA 1WC6A 2E7WA 1R3NA 1Q0NA 3DLJA 1B70B 1FE4A 3D6TB 5ETNA 4YHHF 3K5MA 1IBLJ 3P6YC 1CJUA 4IFYA 3US5A 2LMIA 4DV2F 1YSJA 3KDNA 3A4TA 3MM5B 5KAKA 1CPZA 1YGYA 3EWGA 2B56A 2QLFB 3G8SA 5D4OA 2YKOA 4AXJA 4MK9A 5HLFB 4I67A 2X1AA 1JJ2R 4CLWA 2MEWA 4ID5A 3AQOA 4GO5X 2EXUA 5G0RA 4DS5A 1K73T 2JEFA 2W2QP 1P1LA 2QA1A 3VGTA 1S6UA 2VHGA 4ZCLA 1HR0F 1B7FA 3IM8A 1UJ5A 2MJUA 1FTRA 1H72C 3DYAB 4QWBA 3K0JA 2ACMA 2G13A 1MG7A 3O8WA 4ZVSB 4RZRA 2WCXA 3AJDA 1N5YB 2YNGA 2EFPA 3MPWA 1JJ4A 4ZA1A 4LT6A 3G8QA 2AQ4A 3PEHA 4O3QA 4J9SA 3BR8A 4MIAA 1SCJB 3IGVA 2LXFA 2I2YA 2HHHF 3QWUA 1RXOB 2CADA 1H0HB 3HHLD 4X4TA 2XBPA 4N56A 3K5OA 4ITSA 2H54B 2R2UA 3KLIB 2UXCF 2R9LA 2B3TB 2BOAA 1GXTA 3QBCA 4GVBB 1TL5A 5KFLA 3TZZA 4ECVA 4DV0F 1S6PB 2QA2A 1IKXB 4HHJA 2ROPA 4OYOA 3QRPA 4NLGA 4KGKA 3M4XA 5J2NA 1FT8A 1GH8A 3FVYA 1X93A 2WSFC 4LIRA 1CEZA 2M0GB 3UO0A 1TVRA 2JFKA 4UW2A 1X4DA 4ZLLA 1WDTA 5E2QA 1RTIA 2FLPA 1C0TB 4X2BA 2KYZA 2W2PP 3R7SB 2C2KB 3K2YA 2OI2A 3UDVA 2RQCA 1Q7LB 3PTWA 3A8KA 4NEZA 2QRRA 3E01B 2DGQA 3H59A 2IDEA 4KYZA 3LWLA 1U0HA 2HQDA 1YJUA 4ECRA 2F5GA 1WC1A 1XIQA 3BBBA 2D74B 2LECA 2E44A 4MJWA 3UN3A 4RKUC 4J9QA 2IHR1 1RWVB 3I9ZA 1N48A 3DFEA 5AE1A 1N8RT 3SCJE 2EWHA 3VGSA 3AH6A 1RT1B 1BQNB 3B6BA 3HHLC 6AT1B 4N5SA 2A6OA 3MR6A 5JXSA 3HO1A 1CSJA 2DHXA 3EMTA 1PYSB 5M2RA 1K8AT 1NJYA 4C0HA 2QTWA 1HBNA 3BYPA 5KFQA 1JLEA 4M94A 2VZ9A 1LW2B 2W1BA 3RBEA 3KLEB 1H7WA 2R7RA 1WACA 4QIGA 4WFYA 4HH0A 1RT2A 1U2CA 2KU7A 2B9YA 4I69A 3P5TL 2BOPA 5FLXY 4Q0BA 1X9MA 3BO3A 1H2UX 3AQPA 2E7XA 4CLSA 4QR1A 4ZK7M 2QMUB 2CQDA 3L9ZA 1UFWA 1SJQA 4U9RA 4A46A 1FWKA 4IFVB 3V6HA 3GIJA 2OPSB 3I0SA 1N32J 4LFBJ 1S6PA 3PW7A 3HPOA 4GKJF 1S9EA 1NO8A 2MKJA 1H2VZ 2R3VA 1WHYA 1XEZA 2RNEA 3CJRA 2JBVA 4Y65A 2BRKA 5GVQA 1C4AA 3TRGA 4WIQA 5D4LA 1RCOB 2LQBA 3FDSA 3KUGA 4AYBD 4CO0A 4ED6A 1H98A 4DFJA 1RAJA 1HQEA 3NAHA 3D9BA 3HKZD 1FFGB 3WIUA 4ED7A 3UD5A 2MLYA 3PRDA 1FO1A 2VD3A 2WOMA 2R7UA 5F41A 3U27A 2YNGB 3BH6B 2OEJA 3KJQB 3C14B 1FA0A 1RQ0A 2C3OA 1CVJA 3R5AA 1R31A 5DRKA 2IM1A 2EBGA 3OR1B 2B8QA 3NGSA 2LVWA 1PJ5A 3ZZZA 2CWXA 1KHVA 2HBZB 1RT7B 3SZ2A 4K4WA 3VV2B 4DQRA 2YBVA 3G86A 4OYIA 1AZSA 3H2LA 5KFHA 3DLEB 4A8WA 3D68A 4DN9A 3W8PA 3FZBA 5EWFA 2F7VA 3VAFA 3BSOA 4LF2A 2ASLA 1L3VA 3DGPB 3AA8A 2JX2A 5F8LA 2UUTA 2MKSA 2NPIA 4K7QA 3V6DB 4X4OA 2GQ2A 1AROP 2V8DA 2ADCA 1NDPA 2CNLB 4NYOA 5HP1A 1N36F 4IO1A 1R6VA 2HMIB 3NS6A 2HIQA 1S0OA 3D6HB 3POTA 1U9PA 4ZVGA 5M2PA 3PCOB 5DG9A 1FKAF 1VCTA 2NXEA 3JYTB 2G4BA 4WBFA 4UOGA 5LSOA 4KTQA 2CNNB 3DC2A 4C8LA 4RNOA 3VHQA 3DRRA 4RLEA 5HAOA 1ZAXA 4RUCA 1UETA 3S01A 1MN9A 4USJC 2PMWA 1ZPVA 4ANEA 1R0AB 4PABA 1W7WA 1QAYA 5KG1A 1IJFB 3DDKA 3J7YU 2ZH1A 1E6VB 1KC8T 1VRUA 2DR9A 4PYDA 1FRXA 3CB4A 3N28A 1H74A 1Y10A 2CPXA 2DO4A 1VR6A 2VPXB 1SXLA 2BABA 3NOGA 1RAFB 4DV0J 2I0XA 4QYRA 2RJZA 1ZETA 3EICA 4ZVTB 2IBKA 5T7LB 3JAMU 3HSGA 1KDNA 4K50A 4C4WA 2UXCJ 5L8RC 4HI1A 2NXUA 2AZ1A 1JQGA 2N4DA 2Q43A 2I6WA 5CD4H 2X51A 3L7UA 3M6VA 2JC1A 1F5BA 3CXCR 1K9MT 1HWJA 3ZTRA 2BSQE 1SVDA 4J91A 2V1TA 1GQEA 2LA6A 2VOPA 1YJRA 4HLBA 1ZBTA 4AL7A 3PKMA 3GYNA 4Q0BB 4EZ6A 4KKOB 2V50A 4RWXA 2EFVA 1B7YB 2YNIA 2KFYA 3BYRA 2BW7A 2ZH5A 1KD1T 3MM6A 3BGFA 1HR0J 3QPIA 1SQGA 2MDAA 4LRFA 4CCHA 4PUOA 4DR7J 2IJFA 1QY7A 2F4VJ 1HBUA 3DMJA 3DDNA 1V5VA 2MQNA 2ZBPA 1JNZB 1Y5IB 5HL7Q 5DDPC 2RRNA 4YFUA 3VVUA 4QOTA 4LF6J 2XMTA 5HI7A 3RBDA 2QG9B 2IVFB 2RHSB 1OM2A 3K58A 4DV2J 1JKHA 1QE1B 4JI3J 1JLFA 1RWOB 1YLXA 2AIRB 3D3CJ 3ILIA 3QIPA 1RK8A 4YHHJ 4UQGA 2DGVA 3PR5B 2RUSA 3BDPA 5KG6A 3EXYA 5FJ4A 2OFGX 5G0RB 4B17A 2KM8C 5KFXA 4I2QB 4R0EA 1KOOA 5LMNJ 3LGMA 2FHJD 3W9JA 4DPYA 2B4PA 1NM2A 2GJFA 5L39A 1FI4A 5BYQA 4NLXA 5IC4B 3X3UA 4DSKA 2ZOMA 1HHTP 3KK2B 2XYPB 3VEBA 1D1UA 2YWHA 3TARA 4IDKA 2AV5A 2VJVA 4PXCA 1RAOA 3VAMA 4KO0B 4KGZB 3HSJA 1LOUA 4YQWA 3G82B 1NPKA 4B3OB 2J0XA 3W2VA 3CDBA 1S7HA 4P6QA 4K4XA 5C24A 2JEGA 1T3NA 1QLNA 3MECB 1CULB 3CVKA 2DY9A 3D1HA 4TLRA 1PO6A 3DRXA 4JI6F 3R3TA 2OJ3A 2PMHA 3MMBB 3HXMA 1TK5A 4MK7A 2V68A 1XR6A 1DURA 3OXFA 2Y1RI 1F9FA 1F60B 3Q22A 2HGLA 3CNQP 3AODA 2IMWP 2P9GA 3IM9A 2E1MC 3LP0B 3PXGa 1S7IA 2BXJA 2CZ4A 2KZZA 1RI7A 2DNYA 2F8MA 4PG7A 3UNYA 1V9OA 2ZE2A 2FHOB 2WB4A 4DV4F 2CQBA 3JYTA 2VQFJ 1RA6A 4UUXA 2WVEA 1V6HA 1RWWB 3DRRB 4WJBA 1R8CA 2D41A 2JRSA 3CJKA 5ITHA 1U45A 1QTMA 1SKRA 4NZ7A 4AQYJ 2OP5A 3CJ2A 4QZVB 2V63A 2RMLA 3MM5A 1NZAA 4IYQA 2GO9A 4IRDA 2XWXA 3IRXA 2GA7A 5B09A 3AX5A 4B3MJ 4BDPA 3MOJB 3KJNB 1WG4A 4FXWA 2MZJA 5HP1B 3WDOA 1N5TA 2IPOB 4F4XA 3CTRA 5DG7A 2HNDB 2E9TA 1VQYA 1IBCB 2C42A 3SXLA 3OHBA 2Y8YA 4B3RF 1OPZA 2K3KA 3WC2A 4DUYJ 4GKKJ 2XC9A 5G4DA 1F3VA 1PYTA 4PQUA 2GQCA 3M9MB 1X8DA 1T9YA 3PVXA 4ZPAA 5KFNA 3T1HF 3LTOA 4B9SA 1HL6A 3FSYA 2MSTA 2ZM6J 2G2YA 5KFCA 3SIPB 2XZTB 2DTJA 4ES1A 3QT8A 2AT1B 1WKLA 2DCUB 1NJZA 1WHVA 1HWUA 2JLGA 4O4RA 3R5GA 4XPEA 3OVBA 5I3UB 3DU5A 5D0GA 1I5OB 1I3OB 3H8YA 2KM8B 4ZP9A 4ZIWA 4CM0A 5LMUF 2R7OA 3T5LA 1F2GA 1U1OA 4LRDA 4JV1A 3GJQB 1YJWS 3MMBA 2RVJA 3A3PB 5KFZA 3NWRA 1ACMB 3SCLE 4G65A 3R97A 1EARA 2HNZA 4B3SF 4MAKA 5KFWA
chains in the Genus database with same CATH topology
1M5HA 3P49B 4IOAQ 2DH9A 4WFBQ 1UVNA 1RT3B 4ZMMA 1UVKA 4TKTA 2XY5A 1C1CA 2Q79A 3QYYA 2HWTA 1BC6A 5IT4A 2J7UA 2EBEA 3DOKB 4KHPF 4RW9B 3FNNA 3UDLA 4YR2A 1JLQA 5B0FA 4ILMA 3T5HA 4C9DA 4MFBA 1L3SA 3DLEA 3H40A 2HWIA 3MXHP 1UEVA 2GW8A 3L7OA 5GAEU 1PGZA 1GXUA 2W24A 3ZZRA 3GILA 3HP6A 3NNEA 1M1KT 3HVTA 1DQ8A 4O44A 5AE3A 1QM9A 4K59A 4ZCKA 2XSJA 3KTQA 3JSYA 1QE1A 4TY9A 2Z2LA 3UQSA 2IM0A 2ASYA 2HNYB 3N5FA 3PHEA 7FD1A 4QWAA 4DL2A 1KOHA 5KFPA 2AJQA 1VS3A 5L38A 4YMEA 4OHXA 4CTAB 5LT5A 4CT9A 4E98A 5KFEA 2MQOA 2HPUA 1Y3JA 4QW8A 4TNOA 2LDIA 3ITHA 2OPSA 1RT3A 3I0SB 4DEZA 4FVMA 2GJIA 4BCAA 1NHVA 1UJ4A 4MIWA 3LP1A 3N4WA 2AP6A 1S1TA 3I87A 4DV1F 1RKIA 4OX6A 4ECZA 2M8HA 2O67A 1B0VA 1Y5LB 2DT9A 4FF2A 1R8BA 4W90B 3ULHA 2PFFB 4WTYA 3EXCX 2FLLA 2GHWA 1T95A 4AUKA 3ZZOA 5IXUA 2UVRA 2A1BA 4Y2MA 7FDRA 2DHSA 5I42A 2D3OR 1ZAVA 3DHXA 5C42A 2VASA 2XZWA 3SFUA 1IN0A 2KYXA 4LF5F 1M5PC 3G6XA 1S0NA 4HVZA 4ZP6A 2XMMA 3D0GE 4KSEB 1DFDA 5FIIA 1JLQB 5F8JA 3PV8A 1JJHA 1OG7A 2DGWA 4ZLPA 4MH8A 5B7WA 5L1JA 2IA0A 1KFDA 2D9PA 3FEXB 1UA1A 2IVMA 3GSDA 4BS2A 4EU0A 4K4SA 1TK8A 4FP9A 2ALZA 2VPWB 4MYTA 1QVFR 3N6LA 1C4CA 3IRXB 2MHEA 5DDRC 5K8OA 2MKIA 5MLCV 3OTCA 5B0AA 1U1PA 3BR9A 3KNGA 3H5SA 3CCJS 3RW6A 1LXJA 3DLGA 1UUJA 2X1FA 3KG1A 4DL6A 3IR6B 3T9ZA 2HHSA 1FD2A 3Q2TC 4KC5A 2LDYA 1VC6A 4NLDA 4NLYA 2AW0A 4ELVA 5DLFA 2K8GA 2KHDA 3PW2A 2QLXA 3HHDA 1FJGF 2DIUA 1YBAA 5J1NA