3BSNA

Norwalk virus polymerase bound to 5-nitrocytidine triphosphate and primer-template rna
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
484
structure length
479
Chain Sequence
KGTYCGAPILGPGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEPRGKPPKPSVLEAAKKTIINVLEQTIDPPDKWSFAQACASLDKTTSSGHPHHMRKNDCWNGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDLATMIRCARAFGGLMDELKTHCVTLPIRVGMNMNEDGPIIFERHSRYRYHYDADYSRWDSTQQRAVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCTSQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLKEYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGPNHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELDFYVPRQEPMFRWMRFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA dependent RNA polymerase
publication title Structural insights into mechanisms of catalysis and inhibition in norwalk virus polymerase.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Transferase/rna
total genus 148
structure length 479
sequence length 484
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2007-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.100 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Arc Repressor Mutant 3bsnA02
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 3bsnA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3bsnA03
1TP7A 4NZ0A 3IS9A 4Q43A 5C25B 3NBPA 1TKXB 3LP2A 4XPCA 4MK9A 4R8UB 3MR3A 1S49A 3CJ4A 1JLGB 3BQ0A 2C22A 1QAJA 3ICLA 5L1KA 1NHVA 1TKZB 1RTJB 1I6JA 4QWBA 5KT6A 4K4ZA 2UUWA 3BSOA 1RDRA 4RW4A 3UDLA 3D5MA 3V6HA 3PW7A 4NLVA 3EZUA 4F4WA 4EBDA 1EP4A 4IFVA 3LAKA 4H4OB 3MR2A 5DGBA 4Y2CA 2OPSB 3H59A 3DRSA 5KFLA 3MEDB 2I5JA 3KOAA 1HNIB 1K1QA 4U7CA 3LAMA 4TLRA 4O3PA 5C5JA 2D7SA 4GC7A 3T5JA 3DDKA 1JLQA 5J2NA 2ILZA 3NKYA 2HWIA 3MEEA 5KFHA 3DI6B 3KK2A 1IM4A 4KSEB 4RW7A 4ZHRA 4RNOA 4Q0BB 2JC0A 3T19A 1RT3A 4LQ3A 2HAIA 3RAXA 2V0NA 4K4YA 1W25A 4WXWA 5KG6A 4Q8EA 2OPPB 5FDLA 5J2QA 3QIDA 5JUMA 2R8GA 5KFYA 2R8HA 4WE1B 4H4MB 2B5JA 4WYWA 3TAMB 3CJ5A 2UUTA 3MFIA 3GIKA 2W7OA 2ASDA 2E9TA 4RUCA 3BGRA 4Y3CA 3GILA 3CDUA 3UQSA 5JXSA 1UWBA 2R2RA 4ECZA 3IRXB 3BR9A 1RT6A 5J2PB 1LW0B 5HBMB 5K14A 1WNEA 2ATLA 1VRTA 3CWJA 5D3GB 4RW9B 3H2LA 4NLGA 3PW4A 3E51A 1FK9A 1TL1A 2B6AA 3PR4A 4EEYA 5KFKA 3N6NA 3NAIA 1FKPB 2R8JA 2EC0A 2FVQA 3DRPA 3GIIA 4I2QB 1GX5A 4M95A 4ED7A 1JLCB 3V81B 1SH0A 1QE1B 3OSNA 4FBTA 2UVVA 2F8EX 3M8QB 3DRRA 4FS1A 2QV6A 4J9SA 5J1EB 4KV8B 4KO0B 3NMAA 1RT7A 4XO0A 4IH5A 3HVWA 3KK3A 2J6SA 3H40A 1HNVB 4DL4A 1XR7A 3MEGB 1S1TB 4I2PB 1S1XA 3PJWA 2FJXA 1S1VA 3QLHA 4QW9A 4O4RA 1S9EB 3FFIA 4URQU 4F4YA 1VRUB 5C24A 2VA3A 4ECTA 2AGPA 4FS2A 4KKOA 1LWFB 2IJNA 2YKNA 3PVXA 3M9MB 5F8IA 3RBEA 3LP0B 1RAJA 4I7FB 3M9OB 1JLEA 5KFSA 4EYIB 1C0TA 3NBPB 5KG5A 1T94A 3LP2B 4RNHA 2W8LA 3PW0A 5HP1A 4JV0A 3RB6A 1RTDA 4IDKA 2IM2A 1SUQA 4O44B 2FLPA 4ID5A 3KJVA 1RYSA 3KHRA 2CKWA 3BJYA 1C1CA 4K4SA 3CJ0A 1BQNA 5CYQB 2VG6A 2YNFB 3KMQA 5KT2A 4NLTA 2IJFA 2BE2A 3KLHA 4K4XA 4K4WA 1S1UA 3IGNA 5KFCA 3UR0A 4MFBA 1ZTTA 3I0SA 4O3OA 3DRSB 4WYLA 4TXSA 2I5JB 3BQ1A 3I5AA 5KFJA 3DMJA 1S9GA 3GV7B 1JLAA 3ITHA 3KHGA 2W9CB 1EETA 2HWHA 2BQUA 5J2NB 3T1AA 4URSA 3KK2B 1RTHB 2HNYB 2OPQB 3MEEB 1IKWA 2RKIB 4EBCA 3PJXA 5KFDA 3KLIB 2XCPA 3MR5A 1QAIA 1RT3B 1RT4A 3KLEA 1S48A 4PUOA 2W9BA 1GX6A 5I42A 4NLDA 3G86A 4Q45A 3N6MA 3C6TB 1MU2B 3LANA 5L1IA 4ECWA 3V6KA 1HYSA 2BRKA 3G6YA 4XPEA 1REVA 3PHEA 3M8PA 2R2SA 3H5XA 1S6QA 5KG2A 3KHLA 5L1JA 1HMVA 3KLGA 2V4QA 5T14A 2IAJA 1T05B 1UWBB 2WTFA 4IRCA 4ZPDA 1RT6B 3CJ3A 2O5DA 2FVCA 4ECUA 4J9QA 2IM0A 2WOMA 4EBEA 5KFQA 4LSNA 3RB3A 4NRUA 1D1UA 4KB7A 2R2TA 4GC6A 3SI8A 3V4IA 2B6AB 1TL1B 2OPRB 4YR2A 1BQMA 2CJQA 1HPZA 4QWAA 4IG3A 3VQSA 4DL3A 4RNNA 5L1LA 1K1SA 1DTTA 3IGVA 2B43A 4IG0A 3DLKB 2YNIB 3IG1B 4DEZA 2HNDA 4DL7A 2ZE2B 1S6PB 2WONB 2WB4A 3DOKB 5HROA 4PQUA 4IFYA 2WRMA 3DRRB 3BSNA 2AX1A 4RUAA 4X2BA 1DTQA 2XGQA 4ZP8A 1RT7B 3FQLA 4QWDA 4QWEA 1KHVA 5I3UA 3C6UA 3I5CA 4ZVHA 5KFUA 5F9NA 1Z4UA 4EO8A 4YR0A 4NLRA 3Q8SB 1U09A 1JLBB 5F8JA 3FFIB 4ED0A 2JEJA 3EPIA 4O3QA 5KFBA 5DGAA 5J2MA 3MTKA 1T03B 4PWDA 1TVRB 3UPFA 3NGDA 4F4XA 4ECQA 3KMSA 2VG5A 5KFEA 1SV5A 3I5BA 1JXLA 2AWZA 1D0EA 1HQUA 3H5UA 4RNFA 1JLEB 3PW5A 1C0UA 4NLPA 3HVTA 5KFGA 1C0TB 4ED6A 4KAIA 1J5OA 2FVSA 4G1QA 4ECSA 5C42A 1RTDB 1NHUA 3JYTA 5KFXA 1C2PA 1SUQB 2UVWA 4RW8A 5HLFB 2W7PA 1S1WA 1C1CB 4ZP7A 1S4FA 4ZPCA 1BQNB 3CO9A 2BR0A 3MF5A 4Y34A 2BE2B 2XGPA 3JSMB 1RTIA 1S1UB 2FJVA 1HQEB 1RT1A 1RT2A 4ICLA 4RU9A 3H5YA 4ZPAA 1OS5A 1IKXB 3CDEA 4IH6A 3E01B 1S97A 2R8KA 4NLXA 2HMIA 1R0AA 1JLAB 5KFMA 4ED3A 1EETB 1N5YB 3DYAA 4RZRA 4TYAA 1IKWB 3FSIA 3OL6A 2YKMA 4LSLA 1LWEA 4KFBA 2JC1A 3H98A 1KHWA 4ZP6A 1KLMB 4FBUA 4MKAA 2VG7B 5CYMA 1JKHA 3I0RA 4NLWA 1TKTB 1C1BB 1YVFA 2ZD1B 4YQWA 2W9AA 4O3SA 3PW2A 1FKOB 4JV1A 2E9RX 3MR6A 4ED2A 1REVB 3M8PB 3QO9B 4M94A 5C25A 1SH3A 3MECA 4RW6A 3H4BA 2DPJA 3OL8A 3KK1B 4R8UA 2YNHB 4IRDA 4KBIA 4K4VA 4KE5A 1JX4A 3GQCA 3FQKA 1TL3B 5KG4A 2XCAA 3DLGB 4J9LA 2AX0A 2WOMB 2AQ4A 2BANB 4OL8A 2R8IA 1JIHA 2XWYA 3IS9B 1BQMB 4H4OA 4IG3B 4J9NA 4ED8A 3V6DA 2OPSA 2C2RA 4QW8A 4TY8A 3MEDA 1HNIA 3FRZA 1CSJA 4DL2A 3KLFA 5KT7A 4Q8FA 2IC3A 2JEIA 3DI6A 4RW4B 2ASLA 2WK4A 2IM3A 4JV2A 1EP4B 1NNDA 4IFVB 1T3NA 2WHOA 3T5LA 1DTQB 4DG1A 3OHAA 4F4ZA 4ECRA 3C6UB 2FLLA 4J9PA 4NCGA 1JLQB 5F9LA 1TQLA 3RB0A 4HKQA 3LALA 4H4MA 4WE1A 4RW7B 4U6PA 4ZHRB 3TQ1A 1QUVA 2W8KA 1HARA 4PWDB 4EO6A 3DOLA 3TVKA 4URGA 4MIBA 3IRXA 4TQRA 3CJ2A 1SV5B 5J2PA 4O4GA 3OL9A 1HQUB 5FDLB 2DPIA 5J2QB 1C0UB 1S0OA 3LP1A 4RW9A 1S9FA 1J5OB 4G1QB 2B5JB 5C42B 3CDWA 3BSCA 5KG3A 5DG8A 2RDJA 1FKPA 4TYBA 3BGRB 4RW8B 1IKYA 3PR5B 4KHMA 1S1WB 2HNZA 1DLOA 5EWFA 1N48A 4IRKA 1JLFA 1SH2A 5K14B 5DQIA 4J9RA 1VRTB 1JLCA 2JLEA 4HYKA 2C2DA 3SFUA 1RTIB 1QE1A 3HHKA 4J9OA 3V81A 3OSPA 4ICLB 3M8QA 1FK9B 3CIZA 5J1EA 1TV6A 3GIMA 3H4DA 4ECVA 2E9ZA 2AU0A 2FVRA 3DRPB 4JUZA 1R0AB 3MFHA 5KFNA 2HMIB 2IBKA 2GIRA 5KFWA 1HNVA 3N6LA 5KT3A 4EYHB 2ALZA 2FLNA 1RA6A 4K4UA 3DYAB 4MIAA 4IOBA 4R5PA 2YKMB 3ISND 2IMWP 4ZMMA 4KFBB 1ZTWA 3KLVA 4WZQA 2D3ZA 5CYMB 3I0RB 3G6XA 2AGOA 2I1RA 4B3OA 2RF2A 3KK3B 1LWFA 3NL0A 2GC8A 4WFYA 3QIPA 5DLGA 1S1XB 4YR3A 1S1VB 2ZKUA 3MECB 3QLHB 4QPXA 4RW6B 3DM2A 4QWCA 2ASJA 2ILYA 5C24B 4O44A 3QGHA 4J9MA 1S10A 3BREA 4KKOB 4WFZA 4DL5A 3HKWA 3CVKA 4TN2A 3RAQA 4IR9A 2YKNB 5CYQA 2JEGA 2YNFA 2UVRA 5HP1B 4NLSA 2XC9A 1N6QA 4F50A 3ISNC 4NYZA 3D28A 4IDKB 3V6DB 1N4LA 4TY8B 3GYNA 4ID5B 5KFFA 3KJVB 4K4TA 4ZVGA 5KFOA 3KLFB 3QZ8A 2W9CA 3BQ2A 4IKAA 2IC3B 3GV8B 4WXOA 2VG6B 1RTHA 2HNYA 2OPQA 3BSAA 3QZ7A 4LQ9A 1LW2A 2RKIA 4Y2AA 3QYYA 3KLIA 3KLHB 4NLUA 4MFBB 4IR1A 1RA7A 3Q8PB 3I0SB 2BQRA 4WZMA 5KG0A 4DG1B 2OH2A 3C6TA 1MU2A 3OLBA 1RT5A 1S9GB 3DMJB 1ZETA 3ITHB 4MH8A 4R0EA 2YNGA 4NCGB 5L9XA 2IA6A 4DL6A 4ECXA 4PUOB 1RT4B 3KLEB 4WFXA 3HVAA 2W9BB 5F8NA 1XR6A 3DOLB 1T05A 5KG1A 4IQXA 3DLEA 4MK7A 5I42B 5DLFA 5DQHA 1RYRA 3G6VA 3NAHA 4ZPBA 4O4GB 1HYSB 2D41A 5F8HA 4O3RA 1IKVA 3GIJA 3LP1B 1LWCA 1S6QB 4KHRA 1HMVB 2V4RA 1TKXA 2OPRA 4O3NA 3KLGB 2IM1A 2IAJB 1IKYB 5KFVA 4NLYA 2HNZB 1DLOB 1S0NA 1JLFB 1JLGA 2YNIA 3DLKA 3IG1A 5F8MA 3RB4A 1TKZA 2V9WA 1RTJA 2ZE2A 1S6PA 2WONA 3DOKA 4LSNB 2XI2A 4K50A 3V4IB 1TV6B 1HPZB 3T5KA 3OL7A 3EPGA 1DTTB 4IG0B 5DQGA 3PZPA 2HNDB 4R5PB 5HROB 4TQSA 3Q8QB 4PQUB 4IFYB 5EWEA 1JLBA 3IN5A 4NLQA 4Q0BA 3KNAA 2GIQA 2QE5A 3V6JA 1T03A 1TVRA 2J6TA 2C28A 3GV5B 4B3OB 2RF2B 2BRLA 4H54A 5I3UB 2J6UA 3H5SA 3SFGA 2OPPA 2VA2A 3QIPB 5KFAA 3KHHA 3T5HA 2FVPA 3DM2B 3TAMA 4J9KA 3FDSA 5EWGA 2FJWA 4ZP9A 5J2MB 5KT5A 3OHBA 5HLFA 2VG5B 4RNMA 1LW0A 5DG9A 5HBMA 4MK8A 4Q44A 3JSMA 3HVTB 2D3UA 5KFPA 2JEFA 5D3GA 3Q8RB 4NLOA 1HQEA 3QGGA 1N6QB 4IH7A 4G3IA 5EDWA 3JYTB 2XI3A 1IKXA 3E01A 2R2UA 2RDIA 1N5YA 2AGQA 4I2QA 1XR5A 4YMEA 5F8LA 1LW2B 1S0MA 2C2EA 1RT1B 1RT2B 1KLMA 2WCXA 5KFZA 4MKBA 2VG7A 2BQ3A 1TKTA 2ZD1A 1C1BA 5KFRA 4KV8A 4KO0A 4TY9A 4YP3A 5DG7A 1RT5B 4I7FA 1FKOA 5EUHA 5KT4A 2YNGB 4ECYA 3QGIA 4ED1A 4ZVEA 2UVUA 3MEGA 1S1TA 3QO9A 4I2PA 1MMLA 4LSLB 1LWEB 1S9EA 3RBDA 3KK1A 1VRUA 2YNHA 3OLAA 3M9NB 1JKHB 3DLEB 5KFTA 1N56A 5KG7A 5KFIA 1TL3A 3DLGA 4ZVFA 5F8GA 2BANA 1IKVB 4NRTA 1LWCB 3LP0A
chains in the Genus database with same CATH superfamily
1NXIA 1X5OA 1RTJB 4DUYJ 2DRBA 1MMDA 3PW7A 3EZUA 3IAM9 1VR6A 3K5LA 2WSCC 2ZWPA 4Q0BB 2ZBIA 2XHCA 1HHTP 1W25A 4WXWA 4DSLA 1E6YA 2K06A 3D68A 2M0GB 2ASDA 3M32B 1XBWA 3BGRA 2JLFA 1YZ6A 4DV6J 3H2VE 3CJ8A 3GB0A 1FESA 5E3QA 1A9NB 1SXLA 1NO8A 1YG0A 4N56A 2MQOA 1HL6A 1P8GA 4C8OA 1GX5A 2E5GA 2H5IB 1UEKA 3R2CJ 3DKDA 4NYOA 3KTQA 1S1TB 3PJWA 1OQ3A 1S9EB 3ILJA 1RAGB 1NBEB 4CH7A 2CA9A 1ICEB 5K5MA 1CC7A 1LWFB 3PX4A 1T9XA 1ROFA 4OJ1A 3R1LA 3DC2A 1SUQA 3KJVA 2CKWA 3PEJA 3CJ0A 1X7VA 3V5RA 2YNFB 5MLCV 1I94J 1UJ5A 3IGNA 1SKRA 2GS8A 4O3OA 2DNQA 3I5AA 2NYHA 2ZVIA 1QLNA 2RQCA 1RTHB 3F0NA 4ZA1A 1FF2A 2E1AA 1IBLJ 4OYBA 1AT1B 5L1IA 5I4MA 3G6YA 4LFCF 2FHJD 5KG2A 3I96A 4U67Q 1V6HA 2RHSB 3W2VB 2Q79A 2MY8A 1Z2ZA 2IM0A 2B8PA 1UL3A 4QWAA 4WTYA 1VFJA 3O44A 1IWGA 4MIWA 3DOKB 5HROA 3FZ2A 2MY7A 3BEGB 4B9VA 2K7JA 5IT9Y 4M5IA 4LF8F 1JLBB 1CG2A 2BM1A 4F4XA 2HPUA 2APOA 2ZM6F 1OMSA 1C2PA 3CW2C 5ETTA 4UTGA 3P5BP 1S4FA 1S59A 4M8LA 2XNQA 2VFSA 3DRXA 1N5YB 3H0PA 4CLWA 1Y4ZB 1IKWB 2GA7A 1QD1A 4P52A 3L09A 3D9BA 2E9RX 4F2RA 1FX4A 2VQEF 2BXJA 4OI1A 1VJQA 2BANB 3IS9B 4CNYA 4B3SJ 4UY85 3OPKA 4X65F 4CLPA 2ROGA 3D1HA 3OFFA 2AY0A 1EP4B 2V9KA 1ACMB 2ZHAA 2FHJA 4B9SA 2M8DB 3DOLA 1X93A 1U1KA 4J9UE 1S0OA 3IP0A 1PG5B 5CCMA 2YKPA 3N5FA 2RDJA 5HK4A 2J9EA 4BS2A 2X1BA 4EMDA 2AN7A 3B8HA 3GIMA 2XB2D 1HWKA 4GKKJ 2DEIA 1N0VC 4AXJA 1XK8A 2YXLA 4C3LA 4B3OA 3T9ZA 4W98A 3CT9A 2W4CA 1C4AA 3G2XA 4RW6B 2P9GA 2UU9F 2ILYA 3M2UB 2DGOA 3RAQA 1MSWD 3M2RB 2ROEA 5A8WA 4NYZA 2CVIA 2ZH9A 3GG1A 1BDVA 4GRSA 3GV8B 3BQ2A 3I32A 4WZMA 5KG0A 2BOAA 4C6AA 2QRRA 3VF0B 4CM0A 2JL9A 1F2GA 2VPXB 4WFNQ 1JJCB 1Q53A 1IKYB 2CVEA 1WHXA 2BABA 1S0NA 1JLGA 3EUNA 2KFNA 4MT1A 2FHMA 2RQ4A 1WDTA 4R5PB 4PQUB 4UOFA 1OSDA 3OJSA 2VA2A 2FJWA 1D09B 3D66A 3T1HJ 5E5NA 1FRXA 4R25A 5CXTA 1T7PA 2DR6A 4PG4A 3QNWB 2RDIA 4HR2A 1S57A 3IWXA 2M8HA 1XMBA 2POKA 4YDDB 3BS9A 2AYBA 4ED1A 1U45A 2KOEA 2ALYB 3DLEB 2NPFA 2GO9A 1IKVB 5IWAF 1GMUA 2VUGA 4E98A 3TA2A 3LGMA 9RUBA 1MW7A 3CJ4A 2QEXS 1MYLA 3MM9A 4NLVA 3DDNA 4L6V3 4DQQA 2UUAF 3R5GA 2DRAA 3DI6B 1G7CB 2JC0A 4ED5A 1R7IA 2DCUB 4I4BA 4P72A 4DDFA 5J2QA 1SQFA 4M5KA 5KFYA 3I31A 2A2CA 3RR7A 1LW0B 1H74A 2VASA 4NLGA 4ZPVR 3PEHA 2R8JA 1DURA 2HQIA 3FBBA 3OFHA 3GIIA 1UVLA 1JLCB 2AF6A 5KAKA 5J1EB 3G4SS 3LQVA 3M6UA 4XO0A 3ZTPA 2PN6A 4ZVQB 4DL4A 3AOAA 4DUZF 3HSJA 4URQU 3AJDA 5G0RB 4JI6J 1W2BR 2ABYA 2M2BA 4RUBA 2KI2A 2VG6A 2FUG9 2JBVA 3MMAB 2K3IA 4WFAQ 2VONA 4C8LA 3ITHA 5D0HA 1CBKA 1NU4A 1VHFA 1RBAA 4NXMJ 4NLDA 4CYUB 1SJ3P 2F8MA 1VC0A 1Y5NB 2Z56B 1VQ4S 1REVA 2XMVA 1NK9A 4K0KJ 3OFEA 2O5DA 4AUKA 3RB3A 3FEYB 4NRUA 2XMKA 3V4IA 1KP6A 1WEYA 4HACB 5C2GA 1UFLA 1T9YA 4DV5J 3M6VA 3FEZA 1U0HA 4I56A 1WKLA 7FDRA 1DAXA 1RWOB 4QWDA 4ZS6A 1PILA 2HIQA 1D3WA 2K1RB 1FEEA 4QZVB 2XMTA 2RE1A 4O3QA 2P9CA 4F8RA 4YB5A 2AWZA 1S7IA 1HQUA 5A76A 4ECSA 3M1VB 2E5JA 2K6LA 3J81Y 1C1CB 3FMTA 1NHKL 2XGPA 1F2HA 2V2VA 3L7OA 4EWTA 2IHR1 1WF1A 2QL9B 4Y0FA 2MKKA 4A8QA 4DR5F 3TZXA 3SZ2A 2LXUA 3W5YA 1HBUB 3OL8A 3NEKA 3Q0AA 1NH7A 1HWUA 5E3RA 3I87A 2DY9A 3K58A 1VHIA 2C2RA 2Q66A 5KT7A 4CP5A 2ASLA 2FZCB 1M1KT 4DG1A 2GMHA 2KKHA 1OPZA 2CPJA 3EZOA 2W8KA 3M32A 3HFZB 3N9UC 5HMYA 4MIBA 4L76A 4WK3A 1R8CA 2H65B 5KG3A 4JI4F 1MWYA 5CH7B 1CS4A 1SH2A 2BJ1A 3M30B 5DM7Q 1HI8A 4ELUA 1YBTA 2C3PA 3SXLA 1NDLA 2N3LA 2G13A 1Q8KA 2RF2A 1LWFA 5DLGA 2EBGA 4YR3A 2ZBQA 3CC7S 2V68A 1AZSA 4DU8A 1S10A 5GVQA 3LF0A 4IR9A 2MQMA 4HDGA 2Y1IA 2YNFA 3GCWP 3EDRB 4IDKB 3V6DB 1KDNA 4LFAJ 2HYIB 3UCZP 1QJHA 1RTHA 3E8OA 5CQGA 3I4PA 1U9PA 1QY7A 5ETKA 3GP9A 1AUDA 3W2VA 1VQMS 4ZPBA 1FX2A 2VFTA 1UCNA 2HNZB 3G87A 3DOKA 1NUEA 2Q6BA 1P1TA 3SSSA 4ZKAA 3UCUP 1JLBA 2LEBA 2V1SA 1R3NA 1PO6A 1F0XA 2Y8YA 3TZZA 5FJ4A 2VG5B 3ZZRA 5DG9A 2VQFF 5KFPA 2LCWA 1N6QB 2LQ9A 1RAIB 1ZPVA 3FVYA 1N5YA 2AGQA 1WC5A 1ZOTA 2BM0A 3CJKA 3QSYB 1NK8A 1FWPA 1GQEA 2MJNA 2ZH1A 4ZCKA 3MUVP 3SCJE 4MKYA 2UVUA 3HULA 4C8MA 2PMZD 1R43A 1CC8A 4DR3J 1SL2A 2ZJQQ 2BANA 1OWXA 3IS9A 1T95A 1TZ0A 4A8YA 4L3KA 2ZZMA 3M2VB 2ZBCA 4P73A 2LDIA 1EP4A 1X4GA 3MR2A 4Y2CA 3DRSA 2Z57B 1FRLA 4LF2A 3MMBA 3POTB 3RAXA 2H5EA 1GEHA 2E7XA 2RDDA 2R8GA 3T3FA 3MURP 4MMOA 2ZVSA 2JLGA 3FCHA 2IFXA 4Y00A 1F3VA 2GVZB 3H2LA 2CQ0A 1TL1A 3O5TB 1FKPB 4WU2A 3CJRA 2FVQA 1FNOA 4CI0B 2CUYA 1FRMA 4J9SA 4V19J 1XWLA 2FIUA 3MM7B 1V5IB 4DSIA 2GIFA 2AKWB 3FUYA 1XR7A 2XLIA 2BX6A 2W2NP 2V4JB 4ED4A 1VRUB 3M2UA 1QVGR 3MD1A 5LXYA 4OIXA 3RBEA 4EYIB 3PW0A 1HWLA 3CXCR 5LMNF 5KT2A 4OX8A 2WVEA 1N32J 1M1GA 2NCKL 4JI0F 2WB1D 2ZWOA 3ISZA 2HWHA 4PABA 4CO2A 2W7AA 2EKYA 4ECWA 3VHQA 4DJBA 3PIOQ 2M7SA 2R2TA 4C2MA 4U8VA 1ZYQA 3DLKB 2J9DE 1EB0A 2WB4A 1IR1A 3F41A 4PQUA 1T11A 2AX1A 4ZVTB 3CCSS 1FTRA 2CNNB 2EK1A 3IRWP 3C6UA 3I5CA 5F9NA 4WPAA 4YR0A 4WJBA 5E3PA 2QGFB 5DGAA 1T03B 2QLWA 5KOWA 5GMEA 1D0EA 5H9EJ 1N36F 1C0TB 4XAKA 1S1WA 2UUBF 2VV5A 2DISA 2BE7D 2VU5A 3VALA 5C7PA 3C46A 2MGZB 1KLMB 1RHRB 2OUGA 2M52A 3GLJA 1YZ7A 1UEVA 4QYZJ 3KK1B 4USKA 2OJ3A 4J9LA 1Q95G 1QAXA 1PKUA 3GCXP 3EJMA 4ED8A 1WC0A 5H9FJ 3KLFA 3DI6A 5IOLA 4FZVA 1DTQB 3OT9A 4X4NA 1HI0P 1EX8A 2XMJA 2ERRA 4TQRA 1WJ9A 1SV5B 1W2IA 4NI2B 1WHVA 1J5OB 2B5JB 3OTCA 2J9DA 4RW8B 1JLCA 4IOAQ 2FGCA 2FLOA 1TV6A 5J1EA 1YSJA 2IBKA 3UD5A 1IBMJ 2GIRA 4Q2LA 3OVAA 1JB0C 2B4OA 4PG6A 5G0RA 4DX6A 1NH8A 1F9FA 4C0OC 3BO4A 2ZKUA 1VLYA 3HLUA 5DDPC 2E1PA 4X4UA 1LK5A 3MMAA 4TNOA 1U1MA 1QTMA 3SQOP 3ISNC 3G96A 4TY8B 4ZJQA 2DNKA 4K4TA 1FD2A 2RD5C 1SVDA 3B54A 2J7WA 2YPYA 2AIRB 4CYUA 2U1AA 2KKEA 1XNQF 2YNGA 3D6FB 3MCSA 1U4BA 4IQXA 1Z1ZA 5K8NA 1SQGA 1M90T 5BJRA 3LWMA 2LQJA 1R6VA 3KDNA 2B9YA 2D3O1 3ZZZA 4I68A 2NSBA 5B0DA 2KRRA 4MKVA 3O3LA 4KGMA 1BMQB 4HH1A 3EPGA 5D4PA 2VF3A 3UVJA 4DSJA 1CJKB 1VBYA 4MYUA 1TMJA 3DM2B 3M1VA 2HFNA 3AA9A 1NMEB 2QMXA 2JWNA 1FXRA 3QGGA 3JYTB 1FD8A 1YJUA 3NP5A 2X3DA 3VAGA 3C66A 1XR5A 1TMMA 1YI2S 1S72S 3KUGA 4AE5A 1NPKA 5KFZA 3Q2SC 4DV4F 5C2CA 3WX8A 1SPBP 3M9NB 3BYRA 3D1OA 2WVCA 4U96A 1PJ5A 1X4CA 1RDRA 3UDLA 2IRXA 4FF2A 1NM2A 2C2NA 4ZVPB 2OD4A 3AOCA 3TUZC 1F60B 3ZO7A 1UP1A 4OYWA 3VEAA 4QJVA 3NNCA 4PG5A 1PC4A 3TYTA 4RR5A 4WYWA 3M8ZA 4LBHA 1NK4A 2QG9B 1AFJA 3M30A 4X62J 2G1HA 2LMIA 1OJ4A 4FVMA 3NNAA 3UNGC 2KB2A 3UI3A 3VVUA 3T6JA 1KVIA 1QE1B 1CJTA 2COLA 1MROB 2M70A 4NCAA 5EX3A 4YHHJ 4F25A 4DUTA 4LRDA 4MYTA 1HNVB 3O6QA 5D15A 3GFXA 3THPA 3GXQA 2HHHF 3HI9A 4DV7J 5ETLA 3C16B 4JV0A 4IDKA 4OZLA 2HHVA 5HJXA 3RJMB 2UXCJ 3OXGA 1FJ7A 3I9V9 1URNA 4FXDA 2M88A 1SJ4P 1JLAA 5J2NB 2AHOB 1RT3B 4OHZA 1RABB 2ADLA 2PA3A 1T02A 1FDAA 4P75A 3ZTQA 3HDSA 3M8PA 2V4QA 1UWBB 2VDIA 5ETVA 4F2SA 1N33J 3FRYA 5FIIA 4YFUA 1M1HA 1KOHA 1RBOB 1UPPA 1Q7LB 2XZWA 3NGTA 4L75A 3AX5A 3FQLA 5D4NA 5AJ3J 2H48B 4JI7J 1FCAA 4DV1F 2KYXA 1F5AA 1KFDA 2VG5A 2QLBB 1S6OA 4R0JA 3PW5A 5L46A 1OG7A 3PYEA 2HBRB 2LA6A 3TO8A 2HFSA 2VL1A 1FJGF 3H5YA 4W90B 1IKXB 3CSKA 1S97A 2MXYA 3SIPB 1TAQA 1UVMA 3QOQA 2EEYA 4CIOA 2DIUA 1YJVA 2AYEA 2PI4A 4IRDA 2BJ7A 3GJTB 3M2VA 2FTRA 1BQMB 1IQZA 2G2ZA 2DITA 3EMTA 2F4VF 4DL2A 2VKZG 2BKNA 3G8SA 2WK4A 3POTA 4H4KA 5JJBA 4ILRA 2J0XA 4WCEQ 1OY8A 2N4CA 1TQLA 2WSFC 5D6GA 1H6KX 5BYRA 1TKDA 3OL9A 3ZXWA 4PKDB 1MNTA 4PXBA 1FKPA 2QSFA 4OX9F 5K14B 4JI2J 2PDAA 1FVQA 1RA6A 2JVRA 1YQHA 2HURA 3KFWX 1XERA 2HQ3A 2PO4A 4QYRA 5IT9U 1RKIA 1H98A 4TVAB 3MECB 2D3OR 2DXEA 1HR0F 2CQGA 2DNPA 3GONA 1E6VB 4DL5A 4K2XA 2B4VA 4YB1P 2CPFA 5IM0B 1HNWF 4B9LA 2XMUA 2YH1A 2GO8A 3Q8PB 4HTJA 3X3UA 1RBLA 4CLSA 4DR1F 4NCGB 1DBDA 2FQQB 3KLEB 2HFOA 3I56S 4FDFA 3W5XA 1VQNS 2F9JA 3LP1B 3TWZA 1Q5YA 4M63A 1OHNA 4XK8C 3DLKA 4UUWA 3U27A 3QMQA 4N8OA 2HNDB 3IN5A 1T03A 1FRIA 4IO9Q 5G4DA 3RZAA 3HKZD 6FD1A 4PWUA 5AXLA 3JQKA 1N5SA 4X64J 4LF1A 4WP3A 4M5GA 1LFWA 2D69A 3R7NB 4LVNP 1WOOA 1KLMA 2CAXA 4USTA 4KV8A 3EM1A 3EICA 5FLXY 3M8YA 3KK1A 2YQ0A 5KFTA 2Z58B 3BGFA 1LWCB 4NZ0A 5HO4A 1RHUB 2GAHC 4X66J 3ICLA 5L1KA 4QWBA 1IR2A 2YX4A 4EBDA 1UWAA 3LAKA 1XQIA 4DSFA 4ELTA 2I5JA 3KK2A 5KFHA 1FDNA 4OZJA 5DDQC 4DPYA 1RCXB 4DFMA 1P1LA 4FXWA 1IVZA 2OPPB 2IY5B 2CPDA 5JUMA 4NI2A 2DR5A 2NXUA 4DUZJ 2B5JA 2H3AA 4D3HA 3PCOB 4QQBA 5JXSA 5IFMA 1FFWB 4LSZB 2DHAA 4TU8A 5A8RB 3Q8UA 2W25A 3VCDA 2P9EA 4CNZA 2P2CB 2Z4PA 5A6WA 4NZ6A 3VR1A 1XMOJ 5DDRC 3KUEA 3UDEA 1RT7A 1N0UA 1XNRJ 4C8KA 3D6TB 1MYKA 4OI4A 4ZVOB 1S6UA 2E5LF 2HHXA 1WWHA 4LF4F 4QPTA 4ZITA 5F8IA 3JAMU 4I7FB 1X9MA 1JLEA 3GZ7A 2CZ4A 3OTBA 2FLPA 1RAFB 2XYHB 4DPXA 2CPEA 1WC1A 1ZM9A 1DFDA 2ZITA 1ZTTA 3BV8A 3P49B 4ZN3A 2W9CB 2BBEA 2IYGA 1S48A 4Y28C 4C0BA 2MB0B 1PJ7A 4PCQA 2C2MB 5IZHA 1JQGA 2CZVC 4OJHA 2NUHA 1H7WA 2OPRB 2KG1A 2HVHA 2IRYA 1K1SA 1NJZA 2EKNA 3SCKE 3DRRB 2NXJA 1CJKA 3L4BC 5CAAA 1KHVA 4FNIA 1Z4UA 2BE9B 2F8HA 4B3MJ 3TUIC 1KTVA 1TVRB 3K5PA 2ZNZA 3NLCA 5KFEA 2CJYB 3NMRA 2FVSA 5C42A 2HQGA 3JYTA 4CWBA 2UVWA 2LVWA 2KO1A 5LXRA 3L95X 3DLBA 2G0IA 2WAQD 1RCOB 3TVZA 4OLOA 5B0GA 3CIMA 3MPUB 3DYAA 2YKMA 5IS2A 4USHA 4MKAA 4YY3J 2OTJS 4WFBQ 4FF3A 3QPIA 2GJIA 3DGVA 3CCTA 3QJPA 1VC5A 2V1TA 4KBIA 1Z2LA 1EA4A 3JSYA 3ENVA 3UD3P 1GT8A 4FXVA 2ZJPQ 2FDNA 4WK1A 2WHOA 3T5LA 2MQ8A 1A6LA 4XDCA 3W7BA 2FLLA 4KJIA 3PKMA 1HHSA 4RW7B 1YRUA 1CQNA 4PEOA 1NJIT 4PPZA 3H42A 4X4QA 5D8HB 2HGLA 3CJTA 4Z37A 1HBNA 2RILA 4DR2J 4CZCA 3NNHA 2MLYA 2DH9A 1WG1A 4BCAA 4HYKA 1Y00A 2C2DA 1QE1A 3D0IE 4ICLB 1MROA 3QBCA 4B3TJ 3TOQA 1HNVA 4MIAA 4ZVSB 4H4KC 2YTCA 3M7VA 1PSDA 2I1RA 2PSZA 3NL0A 3QIPA 3MAQA 3IBCB 5T7LA 2O66A 2CQ2A 2W4PA 2HBZB 2HHWA 4EK2A 2DHXA 4DV3J 4ZIVA 2WVDA 3QZ8A 4IKAA 3QYYA 4OFZA 4MFBB 1M0SA 3OLBA 1B0TA 3DMJB 4PQAA 3FMBA 1QTNB 4DL6A 5J1PA 1ZH5A 4WFXA 4Y2IA 2ZFHA 2W9BB 4O3RA 1NPRA 1X0FA 3W65A 1R89A 1L3UA 1TKXA 2GJFA 2IAJB 5KFVA 4RBUA 2MKHA 3ULHA 2R7XA 3ZNUA 2L9DA 1DQAA 5IC4B 3CTRA 3HFVA 3GJSB 3NGKA 3VAJA 3D54A 3BH6B 4CO5A 4K59A 2IYIA 1KVKA 4QIFA 4KGZB 3TEHB 4HEA9 5DETA 1H7XA 1UMJA 1YGYA 1IKXA 3TAPA 4JI5J 3NOCA 1ULRA 5F8LA 1YJTA 3ENQA 4BLGA 2DR8A 4ZVUB 2KVIA 3M4XA 5K9FA 3MM6B 4OI0A 1VBXA 5E7OB 3R7BB 2F3JA 3R1HA 1VRQC 2R3VA 3LP0A 2V8PA 1TP7A 2RMLA 2VC0A 3RW6A 3VAHA 3K7RA 2YWFA 1D9AA 1UA1A 5KT6A 3WZ0A 2BOPA 1L3VA 1UEUA 3D5MA 3BKTA 3MEDB 4NCBA 3K2YA 1VK3A 4K4YA 3EDQB 1FKAF 2R8HA 1M5HA 3CC4S 2UUTA 2ZDOA 1Q7YT 5K14A 1WNEA 3PACA 2ATLA 1I3OB 5GAHI 2CIMA 3TNVA 5AE1A 3KG0A 1UVIA 3HHEA 4OX7A 4USIA 1NRKA 3K5NA 3HK2A 5CD4H 3MEGB 3FFIA 3VV2B 2UV8G 1S99A 2VZ9A 1IJEB 4USMA 1WG5A 1E6VA 2KZMA 1WOPA 1RXOB 2E5IA 2F40A 1VK8A 2W8LA 2XTDA 1K44A 4TU7A 3R7SB 4F36A 5IM0A 4JBCA 1LFPA 1QAYA 1KOOA 4NXNF 2VKRA 3MD3A 1UZHA 1FT8A 3IR7A 3IWNC 4P7TA 1EETA 2UZAA 2CDRB 1TK5A 1XIQA 3KLEA 2ZJRQ 4PG8A 4CT8A 3C6TB 3LANA 3KHLA 5B7WA 2DGUA 2FJDB 2EW9A 3WIVA 2Z30B 1N36J 5KFQA 4RWWA 2ZUAA 2DTJA 4KQZA 5L1LA 3AOBA 2DR7A 2MEWA 3HP6A 2DVIA 2HNDA 2R42A 2A2BA 1Y0HA 2RU3A 4X2BA 1RSCA 3KG1A 2K7KA 4ZVHA 5IXUA 3AY0A 3DRYA 2Y0SD 4Z2XA 4DR7J 3MM8B 2O01C 4LRCA 2V50A 2PGCA 3BDEA 2XS2A 5LSLA 4G1QA 1LOUA 1SUQB 3HZEA 2E7WA 1W7WA 2B51A 4ETXA 1RISA 1YIJS 2MKIA 3CDEA 2DGVA 4M5LA 1KD1T 4DBQA 5D78A 4TYAA 2HVDA 3HMJG 3FSIA 2LA4A 2ASYA 1R8AA 4KFBA 4NL5A 4NLWA 5AE2A 4ED2A 3K57A 2RT3A 1JX4A 3GQCA 3SDEB 4FPIA 2D9PA 2YWGA 3QWUA 3MCNA 4QW8A 4KY3A 2DY1A 4OZNA 4U9RA 1X4FA 2R7QA 2KVQE 2ZH4A 3QJLA 4QR0A 1R8HA 3MPVA 4NEZA 1FE4A 3TX0A 1WD6A 3R97A 1QUVA 4EO6A 3OBIA 3IR6B 2Q3PA 5A8RA 1S9FA 2VD3A 3OFGA 2XLKA 5AXMA 2IBOA 4J9OA 2H54B 3HJVA 2ZKTA 3MFHA 2F9DA 1AUSL 1YWXA 2IVFB 1Q0NA 1XC9A 2Y1JA 2KJVA 1S1VB 3QLHB 2VBWA 2ASJA 3MEKA 4QWCA 2B9EA 2MQQA 2ZZTA 3H2UB 4J9MA 2C3UA 3OTEA 3QAEA 2CNKB 2WVFA 2V2ZA 2B9XA 4DZ6A 2W9CA 4KTQA 4JI8J 4TU9A 2CQ3A 2DRDA 4GO5X 4HHJA 3DOLB 1BE4A 3NAHA 2A6MA 2AD9A 5F8HA 2B7CB 3PIPQ 2OPRA 1WHYA 4OI6A 2EG2A 4Q2MA 5LMUF 5LSOA 1DARA 2XI2A 5DQGA 5A6PA 4OJ3A 2YPZA 3FT7A 4NLQA 3KNAA 3TA0A 1TVRA 3UO0A 4B3OB 3SFGA 3FJ2A 5CABA 1VCTA 2HQFA 4FNHA 2FVPA 2ZH3A 3PX0A 5J2MB 1U47A 1IXKA 3QFWA 9ATCB 5GAEI 4Q44A 1JNRB 1U2CA 4YMEA 4BWMA 2OEKA 1OO0B 1RT2B 1D8YA 3LA0A 4MKBA 3SBMA 2E1CA 4A8KA 4F3OA 3EXYA 4LSLB 3KYLA 1JKHB 2CFXA 4Q43A 1SL1A 1LNQA 1JLGB 4CTAA 3UR3C 3I4HX 4J9VA 1UFWA 2CZ9A 1U7LA 3V6HA 5M2PA 2AJ1A 4C8YA 3J7ZT 1PIEA 3T5JA 3HD1A 1KS2A 4KSEB 4RW7A 3QATA 3R9LA 4Q8EA 1JMTA 3ETMA 1F9HA 2H51B 3OVSA 2MKCA 4YN3B 1LWXA 2C3MA 1FTCA 3MTJA 5J2PB 3J80U 3W61A 2HSEB 4RW9B 4JI1J 2L08A 4EEYA 2EC0A 2Q1LA 2CRLA 4DR6F 1ZAVA 4M95A 2EK6A 1B3TA 1VBZA 2GNKA 3GSIA 4QW9A 2F5GA 5K8MA 4JI3F 1LXNA 3R5JB 2KU7A 2XS5A 4FP9A 2BV3A 2L3MA 4HVZA 3AQOA 3IA0A 3DHXA 3RB6A 1N34F 1BQNA 2HFZA 4EI2A 3T1YJ 1HBOB 2WSEC 1UFKA 4MFBA 3DMJA 5LL6d 4KHPF 4URSA 4EU0A 3JXOA 2HQCA 2W9BA 3OTOJ 1RI7A 4ZVRB 1NJYA 4Y2KA 2RQMA 4HLBA 2IAJA 3AXKA 4CLYA 3ILOA 2H3EB 3C19A 2ZH6A 1U1LA 1FDBA 3TJAA 4DL3A 3MAAA 1UJ6A 3CNQP 4DL7A 3R2DJ 1PYTA 2LU1A 4ZP8A 1CULA 5IQ6A 1VQYA 2GVDA 2EXUA 3UDCA 2JVOA 2PEHA 1JXLA 1P27B 3QT7A 2KYZA 3AODA 4FYYB 4NLPA 3W64A 5HLFB 1VQ7S 1PBUA 1X4HA 4DUYF 4YOEA 1RTIA 2FC8A 4ED3A 4B3RJ 2FC9A 4PXCA 3H98A 4ZP6A 2VG7B 1C1BB 4PYDA 1REVB 3CCMS 4I6AA 1O0PA 1R0CB 2G1DA 3S8SA 1B28A 1YRXA 2AX0A 4DV6F 1N88A 5CHCB 4DN0A 1ZS6A 3IM8A 2K5JA 3PO5A 3AJ1A 2EFQA 3MEDA 4QCLA 1NNDA 1UW4A 5HI7A 2D68A 5IT4A 6FDRA 3TQ1A 1U24A 1TFYA 2PFFB 2KM8B 4EFAC 1HQUB 4OYIA 3ILLA 3VGUA 3H7HB 3SSRA 4JYAJ 2JLEA 1I94F 4IOCQ 2XS7A 2XMWA 2XZTB 2RUSA 3CCES 1FRHA 3JTPA 2CXEA 3BBCA 3ZFVA 1IBLF 3KK3B 1RP5A 5C24B 1K47A 3QGHA 3GE9A 3KKFA 1UPMB 2JEGA 3T6BA 2AW0A 3RRGA 2J0SD 4P9SA 4B08A 2YWWA 5KFFA 4RX6A 2BJ8A 1LW2A 2GV1A 4YB7A 2DNGA 3HT0A 3SSQA 3F73A 3ZZ0A 4DG1B 4O0NA 3C6TA 2IRUA 1V3RA 1T9TA 1RT4B 1XR6A 4GKJJ 4F0KA 3G6VA 4F67A 3MUTP 3KLGB 2IM1A 3D1QA 1RWNB 1LKZA 3N28A 1CS4B 1MN7A 1JK9B 4LSNB 1WI6A 2CPHA 3R8YA 4B9MA 4UUXA 3T5KA 3DU5A 2XMAA 3EVOA 3MM8A 2RF2B 4M1KA 2O1PA 2O67A 4F3QA 2MQNA 4E2FB 3S6EA 1AZSB 3PRVA 1X5SA 3CCLS 4G3IA 4B3SF 2NXCA 4M5HA 3T9NA 4AFFA 2R2UA 2ZDPA 1KWMA 4I2QA 1XJWB 3OXLA 2W2OP 5THWA 1S0MA 2C2EA 5DG7A 4IUFA 2RS2A 5KT4A 3QJJA 5AXKA 2FB0A 3MOZA 2V63A 3SDEA 2YH0A 4DCJB 3G5OA 3AAWB 5C25B 4MK9A 4LR7A 5JVHQ 3AH6A 2C22A 2R7TA 7FD1A 4IO1A 5HQMA 3PDNA 1S4EA 4OJGA 2L41A 2MKSA 3SYZA 2HLUA 4QU6A 4U7CA 2OP5A 1S5ZA 4GKKF 4O3PA 2QYCA 1REGX 3NKYA 5IQQA 2XG8A 3T19A 2KHDA 3MUMP 2KXHA 2Y1LB 1YTYA 2VFRA 1VOMA 3UQSA 4ALZA 2HZVA 3BR9A 1PBAA 4ID8A 3CWJA 5KFKA 2I0XA 4LFBJ 2FJBB 2G2YA 4A8SA 3CJKB 3LJPA 3OSNA 4FBTA 2CWXA 1B7FA 1MWZA 4ZCLA 3SEOA 2C2OB 1AYEA 1S1VA 3QLHA 2A3JA 3VW4A 4I6YA 1RAJA 1TTHB 1OIAA 1HNXJ 4IYQA 2BJEA 1U6BA 4K4SA 1U26A 3QRPA 2DH7A 2VOOA 2NQPA 3DRSB 4U7UK 3TJ9A 2RKIB 3MMBB 4ZLPA 1XMQJ 3D0HE 2PMHA 3G86A 3V6KA 4XPEA 5FLXU 3H5XA 5B0EA 4P2FA 4I64A 2MKJA 1H72C 5B0AA 3CJ3A 2AZ1A 3T1HF 5BR8F 4J9QA 4GC6A 2XTCA 1TL1B 4OYPA 3C15B 1D9DA 4IG3A 1EHWA 5GMKa 4LREA 4DX5A 2GQCA 1KR4A 2G0CA 3BSNA 4OV6A 4QWEA 4Y6IA 1ZZNA 5KFUA 4EO8A 2C2KB 4AAIA 4ED0A 5KFBA 3GWCA 1HNZF 5J2MA 2KL8A 1A0OB 4ECQA 3H5UA 1C0UA 1N5VA 3LUYA 5HVFA 2RAQA 5KFXA 1JWWA 4Q7AA 3LWLA 5F3TA 2RS8A 2ADBA 3KJFB 1RT2A 1HIYA 1OS5A 3W5ZA 4RJVA 5E3CA 4RU2A 2BA3A 2E66A 3MPDA 1RAHB 4LSLA 1M5VC 4DPWA 1JKHA 1NKCA 4YQWA 2B0GA 2BUNA 4KGXB 4M94A 2W4DA 2YNHB 3TVYA 2J5AA 1TL3B 5KG4A 2R8IA 4N7TA 4ES2A 1YRTA 2CYYA 2NSCA 4X4OA 6AT1B 2RBFA 3A12A 3C6UB 3JAMY 3TEGA 1JLQB 4WF9Q 2IVMA 2V2QA 2GGPA 2CPGA 1I1GA 4CLLA 2IJRA 5J2PA 1BQXA 4JI6F 3WBZA 3U7JA 4RW9A 2CQHA 1YJ7A 1HW9A 2OFHX 2X1AA 1S1WB 2QL7B 3PYGA 3L7PA 1JLFA 1CJVB 2QO3A 1BDTA 5D0RA 3HM9A 5KFNA 1VQ6S 1AROP 2C3OA 1TL7B 2WW8A 1S1XB 5K8PA 5RUBA 1GH8A 4K0KF 3HXMA 4AQYJ 4WFZA 2JJ4D 4DS4A 4NLSA 1HBOA 4DPUA 1G4CA 2X1FA 3KLFB 3DU6A 5JVGQ 4DV5F 3J7YI 2QYGA 4ZJOA 2ZOGA 4O0IA 3QT8A 4MH8A 4B9UA 2HGMA 3PYFA 3V4MA 4PZVA 3A3OB 2IA6A 5CZVA 5F8NA 1QTGA 3ZTRA 5KG1A 3C14B 4G6VB 2CPZA 1RYRA 2LQ5A 1YITS 2V4RA 4O3NA 2YQ1A 4UOCA 1TKZA 3U02A 1VMBA 1TV6B 3DHWC 4IG0B 5E41A 4IFYB 4HHHA 5DS7A 2YX1A 2B8QA 2XY6A 1IUJA 3WX4A 3TAMA 1UVKA 4DQIA 4ZP9A 5HLFA 3EGZA 5HBMA 4QIWD 4FN5A 5D3GA 3NCRA 2R9LA 2A0FB 4GO7X 2RUGA 3UDVA 5EDWA 4P2XA 3IBWA 1CPZA 1Y11A 2AT1B 3OW2R 1BAZA 4OI3A 4DFJA 2VG7A 1C1BA 1SIWB 4EUVA 2YNGB 2B4UA 5FD1A 3LO3A 1RHJB 4QOTA 1LWEB 2HS3A 3ENWA 3HO1A 5LT5A 5F8GA 4TLQA 3LP2A 4XPCA 4WP8A 1YKWA 1FEHA 3NS6A 5JMNA 1SI9A 3BQ0A 4AXIA 2MPUA 2MMYA 1NDKA 4OHWA 3H59A 2CJKA 1K1QA 1IBKJ 3UVJB 4RNOA 1TK0A 3MWBA 3ZC4A 3RBXA 4ME7E 4WE1B 5E3AA 3UW1A 2DB1A 3GIKA 1PC5A 3L3CA 2AEFA 4KT0C 5B0CA 1F6TA 1RT6A 4Z7CA 3D67A 3CC2S 2OFGX 1UKUA 4LFAF 3N79A 3V81B 1SH0A 2EFNA 2F8EX 2LQBA 5GADI 1NLAA 1ZA1B 3KK3A 3K59A 2J6SA 2FJXA 2KDOA 5C24A 3HD2A 3IAS9 1Q1KA 1BWEA 1J27A 2Z0GA 2XO6A 3OXFA 2AJFE 2JX2A 3BO3A 5CYQB 1F9EB 2VC1A 1Q16B 4NMLA 3DNCA 3BQ1A 1JNZB 2BQUA 2YY3A 3T1AA 2ZH2A 3MR5A 1RT4A 4WKRA 2F1FA 4LF6J 2BSQE 4LVOP 3HHLB 2MZQA 1M5OC 3KLGA 2EFVA 5T14A 4DU7A 4DV0J 3Q8VA 4LSNA 3QRRA 2PE8A 1D1UA 3VQSA 2UXDJ 2EI5A 4C48A 2ZE2B 2WONB 1CJTB 3A8IA 1Y5LB 1P94A 2Y1RI 1WEXA 3J7AN 4CO3A 1TL4A 1U09A 1GNKA 4PAAA 4PWDA 5SZTA 4DR3F 4DV2J 4DX8H 2BKOA 3G6ES 4ED6A 2J7UA 1FWLA 1SC6A 4ZPCA 3CO9A 2CNLB 2NREA 3RTVA 1HQEB 4RU9A 3A8JA 2AEMA 4NLXA 1JLAB 1RK8A 4KIAA 3DFEA 2XYPB 4ATNA 2JC1A 4N8NA 2CG4A 3ZNJ1 2F63A 1K0VA 3I0RA 4JV1A 3MR6A 3M8PB 2ZEJA 3PY8A 5C25A 1RWVB 2DK2A 4BC9A 4LF7J 2A18A 3MPWA 8AT1B 1G3OA 2M4MA 5AE3A 2IC3A 4QIGA 4IFVB 1TELA 3UCGA 3KJNB 2JDJA 4J9PA 4GMKA 2LQ8A 3CJQA 4LF5J 1H3DA 2Q6CA 4LF9J 4O4GA 2DPIA 3CD0A 3IMQJ 3CDWA 4DR4J 1HLWA 4N77A 1TR0A 2HLTA 3PR5B 1C4CA 1DLOA 3PXGa 4J9RA 1VRTB 3SFUA 3HHKA 4HT5A 4X4PA 3J7A1 1QDUB 1N32F 5DM6Q 2FVRA 5KT3A 4K4UA 2BVZA 1RU1A 5F0UA 2KJWA 1NK0A 2IMWP 2XLJA 1ZTWA 3KLVA 5DJBA 1LK7A 4WFYA 4HDHA 1KTQA 1U1NA 2N7YA 2N3OA 4KKOB 4TN2A 2PFDA 2Y9HA 2QA4G 2DXFA 1N8RT 3DN9A 3R5CA 3MGJA 3QZ7A 2RKIA 2HZCA 3I0SB 1UJ4A 3GJRB 1O51A 3W1YC 1RAAB 3RR8A 3Q8YA 1FXLA 1ZM4A 1S0VA 4YEAA 2CQ1A 2NYIA 3GIJA 1B4SA 4KHRA 3C15A 1KN6A 3AA8A 1HPZB 1AXQA 2GHWA 4NASA 1EIYB 1HA1A 1RADB 4DF8A 2FJEB 3I55S 2W24A 4JOUA 2QE5A 3WDOA 2P6SA 3GV5B 1HBMA 3EVMA 1WSRA 4AL6A 2XSFA 3U1MA 4WU3A 2RQKA 2CADA 4CLUA 2NS1B 1HKAA 1GTEA 2ZHBA 1NPPA 4G1IA 1FDDA 2HRYA 2VJUA 4LIRA 1U2FA 1FNMA 1P9YA 2DJWA 1N5QA 2PMWA 2YKAA 2RNEA 2Q2KA 5M2UA 2OO4A 5CCLA 1DZ5A 3ZTSA 1U8WA 3QGIA 1IRQA 3BN7A 2W01A 4LR8A 2YNHA 3OLAA 2OEJA 2RRNA 5KG7A 1TL3A 3NBPA 5GAGI 3D4JA 2DO0A 2YVSA 4C3MA 1WF2A 2Y0BB 3A8EA 1F3FA 4H4OB 1Y3JA 3MZIA 2R7UA 1IBMF 1JLQA 5HN0A 2VODA 2YBVA 4OZ5A 4OMFG 3ET6B 1H2UX 1IBCB 2HFVA 2IVYA 2ZBPA 3CCVS 3CJ5A 2UXBJ 2E9TA 4OLPA 2MQPA 3CDUA 5ETOA 1CJVA 1PAUB 4ZDNA 3PV8A 4F0HA 4A46A 2EVZA 2B6AA 3PR4A 1T8EA 1KBRA 1U25A 2SXLA 2Z2LA 1H2TZ 3UFCX 2HKEA 2RHQB 3MAHA 1NB2A 1X0PA 4KV8B 2UUCJ 2BW2A 4IH5A 4A8FA 1TL7A 3IR5B 2KM8C 1S1XA 1IN0A 3D0GE 1Q78A 4AL5A 3HSZA 3IFEA 2U2FA 2G4BA 2G0JA 3K8VA 3FSYA 3W9IA 3L9ZA 1T94A 1OQ6A 1RU2A 2NXNA 2XNRA 2RIJA 2BE2A 3RBZA 4K4WA 4I69A 1UETA 4UY8T 2I5JB 3Q22A 1GXTA 2B56A 3KHGA 3KK2B 3HSGA 3C14A 4J7CA 4C98A 2BRKA 8RUCA 1WELA 2QJ3A 4OYXA 3W60A 4C11B 5D0GA 1Q79A 2JXIA 2XHWA 2J76E 3P5TL 5D4OA 4IG0A 2NZ4A 2B43A 1S6PB 2JFDA 4IFYA 5GAHU 2GAGC 1RT7B 3Q23A 5LSRA 2PT0A 4OZ1A 4ES3A 1JLEB 2C2ZB 4KAIA 3DOMB 5HVGA 2PEBA 4WKYA 3AX2A 1SIWA 3E01B 4E8UA 2R8KA 2HMIA 1R0AA 3DGPB 4J5OA 2RRAA 1LWEA 2EWHA 1RZMA 3J80Y 3HHLD 1EZZB 3QO9B 2GX8A 3H4BA 4KE5A 1G1XA 1SB6A 2YKOA 4JV5J 2FHKA 4X62F 3M6WA 3HZGA 5DZ6A 2GZOA 1NJXA 2JEIA 3PTWA 4RW4B 5HMWA 1O6XA 4YHHF 1T0TV 3RG6A 4WE1A 5D4LA 4G1PA 4PWWA 1G2EA 2K1OA 4DV7F 1OY6A 1TL5A 3AD8C 2MJUA 5C42B 5DG8A 5ETNA 4KHMA 5DQIA 3AB4B 2UXCF 3V81A 2GMJA 1RTZA 3CIZA 3HSDA 3DRPB 3W8PA 4WTOB 3DYAB 2YKMB 2DGTA 3ZZOA 4J37A 2AGOA 4DFPA 3MCOA 1N33F 1X60A 3F56A 2HK3A 5CYQA 3CMES 2C42A 1NZ8A 1Q16A 1V5VA 4WXOA 1X5TA 3DLLQ 5HMXA 1IR0A 3BZQA 5AJ3F 3HHLA 4R0EA 4PR6A 2E29A 4JI7F 3WIUA 4ANCA 2B3TB 4PUOB 1L5UA 5I3PA 1VIOA 2GHPA 1DQ8A 1HBNB 3CEDA 2QFJA 4HI1A 5ETPA 3B4MA 2ZE2A 5HSPA 2WONA 2AEJA 4LRBA 1Y10A 2JH3A 3TI0A 2ACYA 4CH0S 1Q4RA 2GIQA 3MMJA 3TQEA 2F4FA 2BRLA 3QIPB 4LFCJ 2HK2A 5T7LB 2DNLA 2JNJA 3Q89A 2XZDB 3NY0A 1EQ0A 2HHUA 4KPCA 4HV0A 1HQEA 3K8WA 3CB4A 4C8ZA 1ARQA 4KO0A 3DLHA 4LF8J 3C2PA 3HVRA 3W9JA 4I2PA 1MNEA 3KNGA 2ZM6J 4FYXB 1TKXB 3QFHA 1I51B 2CJXB 2LEAA 3LH2S 3HFKA 5A8KB 1FXDA 4JI2F 1T9WA 2V2KA 4IFVA 3G8QA 1RWXB 2NXEA 1HNIB 4GC7A 4TLRA 2D7SA 3CCWA 3Q24A 3MEEA 3R5BA 2V0NA 1BXNA 5KG6A 4ILLA 2DYAA 3H25A 2XY5A 2VQEJ 3GILA 4MJWA 4ECZA 4K5SA 1WDDA 3ZZTA 2VBZA 2KT3A 1VRTA 4KC5A 3PW4A 3N6NA 2HFUA 4X65J 3NO7A 2QMWA 3NWGA 3PNIA 4ZPWR 1X8DA 5GAEU 3M8QB 4FS1A 3EXCX 4QIEA 4XDDA 3H40A 1R8BA 2EBEA 2Z2ZA 2WZ1A 5GMDA 2MZRA 4F4YA 4RL1A 1P9QC 1UZDA 4KKOA 3LP0B 4DSKA 1RAOA 3W2WB 4RNHA 2MQLA 4RUHA 1RTDA 4O44B 3UE2A 3KHRA 5BR8J 3BO2A 4QU7A 1S1UA 3I0SA 5HAOA 3GV7B 3TR5A 4RO0A 3PJXA 2QA1A 5LJ3Y 5EX0A 1ELOA 3MPYA 1VQKS 3FBFA 5L1JA 2UU9J 2HBQB 1HNZJ 4Y2MA 5F3ZA 2RJZA 2A6OA 2XBPA 5LM7E 2WOMA 5DZ7A 3ETOA 2CJQA 1HPZA 1EKRA 4X64F 4RNNA 1NB7A 2MLZA 1W26A 2EC2A 2HHPA 2HRTA 4LIWA 1X4BA 3M05A 4DQSA 2HS0A 5ETQA 4ERDA 3FFIB 5F8JA 2UV8A 2VICA 5SUHA 1D8ZA 3OQ2A 3UPFA 2W2QP 4RNFA 2FYXA 2Y3YA 2LXIA 3CJSA 2BDPA 1UW9A 1VISA 4X66F 1TK8A 1OM2A 3PRDA 3IR7B 4UT4A 3RGIA 1EETB 3AWRA 2FPHX 4UZCA 4F7VA 4FBUA 2AJQA 5CYMA 3HX9A 3PW2A 1FKOB 1SH3A 1WTFA 2IPOB 3MHYA 1MG7A 3EGNA 1RHQB 3M8WA 1JIHA 1F5BA 2DNNA 4DMZA 5CZXA 1YJWS 4H4OA 1FNXH 1XMOF 4FF1A 1GTHA 3ET6A 3TRGA 4CCHA 1ITPA 3PM9A 3PKYA 2DD8S 2QTWA 1XNRF 2GQ2A 4OZ2A 1X9WA 3W62A 4X4RA 5FDLB 5IWAJ 4G1QB 2N4DA 3CCJS 4LT6A 2HGNA 4C3KA 2AU0A 2UUAJ 3CDBA 3ISND 3RU0A 4KFBB 3EVWA 1BLUA 1CJUB 3NG8A 2DNYA 1L3KA 5L39A 3WC2A 2KTQA 1Y9OA 2YKNB 2ZUGA 1RWMB 4KRWA 5E2QA 3GFZA 3BH7B 1H73A 1B70B 1HFEL 5HJYA 3AFGA 1RT5A 1S9GB 3VGVA 4F0MA 5HVHA 2HG4A 4B3MF 3IC1A 3SQGB 4ZLNA 2CAJA 4C11A 3H87C 3THVA 2OMLA 1S6QB 3OR2B 3HHDA 1AA1B 1Q8LA 2V9WA 1RTJA 4AD6A 3VAKA 1S6PA 2KHCA 5IT0A 1M5SA 3BBBA 4Z7YA 4TQSA 3FSXA 2GCFA 4Q0BA 4FVCA 3HHLC 1B0VA 4YY3F 2E5HA 2OGUA 2HW3A 4U7UD 2XYGB 1RJJA 3US5A 1RHMB 3FDSA 5EWGA 4B17A 3DOMA 2KRBA 2V67A 4RNMA 3BDPA 3Q8RB 4NLOA 2W2MP 5D77A 2XI3A 2OIHA 3E01A 1TUWA 4I1TA 5DO2A 3DGPA 4A8OA 2EFOA 5K20B 2AP6A 3TAQA 1HHQA 1OYEA 4YP3A 1KVJA 3QO9A 1S1TA 4EGLA 1S9EA 2OI2A 3QWPA 2B7BB 3CMQA 4ZVFA 5M2RA 2IMOA 4DR2F 1T9UA 2BZ2A 3GFHA 3U1NA 1S49A 4ZIWA 4DN9A 4K4ZA 2QIFA 2UUWA 2VIHA 4RW4A 4BDPA 4PYAA 1UUJA 4RPFA 3AD9C 4B3TF 3G9CA 1Q5VA 1PYSB 2ILZA 1HW8A 2HWIA 1IM4A 1KQFB 4DR5J 3FCWA 1BC6A 3VGTA 4CLZA 2DEJA 3NRBA 5EGYA 4NYPA 3UNYA 3QIDA 1BD6A 4YB6A 3D2WA 1SKWA 4ZK7M 2C1EB 3IRXB 4DV3F 4IQMA 3VQTA 4DPOA 3M8RA 3DRPA 3OUYB 1S12A 4BBYA 4KH1B 1FRJA 5J1NA 3LW5C 1ZAWA 4ECTA 2MSTA 5KFSA 3TA1A 2OKQA 4DZDA 4JI4J 2DNMA 1FHTA 2KT2A 4CTAB 3BJYA 1U02A 4K4XA 1U1PA 2RH3A 2OSRA 5AT1B 4L3NA 2KZZA 3OD2A 1IKWA 2XCPA 4PUOA 4RKUC 3N6MA 2X3GA 1FJEB 1IJFB 2MYFA 1F5CA 1NEEA 4IRCA 4ZPDA 2OAUA 1ZBTA 1PCAA 4KGVB 4KB7A 5ETMA 4USUA 4JI5F 3GMGA 3FEXB 4DEZA 1U6FA 4B9NA 2CPYA 1M5PC 4C4WA 2XGQA 1KONA 4ETZA 3TANA 4NLRA 1X5PA 2X51A 3LGHA 3CCUS 4CLKA 3KMSA 4DPTA 5KFGA 3EE3A 1H2VZ 2R7VA 3DCAA 3EGVA 3T41A 4DOZA 1BQNB 3BR8A 1Q82T 1EAYC 4ZPAA 3GR0A 4RZRA 2HHQA 2MHNA 3NGSA 4O3SA 2W9AA 4ITSA 4U8YA 3N5BA 4P7VA 2HZAA 2H4WB 4RW6A 5HQLA 5A8KA 2KXNB 1NSPA 3MR7A 3O1LA 3MM5B 2VQFJ 3M2RA 1S77D 3MAAB 2BEFA 1HNIA 1CSJA 3ENAA 4YUDA 5HMZA 1D9FA 2V8VA 4JV2A 2ZNYA 3NXZA 1G6BA 1SKSA 3ZZPA 1CULB 2MZJA 4GVLA 2GVDB 1QUPA 1Y5IB 1HARA 2DNOA 3WQPA 5A2QY 1FE0A 1R31A 4HI2A 4GVBB 3JTOA 4TYBA 2ZH5A 1IKYA 1S7HA 1SKUB 5EWFA 3GSDA 3TUJC 1NKBA 5HQ8A 2OELA 1RTIB 1KRPA 3M8QA 1FK9B 2E9ZA 4JUZA 1DHMA 5L9NA 4EYHB 2PC6A 4R5PA 3TARA 3EWGA 4WZQA 2MZ1A 1V3SA 3K5MA 2V5HG 1KSPA 2GJ2A 2GC8A 4DX7A 3JSRA 3W2WA 3G82B 3PFEA 3EX7B 4O44A 3CVKA 4I0WA 3ADAC 1SL0A 1GXUA 3DLJA 3DXBA 2CQIA 3GYNA 3MDFA 4DCOB 4Y2AA 1WHWA 4OYMA 4CRJA 3LGNA 2P6TA 4KR0B 4X4SA 2CG8A 3UN2A 3IBFB 5I42B 3DLEA 4DR7F 1HYSB 2B4PA 5LOQA 3FZBA 1IKVA 3LPYA 2J0WA 3G8TA 3VZIA 3PG9A 1B64A 4NWBA 5LMNJ 3BGUA 4DS5A 4JI0J 3ELHA 2AYGA 1NDPA 2FHOB 2P8IA 1KC8T 1UVNA 1IWAA 3KJQB 3H5SA 3IXQA 3MXHP 4USVA 3J81j 2CQCA 2FGOA 1PGZA 1EQMA 1DRZA 5IV3A 1LW0A 3K89A 1VQ8S 1RAEB 1NZAA 1XEZA 4ILMA 4LUBA 2VJVA 5BYQA 2YWKA 1LW2B 1J5EF 1RT1B 4HTIA 3S01A 4TY9A 1MN9A 2K29A 1WOSA 2JXGA 1FKOA 3EZ5A 3WC0A 1MMLA 3GTYX 4M5DB 3J7YU 5H9EK 2V34A 1DQ9A 2MZTA 2XM3A 4KPYA 2DNHA 2UUBJ 1SQEA 1NHVA 3CUNA 3QGPA 3VAFA 3FC9A 3CGIA 3VAIA 4MTPA 2OPSB 4C7QA 3CCQS 1GK8A 5FDLA 2QA4S 4QYZK 1Y3KA 5H1SV 2NZCA 4H4MB 2J8SA 1RE1B 5EHHA 1VI7A 1FFGB 2VPYB 5E0OA 1SJ1A 1YJRA 2CPIA 5H9FK 4HACA 2XTEA 4I2QB 2IDEA 3GJQB 4CO4A 4RLEA 2QV6A 4JI8F 3NS5A 4F04B 1CJUA 2K1RA 3EGWB 4OYAA 4X4VA 2KN4A 1VQLS 1FVSA 3AX3A 1GMWD 4Q5VA 1RWPB 5ETSA 4TKTA 2VA3A 4FS2A 1VQPS 2YKNA 3PVXA 3M9OB 3SCIE 1IQTA 1C1CA 2KG0A 3MCMA 2IJFA 5A0YB 5KFCA 2L9WA 4WYLA 5KFJA 3P96A 1S9GA 2BJ3A 4I6WA 4CLFA 2OPQB 4PRFA 1A7GE 2D1CA 4KGKA 3KLIB 1YBAA 3SQGA 4L73A 2Z8QA 1X4DA 4P71A 2E1MC 2K8GA 1SJQA 3PHEA 1HBUA 1S6QA 2LDYA 3FCVA 3OR2A 2J8AA 4J91A 1NK5A 4OZ0A 4ECUA 3UWTA 3FNNA 2AV5A 3BN4A 3SI8A 4QR1A 1HI1A 1PYOB 3IG1B 2V8DA 1B01A 1JXEA 4RUAA 4F26A 2I6WA 3K5OA 4WIQA 1U8SA 1XNQJ 5BXIA 2ZC3A 3M8SA 2I9SA 2JEJA 1RHKB 2R4FA 4UW2A 5GADU 3AHPA 2ZH7A 5U47A 4EZ6A 2YWEA 3A3NB 1NHUA 2FD2A 2KT5A 2BR0A 4Y34A 3RUBL 1URRA 4IH6A 3OTDA 4PXDA 2G9OA 2ZOMA 4HH0A 1RWWB 1GMWA 1KHWA 4I67A 1VS3A 1VQSA 2ZD1B 1CVJA 2XEXA 1VQ5S 5DRKA 4ANDA 3TP2A 3BF4A 4UF4A 4JI1F 4IG3B 4J9NA 1RGVA 2LLZA 3V6DA 4B9TA 3FBCA 2DIVA 2MHEA 4USJC 3PYDA 4DV4J 4ECRA 4NMXA 3NNEA 4ZHRB 3TVKA 3IRXA 2LYVA 4FYVB 1EJ7L 1C0UB 2XSJB 4DSEA 2DGSA 3HCXA 2HNZA 1QSYA 3T1YF 3OUYA 2EG1A 1KFSA 3BPDA 4QBUA 1UTAA 2FLNA 1SBRA 2H9ZA 1M5KC 1WF0A 3V2UC 1U1RA 5CD4A 3OTOF 2O3DA 2DR9A 1Q8BA 2K3KA 1Y7PA 2W1BA 3HKWA 3A4TA 4DQPA 2UVRA 2V8GA 4UQGA 3VWSA 2XC9A 1N6QA 3D28A 4ID5B 3UD4P 3KLHB 4LQ9A 3OJUA 2B9WA 3CO0P 3X1LB 2OH2A 3D3CJ 3GYGA 2EFGA 3CD6S 4KYZA 2HQDA 3B4DA 2GGPB 2DNRA 4ECXA 2HHHJ 2RVJA 1BY9A 1XTZA 1O5JA 4DI6A 1R27B 2VFVA 1NJWA 4NLYA 1P6TA 4F02A 4AL7A 1JLFB 3HT3A 3RB4A 1K73T 1MWQA 8ATCB 2JXHA 2JZ5A 5D0EA 2DBBA 2QMUB 4OQJA 4FYWB 3S1TA 1K0TA 1DTTB 3ZTOA 3NGUA 4B3RF 2DH8A 2V69A 3A13A 4DL0C 2GFFA 1FA0A 5I3UB 2J6UA 1ZA2B 3OVBA 1RWKB 3L7UA 2LKZA 2YKQA 2GVZA 2BW7A 3HVTB 1IM6A 2CJ9A 2HRUA 4IH7A 2UP1A 4D8JA 1J2VA 1DY3A 4E0DA 4F4AA 3HF5A 2YX7A 1HWIA 3MM7A 1YLXA 3NS7B 4DV1J 5KTQA 4MJKA 2V4JA 1QVFR 4HL9A 4A8MP 1VRUA 1RWUA 5KFIA 4CO0A 3MM5A 3CD7A 5HANA 4CT9A 1X9SA 2BA9A 2MKYA 4DCPB 2ZC4A 1QAJA 3ZZUA 1TKZB 1I6JA 1HQ2A 2HIYA 1KNZA 3BSOA 4JYAF 4JP8A 1U48A 4F4WA 1FJGJ 2DO4A 5KFLA 2NUUG 3KOAA 5HL7Q 3MMCB 3DDKA 3CDAA 3LTOA 3ZZYA 4Y65A 4LQ3A 4DHVA 3UN5A 3W3SA 3W63A 2VB6A 1OSCA 2QN6B 4GVBA 3TAMB 2H1YA 4UZBA 4RUCA 2R2RA 3HHNB 2CNOB 5HBMB 1U2RA 5D3GB 3GPAA 1FK9A 1JJ2R 3LPEA 5CYJA 2F4VJ 4CM2A 1FI4A 1WC3A 3MI7X 3NMAA 1ZZFA 3I6PA 3HVWA 1KLNA 2HHSA 3TZWA 3G82A 4GKJF 2IJNA 2A10A 3BKFA 1C0TA 3LP2B 4CDIA 4LJMA 1RYSA 4OX9J 4P10A 3G71S 2GPEA 1WG4A 1O8BA 2BYCA 2I2YA 3UR0A 3W9HA 4WIIA 3FBEA 1NSKL 5GAGU 4TXSA 2MGZA 4M5MA 2XWXA 2EFPA 4DWIA 2HNYB 4P2MA 4EBCA 5KFDA 2VH7A 2JOQA 5I42A 4Q45A 1MU2B 1HYSA 4V1Ak 5B09A 3P6YC 2R2SA 4K2JA 1RQ0A 2ZBRA 2VPWB 3AJ2A 1HR0J 1T05B 2WTFA 3IM9A 1ZM3A 1RT6B 2C3YA 1CLFA 2K9IA 2NPIA 1YDLA 3J7Z5 2AYMA 1RKJA 5BYSA 2YNIB 1HNWJ 3A3PB 2WRMA 1DTQA 4DR1J 3A1YG 1X31C 2HVIA 2X7IA 1TUVA 3EPIA 3MTKA 1CEZA 3NGDA 1SV5A 2FZKB 1J5OA 2W2PP 4YS2A 4NE9C 4RW8A 2GMLA 4NX9A 2OHDA 3D6MB 4LR9A 1VQOS 2OD6A 3MF5A 3JSMB 1JJ4A 2XTJP 3FGVA 4ZPTR 1RT1A 2CQDA 2OMOA 1S76D 5KFMA 1Q8IA 3CPWR 3R5AA 4M5DA 1TKTB 1YVFA 3P45B 3JQMA 4X84A 2ACMA 2OSQA 2HVZA 4C9DA 2QL5B 1T3OA 2V6AA 2CQPA 3R3TA 4K4VA 2JFKA 3K0JA 2VOPA 2DGQA 2XCAA 2AQ4A 4FYDA 3BGLA 1RLCL 4O23A 3GG0A 2E44A 2OPSA 2P5VA 4LFBF 2HAFA 3FK4A 4TY8A 2HBYB 2CJAA 4X4TA 2GW8A 2ADCA 1OPIA 3DXSX 3OHAA 5F0WA 4N76A 3BKUA 5I3QA 4H4MA 2ATCB 2LXFA 4PWDB 4URGA 4V19X 2HHTA 4OX6A 3BSCA 1HNXF 1N48A 4IRKA 2DXDA 3B6BA 4B02A 1WTBA 4ECVA 3H4DA 1FO1A 3SV3A 1H38A 1RUSA 3N6LA 3C8YA 3R5DA 2KELA 2N82B 2A2DA 2D3ZA 1XMQF 3I0RB 1NSQA 3RW7A 3DM2A 3FKBA 4OHVA 1U1OA 4W4MA 3BREA 3JTNA 3CULA 2DT9A 2CQ4A 4LBPA 1KKHA 5HP1B 5A0YA 1N4LA 1U49A 1OY9A 4ZVGA 2BNZA 3SV4A 4U95A 2IC3B 2AJ2A 3TW0A 2OPQA 3BSAA 3KLIA 4N41A 1BHNA 1ZETA 2X1GA 5B08A 4UOGA 2R7WA 3S7RA 2LECA 4CO1A 3D7SB 4UOHA 3HVAA 2E5LJ 5DLFA 2LP4A 2MSSA 4LF4J 4O4GB 4A8WA 2H1OE 3CF5Q 1HMVB 4NZ7A 3M6XA 5CA5A 2DHHA 4G65A 3RYLA 4JB8B 1DLOB 3NOGA 3IG1A 4M5JA 1AW0A 1VDHA 2MDAA 3PZPA 1U6ZA 3Q8QB 2AZ3A 3V6JA 2J6TA 2C28A 4S0MA 2IDLA 4FKYA 1V3ZA 3GU0A 2BJ9A 5KFAA 3VZHA 5ITHA 3KG4A 1SC1B 2QT7A 4J9KA 1ARRA 4A4JA 3BGOP 3D6HB 2DHGA 2JHEA 1AFIA 4MK8A 5F41A 2PD1A 4A47A 3JSBA 2J0QD 2J7KA 3CMAS 3RAMA 3PRBA 4C0HA 1HD0A 2Y8WA 5MAOA 2ZD1A 5KFRA 4M5NA 4ECYA 1TAUA 4L74A 4FF4A 3KDOA 1WC6A 1UA0A 1KQKA 3C16A 4R8UB 4OYOA 1VIXA 2KFZA 1U0SA 2VFUA 2MZSA 3G6XA 3J81U 3LAMA 3GR1A 4K8RA 5J2NA 1NDCA 2CQBA 4ZHRA 1RT3A 1HBMB 2IIHA 4P74A 2XSJA 2W7OA 1UWBA 1FFSB 2QLFB 4AQYF 3R6GB 2FZGB 2MTLA 4ENOA 1GAOA 4K7QA 3B78A 2PI5A 2HVEA 1PJ6A 1JJHA 4AT1B 1WC4A 3JS9A 2BJDA 3OR1B 3O8WA 4NA1A 7AT1B 3PX6A 3MOJB 2AGPA 5KOXA 3WHIA 3M9MB 4J90A 1X4EA 3NBPB 5KG5A 1FWKA 2N7CA 4MAKA 1YHQS 2OEMA 1VYAA 2IM2A 4ID5A 3AB2B 4AYBD 3KLHA 4PXEA 4WBFA 1RACB 3CD5A 3BYPA 1QAIA 2MLXA 3UN3A 1XN9A 2QFIA 3ONQA 2KH9A 2CWKA 2GHVC 2FVCA 1TUGB 4EBEA 3BB5A 2B6AB 1BQMA 1PARA 1DTTA 1LXJA 1KQGB 1QSSA 2ROPA 4ELVA 4NXMF 1SC4B 1ZM2A 5I3UA 4WWSA 2IA0A 2F7VA 3Q8SB 1MLAA 3PFOA 5ETRA 4DF4A 4EZ9A 3HVTA 2QZ8A 3VTIA 1WKJA 2BE2B 3Q2TC 2FJVA 4HT7A 1IBKF 2F65A 3RRHA 1LQ9A 2J9CA 4ZN1A 3MECA 1Q86T 2DNZA 2RU9A 4RBTA 2WBMA 3DLGB 4OHXA 4CQ1A 2XWYA 1EARA 1YX2A 3SMZA 3MMCA 4Q8FA 2KFYA 2QLXA 1T3NA 1WI8A 3N4WA 4C97A 3Q86A 4NCGA 1VJWA 3LALA 4U6PA 2D74B 2VBXA 3BM7A 1YBUA 1GXLA 1E6YB 4LMZA 3LP1A 2Z2MA 3BGRB 2BKPA 3NGRA 5E33A 2HMIB 1NCLA 1R0AB 5KFWA 2ALZA 5L38A 4IOBA 4BHQA 1UVJA 4ZMMA 2ZHOA 5HATA 4LF6F 4YDXA 4NOHA 3LOUA 2D9OA 4QPXA 4P6QA 2V8HA 3CE8A 4DV0F 1WACA 2OLWA 4F3MA 1LV5A 4FKXA 3KJVB 2VHGA 2UXDF 5KFOA 1QM9A 2HNYA 4F4KA 2BNWA 4ES1A 3HJFA 4NLUA 4IR1A 1RA7A 4A48A 2Z2YB 1HWJA 1MU2A 3BBFA 3KXDA 1CQMA 4C8NA 1N52B 5L9XA 2R7OA 1T05A 4ZCIA 4N47A 2R7RA 4RBVA 2D41A 4DV2F 1ZAXA 4NA3A 1LWCA 3KUHA 2XY7A 2RB7A 1VLOA 2YNIA 4OYZA 4NXNJ 4K50A 2FY8A 3PJ9A 5HROB 3VGSA 1J5EJ 2VPZB 2CPXA 2YQ3A 1NLKL 3QT6A 3H90A 1NK6A 3QQCD 4ZLLA 2OPPA 4DLEA 2RSQA 5T41A 3OHBA 5A2QU 3P8BB 3JSMA 4L72B 4LF7F 3JQJA 3AQPA 4QIVA 2LU2A 1N54B 1TKTA 5EUHA 2FJAB 4ZVEA 1LEOA 4LF5F 4ZCMA 5K8OA 3KWMA 4DFKA 1KQSR 1N56A 4WP9A 4LF9F 2RRBA 5B0BA 3N0VA 4I7FA 3QRQA 2XULA 3MR3A 4DR4F 1L3SA 4CLTA 3RRKA 3H20A 3I82A 1PAEX 4NEYA 5DGBA 3W8GA 3HPOA 5LJ5Y 1GFWB 5C5JA 2HEKA 3NCPA 2QC3A 2HAIA 1T9VA 2ZZNA 2DCLA 1R6YA 3IWLA 3MFIA 3O2IA 1RB0A 4Y3CA 3U1LA 2DGXA 2DKOB 2KXFA 3E51A 2A1BA 3B82A 2L48A 3A8KA 3NAIA 2FY1A 1R0BG 4ED7A 2M9KA 2UVVA 3DRRA 4KO0B 2WVBA 3GFYA 4I2PB 4LBIA 4O4RA 1FRKA 1UAWA 2E1RA 4DQRA 2QX0A 2YWHA 1WSVA 5HP1A 2XO7A 3CCRS 3Q83A 2K2PA 3KMQA 4NLTA 1VC6A 4HHUA 5A8WB 4ANEA 2QA2A 1JXVA 3THTA 1ZPWX 3MEEB 1SC3B 1GX6A 3TZYA 5ADZA 1H0HB 1EKSA 1HMVA 1QSLA 1F1BB 2PIIA 4D3GA 4N5SA 2H5JB 4ZLJA 3I9ZA 4YR2A 3EYZA 4FXEA 1R8PA 3IGVA 5AXNA 4OZ3A 1FERA 3AT1B 1FJCA 2AJ0A 4DLGA 2DGWA 3R6LB 1K8AT 1RLDA 1KEKA 1BUXA 3I5BA 2I38A 2AJ4A 2Q43A 1GMVA 1RTDB 3DDIA 2W7PA 4ZP7A 3ILIA 5LMUJ 2R7SA 1S1UB 4QR2A 4ICLA 1I5OB 1OYDA 1U1QA 2CDQA 3QT5A 4UQTA 3OL6A 1WEZA 3P3DA 3CCZA 2LEPA 2M3DA 2E7VA 5B0FA 2DPJA 2VDHA 3D3BJ 5DDOC 1SJFA 2UXBF 4R8UA 1DJ0A 3FQKA 2G2OA 2L9NA 2WOMB 3QAUA 4OL8A 2I8EA 3R27A 5IV4A 3FRZA 3MM9B 2IM3A 1NAQA 2NLWA 3SCLE 3AXMA 2UUCF 4F4ZA 2HS4A 3AD7C 5F9LA 4HKQA 3RB0A 4KH0B 1WORA 4K5RA 4LRVA 1NSAA 3CJ2A 3K17A 5J2QB 1WUUA 2HWTA 3N01A 3JB9k 4USWA 2ZH8A 3FMWA 3GIRA 1NK7A 2DHSA 2V94A 2ZOFA 1AB8A 3P4UB 1NKEA 2JSXA 2H4YB 3PO4A 3OSPA 2QLJB 4OV1A 4OHYA 3E2EA 3OR1A 1S79A 4LRFA 3OV7A 1B99A 3BPSP 4A8XA 5CYMB 2M5YA 4PG7A 1VQ9S 3NWRA 1MMNA 4XTTA 3VVTA 1SCJB 2BMBA 2VBYA 3GYXB 2PA8D 2WBRA 4W92B 4FPRA 3VAMA 4F50A 4DR6J 1APSA 2VG6B 2XZ2A 3NCQA 2BQRA 3MM6A 3ITHB 2NR0A 3QSIA 1L3TA 2EPIA 4JI3J 4CH1A 4MK7A 1K9MT 5DQHA 5IC6B 3W66A 1TU0B 4LRAA 4NA2A 4NPOA 1N34J 1VBKA 2LFVA 4XIUA 4OI2A 1VGYA 3C3LA 3F44A 3TUPA 5F8MA 1BWVA 1TFWA 4ZOSA 2OTLS 2XQCA 3V4IB 1V9OA 2XMMA 3OL7A 1B7YB 1SIZA 4KHPJ 1HD1A 5EWEA 2CJBA 1U0HB 1YJ9S 3TX8A 3E3XA 2BACA 4H54A 3H8YA 4PPDA 3KHHA 3T5HA 1BGXT 4ER8A 2WW4A 5KT5A 2QSWA 3IO1A 3TJ8A 1YK9A 1Q81T 5EN1A 2D3UA 2JEFA 3PHTA 4JV5F 1X4AA 4ZJLA 1YJNS 1WKKA 4BWJA 2WCXA 1B0PA 2BQ3A 4BC7A 1RT5B 3VEBA 2GQQA 3MEGA 3RBDA 1SJRA 4P2SA 1N5TA 4DXLA 4RWXA 2AMCB 5L8RC 3DLGA 4NRTA 2JRSA
chains in the Genus database with same CATH topology
4NZ0A 4TLQA 4KPYA 5HO4A 3LP2A 2DNHA 4XPCA 1X5OA 1FEHA 3NS6A 1SI9A 3BQ0A 1SQEA 3ICLA 4AXIA 1NHVA 5L1KA 1RTJB 4QWBA 3CUNA 2MPUA 3QGPA 2DRBA 1MMDA 2YX4A 3VAFA 2MMYA 3PW7A 4EBDA 3EZUA 3CGIA 3IAM9 3LAKA 3VAIA 4MTPA 4OHWA 4DSFA 2OPSB 3H59A 2CJKA 2I5JA 1K1QA 4C7QA 4ELTA 3K5LA 3CCQS 3KK2A 2WSCC 5KFHA 1FDNA 4RNOA 4Q0BB 2ZBIA 4OZJA 5DDQC 1TK0A 1HHTP 1W25A 4WXWA 4DFMA 1P1LA 4FXWA 3MWBA 3ZC4A 4DSLA 2OPPB 5FDLA 1E6YA 2QA4S 2CPDA 5JUMA 2DR5A 2NXUA 1Y3KA 5H1SV 4WE1B 4H4MB 5E3AA 2B5JA 2M0GB 3UW1A 2DB1A 3GIKA 2H3AA 3M32B 2ASDA 1XBWA 4D3HA 3BGRA 1PC5A 4QQBA 5JXSA 2JLFA 4KT0C 5IFMA 5EHHA 3L3CA 5B0CA 2DHAA 1VI7A 1RT6A 2VPYB 5E0OA 4TU8A 5A8RB 3H2VE 1SJ1A 3GB0A 1YJRA 1FESA 2CPIA 5E3QA 1A9NB 2W25A 3VCDA 2P9EA 4CNZA 1SXLA 1NO8A 1YG0A 2Z4PA 5A6WA 2XTEA 1HL6A 2MQOA 4N56A 2OFGX 3CC2S 1UKUA 4NZ6A 1P8GA 4LFAF 4I2QB 4C8OA 1GX5A 3VR1A 3N79A 2E5GA 5DDRC 3V81B 1SH0A 2EFNA 4CO4A 2F8EX 2LQBA 4RLEA 5GADI 2QV6A 4JI8F 3NS5A 1RT7A 3KK3A 1N0UA 3K59A 2K1RA 4NYOA 2J6SA 3KTQA 3EGWB 4C8KA 2FJXA 1S1TB 2KDOA 3PJWA 4X4VA 1OQ3A 1S9EB 2KN4A 1VQLS 1FVSA 4Q5VA 5C24A 4TKTA 4OI4A 4CH7A 1S6UA 2E5LF 2VA3A 2HHXA 5K5MA 4FS2A 1CC7A 1WWHA 1VQPS 3IAS9 4LF4F 1LWFB 4QPTA 2YKNA 3PVXA 5F8IA 1Q1KA 4I7FB 3M9OB 3PX4A 1X9MA 1JLEA 4OJ1A 1ROFA 3GZ7A 3SCIE 1BWEA 2Z0GA 2CZ4A 3OXFA 3R1LA 3DC2A 2AJFE 1SUQA 3OTBA 1IQTA 2FLPA 2JX2A 3KJVA 2CKWA 3PEJA 1C1CA 3CJ0A 2KG0A 1X7VA 3BO3A 5CYQB