3BSOA

Norwalk virus polymerase bound to cytidine 5'-triphosphate and primer-template rna
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
484
structure length
479
Chain Sequence
KGTYCGAPILGPGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEPRGKPPKPSVLEAAKKTIINVLEQTIDPPDKWSFAQACASLDKTTSSGHPHHMRKNDCWNGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDLATMIRCARAFGGLMDELKTHCVTLPIRVGMNMNEDGPIIFERHSRYRYHYDADYSRWDSTQQRAVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCTSQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLKEYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGPNHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELDFYVPRQEPMFRWMRFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into mechanisms of catalysis and inhibition in norwalk virus polymerase.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Transferase/rna
molecule keywords RNA dependent RNA polymerase
total genus 149
structure length 479
sequence length 484
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2007-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.100 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Arc Repressor Mutant 3bsoA02
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 3bsoA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3bsoA03
4K4YA 3KHHA 3T5LA 3UPFA 4RNFA 2O5DA 3DRSA 1C0TA 5JXSA 3TQ1A 4EBDA 5DLFA 1LWFB 4I7FA 2QV6A 4DL6A 1S1TB 2YKNA 4URSA 4Y34A 5I3UB 3MEEA 4XPEA 3SI8A 2OPRA 1I6JA 2WCXA 3TAMA 4F4XA 3H4DA 4TQSA 4IH5A 3IGVA 2YNIA 5KT2A 4H54A 1SV5A 3LP2B 3KLEB 2R8HA 1JLBB 3PW7A 1RTIB 1S9EB 3PR4A 4ED7A 5KFRA 1JLCB 3N6LA 4K4ZA 5C25B 3KLHA 2ALZA 2BRKA 3MR6A 5HLFA 5KFMA 5KT6A 2EC0A 2D3UA 4FS2A 3SFGA 4EO6A 1D1UA 3QLHA 5KG1A 4DL7A 4RZRA 3V6KA 5KFQA 3T5JA 1YVFA 2R8KA 1S6QB 4MFBA 3FSIA 2IA6A 4U6PA 4KHMA 4PUOA 4Y2AA 3KK2B 1SH3A 2B43A 3DM2A 4QPXA 4I2PB 4MK7A 5J1EB 1JLGA 3GV7B 4ECRA 4Y2CA 3OL7A 1TKTB 3BSCA 3BSNA 1CSJA 2B5JB 3QO9A 2W9CB 5HROB 4MH8A 2AGQA 2FVPA 4Q8EA 3NBPB 3PJWA 4Y3CA 4F4YA 1IM4A 2FVSA 3RBEA 5D3GA 1C0UA 3IGNA 3RB3A 2D3ZA 4DG1B 3MEGA 4B3OB 3JSMB 1LW2A 4KO0A 4EO8A 3UDLA 3OHBA 4X2BA 5CYQA 4QW9A 1RAJA 4RW4A 5DG9A 1RYSA 5T14A 3BSAA 2IJNA 4R5PA 4RW9B 4RNNA 2XGPA 3PW2A 2AU0A 2VG6B 3M8PA 1LW0B 4KKOA 4WE1A 5C5JA 4K4WA 4Q43A 2RDJA 4NLWA 2OPQB 4KV8A 5KFDA 1MMLA 4PQUB 2E9TA 3DRRB 2FJXA 4I2QA 2FVQA 3I5CA 4O4GB 2XCPA 1FKOB 3IS9A 5DG7A 2J6TA 1SUQB 3E01B 3KJVB 1DLOB 1N5YB 2V9WA 1HARA 1S9GA 4RW7B 3GYNA 3OL9A 2W9AA 3V4IA 5KFKA 3MTKA 4RUCA 2HMIA 5F8HA 2YNFA 4QWEA 5DQGA 4NCGA 1REVB 1VRTA 2VG7B 3DOKB 3MECB 4H4OA 3NMAA 4DEZA 2ZD1B 5J2NA 3DMJB 4TLRA 4LSNA 4MK9A 4RW8B 5KG7A 3KK3A 3CDWA 1JLAA 1MU2B 4YMEA 4EYHB 3KLFB 4Q0BB 4RW6A 4RW6B 5L9XA 1RT6A 3HVTB 1JLQA 1K1QA 1TL3A 4GC7A 4NLOA 2BR0A 1T03A 3NAHA 1DTTA 3IN5A 4ED1A 1QE1A 5DG8A 1S1WB 4IOBA 3KLGB 5KFGA 3DI6A 3DOKA 4H4OB 4ED3A 1KLMA 2W7OA 3IG1A 3PR5B 4NLDA 2J6UA 2DPIA 1JIHA 4NYZA 2C2RA 1XR7A 1RTDA 3D28A 4EEYA 1RT5A 2XGQA 1JLEA 4DL4A 1OS5A 5KT4A 3QYYA 3OL8A 2AWZA 3OLBA 1SUQA 3E01A 1FK9A 4Q44A 3KJVA 5J2QA 5J2PB 2AGPA 3H59A 4NLTA 4ZVGA 4KHRA 3T19A 5KFYA 2IAJA 2XI3A 4G1QB 3RAQA 2I1RA 2DPJA 1S6PB 3LP0A 4URQU 2FVRA 5EWEA 1LW0A 4KKOB 1JLEB 1S1UB 2HNDB 4H4MA 4O44A 4ZHRB 4ZPBA 5DQIA 3MR2A 4J9MA 2IBKA 4IKAA 5CYQB 5KFBA 4KO0B 3QGGA 3JSMA 3PHEA 2BE2A 4NLRA 4TY8B 4KFBA 1JLQB 1TL3B 4J9RA 3C6UB 3KLIB 1C1BB 4Q8FA 3ITHB 3VQSA 5L1IA 5KFWA 1JX4A 4EBEA 5HROA 5F8LA 2ATLA 4JV2A 4WFYA 2UVRA 1N6QB 4WYWA 1Z4UA 1FKPB 1J5OB 5DLGA 3BGRA 1C1CB 2W9BA 4XPCA 1EETA 1JLGB 3G86A 2ASDA 4YR3A 3Q8SB 2C2EA 1ZTWA 2IM0A 2RKIB 3V4IB 2C2DA 1S9GB 4RW7A 4ZVFA 1T05B 4MFBB 4LQ3A 3DDKA 1S49A 4URGA 4O4GA 5EDWA 3RB6A 1UWBB 1N6QA 1J5OA 3DRRA 1QAJA 2IM2A 3CJ5A 5EUHA 4KV8B 4K4UA 3OL6A 3OSNA 3NL0A 1S1XB 4ICLA 4ECXA 2FLNA 4J9NA 5C42A 5KG0A 4O3PA 1RT1B 1KHVA 1VRUB 3PW0A 2VG6A 2BANB 3QIDA 1MU2A 4RW9A 4KFBB 5K14B 5KFLA 3T5HA 4RW8A 4O3QA 3KHLA 4RW4B 3JYTB 1HNVB 3PW4A 2OPSB 3V81B 2VA3A 1JLBA 2ZD1A 2BE2B 5J2NB 2VG7A 3MECA 3DLKA 3QGHA 2C28A 2YNIB 1S10A 3M9MB 3NKYA 3V81A 1GX6A 3I5BA 1IKWA 3GV8B 1S1UA 2HNDA 2FLPA 5K14A 2BRLA 2UUTA 1TP7A 1VRUA 4F50A 3CDEA 1S9FA 4TY9A 4O3RA 5C42B 1N5YA 1JXLA 3QO9B 2W9CA 1RA7A 4G1QA 4ECSA 3SFUA 5J2PA 2R2UA 4NZ0A 1C0TB 4ED6A 5KFFA 4NLVA 2ASLA 3NAIA 4YQWA 5J1EA 5KFAA 4O4RA 3NGDA 3M8PB 3G6XA 4HYKA 3V6HA 3LANA 2JEJA 2XWYA 3KK2A 1RTDB 3T1AA 4KE5A 3EZUA 1IKWB 3Q8RB 2JC1A 4PUOB 5KFVA 4HKQA 1U09A 1HQEB 1BQNA 1HMVA 1C1CA 3LP1B 3H4BA 2BQRA 5KG6A 4ED0A 3KMSA 1N48A 1N4LA 1T03B 3JYTA 3N6MA 2D7SA 1SH0A 5DGAA 4TXSA 1RTHB 3QIPB 3ITHA 2WK4A 2R2TA 2JEFA 1JLCA 2HAIA 3KK3B 1SH2A 3ISND 4LSNB 3M9OB 1UWBA 3M9NB 4ZPDA 2GIRA 2W8LA 3LP1A 4O3NA 1HMVB 5KFEA 1TKTA 1QUVA 2YNGB 4JUZA 1HQEA 4ECZA 2YNFB 3KHGA 2R8GA 2JC0A 3GIMA 2FJVA 2RKIA 4NLUA 1XR6A 2ILZA 2IJFA 1EETB 3OSPA 1S6PA 1S6QA 3LP0B 5F8IA 5KG3A 4WFXA 3QZ7A 2IM3A 2WHOA 4IR1A 4FBTA 1FKOA 4IQXA 3IS9B 4DL2A 1LWFA 4FS1A 3PW5A 4O3SA 3BJYA 2AX1A 4PQUA 4IG3A 5KFNA 1RT5B 5F8NA 2CJQA 3C6UA 3KLIA 3D5MA 5C25A 1W25A 4TY8A 3LAKA 3HVAA 3DLKB 2XI2A 5F8JA 2OPSA 3KLGA 4DL5A 2FLLA 4NLYA 1DTQA 1HNVA 3OHAA 3MEDA 5D3GB 4ZHRA 4RNMA 4H4MB 4O44B 2R2RA 1NHVA 2BANA 1ZETA 4K4VA 1RT1A 3FQLA 4MIBA 3M8QB 5I3UA 4Q0BA 1S1XA 1JLAB 4ICLB 4TQRA 2B5JA 2IAJB 4JV0A 4ECQA 2GIQA 4RNOA 4U7CA 3CO9A 2XC9A 1T05A 2VA2A 1S97A 2GC8A 1IKXB 3GQCA 2WB4A 5KG4A 3HHKA 4YR0A 3KK1A 1TKXA 3G6YA 1QAIA 5EWFA 3EPIA 4QW8A 2W9BB 3BGRB 5KFHA 1FKPA 3MFHA 4J9KA 2AGOA 4MK8A 1QE1B 4EBCA 1DTTB 3QLHB 1TV6A 3HVTA 4K4XA 4PWDB 1HQUA 4WE1B 5HBMA 5HP1B 1LWCA 1C1BA 4KBIA 4R5PB 3G6VA 4TYBA 4IH6A 3KLHB 4ED8A 2VG5B 1SV5B 2UUWA 3LP2A 3KLEA 3CJ2A 2E9RX 2E9ZA 5KFOA 2R8JA 3MEGB 4B3OA 4ECYA 2HNYA 1RT2B 3I0SA 4YR2A 1K1SA 3TAMB 2HMIB 2OH2A 2IC3A 3DLEB 3NBPA 4NLQA 1GX5A 4K4SA 4I7FB 4NLSA 1S1TA 3H98A 4I2QB 3H5SA 1BQMB 3BQ1A 4J9OA 2JEGA 1FK9B 5J2QB 1RA6A 5KT7A 2OPQA 1C2PA 3DRSB 3Q8PB 1JKHA 3RB0A 3BR9A 5EWGA 3DRPA 3OLAA 3KHRA 3DLGB 3E51A 3RAXA 1S0OA 1R0AA 2I5JA 5C24B 3IG1B 2WTFA 1KLMB 4LSLA 5L1LA 3DI6B 2CKWA 4ZVHA 1S1WA 3V6DA 5DQHA 5F9NA 2C22A 4J9SA 3KOAA 1TKZA 3BSOA 3V6JA 2IMWP 1RT6B 1XR5A 3KMQA 4O3OA 4ZPCA 3IRXA 4RNHA 5HLFB 3ISNC 3KNAA 3KLFA 3IRXB 2D41A 1EP4A 2IM1A 3MR5A 5L1KA 1S0NA 4M94A 2FJWA 2B6AB 3T5KA 3DMJA 5KT5A 3I5AA 2AQ4A 3DOLA 4FBUA 1REVA 4LQ9A 1VRTB 4NCGB 4LSLB 4JV1A 3DM2B 4I2PA 2YNHB 3FDSA 2YKMB 3GIIA 2OPRB 1NNDA 3MEEB 4YP3A 1S4FA 1HNIA 4MIAA 4Q45A 1DLOA 4ZP9A 4F4ZA 1JKHB 2BQUA 1S1VA 4IDKB 4J9QA 2W7PA 1IKYB 3C6TA 4TN2A 5KFIA 1IKYA 1LWEB 3ICLA 3KLVA 4ID5B 4RUAA 1S1VB 1RT7A 4IDKA 5KFUA 3MFIA 3GILA 4QWBA 3I0RB 2RF2A 1T3NA 4R0EA 3CDUA 2F8EX 2HNZA 2IC3B 3DLEA 5KFSA 5KFPA 4WZMA 3BREA 3EPGA 4K4TA 3H2LA 2YKMA 4NLXA 3MR3A 4ECUA 1S9EA 4OL8A 2UVVA 1LW2B 1RT2A 5FDLB 2J6SA 2V4QA 5FDLA 4NLGA 4IG0B 3H5XA 4DG1A 4G3IA 1C0UB 5CYMA 3DYAA 3H5YA 4WYLA 3TVKA 2HWIA 4ECWA 4QWAA 1S0MA 1RTJA 5I42B 4WFZA 1TQLA 1EP4B 4M95A 5JUMA 2OPPA 4K50A 2RF2B 4IH7A 2BQ3A 3I0RA 4PWDA 4DL3A 1N56A 1JLFB 2ZE2B 2RDIA 3FFIB 1NHUA 3LALA 5KFZA 1ZTTA 3GV5B 3BQ2A 1RT3B 3H5UA 3N6NA 3FQKA 3Q8QB 4J9LA 5F8MA 1HNIB 1R0AB 5KFCA 4IFYB 3CWJA 3PZPA 3DLGA 5KFJA 1HPZB 3GIJA 1WNEA 4R8UA 1HPZA 2YNHA 1HYSA 4WZQA 3DOLB 1TL1A 4IR9A 2R2SA 4MKBA 1BQMA 3UR0A 2WONA 3CVKA 3FFIA 2XCAA 1JLFA 2ZE2A 4ZVEA 3HKWA 5F8GA 2W8KA 3M8QA 4IFVB 1TKZB 3DYAB 1RTIA 4J9PA 3MEDB 3BQ0A 5CYMB 4EYIB 2WOMA 3CIZA 4IG0A 5KFXA 1IKVA 1RT4A 4ZMMA 5KG5A 2ASJA 1IKVB 4ZP6A 1RT4B 4XO0A 2ZKUA 2WOMB 3CJ4A 4ED2A 2I5JB 5C24A 2V0NA 2VG5A 2UVUA 3CJ3A 4GC6A 1T94A 4ZPAA 5J2MB 5KFTA 4IFVA 1LWCB 3H40A 1TVRA 4MKAA 4ZP8A 2JLEA 4IG3B 1RT7B 4NRTA 2YKNB 1LWEA 4ID5A 2HWHA 3C6TB 2UVWA 4RU9A 5L1JA 1TL1B 3MF5A 3PVXA 3HVWA 3CJ0A 4IRDA 1TVRB 1RDRA 5KG2A 1HYSB 5DGBA 4IRKA 1TKXB 4KSEB 5J2MA 3KK1B 4QWCA 3RBDA 3I0SB 4WXWA 3RB4A 2HNYB 1RT3A 4TYAA 2YNGA 2QE5A 4NLPA 3PJXA 3UQSA 2B6AA 4NRUA 5KT3A 4QWDA 3QZ8A 4ECVA 5HBMB 2OPPB 5HP1A 4KB7A 4ZP7A 2AX0A 2ILYA 1HQUB 1RTHA 1RTJB 3QIPA 5I42A 1TV6B 3LAMA 2WONB 2R8IA 1DTQB 4IRCA 4KAIA 2FVCA 3V6DB 1S48A 3GIKA 1KHWA 2JEIA 1BQNB 4WXOA 4ECTA 3FRZA 4R8UB 3DRPB 2WRMA 2V4RA 4F4WA 1D0EA 3QGIA 4IFYA 2HNZB 1IKXA 5F9LA 1RYRA
chains in the Genus database with same CATH superfamily
1JXEA 4UY85 2O5DA 3DRSA 1C0TA 5JXSA 2CJ9A 4ZCLA 3TQ1A 1BDTA 2WSEC 3CJQA 3D0HE 4I7FA 4QIEA 4V1Ak 3LWMA 3SZ2A 2R42A 4KPCA 2LA4A 5D15A 1B3TA 1T11A 3AB4B 3OVSA 4CCHA 2JVOA 2GCFA 1N32J 3MEEA 3SBMA 5LM7E 5A2QU 1I6JA 4TKTA 3LUYA 3TNVA 3POTA 4TQSA 1JB0C 1VS3A 1WHVA 5J1PA 2FHJA 3HFZB 2YKPA 4NYPA 2ZBPA 2QYCA 4DX6A 4LFCF 4B3SJ 3JAMU 1JLBB 1DARA 3HHEA 3LWLA 3JSYA 4XTTA 1JLCB 3N6LA 3RZAA 5KFRA 3ZZUA 2ALZA 1SJ4P 4Q2MA 3MR6A 1WOSA 2AMCB 2FHKA 5KFMA 2UU9F 1GK8A 4FS2A 1KRPA 1Y5IB 3GIRA 3QLHA 4QYRA 5GAEU 4ER8A 3QRRA 1CBKA 3TZZA 4PXEA 4FXVA 5C2GA 3FSIA 4AT1B 2HFZA 4PUOA 3HSZA 4U7UD 2CUYA 1WC1A 4ZJLA 4LF6J 2D1CA 2ZHAA 2VUGA 4YN3B 4ECRA 4QPXA 4QR0A 1PGZA 4LF7F 1CJUB 4X4TA 4FF1A 3OL7A 3BSCA 3AT1B 1L5UA 4DOZA 1UVLA 1RB0A 4B3RF 3G82A 1WTFA 2MGZA 1FVQA 1U1MA 1VQLS 3SQGB 2QA4S 1WOOA 3GWCA 3L9ZA 2I9SA 4M5LA 5D0EA 3GV7B 4MH8A 3MOJB 2VOPA 4NMXA 3NBPB 2OUGA 3GLJA 1K8AT 1CJVB 1FE4A 4Z7CA 5DDOC 3MAQA 1Q82T 2FVSA 2OJ3A 3BBCA 3AB2B 2YKOA 1U0HB 2YTCA 2FTRA 3IGNA 4DJBA 2D3ZA 3RB3A 4NWBA 3AJ2A 3C19A 2ZM6J 2KELA 1OYEA 1QD1A 5E3AA 4ILMA 3UDLA 1B7FA 5CYQA 1RAJA 3TWZA 5DG9A 1K44A 2IJNA 4CP5A 3UVJB 2EVZA 1H7XA 1YG0A 3BKTA 3PW2A 2KU7A 1T3NA 1CQNA 4K4WA 3DFEA 2GVZB 1FRMA 1BC6A 3VV2B 2PSZA 4Q43A 3VAGA 1WHXA 2E9TA 2WB1D 2C2NA 3I9ZA 5ETTA 1GFWB 4O4GB 2FVQA 1WTBA 1FKOB 3IS9A 4ZVSB 1DLOB 3CC2S 2FHOB 3TUIC 3K58A 1RACB 2NXNA 3PXGa 4KGVB 1S9GA 3MMJA 4PAAA 1S7IA 3OL9A 2RS2A 1VI7A 2VD3A 3TUJC 4RUCA 4LRCA 3THPA 5D4OA 2D9PA 4DZDA 1FERA 2E5LF 2V9WA 4WF9Q 3DMJB 1T9XA 1NPRA 3I6PA 3K8WA 4TLRA 1WDTA 2NPIA 5KG7A 1AUSL 3CDWA 2XZTB 3KK3A 4CIOA 1NO8A 2AJ2A 4DV3J 2DR8A 3GFHA 4RW6A 1OO0B 2DGSA 3O44A 4C6AA 2EBEA 2DR9A 3FZ2A 3J80Y 3HVTB 2JH3A 2KYZA 4QIFA 1U7LA 1T03A 1L3VA 2Y9HA 3MPWA 1CJTB 2XS7A 2DISA 2VFVA 1S1WB 3MCOA 4C7QA 2Z30B 2NUHA 2HZAA 1F5CA 1KLMA 2CQ1A 3IG1A 4NLDA 3PR5B 3ZTPA 1D09B 2W7OA 4IOAQ 1XR7A 1NUEA 1SQFA 3BGOP 4WIQA 4EWTA 1SKUB 3DC2A 4DV1F 2A3JA 3V4MA 4BLGA 3F44A 5KT4A 1X9WA 4C9DA 1RWWB 4RWWA 3OL8A 2AWZA 2KKHA 1FK9A 5J2QA 3DLBA 5J2PB 3H59A 1NEEA 2EFPA 2MDAA 3IAS9 1RWUA 3B4DA 2E1RA 2Z58B 3PKYA 4UY8T 1JWWA 1NSKL 2DPJA 1U2CA 2I1RA 3SXLA 2X51A 3KUGA 3P5TL 2AYEA 1LW0A 4ZOSA 3JQJA 2HNDB 4LF1A 4NA1A 3UFCX 4F3QA 4OJHA 1Y5LB 3QOQA 2BKOA 1X5OA 3FEXB 3O6QA 1KOHA 2XSFA 5KFBA 2OEJA 1Q1KA 1S79A 2RHQB 1RTZA 2QA2A 3BKUA 2NR0A 4WFAQ 3QGGA 2XHWA 3HX9A 4PPDA 3FSYA 2DXDA 2P8IA 2NYHA 2HG4A 4YDDB 2IFXA 1ULRA 4HLBA 4TY8B 4KFBA 4ES2A 4J9RA 2R7VA 3C6UB 4M63A 4BWJA 3K17A 2C3UA 2HVDA 3OFFA 1WEYA 1FWLA 5KFWA 1T8EA 3K2YA 2DR7A 1RWKB 1VQ4S 3IR5B 4MJWA 5F8LA 2K1RB 4YY3F 2KHCA 3JTNA 4C8ZA 1Z4UA 4DU8A 1J5OB 2P2CB 2EI5A 3LH2S 5D0GA 4OYXA 3VGTA 1LXJA 1U02A 1ZA2B 2R9LA 1ZM2A 7AT1B 3Q8SB 1HWIA 1Y0HA 2DNOA 4ATNA 3QFHA 3D2WA 2H48B 2OGUA 3AJ1A 1QVGR 4RWXA 2ZM6F 5GAHI 1LOUA 2DNHA 1N5QA 1S49A 1H98A 3RGIA 3HJFA 2NQPA 5CZVA 1HBUB 1UWBB 4YOEA 3DRRA 3CJ5A 2BX6A 5EUHA 2LECA 1NLAA 1NH7A 2E5GA 4DFJA 4O0NA 1YRXA 2FLNA 1V5IB 3ZTOA 2RHSB 3D3BJ 3PJ9A 2VG6A 2BANB 3MZIA 3L09A 1MU2A 2CJAA 4RW9A 2PFDA 1Y9OA 4YHHJ 2H4YB 2VOOA 3ZZTA 3ZO7A 3JYTB 2UUBJ 2MEWA 2XMMA 2C3YA 2PMHA 3EDRB 2ZD1A 1NDLA 3MECA 2B4UA 1H2TZ 4OYOA 3IBCB 2C28A 3M32B 1U6ZA 2ZHOA 4K2XA 4DPWA 1IKWA 3GV8B 1S1UA 2VH7A 3GG0A 2ZBCA 1X4BA 5K14A 1M5PC 4P73A 1EKSA 1WKLA 5E3QA 3UCZP 4O3RA 1TL7A 1X4AA 2LP4A 3DNCA 3HD2A 3QO9B 4G1QA 3HXMA 4ECSA 5H9FK 2DY9A 2MKHA 1MMDA 3SFUA 1UPMB 2GIFA 3K59A 2YQ3A 2CPHA 4CYUB 2R2UA 1C0TB 2P9GA 3MR7A 2JJ4D 5IT9U 3G6XA 2AKWB 5HANA 3EXYA 4HYKA 4CM2A 2MYFA 4NX9A 1RTDB 3T1AA 3KG4A 3M8ZA 4HKQA 1WKKA 2GNKA 5KFVA 1U09A 5M2UA 1UA1A 2RUGA 1TK8A 1C1CA 1HWLA 2GJFA 2XNQA 2BQRA 4C8LA 1CJKB 3KG1A 4FVMA 3MXHP 2CWKA 4A4JA 4DS4A 4C8NA 1N48A 3A4TA 3UO0A 1WI8A 4DV2F 2D7SA 1SH0A 4RPFA 3IC1A 3TUPA 2WK4A 2HGLA 2R2TA 2JEFA 2YPZA 1ICEB 2DNPA 1GH8A 1EX8A 3KK3B 1SH2A 3ISND 1XN9A 2GHWA 4ZPDA 2GIRA 4USMA 2W8LA 4FF3A 2YNGB 3DU5A 1GAOA 1YBUA 3T6JA 4DV4F 1KFSA 1HLWA 2A2CA 2KXFA 4DR7J 1LV5A 2CQ2A 2FJVA 3MAAA 4NLUA 2ILZA 4PG5A 2CNOB 2JLGA 1EETB 4DR2J 3OSPA 1NSPA 3LP0B 4WJBA 4USTA 4QYZJ 2OFHX 5A76A 4DL2A 4CLUA 2O66A 3KJFB 1Y4ZB 1OSCA 4ZLJA 2W25A 1EB0A 2CQBA 5A8WB 2JLFA 1N34F 4FXDA 4NE9C 4P7VA 3BH7B 4PYAA 2D3O1 3RR8A 2LLZA 2GFFA 4TY8A 2FDNA 4WP8A 3GR1A 1BHNA 3DLKB 5HSPA 4ELVA 2BA9A 1SI9A 2FJAB 3KLGA 2OPSA 1MYKA 3Q8YA 2AEFA 1DTQA 1HNVA 3OHAA 3MEDA 5D3GB 1RKJA 2DNNA 3AJDA 4O44B 2CQHA 5ETPA 3SQOP 4PWUA 4ZHRA 4RNMA 3G8TA 3G6ES 4GKJF 3ET6A 3A12A 2KHDA 2POKA 2MJNA 2LEBA 1GXUA 1LFWA 5EX0A 2XTEA 5I3UA 2DNGA 2HWTA 2B5JA 3C14A 3OBIA 4TQRA 2UU9J 3U27A 3D6HB 2HURA 2VDIA 4DSEA 4Q7AA 3AD7C 2Q2KA 5F41A 4DV5F 2QO3A 2ADCA 1S97A 1EIYB 1T0TV 2GC8A 1IKXB 2RT3A 2VA2A 2WB4A 3RBZA 4RKUC 2CVEA 3MMCB 2I8EA 5KG4A 4X4NA 1D3WA 2DKOB 3G6YA 2E1CA 1A9NB 2BJ3A 2E1PA 2VPXB 2BYCA 2RJZA 2J0WA 2GQQA 2OTLS 1QVFR 4QW8A 3T1HJ 2A2DA 1VOMA 3BGRB 5KFHA 1BQXA 4A47A 1FKPA 2DITA 3BO3A 3VVTA 3HHLA 4YB7A 4NCAA 1Q0NA 2B3TB 8AT1B 4GVBB 2YH0A 1TV6A 2MQLA 1C4CA 1U1PA 3X1LB 5HBMA 4IO9Q 3A8EA 1FRLA 1RAEB 1HNZF 3N79A 4ED8A 2PD1A 1S99A 2FYXA 2CVIA 4B17A 3LP2A 2UUWA 2HQ3A 1HBNB 3KLEA 3CJ2A 5KFOA 3QMQA 3EZ5A 2GAHC 4QZVB 3DLHA 4CQ1A 2HNYA 1RT2B 3DU6A 2EBGA 3M6WA 3QRPA 4NA2A 2J9DA 3V2UC 5HJXA 1YGYA 1BWVA 4FVCA 3GMGA 4X64F 5D8HB 3DLEB 1RU1A 2AV5A 3OD2A 1VGYA 4UUWA 2A6OA 4F3OA 5IXUA 4I7FB 2KDOA 4NLSA 4J9OA 2P6TA 4I2QB 4LR7A 1FK9B 5J2QB 4KQZA 4KT0C 3P6YC 3M2RB 5FLXY 5D0HA 1JKHA 1ZA1B 2AEMA 5AXMA 1WKJA 3RU0A 4EMDA 3CMAS 3CCVS 3BO2A 3F56A 4ZCMA 1R3NA 2G1HA 2CQ4A 3DRPA 1U9PA 1AYEA 3P45B 1GNKA 1MWYA 3E51A 2DEIA 5A6WA 2MZSA 1YIJS 2EFVA 2ACYA 2HS0A 2WTFA 1KLMB 4ELTA 4ZN1A 2CKWA 5E3PA 5HI7A 1R27B 2W2QP 5CAAA 2C22A 4J9SA 4CLLA 2DYAA 3MCNA 2IVFB 2EK1A 2F9JA 1U0HA 2KJVA 1FDAA 4H4KC 3OTCA 3BSOA 5IC6B 3W1YC 2IMWP 2N4DA 4X66J 3M6XA 1UPPA 4O3OA 3HVRA 2UUCJ 2J5AA 4RNHA 2LFVA 3KNAA 3ISNC 3UDEA 5L1KA 1B01A 2IM1A 2J8SA 2DNLA 4WK3A 4XAKA 3W9HA 3NMRA 1FEHA 5ETMA 1H0HB 1HBOA 2B9XA 2EFGA 2HQIA 2PA3A 3CO0P 3G82B 3K5OA 3MDFA 5B0DA 3D66A 3D7SB 1SJ3P 1NPKA 1YQHA 4KJIA 1X8DA 1REVA 1VRTB 4K5RA 1UTAA 2V6AA 4LSLB 3I55S 3IR7B 4I2PA 3ZC4A 1Q79A 3M7VA 2BJEA 2C2KB 4K59A 3MEEB 1S4FA 4EK2A 2UUAF 3M6UA 1DLOA 4ZP9A 1DHMA 2IRYA 1M1KT 3M2RA 2ZH7A 1HNXJ 4AL5A 3T9ZA 2DD8S 4X84A 3LA0A 2O3DA 4TN2A 4J9QA 1FJEB 3RRGA 1P1LA 4OMFG 2CJXB 4NL5A 1V6HA 5KFUA 3MFIA 2J9EA 2QYGA 3Q22A 1QSSA 2XYGB 4C98A 2BJ8A 5KFSA 5E41A 2IC3B 2B0GA 2WVCA 1CS4B 3K0JA 4WZMA 2M2BA 1KVJA 4K4TA 2CAXA 2YKMA 1OQ3A 2H54B 2M70A 1GTEA 2MQMA 1OWXA 4QOTA 2FZGB 4ZCKA 2ZH4A 5HMXA 4UZBA 4UOHA 3R5AA 4ZVRB 1QAXA 2YWHA 2E29A 3HULA 4NLGA 1G2EA 1WF2A 2OHDA 4G3IA 4J37A 5CYMA 2Z57B 3TVKA 1RXOB 2QA1A 2EKNA 2QA4G 1UVNA 1RTJA 3W8GA 3IBWA 1TQLA 3D0IE 4OX6A 2DH7A 2AEJA 2RF2B 2BQ3A 3P96A 1QSYA 2LDIA 2COLA 4WP9A 3K7RA 2F8MA 3FFIB 5GADI 1TK5A 3GJRB 2V94A 5IV4A 2OEKA 1ZTTA 1G3OA 4TU9A 4CO3A 3GV5B 2KZZA 3BQ2A 2DGWA 1WEZA 2MY7A 4LFCJ 1P9YA 2QMWA 3KFWX 3MOZA 4IFYB 2HW3A 3LGNA 1R7IA 3FC9A 4B9VA 1HPZB 3J7A1 4R8UA 4LFBF 4WU3A 1U47A 1FWKA 5GAGI 1VC0A 1HYSA 4H4KA 2EWHA 4RR5A 1X5PA 1HI8A 3DOLB 1TL1A 4IR9A 3GJQB 2V1SA 1WOPA 4DR5F 1BQMA 3UR0A 4YHHF 3TOQA 1IBLJ 1MWZA 2XLIA 1OPIA 4ZN3A 2RU3A 1X5TA 2KG0A 2R4FA 1PYTA 2F1FA 2MKIA 1HWUA 5DETA 5H1SV 2OI2A 3DYAB 3RRKA 1RTIA 5HQMA 3ZXWA 2B9EA 5CYMB 4EYIB 3OTDA 1IKVA 1RT4A 2DBBA 1FE0A 3BDEA 4ZP6A 4DR7F 5DM6Q 1LFPA 1H2UX 2W7AA 2MQOA 2UVUA 1FCAA 2B9YA 1M90T 4ZPAA 3BYRA 2HQCA 4CWBA 5KFTA 3DOMA 4IFVA 3H40A 5HO4A 2K2PA 3KJNB 2DEJA 4ZP8A 1HW9A 3RB6A 2CG4A 1RT7B 2E7XA 2XLKA 2YWWA 1LWEA 2E7WA 5B09A 2OEMA 4I6YA 2MLZA 2HWHA 4ID5A 2VJUA 3I4HX 3HT0A 4F2RA 1URNA 4RU9A 4LF5J 4ZLLA 4N76A 3NLCA 1YJ9S 3O5TB 5DS7A 4LR8A 4K5SA 1RLDA 2DNRA 4ZK7M 1HYSB 2DRDA 3QJLA 5DGBA 3HM9A 4KSEB 3DLJA 5HVFA 2PI4A 1NDPA 2EC2A 2GO8A 2IBOA 3MM6A 2HGNA 4CLPA 5IS2A 3I31A 3PO4A 4WXWA 3WX4A 1UEUA 3RB4A 4JB8B 3ILIA 3PTWA 2DGUA 4HDHA 1F3VA 5LL6d 2FQQB 3PEHA 4PG7A 1AT1B 1V5VA 5HN0A 2XWXA 3PM9A 1WC0A 1VFJA 4M5KA 4L74A 3UDVA 1H73A 3FSXA 4I6AA 5CH7B 2FLOA 1TV6B 3NS5A 4HI2A 3R97A 2XY5A 1RCXB 2UXCJ 3KNGA 3LAMA 3MMAA 4DV6J 2JFDA 3FBFA 2Q79A 1FTRA 4DV7J 2J0QD 2UV8G 3V6DB 2ZZNA 3LF0A 3FCVA 3CT9A 3GIKA 3CCSS 1UAWA 3BO4A 3CDAA 3SV3A 2M7SA 3MMCA 3QGIA 1YJWS 2CIMA 1H72C 4CLTA 5F9LA 2BJ1A 3IO1A 4K4YA 3AH6A 1GQEA 3UPFA 4USUA 3SCKE 4RNFA 3T5LA 2UXCF 1WC4A 4DQIA 2V34A 2R3VA 4EBDA 1BWEA 2GS8A 3QT6A 2LEAA 2QV6A 4NCBA 2FHJD 2YKNA 2NXUA 3ENVA 4MJKA 4URSA 2FY1A 2YKQA 2HYIB 4QYZK 4Y34A 5L9NA 1YZ7A 1RADB 3JXOA 3MM7A 4ZIVA 2HHWA 4M5MA 2WCXA 4N8OA 5BXIA 4F4XA 4DPXA 4ZIWA 4PABA 3FMTA 3H4DA 2HRTA 4KPYA 2Y8YA 3FT7A 1MNTA 2FY8A 2B9WA 1VISA 2HBQB 5L38A 3LP2B 1IBMJ 1HBNA 3KLEB 2R8HA 1PARA 3K5NA 1FX4A 1YWXA 1RBOB 4OLPA 4ZVTB 3K57A 1M1GA 2DY1A 2D3OR 2KYXA 2JL9A 2ZUGA 4CDIA 4USWA 3U1NA 4F0HA 3KUEA 5KT6A 5HLFA 1HQ2A 2E5JA 1VBZA 3SFGA 4EO6A 1D1UA 1RWNB 3E3XA 4FDFA 4GVBA 5M2RA 3CCES 1A0OB 1BMQB 2BVZA 4RBTA 4DL7A 2K3KA 1DZ5A 4OJGA 3GSIA 3V6KA 5BR8J 2ZITA 5KFQA 4JV5F 4WTYA 2HZVA 3THTA 1KNZA 2ZNYA 2N3OA 3F73A 2UXBF 2IA6A 1F1BB 2JSXA 3OFGA 2H3EB 1IBCB 4Y00A 3K5MA 2OIHA 4Y2AA 2A1BA 4FZVA 3Q23A 1SH3A 1VQ9S 2XSJB 2W24A 1T3OA 3CJSA 3IR7A 2PA8D 3NCQA 4I2PB 4MK7A 1RHRB 1ZS6A 3CTRA 3BM7A 3H8YA 1TKTB 4DR3J 3CC4S 1F6TA 3BSNA 5E33A 5DDRC 3Q24A 2LXFA 4DUYF 2W9CB 2AGQA 4JI1F 4X65F 2QFJA 4Q8EA 4U7UK 1SCJB 2DGQA 4Y3CA 2QLBB 1IBLF 2B7BB 4E2FB 4U95A 2KM8C 3PRDA 5D78A 3RBEA 5D3GA 1UVMA 4NXNJ 4OIXA 1ELOA 3QQCD 4DG1B 2LXUA 3C3LA 1RWVB 1MROB 4B3OB 3HD1A 4OHWA 2V8GA 1B0VA 2HLUA 4CLFA 4X2BA 2ZVIA 3OJSA 1LKZA 2B56A 3BPSP 2GVDB 1VK3A 2YWFA 3BSAA 4KRWA 5ETNA 3W64A 4CTAB 4RNNA 3C15A 1LW0B 1JJ2R 4WE1A 2HPUA 1IN0A 1NZ8A 1UP1A 1SL0A 2OPQB 2D69A 3FCWA 3MPYA 3OFHA 4J90A 5HMZA 4PQUB 2CDQA 2LEPA 1RWPB 2PN6A 2M88A 4I2QA 1SKSA 3NXZA 2KO1A 2L9DA 4DR1J 2EFNA 3E01B 2QTWA 3NS7B 3GFXA 5B0EA 3KJVB 4UTGA 2GPEA 4A8KA 4K0KF 4RW7B 3R5JB 1VK8A 2ATCB 3GYNA 4E98A 2W9AA 4DQRA 2HMIA 3MTKA 4DV4J 4JI4F 4NCGA 1UUJA 1REVB 1RAAB 1VRTA 2VG7B 3DOKB 2CQIA 2ZD1B 4ILRA 1J27A 1U1NA 2HHUA 2ZC3A 3JQMA 2K3IA 4AQYF 4RW8B 3HMJG 3MPVA 1F5AA 3VGVA 4JI7J 3N9UC 1HA1A 3ZZYA 2BBEA 3GXQA 2Y3YA 4OZ5A 1RT6A 2DRBA 3BF4A 3GZ7A 1K1QA 2BE7D 3ELHA 4FNIA 4Y0FA 2BR0A 3NAHA 5LSRA 2FPHX 2NSBA 2Q6BA 4LBPA 4KH0B 1NXIA 4CT9A 5KFGA 2C2MB 3DI6A 3DOKA 2IRXA 3L7UA 1N36F 2V8VA 2DPIA 2BABA 4NYZA 2ZFHA 3OR2A 1K0VA 1LK5A 1R8PA 1UL3A 2PC6A 3PFEA 4B3TF 4OQJA 3RW6A 1RT5A 2XGQA 2AF6A 4DL4A 1HR0J 4UT4A 3FBBA 2OSRA 1M0SA 3EGVA 5LJ3Y 1F9HA 3E01A 4Q44A 3KJVA 2LMIA 5HQ8A 3IRWP 4ZVGA 1W7WA 3L95X 1R43A 1N0UA 1QTNB 1AA1B 1X31C 3T19A 3CUNA 2XI3A 5M2PA 3RG6A 3LP0A 2FVRA 4URQU 1UCNA 4W90B 4KKOB 5E5NA 3PFOA 4A8MP 2Z56B 3M6VA 4Z37A 1O6XA 4HVZA 4ZPBA 4ZHRB 3S1TA 5CYQB 4DPOA 4LFAF 4KO0B 4P7TA 4OYPA 3ZZ0A 5B08A 1XMOF 2W4CA 1WSVA 1CJTA 1IR2A 2KXHA 2YX4A 4OX8A 2ZH2A 5E3CA 3M2UB 4RBUA 3MUTP 1H2VZ 3KLIB 2VHGA 1C1BB 2Q43A 1XNQF 3ITHB 3VZIA 1ZPVA 5CHCB 3T3FA 1G4CA 2ATLA 4OHYA 1FFGB 1FWPA 2AW0A 2IYIA 2NZCA 1N5TA 2QG9B 5HK4A 3LW5C 4WYWA 1FKPB 1CJKA 1TK0A 1PAUB 2ZZMA 1B0PA 1CJUA 2ASDA 1YKWA 2H5IB 3JTOA 4DHVA 1PBUA 4U8VA 2G0JA 2RKIB 1BLUA 3V4IB 1DQ8A 3DHXA 1WF1A 1S9GB 3GCWP 4OJ3A 5AJ3F 2PMWA 1LNQA 1S57A 3WX8A 4MFBB 3GONA 4AFFA 3DDKA 4M5HA 1YJVA 3QBCA 5L39A 3C8YA 3R5DA 5JJBA 4KYZA 4YY3J 5EDWA 3UCUP 1N6QA 2XTJP 3M05A 4K4UA 3OL6A 2CQ3A 2XMKA 4KV8B 4ECXA 5CD4H 4J9NA 4DLGA 1G7CB 1RBAA 1FFSB 1RT1B 3B8HA 3FJ2A 1FA0A 2H1OE 5MAOA 1UFKA 4X4QA 3CCJS 5KFLA 3T1YJ 3PNIA 2WVBA 4KFBB 3CCQS 3KHLA 4RW4B 3ZTQA 4TU7A 1QTGA 2F5GA 3QJJA 1X5SA 7FD1A 1JLBA 2K7KA 2ZWPA 5CA5A 1EZZB 3DLKA 1NB7A 4C4WA 3NKYA 3NCRA 4JI6J 4XK8C 2AYBA 2DIUA 2FLPA 2HNDA 3PDNA 3CXCR 1T02A 3B78A 4OI1A 2BRLA 3R5CA 4OYMA 1U48A 4F7VA 1TP7A 4F50A 2FZCB 2QIFA 2U2FA 1UW4A 1YZ6A 3OR1B 4OZJA 4OYBA 4Y2IA 1GT8A 2M8HA 1S9FA 4DR6J 2DTJA 3G9CA 2UUCF 1GEHA 1VQ6S 5LMNJ 4WFNQ 4P6QA 4NZ0A 1NK4A 3PRVA 1YSJA 1SC3B 4DL6A 2GHPA 4ZJQA 4NLVA 2AJ1A 3V6HA 4JI2F 4EFAC 1NJZA 1FX2A 4M5GA 2YWGA 3BZQA 2XWYA 3LANA 2MZJA 3JTPA 4KE5A 1Q16A 3KK2A 1FKAF 4B3RJ 2JC1A 4V19J 5EX3A 3ILLA 3OR2B 1BQNA 3BGLA 1S59A 1KQKA 3MUMP 5KG6A 4DX5A 4ED0A 1N4LA 1KSPA 5DDPC 1JJHA 1CC8A 2VZ9A 4TXSA 5E3RA 2VBXA 4ALZA 1VC5A 3QIPB 4JYAF 1ZM4A 3ITHA 3B54A 1TFYA 3TW0A 2XZDB 1S5ZA 1WELA 4HHUA 2N7CA 1RAIB 2CXEA 3K5PA 3Q8VA 4LSNB 2A18A 3M9OB 1B7YB 3M9NB 2DNKA 4O3NA 1TKTA 3LJPA 1J2VA 2J8AA 2RQKA 2B7CB 1WWHA 2YNFB 4JUZA 4DPUA 9ATCB 4ZITA 2R8GA 2JC0A 1ZAVA 1X4EA 2RKIA 2FHMA 2VFTA 2BM0A 3ENWA 2DB1A 2GMHA 3EYZA 2AD9A 2IJFA 2I2YA 2BNZA 1Q8IA 1PYOB 4ANEA 3UN2A 2Z2YB 3CCUS 2Z8QA 1X4HA 1VQMS 3ZZRA 1FKOA 4IQXA 3IS9B 4CYUA 1LWFA 1FRXA 1Y00A 3A8KA 4O3SA 2LCWA 1ZBTA 3RTVA 2HQGA 4PQUA 3R6LB 3CD6S 5KFNA 3J7Z5 1M5SA 4LR9A 5F8NA 2FIUA 1NZAA 4KGMA 4EI2A 4HEA9 4ID8A 1H74A 2BXJA 1OJ4A 2CG8A 2MKSA 3LAKA 3M32A 4OI3A 1SL2A 4EZ6A 2N7YA 4UW2A 2D74B 1FJ7A 3HZGA 3OW2R 2BOPA 1NMEB 1XEZA 1F9EB 4DL5A 2FLLA 5CYJA 3UDCA 2VPZB 4KH1B 1MG7A 2R2RA 4H4MB 1WSRA 1FO1A 2W2NP 1JNRB 1CC7A 1PILA 1UJ5A 1YHQS 2GAGC 2VKRA 3MCSA 5MLCV 4K0KJ 5BYSA 5L46A 2O1PA 2QLFB 2IAJB 4Y65A 3HPOA 4ECQA 2MGZB 3NGRA 2HHHF 2H65B 4V19X 2Z4PA 4IQMA 1CPZA 2QMXA 3R27A 5HL7Q 4DSFA 3VEBA 1OY6A 2IRUA 3HDSA 4PQAA 1NK8A 2BDPA 2CPFA 1DBDA 2DHSA 3HHKA 2V67A 3UWTA 3KK1A 2KT3A 4M5JA 1QAIA 1U24A 3RW7A 2A10A 4NOHA 3EPIA 2J0XA 1G1XA 2CPIA 3FVYA 4HR2A 2UZAA 1YJRA 3P8BB 3DRXA 4AUKA 1FI4A 3MFHA 4JI8J 3N28A 3A13A 3EGZA 3S01A 4M5IA 2GVZA 3OVAA 3JSRA 1ZH5A 4PWDB 1LWCA 1RHMB 1AFIA 2ASYA 4CTAA 4TYBA 3KLHB 1D8ZA 2RE1A 3ENQA 2MXYA 5GMKa 1YJUA 1SV5B 3HP6A 3NP5A 1ZAXA 2E9ZA 2XULA 4OZLA 1MROA 1NLKL 4KGXB 2AIRB 4YB6A 2R8JA 4NPOA 4B3OA 1RISA 4LFBJ 4YR2A 4LFAJ 3POTB 2XMWA 3QFWA 4EU0A 1OMSA 3I82A 2XS5A 2OH2A 4L6V3 1HD0A 2GO9A 2IC3A 1R6YA 3NRBA 3NBPA 5DO2A 2H9ZA 3SSSA 4KC5A 4ETZA 4B9TA 4JI3F 5AXNA 4HHHA 4A8YA 2JEGA 3H98A 3BQ1A 3AFGA 3L3CA 1WJ9A 1WF0A 3O2IA 1RWXB 1X4CA 5D77A 2DNMA 1KVKA 5KT7A 3Q8PB 4CO1A 1Q5VA 3WZ0A 1E6VA 5GMDA 1FT8A 4OI6A 4BBYA 5DZ7A 1HL6A 2YQ0A 3BN7A 3KHRA 1R0AA 4L76A 5L1LA 1RJJA 3IG1B 1PG5B 2Q66A 4CI0B 2PEHA 2CDRB 4I68A 2BKNA 2K06A 3CMQA 1VIOA 5HATA 3UCGA 3MMAB 4LF4J 1TKZA 1M5KC 2C1EB 4J5OA 4C0OC 1DQ9A 2V8DA 1VHIA 3MR5A 4HH0A 4M94A 1Q78A 3HJVA 2B6AB 2VL1A 3I9V9 5CABA 1T9YA 5KT5A 3G2XA 5LJ5Y 1UA0A 4DQPA 3DXBA 4YUDA 1VQKS 4GKKF 2MSSA 4LQ9A 1MNEA 1URRA 4FPRA 4JV1A 2LYVA 2AYGA 2YKMB 1QDUB 4F67A 1ZM9A 2OPRB 3H87C 1CS4A 2BSQE 3EM1A 3RAMA 4Z2XA 2DR5A 4FKYA 1HNIA 2V8HA 4MIAA 1OSDA 2FUG9 3ETMA 1UMJA 5CCMA 4DV6F 5CCLA 4E0DA 1S1VA 1V9OA 3QSYB 3C6TA 4JI1J 2MTLA 1LWEB 1R8AA 3LGMA 3JSBA 4ID5B 1S1VB 5ETSA 5LOQA 4RUAA 1VLYA 2VIHA 5FJ4A 4QWBA 3I0RB 1IR1A 3M2VA 2RF2A 1B4SA 3W5YA 5DDQC 1FFWB 2HFUA 2F8EX 2G2YA 3C15B 4M5DA 1YJ7A 3EPGA 1NKCA 4F2SA 4OZ3A 4ECUA 3MR3A 1IBKJ 3GR0A 1S9EA 3CPWR 2UVVA 3NNEA 1TFWA 2YKAA 4JI0J 4FXEA 1TMJA 2H51B 1U4BA 3H5XA 3IBFB 3MM9B 2MZRA 4X4UA 4CH7A 4ECWA 1FRKA 2HWIA 4QWAA 1IQTA 4WFZA 1HWJA 1WORA 1Y3JA 2LQ9A 4Z7YA 5JUMA 4M95A 3IP0A 4K50A 4HH1A 4IH7A 3ZNJ1 2R7RA 4DL3A 1Q5YA 3MM5B 5B0CA 3BH6B 1CVJA 3DDNA 3RRHA 4DR6F 4MKYA 1R31A 1SJRA 2HIYA 3KWMA 5IOLA 4GRSA 3S7RA 4J9LA 4DUTA 3Q8QB 2EEYA 4EZ9A 3WHIA 1HNIB 3VALA 2V2VA 2MKYA 3PZPA 1HFEL 3DLGA 4LRDA 5T7LA 3BN4A 3ZNUA 1VLOA 5C7PA 1VBXA 1YDLA 2DGOA 2VPYB 2YNHA 1NK5A 2NUUG 2LXIA 4DR4F 4OX9J 2R2SA 3OTOJ 2XQCA 3W2VB 1U1KA 2M0GB 1ARRA 4PXDA 2IA0A 4R25A 4RX6A 2WONA 1VBYA 4LVNP 4CO0A 2BM1A 2XCAA 1QLNA 2VDHA 2YXLA 3K89A 3HKWA 3WC0A 4LJMA 1S72S 4IFVB 4M8LA 2RRBA 4ZLPA 1IWGA 2KOEA 4J9PA 1ZZNA 1OY8A 4MTPA 1UWAA 4NI2B 4OHXA 4OI0A 2DNZA 4KGZB 5KFXA 5KG5A 1TR0A 3ISZA 4USHA 4ZMMA 1APSA 2VFSA 2N4CA 3CJ4A 4NI2A 4ECZA 5RUBA 1Q86T 2G0IA 2C2OB 3CJ3A 1T94A 2BW2A 2XMUA 1DJ0A 3P5BP 1T7PA 2A2BA 4ZS6A 4N8NA 1KFDA 1TVRA 2LQ5A 3QNWB 4ZVPB 5SZTA 4X62J 3PX0A 4IG3B 1WEXA 2FC9A 3MWBA 4CH1A 2QN6B 3C6TB 3GSDA 1U49A 3KKFA 4JYAJ 4BDPA 5F3TA 3BEGB 1TL1B 3MF5A 3HVWA 1NKBA 3CJ0A 2KT5A 3M8WA 4DV1J 2QL5B 2XTCA 4IRKA 2AT1B 2HHXA 1TKXB 3RJMB 3KK1B 3TYTA 4QWCA 3I0SB 2M5YA 4C3KA 2ZUAA 2QL7B 4A8SA 2HHSA 5D4PA 1UETA 2QE5A 2V4JA 2XBPA 4NLPA 2BZ2A 3PJXA 4MKVA 4PG6A 5H9FJ 4WPAA 3IFEA 3UD3P 4FP9A 2EG1A 4WWSA 5KT3A 2HBYB 2KVQE 1B64A 3QZ8A 5HBMB 1NKEA 4ED5A 4ZP7A 2ILYA 3AOAA 1S6OA 3QIPA 1RTJB 1I94F 3VAIA 3R3TA 4YB1P 2OTJS 2R8IA 2E5LJ 1DTQB 4IRCA 2DGXA 4NEZA 3G5OA 4N5SA 1U1RA 3A3NB 3PCOB 1JNZB 3QWUA 2JEIA 3PHTA 1Z2ZA 4B3TJ 4WXOA 2XO7A 2IJRA 4DLEA 4ECTA 3FRZA 5IV3A 3DRPB 2WRMA 1D0EA 4IFYA 2HNZB 1HNWF 3LPYA 3R2DJ 2X1GA 2YWEA 3AQOA 2CQGA 4LRAA 2E7VA 1QJHA 1EKRA 2DHAA 1TAUA 1LWFB 2XYPB 4DF8A 4UOGA 4PRFA 2PFFB 5A2QY 1BUXA 2YWKA 3EE3A 2F4VJ 3Q86A 3D68A 2GW8A 3SCJE 2UP1A 3UD4P 4GO7X 5F0UA 1DFDA 3IXQA 3W3SA 1G6BA 4ZVOB 4U67Q 1U45A 5KT2A 5IT9Y 4P71A 4I69A 2MQNA 4H54A 1SV5A 4Y28C 2EFQA 3PYEA 3THVA 1NBEB 1S9EB 4A8WA 5HQLA 4ED7A 3PO5A 2GGPB 4OLOA 2ZKTA 2BRKA 4ELUA 4JP8A 3ONQA 2D3UA 3NS6A 4OZ0A 3AOBA 5IC4B 4BCAA 5KG1A 4AAIA 2QC3A 3FMBA 1VQPS 4ZVUB 2HSEB 4G65A 4FKXA 3T5JA 1D9DA 1VYAA 1YVFA 2AN7A 2HS4A 4MFBA 5G4DA 1X9SA 2R8KA 2JXIA 2KFZA 3LOUA 2OAUA 4KHMA 5U47A 3WBZA 2BJ7A 1UEKA 2V69A 3RYLA 2HRUA 2DXEA 2YQ1A 2W01A 5EGYA 5IM0A 3X3UA 3H25A 2K5JA 1JLGA 5DG8A 4Y2CA 2NPFA 1OPZA 1OIAA 4P2SA 2UXBJ 1HBMA 1YX2A 2VPWB 1IXKA 2QGFB 4C2MA 5L8RC 2ZH1A 2Y1JA 3D1QA 3QT8A 2JHEA 3QO9A 3TP2A 3D54A 2EG2A 2ZC4A 3QAUA 3PJWA 3H2VE 4F4YA 1KTQA 4S0MA 3HLUA 4HI1A 2FD2A 4P2FA 1JXVA 1KQFB 2DCLA 1HNWJ 3M1VA 1ZOTA 1AB8A 3ULHA 1ZAWA 4DR3F 2QZ8A 4JI5F 2ZDPA 2IDEA 4EO8A 3VF0B 2XY6A 1N88A 1YBTA 2PDAA 4QW9A 4PEOA 3AY0A 4LUBA 1RAGB 4RW4A 3UW1A 4RW9B 2AU0A 2CPYA 2HFSA 1E6VB 3DDIA 4KKOA 1HHQA 2RQMA 1FJGF 1MYLA 2J7WA 3M8SA 4WK1A 3EXCX 1PSDA 5KFDA 3J81Y 1MMLA 2RSQA 4RLEA 3W5XA 2MQPA 4X66F 1IRQA 4L72B 2GJ2A 4LRFA 5A8KB 4C8YA 1SUQB 1N5YB 1K9MT 1HARA 4FYXB 1X0PA 5I3PA 1QY7A 1SC4B 4A48A 1VC6A 1MSWD 2RILA 3G4SS 3V4IA 2MY8A 3CW2C 7FDRA 5KFKA 3TZXA 1RUSA 4DV2J 1U1LA 5DQGA 2MB0B 3HHLD 5B7WA 2H1YA 4USJC 5HVHA 1EJ7L 3Q0AA 1SKWA 3NMAA 2CPEA 3TA2A 3TEHB 1ZPWX 4MK9A 2MQ8A 4NZ6A 4I56A 4YMEA 5GADU 1LEOA 1PKUA 5ETRA 4Q0BB 1WD6A 8ATCB 3VAFA 2L9NA 1P6TA 1TL3A 5DRKA 4GC7A 2X3DA 1WUUA 3TRGA 1DTTA 3IN5A 5EHHA 4UOFA 5K20B 3KLGB 1KKHA 1MMNA 5JVHQ 4ED3A 2J6UA 5E0OA 1N54B 1X4GA 2HGMA 3Q89A 2C2RA 2VBWA 5AE3A 2V50A 2QX0A 3D28A 4DS5A 4UQGA 1I5OB 4NXNF 1P27B 1OS5A 2F4FA 3MUVP 4J7CA 4FYDA 4F8RA 3QYYA 4JI2J 3OLBA 1SUQA 4HT5A 2B8PA 2RD5C 4F3MA 2XO6A 4KHRA 1J5EF 2IAJA 4X62F 2XMAA 3RAQA 1RWOB 1U25A 4W4MA 5EWEA 1NCLA 2LU2A 1FJGJ 1JLEB 5HMYA 4QIVA 1UVJA 1FEEA 4O44A 1MW7A 4DXLA 1NHKL 4LBHA 4J9MA 4IKAA 4YB5A 2JDJA 1UKUA 4DZ6A 5LXYA 1AXQA 3JSMA 3PHEA 5KOXA 2BE2A 1NK9A 3F41A 5B0BA 1Y3KA 2RS8A 4NLRA 2XB2D 4DPYA 2QFIA 1TL3B 4I4BA 2PIIA 1CQMA 3L7OA 2PT0A 2SXLA 3G8QA 2RQCA 2HS3A 1KC8T 5L1IA 1JQGA 2QSWA 2ZDOA 4YDXA 2K7JA 4EBEA 3EICA 1HHTP 9RUBA 1T9VA 4WU2A 4JV2A 3JB9k 1F60B 3BKFA 3CEDA 3FBCA 2UVRA 3K5LA 1N6QB 2WVEA 2RRNA 3BPDA 3I96A 3BGRA 4ZPVR 5DLGA 4N41A 1EETA 2E1AA 3R5GA 3SDEB 3T1HF 1PJ7A 4P75A 2Y0SD 2IM0A 1OQ6A 4C8KA 2HFNA 1TELA 3CD7A 3SDEA 4RW7A 3NCPA 4ZVFA 5BYQA 1T05B 3HSGA 4ZPTR 4UQTA 1U26A 3EVMA 4LQ3A 1DQAA 1SQEA 3EJMA 4URGA 2UUBF 2KL8A 3VAMA 4DV5J 1RKIA 2IM2A 2CYYA 3H90A 5HVGA 2RB7A 2Y0BB 3NL0A 1PCAA 4ICLA 4X4SA 5C42A 1SC6A 4O3PA 2PGCA 1VRUB 1NRKA 1RABB 2WW8A 3PW0A 4L75A 1KDNA 2HZCA 3UVJA 1FNOA 1FDDA 2K8GA 3T5HA 5DG7A 2GMJA 5K8OA 1HNVB 4CLZA 2K29A 1O5JA 3V81B 2P9EA 5J2NB 1Q8KA 3NO7A 2VG7A 3QGHA 2YNIB 5F0WA 1I51B 3M9MB 3V81A 1GX6A 3I5BA 4NEYA 4QQBA 1Q16B 4HACB 2XM3A 3Q2TC 1CLFA 3I87A 2UUTA 4F36A 3VAJA 1VRUA 4PXBA 3CDEA 1SIWA 4TY9A 1L3UA 4DFKA 1JXLA 2HFOA 4DSKA 1HHSA 2FJXA 1FJCA 1U6FA 3E2EA 4N7TA 1RK8A 3CCMS 3GB0A 4K7QA 2F63A 4KY3A 3CE8A 2ROPA 5E2QA 1Y10A 5KFFA 3C46A 5J1EA 5KFAA 3D9BA 1O8BA 1OHNA 3HCXA 3M8PB 2UUAJ 2C3PA 1TU0B 2OKQA 4B3SF 3MD1A 3KDOA 2IMOA 3EZUA 1IKWB 5CQGA 3GFZA 3LGHA 1HQEB 2AJ4A 1N8RT 1NJIT 2AHOB 4AXJA 2XZ2A 2ROGA 3EWGA 2X7IA 4Y2MA 3KMSA 5B0AA 1Q4RA 2G0CA 1VIXA 3JYTA 2FJBB 3N6MA 1RBLA 3GYGA 4B9MA 5DGAA 2GA7A 3QRQA 1CJVA 1RTHB 2PEBA 1I94J 1KOOA 2G2OA 2BNWA 1JLCA 3Q2SC 2DGVA 2HAIA 1S4EA 4BWMA 3TVYA 3V6JA 4HHJA 4KIAA 1HMVB 1CEZA 3SEOA 4I0WA 3VVUA 4XDCA 1SBRA 3AODA 3LO3A 1PO6A 1BY9A 4UOCA 2KVIA 1V3ZA 2LKZA 1R6VA 3MI7X 1RCOB 1XR6A 2NZ4A 4Y6IA 4JOUA 2RU9A 3WIVA 4DR1F 2KFNA 1S6PA 1S6QA 5KG3A 4CO2A 4FBTA 3QZ7A 2IM3A 2WHOA 5IWAF 3CCRS 1N5VA 2K6LA 2J0SD 4FS1A 3PW5A 3BJYA 5D0RA 2K1RA 3W8PA 5AXKA 1R8BA 5C2CA 4LSZB 2R7TA 2OSQA 1RLCL 3HHNB 1TUGB 2KRRA 3PV8A 2IY5B 3AX3A 1UW9A 1RT5B 2CJQA 3C6UA 3R6GB 5LMUJ 3D5MA 4DV0F 1TUWA 2O67A 3VAKA 4IUFA 2HHTA 4LF6F 2B4OA 4L3KA 4UZCA 1B99A 1S77D 3K8VA 2CA9A 5F8JA 4WKRA 4NLYA 2BKPA 2XYHB 4C11B 3FRYA 3EVWA 2ZJQQ 1FNXH 1NJWA 4CO5A 5D4NA 3A8JA 5K9FA 1DAXA 1ZETA 1UZHA 1RT1A 4X65J 3M8QB 2YPYA 3J81j 4Q0BA 3TEGA 4ICLB 4Q2LA 2ZH3A 2CPDA 4DUYJ 4C48A 2GV1A 1KQGB 1N0VC 2GIQA 3SQGA 4U7CA 2HEKA 1VJQA 3CO9A 4RNOA 2VQEF 2XC9A 2EXUA 5LSOA 1U6BA 1N33J 1T05A 1K0TA 3WDOA 2VQFF 3Q83A 4DR4J 3MTJA 1K47A 3TX8A 2XSJA 2WBMA 1ROFA 4O0IA 2ASLA 2OLWA 2HBRB 2YVSA 4A8OA 2Z0GA 1Q8LA 4B9LA 2Y1IA 1S0VA 2VBZA 2W9BB 3WQPA 3SYZA 1YJNS 2UXDF 2AGOA 3N5BA 3QATA 1QE1B 1KD1T 4CZCA 1DTTB 3J7AN 5B0GA 3TJ9A 4DQSA 5DM7Q 4K4XA 2NCKL 1XIQA 2OD6A 2ZOGA 4WE1B 5HP1B 3DLLQ 1EA4A 5G0RB 5A0YA 4LIRA 4DL0C 3CIMA 3G6VA 2KZMA 4IH6A 3J81U 2W4PA 1Y11A 2R7QA 3D1HA 4OX9F 5AT1B 1DRZA 5K8PA 3MGJA 2Z2LA 2D9OA 4DI6A 1F5BA 2G13A 1U1OA 2LU1A 3LTOA 2DO4A 3NOGA 3TAMB 2HMIB 1RSCA 4ME7E 2W2MP 4DV0J 1VQ5S 2X1FA 3BV8A 5A6PA 3IMQJ 3UNYA 3BR8A 4NLQA 2CZ4A 2LQBA 3QT5A 2CJKA 4K4SA 1WG4A 1WI6A 4KGKA 2PE8A 2WSFC 3ZZPA 1KLNA 1FRJA 2CNKB 1RA6A 3DRSB 2E1MC 1VR6A 3T6BA 2Y8WA 2CPGA 4DCOB 1XMBA 2DO0A 4DN0A 4HTJA 2R7WA 5AE2A 3WC2A 3OLAA 1NJYA 1FDNA 1RI7A 2GVDA 2WAQD 3FEZA 1XMOJ 3N01A 4IO1A 2I0XA 5C24B 2J7KA 3CMES 1M1HA 2V68A 1YI2S 3SCLE 3R7BB 3ZZZA 5F9NA 3E8OA 5DQHA 5EN1A 3KXDA 2C2ZB 3KOAA 2XZWA 4ZPWR 3C66A 4DQQA 3W9IA 4LF8F 1R89A 2DXFA 1RT6B 3KMQA 2CQDA 1IM6A 2DGTA 2NXCA 2WW4A 3CJTA 3PIOQ 1XTZA 3IRXB 2D41A 1EP4A 2DNQA 2HVEA 2NS1B 2XEXA 2ZHBA 2KG1A 1TTHB 2FJWA 3AWRA 4DV3F 2NXJA 2RNEA 1AZSA 2W4DA 2BMBA 3I5AA 5ETKA 2G1DA 4DF4A 2AQ4A 3FNNA 3TAPA 4FBUA 6AT1B 1UFLA 2MZTA 4NA3A 3DM2B 3AX5A 2VKZG 3PRBA 3MM6B 3GIIA 2MZQA 3T5KA 1IJFB 4L73A 1NNDA 4GKKJ 4YP3A 3AD9C 1R8HA 4Q45A 2ZOFA 4EGLA 1JKHB 4ZA1A 2J7UA 4YS2A 4IDKB 2IVYA 1LXNA 5IQQA 3RBXA 3SSQA 1Y5NB 2W7PA 4QCLA 1IVZA 3QPIA 5KFIA 1IKYA 3ICLA 4FN5A 4ZJOA 4IDKA 2V5HG 3GFYA 2QT7A 2X3GA 3CSKA 2GMLA 3KG0A 3O8WA 4OX7A 4R0EA 2OO4A 3UR3C 2E5HA 3OJUA 1VRQC 4LF2A 5KFPA 2VICA 2GGPA 3BREA 1L3SA 4JI3J 3H2LA 1E6YA 4NLXA 2CJYB 4LF7J 2D68A 2JWNA 2VFRA 4OL8A 2FGCA 2VBYA 4CH0S 3S8SA 5FDLA 2XY7A 4IG0B 2DRAA 1KQSR 3M1VB 4I1TA 3DYAA 3H5YA 4WYLA 1S0MA 3H42A 2V1TA 1Z1ZA 5A8RA 4NZ7A 3UN5A 1X4DA 5J1NA 4C3MA 3M8YA 5I42B 1VCTA 2V9KA 4F0MA 4F02A 3EX7B 5IQ6A 2XS2A 1JLFB 2ZE2B 2RDIA 2B4PA 1NHUA 2ZBIA 3LALA 4FYVB 4UF4A 1ACMB 4C97A 2B8QA 1KR4A 4D8JA 1U8WA 1RT3B 1RP5A 2F9DA 2HFVA 3DGPA 3C16B 3H5UA 4DR5J 5F8MA 3B6BA 3IAM9 2QLJB 1FF2A 1TZ0A 3QT7A 2F3JA 3CWJA 2L9WA 3KJQB 3LPEA 3ZTSA 3DHWC 5IT0A 1WNEA 5KFJA 2XLJA 2JX2A 1XMQF 1FNMA 4GVLA 1AFJA 3VHQA 3KYLA 4ILLA 1HD1A 1V3SA 4WZQA 2HQFA 3P3DA 4UUXA 4NXMF 1Z2LA 2WSCC 5HAOA 4K8RA 4W98A 1DY3A 3VCDA 1H38A 3CVKA 3FFIA 3BDPA 4OHZA 1EQ0A 1Q95G 1UEVA 2QRRA 3C14B 2F8HA 3CD5A 4ZVEA 3CF5Q 5FIIA 1RHKB 1AUDA 5F8GA 3MM8A 4QIWD 2W8KA 5LSLA 5ADZA 2KH9A 4DUZJ 1O51A 2AJQA 1X93A 1KBRA 3SV4A 2DVIA 2KFYA 3CIZA 1YJTA 3MM9A 4ITSA 1BGXT 2MPUA 2RMLA 3SSRA 2J9CA 3IWLA 4TLQA 2APOA 4XIUA 5C24A 4CM0A 2V0NA 4ED2A 2MSTA 5E7OB 1VQ7S 4GC6A 3NGSA 3I56S 2V8PA 1LWCB 3TARA 3MM8B 4KR0B 4MKAA 2JLEA 4PCQA 4F04B 3I32A 2YKNB 5B0FA 3TX0A 1BAZA 2KXNB 1UZDA 2NREA 3NNCA 4JI7F 1FRHA 5L1JA 3D3CJ 4P74A 3M30B 1HNXF 4FXWA 1MLAA 2Y1RI 4X4OA 1TVRB 1RDRA 3MD3A 4IRDA 2L08A 2DHHA 3MPDA 4DSJA 4FPIA 5J2MA 3OXLA 3IWXA 4FYWB 2VV5A 2QLXA 3BGUA 4DPTA 4TYAA 2YNGA 3KTQA 3AD8C 2B4VA 2DH9A 4C0HA 1FTCA 1NDCA 3UNGC 4B3MJ 3G71S 1M5OC 2B6AA 4P9SA 4OZ1A 4NRUA 4DCPB 2HVIA 5GAEI 2CAJA 2A6MA 4X4VA 4LF8J 2JOQA 1RTHA 2AX0A 3EVOA 3N5FA 1FD8A 4C0BA 1J5EJ 1GTHA 3H20A 1VJWA 4EUVA 1EARA 2WONB 2QLWA 3H7HB 4KAIA 2FVCA 1PJ5A 1B28A 2VONA 3AAWB 2W1BA 1W26A 2FJEB 1L3TA 2CFXA 3MEKA 4B02A 4R8UB 2V4RA 4ZVQB 4WBFA 2C3OA 1WDDA 2KTQA 5SUHA 1IKXA 5LMNF 4RJVA 1RYRA 4QIGA 1WHYA 2CADA 3KHHA 3U7JA 5HMWA 2ZBQA 1R0CB 2CRLA 5DLFA 2RH3A 4ZCIA 4PWWA 1S1TB 1YRTA 4JI8F 2QJ3A 3VW4A 1UFWA 1X4FA 5I3UB 5LT5A 2JFKA 4LBIA 8RUCA 4XPEA 3SI8A 2OPRA 3DKDA 2KB2A 4JI6F 3TAMA 5I4MA 2ACMA 3TJ8A 4MIWA 2AJFE 4GO5X 4IH5A 3OT9A 1N32F 3IGVA 4ED4A 2YNIA 2JZ5A 4RBVA 3PYGA 2V2ZA 3PW7A 4USIA 1RTIB 3ZFVA 3PR4A 1S12A 4YEAA 5BR8F 3C2PA 4JV5J 3T1YF 4K4ZA 5C25B 2Q1LA 3CD0A 4U8YA 3KLHA 3W63A 2AY0A 3AA8A 3HI9A 4QU7A 1I3OB 3EUNA 2MZ1A 3FGVA 2EC0A 2KRBA 2X1BA 3OXFA 5A8WA 5KAKA 2ZZTA 2JXGA 2G4BA 1GMVA 3W65A 3TQEA 1FVSA 2PO4A 4RZRA 2ZH6A 3W2VA 4P52A 3NOCA 1NU4A 1PIEA 1F3FA 1TUVA 2F65A 4MMOA 2NXEA 4B9NA 3B82A 1S6QB 5AJ3J 4U6PA 1F2HA 2YX7A 1NJXA 2EKYA 3KK2B 2A0FB 2NLWA 1X9MA 2BE9B 2J76E 2B43A 3DM2A 3C16A 5J1EB 1KONA 4PYDA 2HVZA 1GMWD 3EGNA 1CSJA 2LDYA 2B5JB 1KS2A 2RDDA 4QU6A 5HROB 3MHYA 2FVPA 1U8SA 3NWRA 1IM4A 2W2PP 5ETOA 2OP5A 3D6TB 2DNYA 3A3OB 1NSQA 2CQ0A 3VR1A 1SB6A 1C0UA 2BOAA 1RHUB 2P9CA 3NGTA 4K2JA 1YRUA 3ZTRA 4WFBQ 5CXTA 3PACA 3R1HA 3MEGA 3JSMB 4USKA 1REGX 2OFGX 1LW2A 4KO0A 3OHBA 4B9UA 3IWNC 1IBKF 2CPXA 3PYFA 2E5IA 2MKJA 2BUNA 2FB0A 4C8MA 4DU7A 4WTOB 5T14A 4R5PA 1P1TA 3HSJA 2XGPA 1RZMA 5AXLA 2VG6B 3BB5A 3M8PA 5FD1A 5G0RA 5A0YB 5C5JA 2ADBA 3VGSA 4DSLA 2RDJA 4NLWA 2E66A 4KV8A 3SMZA 1N34J 2XTDA 2BA3A 3DRRB 4OYZA 5IZHA 4RU2A 3D67A 3TJAA 3I5CA 4MT1A 2XCPA 1PJ6A 3SCIE 5D4LA 2P5VA 2J6TA 4A8FA 1TL7B 2PMZD 1KEKA 2K9IA 1N52B 1SIWB 3GP9A 6FD1A 1YTYA 4XDDA 4ANDA 1HNZJ 2GJIA 2HHPA 4N47A 1NK7A 4MYUA 1B70B 4DR2F 4U96A 5ETQA 3MAAB 2QL9B 1VBKA 3PEJA 2V63A 3JS9A 2EPIA 5F8HA 2YNFA 3VWSA 4JBCA 2EFOA 1WC3A 3FK4A 1PBAA 4QWEA 2Q3PA 3MECB 2MJUA 4H4OA 4DEZA 2ZH5A 2QSFA 1AROP 2CZ9A 4C3LA 3GYXB 4DX7A 5J2NA 3FMWA 4DCJB 5D6GA 1LQ9A 4LSNA 1VQYA 3NGUA 3JAMY 1JLAA 1MU2B 1WC5A 4EYHB 1XJWB 3KLFB 2GZOA 3MPUB 1SPBP 3AHPA 4RW6B 5L9XA 2XHCA 1R0BG 2M9KA 3OQ2A 4G1IA 1XNRF 1JLQA 3F0NA 5KTQA 2I38A 4NLOA 2YH1A 3IM9A 2C42A 4ED1A 5ETLA 1QE1A 2RIJA 2ZNZA 2VASA 3DCAA 1XK8A 2C3MA 4IOBA 3T9NA 1SXLA 5IFMA 2RUSA 4H4OB 1HR0F 1S6UA 3CCZA 3GE9A 3W66A 3R7NB 1JIHA 3PIPQ 1KVIA 1M5HA 3EGWB 1IUJA 1I1GA 1SIZA 3KDNA 3QSIA 1RTDA 4DMZA 4EEYA 4JI5J 4PXCA 1JLEA 2EK6A 2B51A 2LVWA 4WIIA 3VGUA 4R0JA 4E8UA 4AL7A 2AGPA 1WC6A 3M4XA 4OFZA 2WZ1A 4NLTA 4YFUA 5KFYA 2ADLA 3FZBA 4G1QB 1T9TA 4Y2KA 3MR2A 1JJ4A 1S6PB 1SL1A 2KJWA 1SJ1A 2CWXA 2EW9A 4AQYJ 2BJ9A 4HACA 4HTIA 1S1UB 5DQIA 4H4MA 1QAYA 3DRYA 4BC7A 1CULA 4A8XA 2IBKA 4LRVA 1RQ0A 4KHPJ 1RU2A 3EZOA 3BS9A 4P2MA 4AL6A 1Q7LB 3JQKA 2RBFA 3N4WA 4J9VA 2K1OA 1JLQB 1KWMA 3FEYB 4Q8FA 4PG8A 2HHHJ 3VQSA 1R8CA 1SKRA 1JX4A 5H9EK 3I4PA 3ILJA 4M1KA 5K8NA 1V3RA 5HROA 3L7PA 4WFYA 2HK3A 1PC4A 2OD4A 1HBMB 3HHLB 4RUBA 6FDRA 2MKKA 2N82B 1WG5A 1D9FA 1C1CB 1LK7A 2V2QA 1NM2A 2W9BA 4XPCA 2U1AA 1JLGB 1RWMB 3G86A 3TA1A 4WKYA 3NG8A 4YR3A 2C2EA 2ABYA 1ZTWA 1XBWA 2R7OA 2Y1LB 3TUZC 3TI0A 2C2DA 2XMJA 1NDKA 3D6MB 1QM9A 4OI2A 1S76D 2F4VF 3NEKA 4MAKA 4O4GA 3UD5A 4DX8H 1J5OA 4DFMA 1BE4A 2IVMA 2W2OP 4BC9A 3OSNA 4ES3A 1S1XB 2HKEA 2VFUA 2YY3A 3W61A 3OR1A 5KG0A 3ET6B 1KHVA 3A3PB 4KTQA 4U9RA 3QIDA 3GG1A 2IPOB 3A1YG 4FF4A 5K14B 4PR6A 4RW8A 4O3QA 5AE1A 2UXDJ 3J80U 1GMUA 3PW4A 2OPSB 1U2FA 2ZH9A 2M8DB 2VA3A 2BE2B 3PYDA 3TZWA 2OMOA 2VJVA 1S10A 5GAGU 1P94A 1MWQA 1UJ6A 4CO4A 1CULB 2OELA 1WHWA 1NAQA 1BDVA 3AA9A 1RAOA 1VQNS 2CZVC 2DHGA 2OMLA 1K73T 3D4JA 3ILOA 2F40A 4G1PA 4M5NA 2RQ4A 5C42B 1N5YA 2W9CA 4USVA 1RA7A 2JNJA 2RAQA 4CLYA 2HBZB 2GHVC 5J2PA 3TANA 4CLSA 4P10A 2L3MA 2DHXA 4ED6A 1U0SA 1H3DA 1S7HA 3HHDA 3NAIA 3VZHA 2ALYB 2MLXA 3CJRA 4O4RA 3B4MA 4YQWA 3NGDA 1FHTA 5CZXA 5GAHU 3QWPA 2JEJA 1IBMF 4P72A 4PUOB 5THWA 3IM8A 1D9AA 4JI0F 3V5RA 3Q8RB 3PX4A 3NNAA 4TU8A 1VMBA 1HMVA 2F7VA 3LP1B 2IYGA 4A46A 3H4BA 1NK6A 3WIUA 2CQCA 1HI0P 1IQZA 2NYIA 2AP6A 1T03B 1ZZFA 2BACA 2ZJPQ 4QR1A 1Y7PA 3IA0A 3CC7S 2JBVA 3VTIA 2AZ3A 1HIYA 3M2UA 5K8MA 2HHQA 3QGPA 3LQVA 1HBUA 1UWBA 4LF4F 4LVOP 1O0PA 3LP1A 5KFEA 1QUVA 2HAFA 3P4UB 1HQEA 3PG9A 4HV0A 4OJ1A 1H7WA 5DJBA 4D3GA 4Q5VA 3KHGA 1SVDA 4FNHA 2M4MA 2Z2ZA 2DT9A 4ES1A 3GIMA 1OM2A 3PX6A 2Q6CA 1N36J 3GJSB 2XMTA 1TL5A 1VQ8S 5F8IA 4WFXA 4F26A 4IR1A 1TL4A 1EAYC 3US5A 1C4AA 1SJQA 2ZBRA 2LQJA 3O3LA 2AX1A 1YBAA 1X7VA 5ITHA 1RHQB 2H5JB 3AXKA 3O1LA 4IG3A 3MCMA 5T41A 3TAQA 2CNNB 3AOCA 3NY0A 3GU0A 3KLIA 5C25A 3L4BC 1W25A 2ZWOA 2CNLB 3D0GE 5CD4A 3HVAA 1SC1B 3OUYB 3RR7A 1RGVA 3SIPB 3PY8A 3HKZD 2FGOA 2XI2A 1A7GE 2N3LA 1FD2A 2IHR1 4F0KA 3MURP 4A8QA 2WBRA 1NB2A 1LWXA 1NHVA 4ZKAA 3DXSX 2BANA 3QAEA 2Z2MA 3D1OA 3CULA 4K4VA 3FQLA 1W2IA 3MM7B 2YX1A 4MIBA 3HT3A 3HSDA 5KOWA 1RYSA 1IWAA 1Q8BA 1S1XA 1JLAB 5IT4A 1PAEX 2L48A 3J7ZT 2QEXS 4JV0A 1GXTA 4J9UE 4AD6A 1Q53A 4LF9J 1WACA 2LA6A 2R7UA 4NYOA 4HT7A 1H6KX 3GQCA 1PYSB 2RRAA 5IM0B 5K5MA 4CLWA 4YR0A 3MAHA 2E44A 3AXMA 1IJEB 1TKXA 5GMEA 4IOCQ 2ROEA 5EWFA 4B9SA 2MMYA 1RAHB 2BV3A 2CPJA 2GX8A 2HIQA 4ENOA 2HK2A 3DGPB 1JMTA 3TA0A 2VQEJ 5LMUF 1KTVA 3PKMA 4J9KA 1N33F 4MK8A 3A8IA 2J9DE 4EBCA 4OI4A 1B0TA 3QLHB 4LF9F 4DUZF 1R0AB 2JVRA 3HVTA 3CJKB 1U1QA 3CB4A 4GKJJ 4P2XA 1HQUA 4FYYB 2BW7A 1C1BA 4KBIA 3U1MA 2HHVA 1ARQA 3TR5A 4R5PB 1XNQJ 2H4WB 4OV1A 3HF5A 1HWKA 4NXMJ 1EQMA 1PC5A 2VG5B 1W2BR 2MLYA 3HFVA 3W9JA 2ERRA 2DJWA 4QPTA 2CJBA 2E9RX 3TZYA 3OVBA 4ETXA 3MEGB 1XMQJ 4ECYA 3W7BA 4KHPF 2L41A 3I0SA 3NNHA 1K1SA 4N77A 4CT8A 1KP6A 4AXIA 1QSLA 4QJVA 3U02A 4BS2A 4W92B 1AW0A 4WP3A 2AZ1A 2MKCA 2KN4A 1NK0A 2XG8A 1DURA 3M30A 1FXRA 1GX5A 1TAQA 2G9OA 5A8KA 2VU5A 1S1TA 3D6FB 2R7SA 3H5SA 1BQMB 2G2ZA 3R5BA 2M52A 1XERA 2OPQA 1C2PA 4GMKA 3R7SB 4RL1A 4B08A 1ZYQA 2HQDA 2AJ0A 3CGIA 4TNOA 4X4PA 4CLKA 1HI1A 3BR9A 3RB0A 5EWGA 4I67A 3IR6B 1OY9A 1CG2A 1UVKA 3DLGB 5T7LB 3RAXA 4QBUA 1S0OA 4X4RA 3HK2A 2I5JA 2O01C 3OXGA 3FBEA 4LSLA 3DI6B 4DBQA 3CCTA 4ZVHA 3N0VA 1RHJB 4MYTA 2H3AA 1S1WA 3V6DA 4FF2A 1FXLA 1L3KA 1FXDA 1GMWA 1P8GA 2BEFA 3MM5A 1XR5A 1OYDA 4ZDNA 2AYMA 4ZPCA 2BJDA 3CCWA 3IRXA 4NMLA 3TO8A 3KLFA 2ZH8A 1FRIA 5HLFB 1Q81T 2KI2A 1S0NA 1XNRJ 3S6EA 5HJYA 3W60A 2MQQA 1GXLA 2KKEA 1M5VC 3DMJA 1QTMA 2V4JB 4OYIA 2VB6A 1ZM3A 3DOLA 4JI4J 4NCGB 1A6LA 2CPZA 2YNHB 3FDSA 3HZEA 3TVZA 2GQ2A 1E6YB 4LT6A 3CNQP 3R9LA 1BD6A 1MN7A 2V2KA 2ZOMA 4OZNA 4RUHA 3RUBL 4F4ZA 4DFPA 2HRYA 4L3NA 2BQUA 5JVGQ 4LRBA 1IKYB 2FZKB 3MMBA 3G96A 2PI5A 1F9FA 3KLVA 1WG1A 2DH8A 1NPPA 1RT7A 5GVQA 3GILA 3R8YA 3OTEA 3AX2A 4AYBD 5H9EJ 3J7YI 3CDUA 2HNZA 2YBVA 3DLEA 1QAJA 1NSAA 3G8SA 3DN9A 3KUHA 1U2RA 5DZ6A 3R1LA 3QJPA 3M8RA 1LW2B 1RT2A 5FDLB 2J6SA 2DR6A 2V4QA 2MHNA 3OFEA 3T41A 1TMMA 1OG7A 4DG1A 1AZSB 1C0UB 3J7YU 1IR0A 2H5EA 4PKDB 1EP4B 1X0FA 1FDBA 1EHWA 2OPPA 4PZVA 3BGFA 4AE5A 4DSIA 2IIHA 4LF5F 3I0RA 3M2VB 1SQGA 4PWDA 1YITS 1F0XA 3CJKA 3GTYX 1N56A 3GJTB 2HVHA 5KFZA 4PPZA 2JRSA 3W5ZA 3GPAA 3VQTA 3ADAC 2GQCA 4X64J 3HO1A 2ZVSA 4F4AA 3OTOF 3N6NA 3FQKA 3W2WA 4ZLNA 4ERDA 1F2GA 3ETOA 5KFCA 3R2CJ 5FLXU 2WVDA 4J91A 5F3ZA 3GIJA 1HPZA 2VQFJ 4F4KA 1VQSA 2XNRA 4NASA 1T9WA 3BBBA 3FKBA 3G87A 3VAHA 4MKBA 3U1LA 4C8OA 1T95A 5BJRA 3BYPA 1JLFA 2ZE2A 3HFKA 3OV7A 1Q7YT 2FJDB 1VDHA 3CCLS 3M8QA 2P6SA 3UI3A 1RAFB 2M3DA 2VC1A 1YLXA 3Q8UA 4OZ2A 1JJCB 1TKZB 1VQOS 1N5SA 2WVFA 3ENAA 4LREA 3W62A 4CNYA 3MEDB 3BQ0A 2WOMA 4IG0A 4CNZA 2R7XA 2QMUB 3FUYA 1IKVB 1RT4B 4XO0A 2KM8B 2RVJA 2ZKUA 2WOMB 5LXRA 2ASJA 1VHFA 2I5JB 3OUYA 2VG5A 3FCHA 1UJ4A 2VC0A 5J2MB 3VEAA 2NSCA 3NWGA 1XWLA 1XQIA 5BYRA 2X1AA 1KN6A 4QR2A 4NRTA 2DK2A 4HDGA 3EMTA 3OTBA 1FESA 5I3QA 1BXNA 2CQPA 4OV6A 5IWAJ 3MMBB 4IYQA 3P49B 1T9UA 3GCXP 2UVWA 4F25A 4HL9A 3PVXA 1NH8A 2DIVA 2I6WA 4N56A 5KG2A 1MN9A 5JMNA 3DOMB 4OHVA 1RE1B 1JK9B 2ZJRQ 4BHQA 1UVIA 1YK9A 4ANCA 1XC9A 3RBDA 3UN3A 3W2WB 2HNYB 1RT3A 2IDLA 3H2UB 4OYAA 2DCUB 4CRJA 2ZEJA 3CJ8A 4G6VB 4I6WA 4RO0A 4TVAB 4DV7F 1HBOB 3BBFA 3UQSA 1QUPA 2JXHA 2UV8A 1D8YA 1ITPA 2XMVA 1P9QC 4QWDA 4DWIA 4I64A 3ZZOA 4ECVA 1HW8A 2OPPB 3CDBA 1HQUB 4KB7A 5HP1A 5A8RB 5I42A 4B3MF 2VF3A 3H0PA 2VODA 4O23A 4DN9A 3EDQB 4C11A 3DGVA 4LIWA 2LQ8A 1S48A 5ETVA 2KT2A 1SJFA 1KHWA 3UE2A 1BQNB 3AQPA 4OYWA 2HLTA 4F4WA 2FC8A 3NGKA 3HHLC 1X60A 2MHEA 3OPKA 1HKAA 4M5DB 4PG4A 4DDFA 4WCEQ 1TKDA 4LMZA 4D3HA
chains in the Genus database with same CATH topology
1JXEA 4UY85 2O5DA 3DRSA 1C0TA 5JXSA 2CJ9A 4ZCLA 3TQ1A 2WSEC 3D0HE 4I7FA 3LWMA 3SZ2A 4QIEA 4DL6A 4CCHA 2LA4A 3AB4B 3OVSA 2JVOA 2GCFA 3MEEA 1I6JA 4TKTA 3LUYA 3TNVA 3POTA 4TQSA 1JB0C 1VS3A 1WHVA 5J1PA 2FHJA 2YKPA 4NYPA 2QYCA 4LFCF 1JLBB 1DARA 3HHEA 3LWLA 3JSYA 5KFRA 1JLCB 3N6LA 3RZAA 3ZZUA 2ALZA 1SJ4P 4Q2MA 3MR6A 2FHKA 5KFMA 2UU9F 4FS2A 1KRPA 1Y5IB 3QLHA 4QYRA 5GAEU 4PXEA 4FXVA 3FSIA 2HFZA 4PUOA 2D1CA 2ZHAA 2VUGA 4ECRA 4QPXA 4QR0A 1PGZA 4LF7F 4FF1A 4X4TA 3OL7A 3BSCA 1L5UA 4DOZA 1UVLA 4B3RF 1U1MA 1WTFA 2MGZA 1FVQA 1VQLS 3SQGB 2QA4S 3GWCA 2I9SA 3MOJB 4MH8A 2VOPA 3NBPB 1K8AT 1FE4A 3MAQA 2FVSA 5DDOC 1Q82T 2OJ3A 3AB2B 2YKOA 2YTCA 2FTRA 3IGNA 4DJBA 2D3ZA 3RB3A 4NWBA 3AJ2A 4ILMA 5E3AA 3UDLA 1B7FA 5CYQA 1RAJA 5DG9A 2IJNA 2EVZA 1H7XA 1YG0A 3PW2A 2KU7A 1CQNA 4K4WA 3DFEA 1FRMA 1BC6A 4Q43A 2PSZA 3VAGA 1WHXA 2E9TA 2WB1D 3I9ZA 2FVQA 4O4GB 1WTBA 1FKOB 3IS9A 1DLOB 3CC2S 2FHOB 3TUIC 3K58A 3PXGa 2RS2A 1S9GA 3MMJA 3OL9A 1VI7A 2VD3A 3TUJC 4RUCA 3THPA 5D4OA 2D9PA 1FERA 2E5LF 4WF9Q 3DMJB 3I6PA 3K8WA 4TLRA 1Q86T 2NPIA 5KG7A 3KK3A 3CDWA 4CIOA 1NO8A 2DR8A 3GFHA 4RW6A 1OO0B 2DGSA 3O44A 2DR9A 2EBEA 3FZ2A 3J80Y 3HVTB 2JH3A 2KYZA 4QIFA 1U7LA 1T03A 1L3VA 3MPWA 2XS7A 2DISA 2VFVA 1S1WB 4C7QA 2NUHA 1KLMA 1F5CA 3IG1A 2CQ1A 4NLDA 3PR5B 2W7OA 4IOAQ 1XR7A 4EWTA 3DC2A 4DV1F 2A3JA 3V4MA 5KT4A 3F44A 1X9WA 4RWWA 3OL8A 2AWZA 2KKHA 1FK9A 5J2QA 3DLBA 5J2PB