3BSOA

Norwalk virus polymerase bound to cytidine 5'-triphosphate and primer-template rna
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
484
structure length
479
Chain Sequence
b'KGTYCGAPILGPGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEPRGKPPKPSVLEAAKKTIINVLEQTIDPPDKWSFAQACASLDKTTSSGHPHHMRKNDCWNGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDLATMIRCARAFGGLMDELKTHCVTLPIRVGMNMNEDGPIIFERHSRYRYHYDADYSRWDSTQQRAVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCTSQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLKEYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGPNHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELDFYVPRQEPMFRWMRFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA dependent RNA polymerase
publication title Structural insights into mechanisms of catalysis and inhibition in norwalk virus polymerase.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Transferase/rna
total genus 149
structure length 479
sequence length 484
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2007-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.100 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Arc Repressor Mutant 3bsoA02
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 3bsoA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3bsoA03
4KO0B 2IM0A 4Q0BA 3QIDA 3C6UB 3BREA 2FLNA 2D3ZA 4QWEA 2OPQB 1RT5A 4IH7A 2YKMA 3OSPA 3KK2B 1VRTA 2XGQA 3KLGA 3T5HA 3PZPA 3NBPA 5D3GA 1RAJA 3DRPB 2YKNB 2IBKA 5JUMA 2HWIA 3MEGB 3DRSA 5CYMB 2BQUA 1R0AA 3KHGA 3T1AA 1S1VB 3DI6B 2HNDB 4MIBA 3MR3A 3LP1A 5KG5A 2R2SA 2V9WA 4PWDB 3TAMB 1ZETA 3LAMA 3RB4A 5HBMA 3CJ3A 2FVRA 1S9FA 2VA3A 3DMJB 5KFLA 4IG3A 2VG6A 3QO9B 3LAKA 2WONA 4H4MA 4H4OA 4ZP8A 4J9OA 4JV2A 1SV5A 2OPPA 4TYAA 4ECZA 3QZ7A 4QWCA 1KHWA 4KKOB 4KO0A 5DG7A 3C6UA 3QIPB 3QLHB 5DG8A 1LW2B 5KFRA 2OPQA 5KFPA 3KK2A 2V0NA 1BQMA 2VA2A 5I42B 4O4RA 3IN5A 3DRPA 2YKNA 2WTFA 2C2DA 2D7SA 3MEGA 3I5BA 5CYMA 4ECUA 5KG6A 1S10A 1S97A 3EPGA 1S1VA 3DI6A 2E9ZA 2HNDA 2YNHB 1D0EA 5DQHA 1RTDB 4QWDA 5KFBA 4I7FA 4PWDA 3TAMA 2W9BB 2BE2B 4TYBA 5KFMA 5DGBA 4NLSA 1DLOA 1KLMB 2FLPA 1TL3B 3DMJA 2W9AA 4NZ0A 5F9LA 2R8IA 3QO9A 2I5JB 4DG1B 3MTKA 3QZ8A 5J2MB 4IR9A 5KFZA 1C1CA 4ZVFA 3V6HA 3G6VA 2VG7B 3PJWA 3QGGA 5K14B 2OPSB 4KKOA 3QIPA 3QLHA 3TQ1A 3I5CA 1LW2A 3CJ5A 3BGRB 5L1LA 3MEDA 4K4YA 3UQSA 2E9RX 4IG0A 1N4LA 1HNVB 4ZP6A 1LWCB 2D41A 5I42A 4Q8FA 2AWZA 3I0RB 1WNEA 4TY8B 1IKWB 4NLWA 2B6AB 3DYAB 3KLEB 4WFXA 4HYKA 2JEIA 2YNHA 3FSIA 3SFUA 3Q8RB 4IRCA 4O3QA 2IC3B 4RNOA 1RTDA 4ZPCA 4FBUA 5KFEA 2C22A 1S49A 2D3UA 2W9BA 3NMAA 2BE2A 4NCGB 3H5XA 1KLMA 4RU9A 1TL3A 3LALA 3GV8B 2ZKUA 2I5JA 4DG1A 4FS2A 1S0OA 5J2MA 3RB3A 3H5UA 4O3NA 3T19A 2GIQA 2VG7A 5K14A 3RAQA 2OPSA 3DM2B 1J5OB 4TQSA 3MFHA 5KFQA 3KLHB 3NKYA 4EBDA 3HKWA 5DLGA 4QWAA 1HNVA 1LWCA 4MFBB 3KK3B 4IFYB 2FJVA 3I0RA 2JC1A 2RF2A 5KG1A 2XCAA 4TY8A 4KHRA 4QPXA 1IKWA 2B6AA 3DYAA 3DLEB 4TLRA 3Q8SB 3KLEA 3RB0A 3T5LA 1S1TB 1RT7B 4RW7B 5DG9A 3PVXA 4B3OB 2R2RA 4IOBA 3CDEA 2BANA 4K4WA 4NCGA 4KV8B 4ZVGA 1GX5A 4J9LA 1SH0A 3HVTB 2BRLA 3CWJA 1C1BB 3H4DA 4DL5A 3OL8A 4NLVA 2HNYB 5J2NB 2JC0A 3DM2A 3DOLB 3M9OB 1J5OA 3HVWA 5CYQB 4EO8A 3KHLA 3N6MA 2E9TA 4IFVA 3KLHA 4O44B 1OS5A 5C42B 1JLGB 1DTTB 3BSNA 3IGVA 4I2QA 4ED1A 3KK3A 1T94A 4MFBA 1K1QA 1NNDA 3ICLA 4K4ZA 4IFYA 1RA6A 2AGQA 1JXLA 1MU2B 4IDKB 1JLAB 5EWGA 2OH2A 1N6QB 3G86A 3ISND 3DLEA 4K4VA 3GQCA 4J9MA 2FVPA 2R8KA 3RBDA 1S1TA 4M95A 1LW0B 5KFHA 1RT7A 4RW7A 2FVSA 4B3OA 4KAIA 3M9NB 1N5YB 4NLRA 4O4GB 1TP7A 4R0EA 2RDJA 3PW2A 4TQRA 2XC9A 3KLFB 5F9NA 1TL1B 3H59A 3LP0B 5J1EB 4FS1A 1FK9B 4QWBA 3BQ1A 1Z4UA 2C2RA 4IRKA 3HVTA 1C1BA 2YNGB 3Q8QB 4ED0A 4U7CA 5J2NA 1RYRA 3DOLA 5CYQA 3NL0A 3HHKA 4Q44A 4O44A 2FVCA 4ZHRB 5C42A 1JLGA 1DTTA 4ID5A 2W7PA 5HLFB 4ECRA 3LANA 2R8HA 3CIZA 4ECSA 4NRUA 2C2EA 2F8EX 3RBEA 1MU2A 4IDKA 1JLAA 1GX6A 4IH5A 1C0UB 3CJ4A 3H2LA 1N6QA 1TKZB 2WRMA 5T14A 3ITHA 4ZVHA 3KK1B 3KHRA 2BR0A 1LW0A 3M9MB 4XO0A 2BQRA 2DPIA 1N5YA 2IM1A 2YNIA 2BRKA 4RW8B 3GV7B 2EC0A 5HP1B 2FLLA 1C2PA 5KFOA 4URQU 2B43A 3KLFA 5KFWA 1RT1B 1TL1A 5F8GA 3LP0A 5J1EA 3BSAA 4EEYA 1FK9A 1UWBB 5KFAA 1T05B 1FKPB 4U6PA 4LSNB 3MR6A 4DL2A 1S0MA 1S1UB 1D1UA 1QE1B 2R8GA 3H5YA 4RUCA 3T5JA 2W9CB 2XI2A 2OPRB 4ECWA 2QV6A 3KLIB 3DDKA 4RNFA 1LWEB 3H40A 3FDSA 4K4UA 4WE1B 4ZHRA 3KLVA 3QGIA 1JX4A 2UVWA 4ZMMA 4PQUB 4MIAA 4PUOB 1IKVB 1XR7A 3PW4A 1IM4A 1TV6B 3MF5A 1TQLA 4WZQA 3IGNA 4J9KA 4ZP9A 4ED8A 3SFGA 1TKZA 1LWFB 3KK1A 5KFJA 5J2QB 3C6TB 1DTQB 4F4XA 2J6TA 3JYTB 4RW8A 3RAXA 4XPEA 2IM2A 1RT2B 5DGAA 5HP1A 4QW9A 4J9NA 1RT1A 1ZTTA 1T05A 1UWBA 5HROB 2FJXA 1FKPA 5L1KA 2ATLA 4LSNA 1QAIA 1S1UA 4RZRA 1QE1A 3V6JA 2ZE2B 4J9QA 4WZMA 5KFNA 2W9CA 5EWFA 2V4QA 2OPRA 3H98A 3PW7A 3OHAA 3KLIA 1LWEA 2ALZA 4WE1A 4YR2A 4EO6A 5KG3A 1SUQB 4DL4A 4PQUA 4PUOA 1IKVA 4YP3A 4JUZA 1TV6A 3OL9A 4RW6B 4X2BA 5KFGA 4IR1A 3BQ2A 3N6NA 3T5KA 1RTJB 4DL3A 1S1XB 5EWEA 3MECB 1T03B 1CSJA 1LWFA 5J2QA 4LQ9A 3C6TA 4ECXA 1DTQA 4NLQA 1KHVA 3BSOA 2HAIA 3JYTA 4ED3A 5KG7A 1RT2A 1TVRB 3BSCA 4LSLB 1XR6A 5KFDA 3BGRA 5HROA 3KMQA 4Y2CA 2RKIB 4ED6A 1JLBB 4IQXA 3PW5A 4WXWA 3FFIB 5I3UB 3DLKB 4H54A 1JLFB 1JIHA 2HMIB 1IKYB 2WB4A 2HWHA 4RNMA 1SUQA 3M8PB 1REVB 2IC3A 2R8JA 1HQEB 1HARA 1VRUB 4ED2A 3KMSA 4RW6A 1I6JA 5KFSA 1HMVB 2CKWA 1RDRA 4EBCA 5KFKA 3MECA 4DEZA 1T03A 4F4ZA 4ICLB 3CO9A 4RNNA 4K50A 1RTIB 4G3IA 3GIJA 1RT4B 1TVRA 2ZD1B 3GYNA 4TXSA 2FVQA 2IJNA 4LSLA 3CDWA 4NLYA 3NAIA 5KFFA 1SH2A 4R8UB 3E51A 4IRDA 2XWYA 2RKIA 3MR5A 4KB7A 1JLBA 3VQSA 4F4YA 1T3NA 4OL8A 2ASLA 2IJFA 3FFIA 5I3UA 3DLKA 1JLFA 5L9XA 4F4WA 3OSNA 2HMIA 5KT3A 4Q0BB 1S1WB 3UDLA 1C0TB 3M8PA 2W7OA 4NRTA 3V6KA 1REVA 2WK4A 2VG5B 4ZVEA 1HQEA 4YQWA 3PR4A 5KT4A 1VRTB 4J9RA 1HYSB 1HMVA 1QAJA 4KV8A 5F8MA 3DRSB 4ICLA 4DL6A 1R0AB 5C25B 2ASJA 3MEEB 3QGHA 5F8IA 1RTIA 4MK9A 4WYLA 5KFIA 5EDWA 2R2TA 5C24B 3KJVB 1RT4A 2HNYA 3DOKB 2ZD1A 4Q43A 4URSA 2WCXA 3M8QB 5HBMB 2UVVA 4NYZA 4R8UA 5FDLB 1IKXB 2JEFA 4O3SA 4NLTA 5L1IA 2YNFB 4RW4B 2ASDA 5KFVA 3OL7A 2AX1A 2WONB 4YR0A 2XCPA 3PHEA 2C28A 4TY9A 3HVAA 4ZPBA 2OPPB 4J9PA 3I5AA 5KFUA 2XGPA 1RYSA 2WOMB 1S1WA 3GV5B 4YMEA 1C0TA 3D5MA 2DPJA 2VG5A 5L1JA 4FBTA 3OLBA 2RDIA 1TKTB 1BQMB 4O4GA 4DL7A 4O3PA 3KHHA 1HYSA 4ZP7A 1S9GB 3UR0A 4EYHB 1EP4B 5C25A 3MEEA 4URGA 3RB6A 2YNGA 5KG2A 5C24A 3KJVA 3CJ0A 3DOKA 3E01B 3BQ0A 5DQIA 4NLOA 4I7FB 1JKHB 1JLEB 1S0NA 4NLDA 3M8QA 3PR5B 4ECVA 5FDLA 1IKXA 1DLOB 5HLFA 3UPFA 2AX0A 5KT2A 4WXOA 2YNFA 4RW4A 4F50A 3SI8A 2YNIB 2ILYA 4MH8A 3GIKA 1C1CB 4KFBB 1MMLA 2UUTA 2BQ3A 3NAHA 1C0UA 3I0SB 5KFTA 3N6LA 2WOMA 3JSMB 3BJYA 3MEDB 4IG0B 1TKTA 4G1QB 3CDUA 1S6QB 1S9GA 3DLGB 2JEGA 2JLEA 1S6PB 2ILZA 1N48A 4ECTA 1EP4A 1HQUB 4MK7A 5JXSA 1FKOB 5F8NA 5J2PB 1RT6B 4J9SA 3DRRB 3E01A 2UVRA 1JKHA 4Y2AA 1JLEA 1QUVA 3ISNC 3BR9A 1EETB 3NGDA 5KT5A 4RW9B 1U09A 2IAJB 3KOAA 3QYYA 3PW0A 1BQNB 2B5JB 4LQ3A 4KFBA 2UVUA 4KBIA 2AGOA 1RTHB 2AQ4A 1HPZB 3GIMA 3I0SA 3EPIA 2FJWA 4ZPAA 4Y34A 3JSMA 2HNZB 4IH6A 4R5PB 4WFYA 5KG0A 4G1QA 2J6UA 1S6QA 3TVKA 3DLGA 5KT7A 2UUWA 4QW8A 4IKAA 4RUAA 3G6YA 2W8LA 1HNIB 1S6PA 4WFZA 2RF2B 4O3RA 4WYWA 4K4TA 4JV0A 1HQUA 1S9EB 1FKOA 4KE5A 3IRXB 1RT6A 5J2PA 1YVFA 1RT3B 2ZE2A 4MK8A 3DRRA 2WHOA 3EZUA 5C5JA 4ECYA 3FQLA 3MR2A 4K4XA 2XI3A 2BANB 5KFXA 1EETA 3IS9B 3IG1B 4EYIB 2AGPA 1JLQB 4RW9A 4ECQA 2IAJA 3MFIA 1BQNA 5KFYA 4NLUA 1K1SA 2B5JA 5KG4A 1W25A 3PJXA 2W8KA 4YR3A 1RTHA 4Q45A 5DLFA 1HPZA 1RTJA 1S1XA 2J6SA 2QE5A 4JV1A 1XR5A 3CVKA 2HNZA 3LP2B 4IFVB 4R5PA 4GC6A 2IMWP 4Y3CA 2IM3A 3V6DB 3CJ2A 3OLAA 3V81B 4I2QB 2JEJA 1RA7A 5F8LA 4HKQA 1NHUA 4I2PB 1HNIA 1SH3A 2I1RA 3V4IB 4TN2A 1S9EA 3OL6A 1JLCB 3IRXA 1TKXB 1RT3A 3FRZA 3D28A 1S4FA 1ZTWA 4RNHA 4MKBA 2IA6A 3IS9A 3IG1A 1IKYA 1JLQA 4Q8EA 1NHVA 4NLXA 5KT6A 4M94A 1S48A 1RT5B 3KNAA 2YKMB 1VRUA 4O3OA 3KLGB 4ZPDA 3H4BA 3NBPB 5D3GB 5F8JA 5F8HA 4NLPA 4K4SA 4GC7A 3H5SA 3LP2A 3G6XA 3OHBA 2R2UA 5KFCA 4ID5B 5DQGA 3LP1B 3Q8PB 4EBEA 3V81A 3V6DA 3FQKA 2AU0A 3GILA 3GIIA 1N56A 4NLGA 4I2PA 2GIRA 4KSEB 3V4IA 4ED7A 4IG3B 2VG6B 1JLCA 3ITHB 2GC8A 4KHMA 2V4RA 2O5DA 1TKXA 4H4OB 4H4MB 4XPCA 2CJQA 5EUHA 1SV5B 4MKAA
chains in the Genus database with same CATH superfamily
1RWVB 4DU8A 3G82A 2YKMA 3QJJA 2BQUA 4KGMA 4NYOA 3S7RA 1X8DA 1YG0A 1GH8A 4NPOA 1S9FA 4IG3A 4H4MA 1SV5A 3OTEA 4PKDB 3QLHB 2OIHA 2V2QA 2K06A 2ZBCA 3CCRS 5LMUJ 3J7YU 1S1VA 2YKAA 2W9BB 2LQ9A 3ET6B 1SKRA 5J2MB 2HHPA 2PN6A 4KKOA 3CD5A 2V9KA 3BPDA 1N4LA 3M6XA 1UFLA 4RJVA 4UT4A 3NNCA 1GNKA 4DV0J 2C22A 3AHPA 5ETNA 1QSSA 3RB3A 2VG7A 1H73A 3IM9A 4F7VA 2DNYA 1CC7A 3ILJA 1DJ0A 2GA7A 1RWWB 2BZ2A 3RB0A 2ZOMA 4IOBA 1UEUA 2UUAF 4K59A 1UUJA 4DL5A 3DOLB 1PJ6A 1KEKA 1URNA 1JLGB 1DTTB 4WK3A 4NX9A 4YB6A 3CC7S 2B9XA 3AAWB 2E5IA 1FK9B 4DR4F 1NRKA 3MPVA 2ROPA 2XYHB 1NK8A 2UXCJ 1FCAA 2C2EA 1IR1A 3AOBA 2H4YB 3ITHA 1SCJB 2YWGA 2LLZA 4UTGA 1WELA 4PG4A 4LSNB 3MR7A 3QMQA 1SB6A 3NS7B 3JQKA 2UVWA 2X1GA 4ZMMA 5ETLA 3SV4A 1IKVB 1NB2A 3M8YA 2VFSA 4F4XA 2ZM6F 4RW8A 3R5GA 1RT2B 1X7VA 2KZMA 1FKPA 1QUPA 1QSYA 2ZE2B 4C8ZA 2RHSB 2V8VA 1BC6A 4EO6A 2VU5A 2G4BA 3MWBA 1KHVA 3P8BB 2RNEA 3MCOA 4LSLB 3BGRA 3ISZA 3DLKB 3U27A 2DHSA 2VF3A 4CO4A 4JI0F 2GFFA 2IC3A 4P2MA 2G1HA 2FJDB 4LBPA 4CH7A 1RDRA 1HWKA 2ROGA 2HBQB 3Q8UA 1U49A 1GAOA 5K8NA 3E51A 2XWYA 4KB7A 1C0TB 3CJKB 2MB0B 3GR0A 4JV5J 1M5VC 5CYJA 3CJRA 1SC4B 1U6ZA 5C7PA 4ICLA 4TNOA 2WCXA 4EZ9A 2DNKA 2D3O1 1XNQF 2MKCA 4OZ3A 4C0HA 5C25A 4URGA 3OD2A 3A8EA 1K44A 1YGYA 3IBFB 1XN9A 5FDLA 1S6OA 2KYZA 2QA1A 4WCEQ 3M6WA 1H2TZ 1PYTA 3O5TB 2MKHA 3DXBA 2ILZA 5IWAJ 2CG4A 4DV6F 3QYYA 3RRKA 2AGOA 2CDRB 1YJVA 1QTGA 1HD0A 4AL5A 1HI1A 1BY9A 1U0HA 2KTQA 3PEHA 3AXKA 4ILMA 4F3OA 2AGPA 2DYAA 1HNZJ 1IUJA 4CYUA 2OP5A 4NCAA 1W25A 2CPZA 1OY8A 4FNIA 5H1SV 2HNZA 1SQGA 3V4IB 1JLCB 1Y5NB 4HR2A 4EUVA 1IJEB 1RT3A 2RVJA 4PCQA 1JLQA 1IBKJ 3AA9A 2PMWA 2GJ2A 3CIMA 4N77A 4JI4J 2G0JA 3GILA 3EXCX 4NLGA 4I2PA 4KHMA 2OMOA 5CCMA 2V8HA 2VPZB 1CQMA 3TJ8A 4Z7CA 1RISA 2Q6BA 3NBPA 5D4LA 2RQMA 3K0JA 4ILLA 2HFSA 4KGVB 4GKKF 5HBMA 4J91A 5KFLA 4H4OA 3HHLD 4K0KF 1DFDA 4C7QA 3W65A 2MMYA 4QBUA 2ZVIA 3GP9A 3HJVA 4QOTA 1D0EA 1NAQA 4RUBA 1FXRA 2PEBA 5KFMA 2F4VF 1C1CA 2NXNA 2OPSB 1BGXT 3QLHA 3EMTA 3CJ5A 2VBXA 4J7CA 4CRJA 4D3HA 2KVQE 3I0RB 2HBZB 5DDPC 3FSIA 3LF0A 2PI5A 4P7TA 2W9BA 4DUYJ 4RU9A 2DGQA 3ET6A 5IV3A 4FYWB 5J2MA 1UTAA 1WHVA 2HZCA 2OAUA 1FTCA 3HKWA 4BHQA 2HHVA 2NR0A 5H9FJ 1ZPWX 4C98A 2FJAB 2MPUA 5T7LB 3H4DA 1JWWA 2WBRA 2RAQA 2LA4A 3BPSP 1PSDA 3VHQA 2ZJRQ 3CCLS 4IDKB 3GZ7A 3CTRA 1YBTA 4O4GB 1M5KC 1UA0A 1UCNA 4F2RA 1CJKA 2QG9B 1VRQC 3DOLA 1BQXA 1JLGA 1DTTA 3IR7B 4Y28C 4WWSA 3BDPA 1VQ6S 1TKZB 4LVNP 2PFDA 3KXDA 1NPRA 2RILA 2BACA 3VAMA 3GV7B 2FLLA 2BX6A 2XG8A 4ZVRB 1FK9A 2V34A 1IR0A 2KU7A 3C3LA 2I6WA 4ECWA 2BJ7A 3G8SA 2ZZNA 4J9KA 2JXIA 2GHVC 5HVGA 1KTVA 2MZJA 2ZNZA 2P9CA 1U6BA 4J9NA 3DCAA 2LCWA 1GFWB 4LSNA 2OSQA 2BUNA 4UOGA 3DNCA 2HZVA 5HATA 1IKVA 5AJ3F 2CYYA 1RBOB 4V1Ak 4PAAA 3DU5A 5K8OA 1RT2A 5HMYA 1V9OA 1KLNA 4DR6F 4USVA 4HEA9 1TELA 1FX2A 2A6MA 3KMSA 1P9QC 1I6JA 4LFBF 4GMKA 1KFSA 2O66A 3ZFVA 2DCLA 1RT4B 3OW2R 2BM0A 4NLYA 4ILRA 4LSLA 3PO5A 1HNXF 4X4VA 4A46A 1TFYA 4LBHA 2PA3A 3DLKA 5BJRA 2HHHF 1RK8A 4P2XA 2MKSA 3Q83A 2VASA 5C24B 2E1RA 4J37A 2H5IB 2CZ4A 5L1IA 2YNFB 2MJNA 1FJ7A 4TY9A 3HVAA 5KFUA 3DGVA 2CPYA 1C0TA 1CG2A 3CJKA 4C0OC 4C8YA 2I8EA 1ZM3A 1EP4B 1TFWA 1WSVA 2F63A 2D9PA 3EGWB 1F60B 1FE0A 2U2FA 3I0SB 2KG1A 3MEDB 2HHQA 1L3TA 3CDUA 1VQ7S 1S6QB 4DQPA 2J0SD 2QL9B 5ETTA 2QYGA 1KONA 3ISNC 2EC2A 1U09A 3KOAA 1LEOA 1FNOA 2BNZA 2C2KB 2HWTA 2UUBF 2A0FB 1NKCA 2XO7A 2H65B 1CJTB 4WFYA 2DK2A 4E2FB 4FXWA 1JB0C 1GTHA 2N7YA 1XBWA 4KE5A 2QIFA 1TL4A 4B02A 5KFXA 1UVMA 4RBVA 1P8GA 4YS2A 2XLKA 1U8SA 2A6OA 4Y3CA 3HFVA 2C3YA 4YHHF 2PFFB 2K1OA 2LEPA 3ZZ0A 1EKRA 2C3UA 3M4XA 1HD1A 2H4WB 2CJBA 3K59A 4FVMA 3CT9A 3D28A 1S4FA 3JQMA 1NH7A 3FC9A 2F9JA 5LSRA 3KLGB 4CLWA 4A8FA 2JLFA 2F8HA 2YX7A 1FRMA 3BO2A 4WKYA 4KSEB 3FT7A 3V4IA 1JLCA 2GC8A 2O5DA 5THWA 3VQTA 3ZTRA 1H2UX 2IRYA 3K2YA 1LV5A 2IM0A 2XY5A 1MWZA 1FVQA 3MDFA 2WVDA 4DU7A 1H74A 2ZBPA 1LFWA 3CCWA 2IBKA 2RS8A 1QY7A 2P9GA 1X4EA 1RAEB 3JQJA 1YJTA 4HVZA 4GKJF 2FVRA 4USIA 3MOJB 3QO9B 4YDDB 4I67A 1WF0A 4UOCA 2D3OR 3CDBA 4DV4F 4P9SA 1RJJA 1O0PA 3BF4A 2C2DA 4PG8A 2D7SA 3V2UC 3I87A 2C2NA 2V8GA 4ZCKA 3WQPA 3J80Y 2KFYA 1WNEA 2ASYA 4L72B 2GGPB 3KLEB 1Q5VA 3OJUA 1OWXA 1KR4A 4O3QA 2JVRA 2VFUA 2FLOA 3B8HA 1IWAA 2OPSA 3DM2B 1ZA1B 5M2PA 2C3OA 4QWAA 4I68A 3I0RA 2JC1A 1TU0B 4Q7AA 2D1CA 2AYMA 4LF8F 2XMKA 1X4HA 4OZLA 2DGXA 4FF2A 4WU2A 3QSYB 4U8VA 1KQSR 3U1MA 4Y65A 4OZ2A 3IGVA 1N0UA 1T94A 3LW5C 4CCHA 2HQDA 4A47A 1VC5A 3LJPA 3GQCA 4X66J 1OPIA 4DSLA 1TP7A 2MQLA 3KLFB 3E8OA 5T7LA 4QWBA 2C2RA 4IRKA 3KJQB 3FKBA 1U1NA 4WBFA 2FVCA 5A8WB 3HD1A 4C6AA 5C2GA 1RU2A 3IWNC 4ELUA 4IDKA 1HFEL 5HQ8A 1UZDA 3KHRA 2CNNB 1CS4B 2YNIA 4NI2B 3CCVS 5KFWA 3FVYA 4M5IA 2HHXA 1QE1B 1A6LA 3VAKA 4M5LA 3DDKA 3H40A 4C97A 1P6TA 2OFGX 2ZUGA 3FZBA 1TKZA 3TJ9A 5LXYA 2E1MC 1W2IA 2HVDA 2EEYA 3M30B 2DT9A 3HHLB 3MAHA 2AYEA 1XK8A 3BQ2A 2DB1A 4LVOP 1EJ7L 2HQIA 3ZZTA 1Y5LB 2F8MA 2ZFHA 4ECXA 4NLQA 3BSOA 5KG7A 4CNZA 3BSCA 1N5VA 3ONQA 1AW0A 3VW4A 2E66A 1TAQA 2ATCB 1KQFB 1WC6A 4RWXA 2Z8QA 4C8LA 2DEJA 2IMOA 2M4MA 3P3DA 2HK2A 1DRZA 4DOZA 3LO3A 2YY3A 1ITPA 1SH2A 4KC5A 4DDFA 2V1SA 3T6BA 2D9OA 3HSJA 2RT3A 5E7OB 2W25A 2V2KA 1D9DA 1R0AB 5F0WA 1RT4A 2C3PA 4URSA 3TWZA 4TU7A 2Z58B 5D78A 1WC5A 2FDNA 2OPPB 3I5AA 2XGPA 3KDNA 3TAQA 2C42A 3NNEA 2CG8A 5C24A 1KWMA 2QO3A 3BQ0A 1VLOA 4FF4A 2YNFA 3QQCD 3D0GE 3PACA 2VJVA 3N5BA 1EP4A 5F8NA 5DRKA 4DR5F 2N82B 1Z2LA 4Y2AA 1QUVA 3ILIA 4OZ1A 1EETB 4DPOA 3MURP 2CNKB 2GQ2A 4ZVQB 3LWMA 5A8RB 4JBCA 3AB2B 3I0SA 2JWNA 4Y34A 1F5CA 1V6HA 4B9VA 1S6QA 4RUAA 2W8LA 1HNZF 4O3RA 3IRXB 1D3WA 5F41A 2J9DA 3MR2A 2XI3A 4EYIB 2Y0BB 4GVBB 1S5ZA 2ZNYA 3P5TL 2DXDA 1U1OA 2K8GA 1CJTA 1BWEA 1ACMB 4I2QB 2E44A 2Z2ZA 4DXLA 5AXKA 2UUCF 4QIWD 1IBKF 4TN2A 5E3CA 1TKXB 2IPOB 2K3IA 2IYIA 4JI4F 1IKYA 2EKNA 3MUTP 3MGJA 4LT6A 2DH8A 4ID5B 1JK9B 1L3SA 3FQKA 1MROB 4LF7F 4OLOA 3RW7A 4ED7A 3W1YC 4DFJA 4KO0B 3M8RA 3M6UA 1AZSB 3KLGA 4B9TA 3DHXA 1V3ZA 3MEGB 2G13A 5E3QA 4HACB 2R7XA 3LAMA 3K58A 1BDTA 3PJ9A 3QZ7A 1UEVA 3JAMY 5CXTA 3THTA 4TU9A 5I42B 3MM8B 4X4QA 2YNHB 1WTFA 2RDDA 3HJFA 3UD5A 2BSQE 3QO9A 4NWBA 4B3TJ 5I3PA 3C66A 2B8QA 2DY1A 2VFVA 2ALYB 2FIUA 3UQSA 2E9RX 3FEZA 2WAQD 2QEXS 4B9LA 1X4GA 4DUYF 1MYLA 3UDEA 3LPYA 4NLWA 4HYKA 1WHYA 3P49B 4QR1A 5D77A 5D4PA 3T19A 3DHWC 1SVDA 3MMCB 3CCTA 2BEFA 4QPXA 2GGPA 3KLEA 3SSQA 2B8PA 3RR8A 2BANA 4DPXA 1TK5A 2CQCA 1KD1T 4ZIWA 1Y4ZB 2MYFA 1F1BB 3K5LA 3DM2A 3KG0A 2E9TA 4O44B 1OS5A 4JOUA 3MM6B 3IA0A 1UJ4A 1RQ0A 2AGQA 1RTZA 3RBDA 1RKJA 4NMXA 1N5YB 1R7IA 3ILOA 2RDJA 4ES3A 3H59A 5J1EB 4JI3J 5ETPA 1T9XA 1MMDA 2ZBRA 3CIZA 4ECSA 3R97A 3J81Y 5CA5A 1HW9A 3H2LA 1VQ5S 1W2BR 2IM1A 3AJ1A 1XQIA 3KLFA 3I9V9 3U7JA 1S0MA 1S1UB 4FPRA 1S57A 2QV6A 3KLIB 3KLVA 4LRFA 3EZ5A 5A8WA 2R7WA 2EG2A 1VQNS 2K7KA 3IGNA 4M5KA 4WJBA 1HHQA 3HT3A 1RBAA 1CS4A 2NSCA 4NI2A 1JQGA 2DD8S 3TR5A 2QMWA 1QE1A 2HGNA 2V4QA 1LWXA 3H98A 2BE7D 4PYAA 3ZTPA 5KG3A 3T5KA 2AKWB 3MM9A 4ZPVR 4QQBA 2HGMA 1L3VA 4CDIA 2Y1JA 3I4HX 2KT2A 3HXMA 2KRBA 3M30A 4OJHA 3HHLA 1U6FA 3VZHA 1CVJA 1D8YA 4RU2A 1QM9A 2CKWA 3RU0A 4CLZA 1WC1A 2R7OA 1U9PA 4PABA 5GMEA 2H5EA 4RBTA 4WIIA 5GVQA 1VHFA 4ZLLA 4C9DA 2QA2A 1G4CA 1O5JA 3EDQB 1U45A 1FEEA 3OBIA 2MLYA 3CXCR 3ZNJ1 3OVSA 2VC0A 4MK9A 3ENVA 3MAAB 3ZZPA 1NU4A 3M7VA 1IKXB 5HSPA 3VEBA 1ZA2B 3AD9C 3OL7A 2RB7A 3PHEA 1H6KX 1B0PA 3CJSA 3BR8A 1Q8LA 1BQMB 2AJ1A 2BM1A 3JTPA 3E01B 2FY8A 2DKOB 4P10A 3LTOA 2EKYA 1EARA 1FKAF 2DNRA 3N6LA 3WX8A 1WOOA 1PC5A 1DQAA 5EHHA 4KR0B 5HJXA 2R7SA 2QC3A 1TL7B 4PXCA 4PQAA 3BR9A 3Q8VA 2L3MA 4JI6F 3OPKA 2FJWA 2ZH9A 3TNVA 4ELTA 1Z2ZA 3JSBA 2HRTA 5KT7A 2RF2B 4K4TA 2ZHAA 4ME7E 1EETA 2OTJS 2RD5C 2OEKA 2YVSA 4YB7A 1YJRA 4K2JA 3ZZYA 3NGRA 5A8RA 3U02A 3WC0A 1RTJA 4NA1A 3PFOA 3C15A 4IFVB 1Y5IB 2KL8A 1RWXB 3HF5A 3IRXA 1YX2A 4DV5J 3DLHA 3DN9A 4NLXA 4GVBA 1FDBA 1RWUA 5DJBA 1R89A 5D3GB 5F8JA 2OGUA 4DBQA 2LA6A 2J0WA 3KG1A 3T1YJ 2WW8A 2AJQA 3G6XA 4I69A 1H98A 3GIIA 2NYHA 4N8NA 1TKXA 1FRLA 2VFRA 3QIDA 1QAYA 2DHGA 3KK2B 3FCVA 2FY1A 4PR6A 1KRPA 5L46A 3QFWA 3PG9A 2MZTA 1MROA 2IHR1 3CJ3A 4U7UD 2MKIA 2CPDA 4AXIA 5DM6Q 2YTCA 2XB2D 4KO0A 2NLWA 2N3OA 2GVDB 3M2UB 2DGOA 4U7UK 3MEGA 1U7LA 3LWLA 2OTLS 1RWPB 2C3MA 4HACA 5KFBA 2BOAA 3OVAA 1B01A 4TYBA 1DLOA 3U1LA 5HN0A 2R8IA 3B82A 3EVMA 1NZAA 3QWUA 5I42A 3MM8A 2OUGA 4RO0A 2JEIA 3TYTA 2YNHA 4IRCA 4FXVA 4DV1J 4NCGB 2XO6A 3GV8B 3MPUB 1T0TV 3HHNB 2L9NA 2E5HA 5ADZA 3TQEA 3KLHB 3HK2A 2HS0A 4MFBB 2BOPA 2XCAA 4ZCIA 2FZGB 1C4CA 4PWUA 3NS5A 1I51B 1FRHA 1QDUB 2E5GA 1CLFA 1C1BB 1R8HA 3B54A 2O1PA 4PG6A 4KPYA 1GTEA 4ED1A 4GO5X 3MMCA 3HCXA 3K8VA 2CPHA 2FVPA 2QZ8A 4TLQA 1TL1B 4ITSA 1Z4UA 2H54B 4O0NA 4U7CA 2M52A 4BWMA 2JNJA 3OTCA 4USMA 4O44A 2MZRA 2M9KA 4ZHRB 1X0PA 3MM6A 4JI2J 2KFZA 4NRUA 1FRIA 1ZZNA 4UOFA 4OYWA 4RUHA 1S0VA 3KK1B 4XO0A 2BQRA 1N5YA 4AFFA 1X4BA 1C2PA 5J1EA 2XMAA 4KGZB 5E41A 4A8SA 4BC7A 4M5DB 3QGIA 3ULHA 4DCOB 5J2QB 4DR7J 3THVA 2VQEJ 1E6YB 5L1KA 1HWIA 1S1UA 1B0VA 3KLIA 1RGVA 2GJIA 4KGKA 4CO3A 3WIUA 1RLCL 3OL9A 5GMKa 2F3JA 3Q86A 3H25A 2RQ4A 1WD6A 3R5CA 5IT4A 4Y0FA 1LK7A 4H54A 4ZVSB 1HL6A 3QWPA 2XZ2A 4F2SA 1UFKA 2ADCA 4B3RF 4ZJQA 1U4BA 4EBCA 3GSIA 3ADAC 3UDVA 1N5SA 2KKHA 2XSJB 3D6HB 2IJNA 5AE3A 3NAIA 5KFFA 3NGKA 3Q8YA 2ASLA 1H3DA 3IMQJ 1M0SA 3GWCA 1AA1B 1RADB 4OI4A 1JJCB 4J9RA 1EHWA 1LQ9A 5F8MA 2FZKB 2AJ4A 4LF1A 3A8IA 2EXUA 4Q43A 3CJTA 4M1KA 2ZJQQ 3UCZP 1URRA 2WONB 1RHRB 1X4CA 2FTRA 2QMXA 2K2PA 3GV5B 1YRUA 2Z2MA 2ZUAA 5ETOA 1X5TA 1TKTB 1VQSA 4ZP7A 1S79A 1NM2A 2DR6A 1OMSA 2EWHA 1C4AA 3MAAA 1MNEA 2YNGA 2M7SA 3DDIA 1NDKA 1U25A 1IKXA 4WP8A 1Q1KA 3D54A 4MH8A 2UUTA 2CAXA 4YUDA 2YX4A 4OZ5A 1RBLA 1FKOB 2BKNA 1MWYA 3E01A 2VPXB 2W2PP 2LVWA 1CPZA 1KVJA 4FXEA 1NZ8A 2XNQA 4DR2F 4OZJA 4DLGA 3FCHA 1HBUA 1HNIB 2OJ3A 1S9EB 3T9NA 1TL7A 4MK8A 1NDLA 4ECQA 1F6TA 2GMJA 3NP5A 3MMAB 3W9IA 4RL1A 3SXLA 3H0PA 4GC6A 3OLAA 1OHNA 4USKA 2HVEA 1U1PA 1NK6A 3OL6A 4Y00A 3G8QA 1ZTWA 3P6YC 1SXLA 1G1XA 1IBLJ 1FTRA 4FYXB 4HT5A 1VRUA 4O3OA 3G96A 1G7CB 2LKZA 4OZ0A 4AL7A 3BKUA 2VOOA 2H51B 2UUAJ 2YH0A 2RBFA 4CLPA 4LRBA 4P6QA 3IR6B 1IBMJ 4X4SA 2VPWB 3GPAA 2M5YA 3PNIA 5HAOA 3PZPA 5D3GA 3EYZA 3WX4A 4F4AA 1VK8A 3VALA 3O1LA 4DR4J 2BJEA 3OTBA 1FWPA 3LAKA 4ZP8A 4J9OA 4HTIA 3KK2A 5GMDA 3QRPA 3IN5A 2K9IA 3V4MA 1XJWB 3N4WA 4NZ6A 4I64A 1VQ8S 1KBRA 2EPIA 3BGFA 2GVDA 3M2UA 3PYGA 2Q43A 4IG0A 2GIFA 1HNVB 4ZP6A 2VOPA 3BBCA 2RIJA 3QT6A 3W2WB 3VZIA 4CI0B 2OFHX 2ZH8A 1FI4A 2JBVA 2IY5B 4ES2A 2DNHA 2ZKUA 1W26A 1WG4A 3BGOP 3R2DJ 3D6FB 2CQPA 4PWWA 4QJVA 5DLGA 2WVFA 4KHPJ 2DTJA 3DGPB 2CZ9A 1HHSA 3T5LA 1JJ4A 2HIQA 4NCGA 2XMVA 1SH0A 4MIWA 4USUA 3QBCA 2YH1A 3PHTA 1UPMB 3HVWA 4PG7A 3KLHA 1REGX 2EW9A 2AT1B 4MFBA 5CABA 1JXLA 4QIVA 5EX0A 1RHMB 3G86A 2BXJA 3QRRA 3UNGC 3PW2A 4FS1A 1YKWA 3MPWA 4Q2LA 1CJVB 1C1BA 2KT5A 5HLFB 4ECRA 1FDNA 3TUJC 4N8OA 2EFGA 1ZYQA 3GONA 4OHVA 5KFOA 1TL1A 4EEYA 1F3FA 3MM5A 2AF6A 1UEKA 1WF1A 3RG6A 2VL1A 4U6PA 1D1UA 5HI7A 2R8GA 4RUCA 2ZH1A 3T5JA 4OYPA 2M70A 2N4CA 3L3CA 4ZHRA 1JX4A 3N0VA 3MF5A 3O6QA 1T9VA 2KJVA 3KK1A 3NOCA 4XPEA 2A18A 2NS1B 4NZ7A 1RWNB 4M5DA 4YR2A 3CC2S 1N8RT 4M5NA 2XTDA 4YP3A 2HRYA 1R27B 1U8WA 5J2QA 5HVHA 3OJSA 1E6YA 1VQ9S 1BWVA 1GMUA 4WXWA 1CEZA 4HHJA 1REVB 3EWGA 1PO6A 4GRSA 1N5TA 4WK1A 1LFPA 1T7PA 1NSKL 1KQGB 2QA4S 3HSZA 2Q66A 3HVRA 4B17A 1OIAA 5KT3A 3N9UC 4NRTA 2PEHA 3HSDA 5ITHA 1KOOA 2GJFA 2JDJA 3QGHA 2OMLA 2XULA 4DCJB 3KJVB 4OLPA 2XSJA 5E33A 2DH7A 4OHZA 2L48A 4R0JA 3BV8A 2YQ3A 4KGXB 1IVZA 2UZAA 5L1JA 4C0BA 2YWKA 3HT0A 3PYEA 3ZZZA 2G0CA 1NK4A 1RWMB 3CJ0A 2JSXA 3OXLA 1KQKA 3X3UA 5HQMA 2MHNA 4CLSA 3GYXB 4CLYA 2DHHA 2GPEA 2BMBA 6FDRA 1TKTA 1NLAA 3LGHA 2J7WA 1U47A 1RT6B 3GFXA 2P6TA 2X1AA 1VBKA 4E0DA 2PDAA 4RW9B 1BQNB 2B5JB 1JXEA 2CPXA 4HHUA 4LQ3A 2UVUA 5DDQC 1HPZB 3IO1A 4C8NA 2J6UA 1B99A 2UXBJ 2H3AA 4DUZJ 3MI7X 2N3LA 1RAHB 1FKOA 3L95X 2XHCA 3R6LB 3PY8A 4G1PA 4ZLJA 3KDOA 1S7HA 1SKWA 2QE5A 1XR5A 4DV5F 2DNMA 1RA7A 1NHUA 2HPUA 1HNIA 1Q86T 4DI6A 1S9EA 3C19A 4BBYA 1VJQA 2FYXA 3K5NA 1FFWB 3VWSA 5DS7A 1L3UA 1UVKA 2XWXA 2G9OA 4GC7A 2R2UA 3LP1B 3F44A 1BDVA 2HEKA 1ELOA 1U48A 5HANA 3ITHB 4EU0A 1RAJA 1O8BA 5CYMB 3WHIA 2ZH2A 3SBMA 2Z2YB 4F0MA 1TUWA 1NB7A 2E1AA 3M8ZA 4ECZA 1VR6A 3QIPB 3FEXB 5KFPA 2IA0A 2NXEA 1UVNA 3TAPA 1JNRB 1W7WA 4OJ3A 5LSLA 3PV8A 1RTDB 1KS2A 4EZ6A 5DGBA 3QZ8A 5IV4A 4IR9A 5KFZA 1IQTA 2RJZA 4NCBA 4F02A 3I5CA 3BGRB 3CGIA 2RE1A 4WFXA 3NLCA 1GT8A 2IC3B 3BN7A 5KFEA 3NMAA 3CUNA 8AT1B 1S0OA 3AJDA 1U02A 3W64A 5KFQA 3CO0P 3NKYA 2B4UA 5ETKA 4DV7J 1HNVA 4RR5A 3W2WA 3CC4S 4TLRA 2G2ZA 2BW7A 4K2XA 4DR6J 1S72S 3K89A 2HS4A 2B0GA 1HWUA 3N79A 3OL8A 2XLJA 1PYSB 4WU3A 4LFBJ 3W5XA 1APSA 2MY8A 2W24A 3DGPA 4K4VA 5KFHA 4ENOA 4KAIA 2PO4A 2MQ8A 2QSFA 3IFEA 1FD8A 4WKRA 1RYRA 2V5HG 3RRHA 2YWEA 1S76D 3EE3A 4U8YA 2IFXA 2KHDA 4FYYB 2XZDB 1YI2S 5HL7Q 1UETA 1NJWA 1FNMA 1CJVA 3OUYB 3H5YA 3FEYB 2XYGB 1LWEB 2CQGA 1S99A 2F9DA 3PW4A 2W2OP 2J6TA 2YWHA 3PXGa 2YQ1A 3L9ZA 5BYSA 3TRGA 3BS9A 2BBEA 1P94A 1JNZB 2DJWA 3I31A 3WZ0A 2ZWOA 4QYZJ 1PAUB 3KUGA 1OG7A 1IN0A 1M1HA 3HHEA 4JUZA 2WB1D 4FDFA 2P5VA 1Q5YA 2BVZA 2UUBJ 4DV2J 2JXHA 4IUFA 1EZZB 2KH9A 4CIOA 1KDNA 1YJWS 2EBGA 2HMIB 1RU1A 3SSSA 4RNMA 3AJ2A 2ZBIA 4YB5A 4F4ZA 4C3LA 1FERA 4F0KA 1PKUA 1X5PA 1FXLA 1Q7LB 3AD8C 4L3NA 4IRDA 2U1AA 4YHHJ 1VQYA 1REVA 4OYAA 5KT4A 2QYCA 3OTDA 1JJHA 4L6V3 4KV8A 2J9DE 2ZC4A 3OXGA 3J81j 3PYDA 4KH0B 3SYZA 5HBMB 3CCSS 4WFBQ 4O3SA 2Y1IA 2RRBA 4ZOSA 2C2MB 2H1OE 5CAAA 1X9WA 3JB9k 1IJFB 1M5OC 5B08A 4DL7A 3FNNA 4TU8A 2K6LA 4DX5A 3KJVA 1RHKB 3CCES 4ZJOA 5H9FK 2AX0A 7AT1B 3GIKA 1C1CB 4A8XA 4GKJJ 4FNHA 3DRXA 2E5LJ 1L5UA 1BAZA 1IXKA 4U67Q 2BJ8A 2DEIA 5JXSA 3GB0A 5J2PB 4DV4J 4ZVOB 3CD6S 1RB0A 1E6VB 4J9VA 2HVZA 3VTIA 2WW4A 4C3KA 3HD2A 2XBPA 1TK8A 3ENWA 1PAEX 4AAIA 2RUGA 1DAXA 4QW8A 2Y1LB 4PXEA 2J8SA 1YWXA 1RT6A 3IR5B 5C5JA 1MYKA 4RW9A 3SSRA 3DKDA 2JRSA 1BQNA 2B5JA 3BEGB 3GU0A 3K7RA 1HPZA 4X65F 3IM8A 3CJ2A 1NO8A 5DZ7A 2COLA 1IBLF 3G71S 3QJPA 2I1RA 2HIYA 2FC9A 2NZ4A 1QJHA 2DNLA 1CJKB 1RP5A 4UQGA 2VICA 3MM7B 3UR3C 3DDNA 3MD3A 4LF8J 4DHVA 1FWLA 1FF2A 1IBMF 4Y6IA 2IIHA 2ZJPQ 2HQ3A 1QTMA 3BO4A 3AQOA 3BDEA 3BH6B 2FLNA 2LEAA 4QWEA 2OPQB 1VRTA 3DRPB 2YKNB 4XDCA 5JUMA 2Z2LA 1L3KA 4KTQA 3L4BC 3LP1A 3GE9A 5KG5A 3FMBA 2VA3A 3J7A1 2AIRB 5DETA 3TX8A 1T9TA 4AD6A 4N7TA 4IQMA 1KHWA 3HI9A 2GHWA 4WF9Q 5DG8A 2YQ0A 2VA2A 1DBDA 1T3OA 2VV5A 3AA8A 5CYMA 2NZCA 3H87C 5DQHA 2EFVA 4KT0C 4I7FA 2AZ1A 2DNGA 2LEBA 4B9SA 3GLJA 4IYQA 2DIVA 2HLTA 2V68A 3A1YG 3QIPA 1Q53A 4DR3F 4QIEA 2NYIA 4K4YA 2AJ0A 4IOAQ 1P1TA 3WIVA 3SFUA 1RTDA 3AX3A 3K17A 4A8KA 2HFUA 2PI4A 5HQLA 1VDHA 4KHPF 1NLKL 3G2XA 5GAGI 3KNGA 2DITA 1NPKA 3PRVA 1ZOTA 5KG1A 3DLEB 1S1TB 3PIPQ 5E3AA 2IVYA 3B4DA 2DCUB 1GX5A 2Q6CA 4L74A 4BLGA 3R5AA 3MEKA 2WSFC 3B78A 4DN0A 5C42B 2QLFB 1EX8A 3HFKA 1PJ7A 5U47A 3R5BA 4J9MA 3D67A 2LQ8A 4TQRA 2DR5A 3LP0B 3BQ1A 3R1LA 4U96A 1YDLA 2FHMA 4W4MA 1WWHA 2ZVSA 3UDCA 4ZA1A 2CPGA 1RABB 4K7QA 2BRKA 4B3SF 1UWBB 5KFAA 1M1KT 3MR6A 2MSSA 3OTOJ 1H38A 4LRCA 4WE1B 4NA2A 5AXMA 1XR7A 1MG7A 3VAIA 1DTQB 4CH1A 3RTVA 5DGAA 3OQ2A 3HDSA 2H9ZA 1QAIA 3OUYA 1TMMA 3W5YA 3R8YA 1KTQA 3QAUA 1LWEA 2EFQA 2KELA 1XTZA 4ANDA 4CLLA 4DR5J 4LF5J 1K9MT 4LFCJ 4P73A 4ED3A 1N34J 1RAGB 3CSKA 2LXIA 4P72A 4Y2CA 1SKUB 2RKIB 2M3DA 3UFCX 1ZAVA 3PW5A 4R25A 4OX9J 4HTJA 4OJGA 3R6GB 4ED2A 5KFKA 2V67A 3EXYA 1RTIB 4OX7A 4G3IA 4OI1A 2ZD1B 2GQCA 2BNWA 2DH9A 3A12A 3TUZC 4JI1J 3SCJE 2IJFA 1QD1A 2HMIA 4MKYA 2UUCJ 4YQWA 1UP1A 1HYSB 1MW7A 1YITS 3TA2A 2HNYA 4NA3A 4NYZA 2DHAA 4NLTA 5KFVA 4KQZA 2DRBA 4DF8A 4LF7J 5CCLA 1EKSA 2JL9A 2QT7A 4FBTA 3BH7B 2VBYA 4BC9A 2BDPA 2Y1RI 1JLEB 1S0NA 3TA0A 2BA3A 3FBFA 3TEHB 3NOGA 2IRUA 3HFZB 1V3RA 2HHWA 5AXNA 4NMLA 1XMOJ 4G1QB 4J5OA 1VBXA 2K1RA 3MMBB 1H0HB 1F0XA 2IAJB 3VAGA 1ZM9A 4CO5A 1KKHA 1OSDA 2UXBF 2YWWA 4DUZF 2AQ4A 3TZWA 3EVWA 3KWMA 1UW4A 3TVKA 5J2PA 2CADA 1YVFA 4JI7J 1E6VA 3IS9B 1JXVA 3SDEB 3UD3P 3D66A 4DSFA 1N54B 4M63A 4XIUA 3CVKA 3AQPA 1ULRA 3M05A 2UU9J 5CD4H 2KFNA 3ETMA 3H2UB 4LIWA 4MKBA 3Q2TC 1KN6A 2ZEJA 2DGSA 5D0EA 4LUBA 1QTNB 2R9LA 1RT5B 2XZTB 2APOA 3HLUA 4A8YA 4FPIA 1HBMB 4ZPWR 3IWXA 3NMRA 4LR9A 5B0FA 1VQPS 2DVIA 1A7GE 5J1NA 4LMZA 2KG0A 2V4RA 2X51A 2YNIB 4MKAA 2MDAA 3TANA 3MM7A 2NQPA 4CLTA 2ZZMA 1AFJA 9RUBA 2J0QD 3DI6B 4ID8A 4LF6F 3QT5A 2I9SA 3PM9A 1XMQF 4QYRA 5IC6B 1F2GA 4QWCA 1X0FA 1BLUA 2OPQA 3DRPA 2YKNA 2WTFA 2PC6A 3EPGA 3QAEA 1SQEA 1FHTA 2G1DA 4A8OA 4CM0A 3W63A 2XS2A 2BE2B 1KLMB 3GFZA 4DG1B 3DOMB 1FJCA 2B9YA 1B7YB 2XMJA 3O2IA 2JVOA 3IP0A 4P52A 1TKDA 1D9FA 2HW3A 3R7BB 3GTYX 1MSWD 4YOEA 4ZPCA 4FBUA 2D3UA 2PA8D 3D4JA 4H4KA 4CH0S 4FS2A 2KT3A 4DV7F 2XZWA 2DGTA 3RAQA 4L76A 2QL7B 4IFYB 1U1MA 2MQNA 4KHRA 2I38A 2GMLA 5IM0B 3PVXA 4AQYF 2VFTA 1RCOB 4ED4A 5J2NB 3VVUA 5F3ZA 5GAGU 2Y8YA 4HV0A 3DLEA 5IT9U 2MZSA 1S1TA 1YZ6A 1UVJA 4NLRA 2ZH5A 4DFMA 1NK7A 5E2QA 1EA4A 4ED0A 3ZZRA 2GV1A 5C42A 3MUVP 2HQCA 3NNHA 1AFIA 2W2MP 3TP2A 4F4KA 1IR2A 1R0BG 2V4JB 2M88A 1J5EF 4B3MJ 2B43A 5F8GA 3LP0A 3BSAA 2CVEA 4DL2A 1M90T 1RHUB 3R27A 1X9SA 1YHQS 2W9CB 3P5BP 4NEYA 1ZAXA 5FD1A 3GG0A 4ED8A 4C8OA 1LWFB 5L38A 3IXQA 4B08A 3VGSA 4ZPTR 1K8AT 1QSLA 1WDTA 1UWBA 4DLEA 3RR7A 3D9BA 4L75A 5KFNA 1HHTP 4WE1A 1SUQB 3E3XA 2JX2A 4DV2F 4IR1A 3N6NA 1RWKB 1DTQA 1WI6A 2VQFJ 4JI6J 4JYAF 4ZIVA 1XMBA 1MMNA 1IKYB 5HVFA 3M8PB 2R8JA 1HARA 3FRYA 3DC2A 4DEZA 3VV2B 2DNQA 2FHKA 2FJBB 2KO1A 5D0HA 1U2RA 2RKIA 4J9UE 5K8PA 4QPTA 4X62F 4QR0A 2YBVA 2DBBA 2W7OA 2NXCA 1X4AA 4ZVEA 1SL1A 1QAJA 5SZTA 1SPBP 4OYOA 1V5VA 3MEEB 1RTIA 3NGSA 2ZD1A 1XERA 1KFDA 2DNZA 3H7HB 1YBAA 4RW4B 5BYQA 3EX7B 4F26A 2FGOA 3AFGA 3OR1B 3CCMS 4A48A 2A1BA 4ALZA 2RDIA 1HYSA 1S9GB 3J7ZT 2MJUA 3RB6A 1S6UA 2FZCB 2W01A 3CW2C 4P75A 2XS7A 2F65A 4OJ1A 2E5LF 1HLWA 3FBEA 4HH0A 1C0UA 3DFEA 4GVLA 3RGIA 2JEGA 4NL5A 3ZTSA 1RHJB 1UAWA 1JLEA 1U24A 3ENAA 2CJKA 3PRDA 1VQ4S 1NPPA 3LGNA 4R5PB 5KG0A 4G1QA 4YDXA 1SL0A 4WFZA 4JV0A 4RBUA 2VBZA 4QIFA 3UI3A 3MMBA 2WHOA 3FQLA 2X1FA 2BANB 3I82A 3BKTA 1LK5A 2RMLA 2IAJA 1U0SA 2YWFA 3KFWX 2G0IA 4JV1A 3M2VB 4L73A 4PYDA 2KZZA 1N33J 3N28A 3V81B 3RBXA 1JMTA 1SH3A 2IDLA 5BXIA 5L9NA 5KAKA 3GJQB 2IA6A 3IS9A 3VAFA 3SDEA 3M6VA 4OYIA 4NLPA 3AD7C 2H3EB 3OT9A 3HO1A 1F9FA 2VC1A 1FXDA 4EFAC 2MGZB 1X93A 3F56A 2VG6B 1GQEA 2CJQA 5HK4A 2V8DA 4QZVB 4Q0BA 1VBYA 3C6UB 4KIAA 3CCUS 1A0OB 1RT5A 3OSPA 3HX9A 4Q2MA 3HMJG 2ADBA 5KOXA 1HBMA 3DRSA 1MLAA 1Q81T 1QAXA 2R2SA 3HM9A 1CULA 4Y2IA 5EX3A 1B4SA 2GX8A 3TZYA 2VB6A 2KXHA 4HI2A 2V0NA 1X4DA 1OYDA 4O4RA 4CLUA 3P45B 3DI6A 1SC3B 2MQQA 1TL3B 4NZ0A 2CQBA 5F9LA 4F8RA 4ZVFA 1R8BA 3V6HA 1WEXA 3MM9B 3PJWA 2XMWA 2H1YA 1PARA 3R3TA 3NGTA 3JSYA 2QTWA 5BR8F 2BE2A 1KLMA 4DG1A 3DOMA 4MJKA 1AXQA 3AT1B 1GXLA 5SUHA 3CF5Q 4LF9F 1QVFR 2FJVA 3A3PB 4Z2XA 2HKEA 3SCKE 3FCWA 1RAAB 5DG9A 2UV8G 4EGLA 3FZ2A 4KJIA 4F67A 1SJ4P 1ZAWA 3M2RB 1X60A 3NEKA 1YJUA 1UJ5A 4B3RJ 4QU7A 4U9RA 5FIIA 3T9ZA 1K1QA 4IFYA 1RA6A 3CCJS 2R8KA 2Y8WA 4I6AA 2FVSA 5IM0A 3PX6A 4R0EA 5LT5A 2XC9A 1RACB 2RU9A 1AYEA 3OFGA 3Q8QB 5LMNJ 5J2NA 2DHXA 1CC8A 3HHKA 3FGVA 3LANA 3NS6A 1H7XA 1YLXA 3TO8A 2CQ4A 2D74B 3EDRB 1KVKA 3OTOF 4URQU 4ATNA 1Q7YT 5K20B 3UCGA 2XI2A 2M8DB 3NXZA 4K4UA 1S4EA 1TV6B 2VKRA 4JI5J 3JYTB 2V4JA 4GO7X 1YK9A 1DQ8A 2DNNA 2CFXA 4RZRA 4LF5F 2W9CA 4LFCF 1VLYA 3PW7A 5F0UA 3VAJA 1N34F 3Q89A 5KFGA 1I3OB 4RW6B 1LXNA 3W5ZA 1RTJB 4TKTA 1LWFA 3C15B 2W1BA 4LQ9A 2QFJA 5E5NA 2CJ9A 2OLWA 3A3NB 3C8YA 4OX9F 2FQQB 4DR2J 1N88A 1YJ7A 3FFIB 2QRRA 1JLFB 1SUQA 2GS8A 1HQEB 4OIXA 5E3RA 5DZ6A 3LH2S 4JI1F 3ETOA 1Y0HA 1NDPA 5IS2A 4XK8C 1F2HA 2F40A 1X5SA 1KP6A 2AD9A 3SMZA 3OSNA 3W8PA 3UDLA 3M8PA 1O6XA 2VG5B 2Z0GA 1U26A 3OFFA 4W92B 4DL6A 4Z7YA 4UUWA 5B0DA 4YB1P 4LR7A 5LM7E 4UY85 3M8QB 3CULA 5H9EJ 3GYGA 1GMWD 4OHXA 1B3TA 2K5JA 1R31A 1FRKA 3UR0A 4AUKA 4HDGA 3MEEA 4N5SA 4ETXA 3HSGA 2AW0A 1DLOB 4RW4A 1XMOF 1WEYA 1MMLA 5GAHI 3NAHA 3OR1A 2ZBQA 1S9GA 1GMVA 1FFSB 2LECA 2JLEA 9ATCB 4LRAA 4DWIA 2UVRA 1SC6A 2A2BA 3D0IE 2K3KA 3NGDA 1EAYC 4KBIA 4NASA 1RTHB 1UJ6A 2HYIB 4JI7F 5LXRA 2R4FA 4DZDA 8RUCA 1WF2A 2GAHC 3EZUA 4ECYA 3GFYA 5E3PA 3Q2SC 2UU9F 2KB2A 2QN6B 1S1XA 4X4RA 3BB5A 4R5PA 1I5OB 2L9DA 1S77D 3ELHA 3AX5A 1ZH5A 2X7IA 3I4PA 1HBOB 2JFKA 2R3VA 3TA1A 2SXLA 1I1GA 2CQ2A 3R5DA 4HHHA 1NHVA 2IJRA 2HVHA 4DF4A 3OFHA 1Z1ZA 2QLWA 3DLBA 5F8HA 1R8CA 5CH7B 3M2VA 3TARA 2ZOGA 3V81A 1X5OA 3D7SB 1N56A 4V19X 1FFGB 1OYEA 4QR2A 3CCZA 3LA0A 1PG5B 4ZCLA 4DQRA 4DQQA 5IOLA 4M8LA 4L3KA 2B4OA 2HG4A 2LP4A 4MTPA 3AX2A 3UN2A 4PWDB 4WTOB 2ZWPA 2MGZA 1UVIA 1OM2A 3W66A 2VG6A 4CLKA 2EFNA 1OSCA 3K57A 3C6UA 2NUHA 1RLDA 4OX8A 4DJBA 1S97A 4D3GA 2LQJA 1PIEA 2PGCA 2MZ1A 1VGYA 1VQOS 4XTTA 1GXTA 3LUYA 4DFKA 2VZ9A 1R8AA 1RZMA 1OY9A 1TMJA 1LWCB 4Q8FA 4C8MA 2KYXA 2N4DA 1NSPA 1IKWB 2V69A 3Q8RB 4F0HA 3UE2A 3BN4A 1TL3A 4H4KC 3LALA 4ELVA 4UW2A 1SIWB 4HI1A 4TQSA 4FYDA 4A8QA 1RI7A 4EWTA 1PBUA 3MD1A 1HA1A 1BMQB 3KK3B 2V6AA 4MYUA 2PIIA 2HBYB 3Q8SB 4KPCA 4X4PA 2CPEA 3UVJA 4PPZA 2M8HA 2GO9A 2D68A 1JLAB 1N6QB 1HR0J 2NXUA 3NRBA 5IQQA 2GVZB 3K8WA 4ZVUB 4CO1A 5F9NA 2ZKTA 3WDOA 5A2QY 3MZIA 3M2RA 2V2VA 2YNGB 2Y0SD 4O0IA 2J8AA 4N76A 4B9NA 3A4TA 2B9WA 3A3OB 4B3MF 2F8EX 1T8EA 1EIYB 5T14A 2J9CA 3M9MB 2DPIA 1N0VC 2DR9A 3CNQP 5HP1B 3LGMA 5RUBA 1J27A 2BJ3A 3CMES 4KH1B 2GW8A 4RNFA 1VFJA 2P6SA 3FDSA 1EB0A 4I4BA 1SJ3P 1VS3A 8ATCB 3GXQA 2XHWA 2OD4A 2GO8A 2CIMA 3S1TA 3ZZUA 1SJQA 2DR7A 1Q78A 1HBUB 1ZTTA 3W62A 3SZ2A 3HULA 4G1IA 4M5HA 4ZKAA 3SEOA 1Q16B 2HS3A 2HFOA 2FC8A 3BGUA 2VQFF 1NH8A 1TV6A 5EWEA 1T03B 3JYTA 3W60A 2ZH7A 3BBBA 4X64J 1JLBB 4F3QA 2KRRA 3PFEA 1PC4A 1JIHA 3TUIC 3M32B 1VRUB 4RW6A 2DISA 4FXDA 1TAUA 4K50A 1DHMA 2LQBA 3GYNA 2FVQA 1A9NB 2HHSA 2B4PA 1WOSA 3H90A 4DPTA 2VODA 3FFIA 2WVCA 4B9MA 3H8YA 1JLFA 1CJUB 1HQEA 1PJ5A 3PR4A 4USJC 2GNKA 3R2CJ 4U95A 2XSFA 4CLFA 4OFZA 2C28A 4F25A 4JI8J 2VG5A 1RHQB 3RZAA 7FD1A 4BDPA 5M2RA 4E8UA 3D3CJ 2C2OB 5DDOC 2I0XA 2RRNA 3M8QA 1K0TA 3UPFA 2ZITA 3PYFA 3TX0A 1Y3KA 3BJYA 2HFVA 2JZ5A 1X9MA 2ZHOA 4IG0B 3DLGB 2FHOB 3ZXWA 2MXYA 1HQUB 1FVSA 3IWLA 5CQGA 2E1CA 3HZGA 2VHGA 2AJFE 3LOUA 1DURA 4A8MP 4YFUA 1FEHA 3GIMA 2JOQA 2GCFA 1FRXA 5DM7Q 5GAHU 1RAFB 3G5OA 1ARQA 4I6WA 4BS2A 1Y10A 2ZE2A 3V5RA 2UXDF 3T3FA 3IG1B 1N33F 1YRXA 4DZ6A 3MFIA 3AWRA 4N47A 3PJXA 2W8KA 1RTHA 2QFIA 2Y3YA 1WKLA 5B0GA 2W4DA 5F8LA 1J2VA 4ZLNA 2DGWA 4RNHA 1HBNB 2MLXA 4OI2A 3UCUP 4DUTA 5KT6A 1S48A 3H4BA 1FNXH 5GAEI 4CQ1A 2M2BA 5DQGA 1U2FA 5L39A 4ZLPA 2Q2KA 4YY3F 1HBOA 2GIRA 3D3BJ 3GIRA 2BKPA 5EUHA 1VI7A 5DO2A 3MM5B 4IH7A 2XGQA 3S6EA 4NXMJ 1RKIA 2HWIA 3T1AA 2HNDB 4PEOA 3TAMB 5JJBA 4OYMA 4DSEA 2WBMA 1NKEA 1RAIB 1N52B 4FKYA 2UV8A 5EGYA 3RW6A 2RHQB 1T9UA 3I5BA 1S10A 4LREA 1Y9OA 2WZ1A 4PWDA 4K8RA 3MHYA 2W9AA 4M5GA 2MHEA 3MTKA 3AODA 3G6VA 3TQ1A 2E7VA 1XNRJ 2D41A 3RJMB 5JVHQ 4IO1A 2R7RA 2OEMA 1PBAA 1RAOA 3TEGA 3MFHA 4MMOA 4OHWA 3JTNA 1LWCA 1WEZA 1IKWA 2QX0A 3FSXA 2LXUA 4USHA 5A8KB 3RAMA 1NCLA 1R43A 2E1PA 2A2CA 3QSIA 2EG1A 1SIWA 1WACA 2VONA 3TJAA 1FE4A 3FJ2A 3KK3A 3C46A 1NNDA 4K4ZA 2OH2A 3ZZOA 2MQOA 3A8KA 3CE8A 5LMNF 4DN9A 1VIXA 3SCIE 3D6TB 1Q95G 2XTEA 4LJMA 3VVTA 4P71A 3CMAS 1WSRA 4Q44A 1FJGJ 2VH7A 2N7CA 4ZVPB 1HI8A 4RLEA 1N32J 1JLAA 1N6QA 1OJ4A 1Y11A 3SIPB 4ZVHA 2B9EA 2GVZA 1Q0NA 5LMUF 5FLXU 2GZOA 2DR8A 5I4MA 2WVBA 2Z30B 4ANCA 4JI5F 4PQUB 4PUOB 1TQLA 1BHNA 3C6TB 5BYRA 4O23A 2LU1A 2JJ4D 5HP1A 1B28A 3VCDA 3SCLE 4KRWA 1NJXA 4DV0F 4FZVA 2JH3A 3MUMP 3QNWB 2NUUG 3MCNA 3GCWP 3BBFA 1FESA 2H5JB 2RH3A 1VMBA 3G9CA 4OMFG 3W8GA 1FT8A 1Q16A 5HMWA 4CT8A 1GEHA 4DX6A 2HHUA 1NJIT 2BABA 3PDNA 1T03A 4I0WA 2RQCA 3S8SA 2HSEB 2KI2A 2VDIA 1DY3A 3EVOA 4X65J 1JLBA 4Z37A 2XYPB 4XDDA 3V6KA 1UA1A 3M32A 3OV7A 2WK4A 2B7BB 2UXCF 1NDCA 1F9EB 4PPDA 2L41A 3D1QA 4LF2A 3SQGB 4NYPA 4J9PA 1CJUA 4UY8T 1ZM4A 3BO3A 4MJWA 2UP1A 2B7CB 4O4GA 3KHHA 3AH6A 2WVEA 5AE2A 5LOQA 4P2SA 5C2CA 4NLOA 4NLDA 5HO4A 3MOZA 4ECVA 3IR7A 5KT2A 2ZC3A 4KFBB 1WHWA 2BQ3A 4MT1A 5AE1A 1AT1B 1XIQA 1P1LA 3H20A 2FB0A 1Y00A 4IO9Q 4J9SA 2HZAA 1OO0B 3DRRB 2R42A 1XWLA 1TTHB 1TUGB 4V19J 1LXJA 2PMHA 3EPIA 3J7AN 1M5HA 2XMTA 5D0RA 3DLGA 4IKAA 3UWTA 1MWQA 1PYOB 4I6YA 1HQUA 4DR3J 4K4XA 1IWGA 2EFPA 3BYRA 3KTQA 2O67A 2CJAA 2J6SA 1YBUA 5K5MA 1Q8BA 1IQZA 2IM3A 3V6DB 2G2YA 5D6GA 2ZHBA 3KJNB 2YXLA 1F5AA 2A10A 1SKSA 1T9WA 2JFDA 2OO4A 4JV5F 4F04B 3IG1A 4LRVA 2V63A 3CB4A 3KNAA 2QGFB 4UF4A 2OKQA 4X4UA 4ZN3A 4K4SA 3H5SA 2DRAA 2K29A 5KFCA 4LFAJ 2FHJD 4EBEA 2XEXA 4QYZK 2VPYB 1N5QA 2QMUB 1UW9A 1WC0A 3NG8A 4XPCA 1KNZA 1HBNA 2FGCA 4HLBA 3BREA 5M2UA 2V1TA 2W4PA 3PTWA 5GAEU 3CD0A 1N36J 3DMJB 2VJUA 3EGZA 1WJ9A 2CAJA 1R6YA 4ZJLA 5IWAF 5KFRA 3RRGA 2P8IA 2ACMA 3IRWP 4B3SJ 2HNDA 4CO2A 3TAMA 4NLSA 1F3VA 1R8PA 2FLPA 2P2CB 2I5JB 2XTCA 1YIJS 1FX4A 3QFHA 5K14B 5IT9Y 1WC4A 3EUNA 3MAQA 3MEDA 1UL3A 1FDDA 1LNQA 3CJQA 2AYGA 2B4VA 1AUDA 1G3OA 5B0AA 5D0GA 1GMWA 2DXFA 4DSJA 3GSDA 1FA0A 1AB8A 4CT9A 3H2VE 3KKFA 1J5OB 2XQCA 1SJRA 4NXNJ 2L08A 5A6PA 2XMUA 5FJ4A 3HHLC 4RW7B 4B3OB 3THPA 4K4WA 4KV8B 4NE9C 3HVTB 3CWJA 3O44A 3M9OB 1HR0F 4EO8A 3KHLA 3N6MA 2CQ3A 1H72C 2X3DA 1MU2B 3K5MA 5LJ3Y 2KVIA 5A8KA 3M9NB 4FVCA 3OVBA 2CNOB 3P4UB 4OYZA 3TOQA 4ED5A 3C2PA 2W7PA 7FDRA 3NCQA 2MY7A 5AXLA 3RBEA 4IH5A 1GX6A 3U1NA 4OZNA 2WRMA 4DPYA 2EC0A 5HMXA 1T05B 3MXHP 1UMJA 2NPIA 2AP6A 2F7VA 2OPRB 4RWWA 5D15A 2IDEA 3F0NA 4Q5VA 5G0RB 3B6BA 3MMJA 4OI6A 4ZP9A 3SFGA 2AMCB 1UKUA 4CNYA 3K5PA 3RAXA 4AYBD 2LDIA 4QW9A 5LJ5Y 4MAKA 5KOWA 1U1LA 3I6PA 2IVFB 3OHAA 4PQUA 4PUOA 1MNTA 2W2NP 4DQIA 4DL3A 3MECB 4FYVB 3C6TA 4X64F 1YQHA 3UD4P 1OQ3A 3Q23A 5KFDA 2XLIA 3KMQA 3OR2B 5I3UB 3OFEA 3L7PA 2KM8B 3UW1A 2HWHA 3X1LB 1VQKS 1HMVB 5F3TA 2ACYA 2EK6A 5HMZA 4TXSA 3R7SB 2ADLA 2JHEA 2LDYA 3CCQS 1PCAA 2MZQA 3MR5A 4OL8A 2NCKL 4USTA 5L9XA 4F4WA 2YKQA 1S1WB 2HBRB 1NSQA 1UZHA 5LSOA 5CHCB 1VRTB 4M5JA 2Q79A 2IRXA 1JJ2R 3T6JA 4WYLA 4DX8H 4MKVA 1RCXB 4JI8F 2JEFA 3BGLA 2A3JA 2KJWA 3T1HJ 1U1QA 1WI8A 3G4SS 3OLBA 4O3PA 1TZ0A 4WTYA 1D9AA 5KG2A 3ENQA 1RUSA 3L7OA 4I7FB 5I3QA 1JKHB 5K8MA 3FMTA 1ZBTA 4WXOA 2B51A 2KXFA 3SQGA 4LF6J 5KFTA 1H2VZ 1XMQJ 1UFWA 2ZOFA 2CJYB 2FD2A 3BM7A 3CDAA 2EK1A 1VK3A 3D2WA 3L7UA 1N48A 4WP3A 4TVAB 4MK7A 3MCMA 3IC1A 3NWRA 4FN5A 4KFBA 1Q4RA 3G8TA 1NBEB 2W7AA 3EM1A 3OXFA 2EVZA 3DRRA 1VCTA 1M5SA 2PMZD 3QT7A 1NMEB 2HK3A 5IFMA 5D4NA 1UVLA 2AY0A 1GXUA 2KXNB 2POKA 3EZOA 3LP2B 3M1VB 3O3LA 2JEJA 3VEAA 5MAOA 2CZVC 2OD6A 3R7NB 2D69A 3FRZA 2KHCA 1Q8KA 3FBBA 4G6VB 4Q8EA 5AT1B 3QJLA 2XMMA 4AQYJ 2M0GB 2CQHA 2HQFA 3OHBA 1K73T 3V6DA 1HIYA 3DLJA 3VGVA 1U1KA 1NHKL 2BJ9A 3T41A 1DZ5A 2J76E 3AB4B 4NXMF 2CPFA 2AEJA 1YJ9S 4S0MA 1NEEA 3EICA 5ETRA 1WG1A 1FDAA 1RSCA 2LMIA 3MPDA 1R0AA 3MR3A 4DPUA 2X1BA 1KOHA 2V9WA 2K7JA 2BW2A 3R1HA 4JV2A 2OPPA 1K0VA 4TYAA 1HWLA 3ZNUA 3AXMA 3PX4A 1J5EJ 2BJ1A 2FJEB 5A6WA 3VGUA 4K5RA 2XTJP 4OV1A 5K9FA 4AL6A 4CTAB 3DMJA 4I1TA 1XNRF 1NJZA 4FF1A 3QGGA 1F9HA 1VOMA 4TY8B 3Q0AA 2QJ3A 5A76A 4LRDA 5A2QU 1SJ1A 5B0CA 3H5XA 2ZDPA 2I5JA 2KN4A 4AT1B 1SJFA 4O3NA 1I94J 2GIQA 5K14A 1WKKA 2HQGA 3I56S 2LQ5A 3Q22A 4JYAJ 3ILLA 1RT7B 2ABYA 4ZVGA 6FD1A 4J9LA 2VIHA 3DRYA 2XY7A 1OPZA 4NLVA 2HNYB 1J5OA 2F1FA 4MYTA 5CYQB 2V94A 1WC3A 4I2QA 4X4TA 2MKKA 5GADI 3ISND 4M95A 1DARA 1LW0B 2G2OA 2PD1A 4RW7A 1VC6A 4B3OA 4RKUC 4ZDNA 1T02A 4AXJA 4Y2MA 1FJGF 4J90A 4X62J 4WFAQ 3HVTA 3PKYA 2CWKA 3C16B 3UNYA 1N32F 1YSJA 4ID5A 3GMGA 1MU2A 5E0OA 3J7Z5 1BXNA 3CJ4A 4OHYA 2XNRA 3GJRB 2C2ZB 1AZSA 2CQIA 2A2DA 2GMHA 2K1RB 1ARRA 3LPEA 4EK2A 3E2EA 4WZQA 2EFOA 1O51A 1NK9A 3VGTA 3TZZA 5IT0A 1T05A 5HROB 3KJFB 2HRUA 3V6JA 5EWFA 2OPRA 4HL9A 3I32A 2ROEA 2R7TA 3POTB 1ZM2A 3TVZA 4DR1J 2MLZA 5G0RA 1AROP 3ZO7A 2J7KA 1QLNA 1CSJA 6AT1B 1TVRB 3NNAA 2CQ0A 2RRAA 3NCRA 4IQXA 1V3SA 3NY0A 4W98A 2L9WA 1X4FA 3MECA 1PGZA 2RS2A 4HDHA 4ZK7M 1FD2A 4RNNA 4LF4J 4X66F 3CDWA 4R8UB 1CBKA 2QL5B 1VQMS 1HNWJ 4RPFA 3OR2A 5I3UA 1Y7PA 1OQ6A 5A0YB 5G4DA 5CZXA 2Z57B 1BUXA 1HMVA 3JSRA 3DLLQ 4DX7A 2R2TA 2E7XA 2NREA 4LR8A 4A4JA 3TW0A 1TK0A 3GJSB 4YR0A 1FO1A 5B0EA 1RWOB 4PXBA 1S1WA 3D5MA 4ERDA 1G2EA 4WIQA 3D6MB 3DXSX 2YKPA 2NPFA 1TR0A 1XC9A 2E5JA 2HAFA 2IVMA 1B0TA 4F50A 3JSMB 2V2ZA 3AOAA 3D1OA 2E29A 1S12A 3FK4A 1AUSL 3FSYA 4DSIA 4C2MA 2AEMA 1SC1B 1JKHA 4KY3A 2VBWA 3GCXP 3N01A 1YRTA 4C4WA 4KYZA 2H48B 2XM3A 4IH6A 3A13A 3ZTOA 2AEFA 3G6YA 4YN3B 4DV3J 4FF3A 4C11B 3WC2A 2XS5A 4OI3A 5KFYA 2MTLA 2LXFA 5BR8J 4YR3A 2CA9A 2CJXB 1BE4A 4HKQA 2DNPA 2VKZG 3MPYA 2R7VA 4YEAA 1BD6A 2LFVA 4WFNQ 4LF9J 4M94A 4LFAF 4E98A 4A8WA 3H42A 5CD4A 3LP2A 3M1VA 2CDQA 4X84A 3NO7A 4NOHA 3ZTQA 1WUUA 2MQMA 3G6ES 3LQVA 4ZS6A 1VJWA 4JP8A 2D3ZA 4LBIA 1N36F 2MQPA 5L8RC 4XAKA 2CVIA 3PX0A 4BCAA 3KHGA 3KUHA 3QOQA 1ZETA 1VBZA 2B56A 2IYGA 3NWGA 3KUEA 2CXEA 3QRQA 5DG7A 1LW2B 3G87A 1BQMA 1FRJA 2ZH6A 2W2QP 1DQ9A 4C8KA 3R9LA 1IRQA 2BJDA 2J7UA 4OV6A 3KG4A 3RYLA 3GFHA 3W2VB 2DY9A 2R7QA 3IBWA 4UUXA 1Y3JA 2AWZA 3PIOQ 3DYAB 2B6AB 3CEDA 5IXUA 1YJNS 4JB8B 4CTAA 4NXNF 3H5UA 1B7FA 2DNOA 2CQDA 2E7WA 2BE9B 3HZEA 2AHOB 2RF2A 4TY8A 1T11A 3AOCA 2QSWA 2ERRA 2MKJA 3SQOP 1LOUA 2QLXA 2BRLA 3IAS9 3QPIA 3O8WA 2JC0A 2JLGA 4IFVA 3BSNA 2OELA 5D4OA 2ZZTA 4Y2KA 2V8PA 2KOEA 1RT7A 2PT0A 3RUBL 3J80U 1SBRA 4CO0A 2P9EA 2CPIA 2DGUA 5CYQA 3GR1A 2R8HA 1NJYA 1WG5A 5KTQA 1C0UB 2BR0A 1LW0A 1NKBA 4C3MA 4ZCMA 3PO4A 3I9ZA 2MEWA 2DIUA 5GADU 1RT1B 2AYBA 1VHIA 4WPAA 3C16A 1SIZA 4B3TF 2Y9HA 1EQMA 4LSZB 1IM4A 4P7VA 5MLCV 1SQFA 5B09A 2NSBA 2IM2A 3PEJA 4AE5A 2FHJA 1NSAA 3EGVA 4UQTA 4OYXA 2ZM6J 3K5OA 3TZXA 2WSEC 3PKMA 2ALZA 1T9YA 2KDOA 4X2BA 2Q1LA 4ER8A 3HKZD 2HVIA 4FP9A 5HROA 1U1RA 1P9YA 1R6VA 4DPWA 2DGVA 3CD7A 1M1GA 1K47A 2PSZA 3WBZA 2HFZA 3POTA 3NGUA 2OI2A 4CWBA 2I2YA 2F4FA 4JI0J 1TVRA 1CQNA 3QGPA 1NK0A 4HT7A 3HHDA 2BV3A 4F4YA 3VQSA 1T3NA 1XEZA 1R3NA 2QA4G 4Q0BB 3BKFA 4JI3F 1TUVA 2VUGA 3DRSB 5KFIA 5F8IA 3T1HF 3DOKB 3BZQA 4DL0C 4R8UA 1CULB 5ETQA 2ASDA 1ZPVA 3NCPA 2XCPA 3I96A 4DS4A 3PCOB 1B70B 2YPZA 1RYSA 2WOMB 5A0YA 4YMEA 2DPJA 5J1PA 1XNQJ 4PRFA 1R0CB 2LYVA 2IBOA 5DQIA 2HFNA 4ANEA 3SI8A 1U2CA 5D8HB 2AZ3A 2EI5A 3F73A 5B7WA 4QCLA 1S6PB 4ECTA 4B9UA 1NXIA 3SV3A 1EQ0A 3PRBA 4ZPAA 2BYCA 4DV6J 3JSMA 3C14B 4P74A 3VF0B 3VR1A 1WTBA 2UUWA 1VIOA 4CZCA 3TUPA 3FUYA 4CM2A 3W3SA 2HGLA 2CQ1A 2MSTA 2B3TB 1D09B 3W9JA 4NLUA 1F5BA 1K1SA 1S59A 5KG4A 4I56A 4Q45A 5DLFA 4FKXA 3A8JA 2IMWP 3B4MA 2Z4PA 2CWXA 2DO0A 3US5A 2JXGA 4W90B 1MN7A 4USWA 4C11A 3TI0A 3G82B 1IM6A 2YKMB 4ZPDA 3KYLA 1VISA 2AJ2A 3Q8PB 2AU0A 2V50A 4D8JA 2EBEA 4IG3B 3JXOA 4H4MB 2RQKA 1SV5B 1LKZA 1HWJA 3I55S 1RXOB 4QU6A 4F36A 4DQSA 3UO0A 3J7YI 3T5HA 1V5IB 2X3GA 3W7BA 4QIGA 3VAHA 1S1VB 3L09A 4MIBA 2GHPA 3UN5A 4ETZA 3RB4A 1ICEB 2W4CA 2WONA 4M5MA 3HP6A 5HJYA 4KKOB 4F3MA 4GKKJ 1WORA 1YTYA 3M8SA 1MN9A 4K0KJ 4PZVA 4ECUA 2OEJA 5KG6A 2J5AA 2E9ZA 2CRLA 5ETSA 4QWDA 1WDDA 3N5FA 2BA9A 2XY6A 1YZ7A 1FJEB 2ZDOA 2DXEA 5CZVA 2VG7B 2F4VJ 1LW2A 5L1LA 3JTOA 2GQQA 5DDRC 2BKOA 1I94F 4RNOA 5H9EK 1S49A 1UWAA 3MTJA 1Q79A 3W2VA 1HKAA 4P2FA 4G65A 4N56A 1ROFA 3RBZA 4EBDA 4EI2A 4EMDA 5FLXY 3DYAA 2B6AA 3JS9A 3JAMU 2CPJA 1D8ZA 2R2RA 3EGNA 3CDEA 3T1YF 1Q82T 1VQLS 5EN1A 2O01C 1TL5A 2YKOA 3MMAA 1WOPA 2OHDA 3R5JB 4OYBA 2ZH4A 4NEZA 3QATA 3CPWR 3ICLA 1FWKA 5EWGA 3AY0A 1IBCB 1WHXA 3ZC4A 4X4OA 1X31C 2FPHX 1SI9A 2YX1A 1GK8A 2AV5A 3W61A 2F5GA 3IBCB 5LL6d 5ETMA 1SL2A 3NL0A 4HH1A 3IAM9 4RW8B 4UZBA 1ZS6A 4WP9A 1FKPB 4N41A 2HURA 2RU3A 4X4NA 4MIAA 3FBCA 1P27B 5KFJA 3HPOA 4C48A 5JMNA 1RT1A 3FMWA 2FJXA 2ATLA 4DV1F 4DR1F 3W9HA 4OX6A 4J9QA 4WZMA 4BWJA 4DL4A 2FUG9 5JVGQ 2O3DA 2NXJA 1S1XB 1Q8IA 1S7IA 2HAIA 4PG5A 4ES1A 1XR6A 2J0XA 5AJ3J 3J81U 4ED6A 4PXDA 1ZZFA 2WB4A 4LF4F 5KFSA 2LU2A 2UXDJ 1HNWF 4ICLB 3CO9A 1M5PC 3GIJA 3BYPA 4ZN1A 5T41A 4DCPB 4DMZA 1NK5A 1G6BA 2DRDA 2KM8C 5IC4B 2MKYA 1HNXJ 3D1HA 2HLUA 1T95A 4JI2F 2WSCC 1HQ2A 5C25B 2ASJA 5EDWA 5IZHA 2HHHJ 3GJTB 1OY6A 2UVVA 3D68A 4K5SA 5FDLB 2R7UA 2AX1A 5B0BA 1QVGR 3UN3A 4ZPBA 1KC8T 3CJ8A 4YY3J 4DFPA 3EJMA 3D0HE 4EYHB 2HHTA 3DOKA 2ZH3A 2J9EA 3PR5B 2GAGC 4DR7F 5HLFA 2ILYA 3S01A 1HW8A 2OSRA 2VQEF 2CUYA 2WOMA 3TVYA 3Q24A 5ETVA 1U0HB 4DS5A 2DO4A 3MCSA 3M8WA 3DU6A 1HI0P 4UOHA 5KT5A 1WKJA 3PW0A 4CYUB 2VD3A 2QLJB 2VDHA 2HNZB 4UZCA 4DV3F 1S6PA 3QT8A 4WYWA 2AN7A 1KSPA 1RT3B 1VYAA 3F41A 2PE8A 4OI0A 4ZITA 2KKEA 1JLQB 1H7WA 3UVJB 4ZVTB 2Z56B 4DSKA 2RSQA 3C14A 2CNLB 1VC0A 1NUEA 3P96A 1UPPA 4RX6A 2Q3PA 4I2PB 4OQJA 1B64A 3CMQA 4CP5A 1RE1B 1PILA 1KVIA 3NBPB 4LIRA 2RUSA 2C1EB 4IOCQ 3GG1A 2QLBB 4H4OB 2YPYA 5IQ6A
chains in the Genus database with same CATH topology
1HBNA 2FGCA 2MDAA 4HLBA 2VFRA 3TANA 3QIDA 3BREA 1QAYA 2DHGA 2YKMA 3MM7A 5M2UA 3KK2B 2NQPA 2ZZMA 3QJJA 2BQUA 2FY1A 2W4PA 4PR6A 2J0QD 1KRPA 3DI6B 4KGMA 1AFJA 4ID8A 4NYOA 3S7RA 1X8DA 4LF6F 2MZTA 5GAEU 3CD0A 1MROA 1YG0A 2IHR1 1GH8A 4NPOA 2I9SA 3CJ3A 1S9FA 3PM9A 1XMQF 4QYRA 3DMJB 2MKIA 3EGZA 4IG3A 2CPDA 4AXIA 4H4MA 5DM6Q 1F2GA 2YTCA 2XB2D 1SV5A 3OTEA 4PKDB 4QWCA 1X0FA 4KO0A 2NLWA 1R6YA 5IWAF 2N3OA 3M2UB 3QLHB 1BLUA 5KFRA 2OPQA 2DGOA 4U7UK 3RRGA 2OIHA 3DRPA 2YKNA 2ZBCA 2WTFA 3IRWP 3CCRS 3MEGA 2PC6A 1U7LA 3J7YU 3EPGA 3QAEA 3LWLA 1S1VA 1SQEA 2HNDA 2G1DA 4CO2A 2OTLS 1FHTA 4A8OA 2C3MA 5KFBA 2YKAA 3OVAA 3TAMA 2XS2A 2W9BB 2BE2B 2LQ9A 4TYBA 4NLSA 1DLOA 1KLMB 1R8PA 3U1LA 5HN0A 2FLPA 1SKRA 3GFZA 2R8IA 2I5JB 4DG1B 2XTCA 5J2MB 1YIJS 1FJCA 3B82A 2B9YA 2HHPA 2XMJA 3O2IA 2JVOA 2PN6A 5K14B 5IT9Y 4KKOA 1NZAA 3CD5A 2V9KA 3EUNA 3MAQA 1TKDA 3QWUA 3MEDA 1UL3A 1FDDA 1N4LA 2AYGA 5I42A 2B4VA 1D9FA 3MM8A 3M6XA 2HW3A 1UFLA 1AUDA 1G3OA 5B0AA 2JEIA 1MSWD 3TYTA 3NNCA 2YNHA 4IRCA 4DSJA 4YOEA 1GNKA 4ZPCA 4FXVA 4FBUA 2C22A 2D3UA 3GSDA 2PA8D 3AHPA 1FA0A 4H4KA 4NCGB 4CH0S 3GV8B 4FS2A 4CT9A 1QSSA 2KT3A 4DV7F 3RB3A 3H2VE 3KKFA 3HHNB 2L9NA 2E5HA 2VG7A 2XZWA 2DGTA 5ADZA 3RAQA 1J5OB 1SJRA 3KLHB 3HK2A 2DNYA 1CC7A 2HS0A 1DJ0A 2L08A 4MFBB 2GA7A 4IFYB 1U1MA 5A6PA 2BOPA 2MQNA 2XCAA 2BZ2A 4KHRA 2XMUA 2I38A 3RB0A 2ZOMA 2GMLA 5FJ4A 4ZCIA 3HHLC 4RW7B 5IM0B 3PVXA