3BT2H

Structure of urokinase receptor, urokinase and vitronectin complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
213
structure length
212
Chain Sequence
b'GVKLQQSGPEVVKPGASVKISCKASGYSFTNFYIHWVKQRPGQGLEWIGWIFHGSDNTEYNEKFKDKATLTADTSSSTAYMQLSSLTSEDSAVYFCARWGPHWYFDVWGQGTTVTVSSAKTTPPSVYPLAPNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIAAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
molecule tags Immune system
source organism Homo sapiens
publication title Crystal structures of two human vitronectin, urokinase and urokinase receptor complexes
pubmed doi rcsb
total genus 43
structure length 212
sequence length 213
ec nomenclature
pdb deposition date 2007-12-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bt2H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bt2H02
3W0WB 5JXEA 3V8CA 4IHOB 4GG6A 4OBSA 1G7LB 2GT9A 1MJUH 2BSSA 4NWTH 5D96B 5F21B 4JAMA 1I8MB 3ALXA 4M7LT 1BOYA 4PJEB 3SCMB 2YRPA 2XOTA 4GBXD 1F45A 3HMWH 4BSWA 3RNKA 1OAKH 1WZLA 2B0SH 1WUNT 1FH5H 5F8QC 4EN3C 5FYKH 5E8EA 2V17H 2CDFB 2GSGB 3D18A 4LCYB 3VFTA 4M1CC 4YBHA 4O02H 1AGDB 1IBGH 3MGAA 1XMWA 3S7GA 3QDHA 3IU3A 4I0CC 5D2LB 2L0DA 5L0QC 4DQOH 4XZUA 4WCYH 1CICB 4JDZB 4RGOL 1PY9A 1LO3H 4J8RB 3CGTA 4LMQI 4UU9A 4MXWH 4LLQB 3T3PF 5EO9B 4XH2B 5D9SA 1MF2L 3IDYC 5BS0D 5IR1B 2LV4A 4F7EA 3L5WA 3UMTA 2ESVA 2ZCHL 2WUBL 3UROR 4JPVL 1UENA 1RAMA 4FQJL 1NGZA 3WS6A 3NCEB 1N2RB 2G60H 3BP5A 3HR5B 2RCSH 2FECL 2OP4L 2DOCA 3VFOB 5BJTB 4P3CH 3HG1E 4UI2A 5HHOA 4HV8A 3VD5A 2VR4A 4TVSa 4X6EA 5BVJB 1YYMH 4XB7A 4K94H 5D70L 2WZPD 5T3XH 1NGPL 3OB0K 3UEZA 1EBPA 2GQHA 2D7MA 2FGWL 2HN7B 5DMKB 1VACA 1XCQB 1W0WA 2A83A 4WGWB 1XH3B 2AXFA 4Q74A 5DJZB 3VFVA 2J12B 5FYKU 3EAKA 1NFDF 4ZSOE 1YEGL 4XP9L 3QDGE 1MFAL 3I75A 3BZFB 4MSWA 5CHNB 1G7MB 1RZKH 1UB6B 1UKTA 4P57A 2ED7A 2YD1A 4R4BB 1I8LC 4WHTB 3C8DA 3DV4A 1G1YA 4H0HB 2PW2A 2DTML 3RHWK 3B83A 4QGYA 2X4QB 4HX1A 4PLOB 2YKLL 1QFWI 1IKNA 1DL7H 3H7BB 3WO4B 2SEBB 4JR9H 1XF1A 2R29L 2VLJB 3CPLA 4KK6D 1LO0H 4XC1H 5DD1L 5F88B 1OP5H 5MP6L 3RWGB 4FZ8L 2BVPA 4X7SL 5HYQB 5J8OA 4N68A 4G9FE 4UUJA 1TZHB 2DQJL 3U1SH 4RMQA 5D1XB 4Y4FA 3VU2A 1JK8B 5CUSL 5LQBH 5L88L 5IG7B 5E2VL 1NBQA 2XZAH 2OMNA 2VO5A 1HCFX 3NVQA 1YEEH 1M6OB 1J88A 5EG6C 1EHXA 2JKXA 3GBML 3U9PH 1RHHB 2IALB 3D0VB 2FZ3B 5LG1A 2P8LA 3GRWH 4YE4H 3ZTNL 3WFBH 5HPMA 1SJHB 3GSUA 3QJFA 3BJLA 3T0WA 2BVEA 1KTDA 4YZFF 5F1NA 1QSZA 3BO8B 3HUJE 3BYYA 1FIGL 1XIWA 2XACC 4NO3A 1P4LB 3D0LB 3DX8A 4G6FB 2NQCA 4G8FB 1OCWH 3BGMA 5KSVA 1DFBH 3K2UL 4MD5B 2F8VA 3BIKB 4HC1A 1QA9A 3VRIA 3L3JA 1REIA 4V1DD 1GHFH 4ZSOB 4U1HB 4Z0XB 2EIZA 3A6CH 3FJTA 3T3ME 3P9LA 4RRPG 1XZ0B 2RIKA 3GSOB 3DURA 2WQ8A 1J1OH 3KPTA 4FMKA 2J8UF 4AG4H 5I0ZA 4CMHB 4MCZB 3T0ED 4TQEL 4UTBL 2VXVL 5F89A 4PG2A 4XCFH 2XTLA 3VG9C 1U3YA 4R97C 4JDVB 4Y4HD 2J1KA 1K3ZA 3J7HA 2BVUA 1MY5A 3BT2L 1UM5H 4NQEE 1LNUA 4OLVH 4KVNH 1A1MB 3CX5K 5LGJA 3KYKL 4JJHA 4L4VD 1PQZB 3SQOL 4S1QH 5HYSA 1R3KA 3RUGA 5AAMA 3S3JA 5I8OL 4YLQT 1U8PB 2NY2C 4LCCC 3D0LA 1D6EA 2LTQB 1HIML 4I4WB 4OZGA 4BQCA 4ZAKB 1FO0H 4Y19D 4JPKL 2Z35A 4JFOB 4NPYA 3VFRB 3N85H 4MNQE 1EVUA 3BGFC 1KB9K 1ZS8B 2Z0BA 3ULSB 4PRAA 1PG7L 1XIWD 4DTGL 4OZIF 4X5LA 1Z9SA 3LQAC 4HUWA 3EW3B 4OT1H 1OP3H 3V0WL 3VCLA 1JHLH 1ONQB 4Y16D 4OLZH 5DHVA 2VDOL 1AH1A 1MQ8A 4M43L 4GW4A 2M26A 3VXPA 4FFZH 5IB1A 2VDML 2GEEA 4NO3B 1AXSB 5J06A 2E9WA 4F37K 5A2LH 1MIEH 3STLB 4ZPVA 5IBUG 1R5WB 1BJ1J 3QEUB 3U46A 1A1MA 4E42A 4H5SB 4L4VE 1HI6A 3DBXA 2I9TB 4HFUL 4HUWB 2DQTH 5DJ2B 4ODSL 4NHUB 2J5LB 3PDGA 2QQNH 1BFSA 3ARPA 1BAFL 43C9A 4XNYH 5JR1H 1DLHA 1U0QA 4Z76B 2XKNA 4NJAL 3STLA 12E8H 2P24A 3KXFA 1FL6B 2BVTA 3BKJL 4KUCF 4OCRL 1RIUL 1DVFA 1FZKA 1R3IH 3OKLA 3RA7H 5AUMA 2Z93B 4RMSA 2XQBH 1LO0L 3CXHJ 2EDQA 2J5LC 4L3CA 3BKYH 3UX9B 1F4HA 1U58A 2GKIA 4K7PX 1OAUH 1JGVL 3G5VB 2YN3A 1PQZA 3DRQB 4KKLC 2WIMA 1HNFA 1ZTXL 1F3JB 4UMGA 1A7QL 2B4CC 5DD3L 4JM2F 5C6TL 5C9JA 3QDMB 3IXTB 1Z6JT 1A5FL 2AXJA 2EH8L 2YPKB 1FLRH 2DQHH 1MI5D 4LGRB 1JWUB 4XPTH 3HZKB 4S11A 4YQXH 1KLFA 3QXDB 4X4XA 3WV0A 1KXTB 2Y5TB 3F6IA 4W68A 4MDJA 5E2WH 4IRJC 4U1MB 3C8KB 1IGCL 4QRPA 1R3LB 2FH6A 1MJ8L 3FQTB 3L6FB 5BVPL 1QSVA 3CVIL 5HDOA 1U8PA 2VIRB 2BC4B 4ZTPH 2EXWD 2FBJL 1JF6A 4Z18A 5D93C 3R06A 1WEJH 5LXGH 3TPUA 3MV7B 3HAEA 1DEEB 4GT7A 4D9QD 4WO4B 4I0KA 5EPMA 4EUPH 2FSEA 1L7TH 1ZWIB 4ZPTA 4U6TA 1DBBH 3LCYA 5DRZB 4MNHB 2P5WB 5L7XH 1P84K 4S1SL 4I2XE 2P5EE 2VE6A 4XCEA 2BERA 1NDGA 1MJJA 4CNIA 4B5EA 3C9NA 4G7VH 5DVMA 5KSUB 2YR3A 3SJVB 3LB6D 4CU7A 5DMGD 1OB1A 5HDBE 3OX8B 5SWZA 4KROC 2VL5B 1ORSB 2J88H 2NY3D 3MCKA 3C09C 1FDLL 4WWKC 4JPWL 1JUFB 5K9KA 1KB5B 3P40A 4NZDA 5D7LD 4C55A 3CLEL 5F93C 1ETZB 1KLGB 4PJXE 1AGDA 5DEZA 3EOBB 3TO4B 2NXYD 1AD9A 4NQEA 2IANB 5FAAA 1MAMH 5D7LE 3L3IB 1A6WH 4GKNB 4P2RD 4YX2L 5I71C 5FKAA 3MJGX 5IK3A 3NN8A 4G42A 3ZKMC 2OTWB 1QRNE 4AH2B 1INQA 3NCMA 1X7QB 5BXFB 2EDHA 2NMSA 5D5ME 4Y16C 3HE6D 4HF5L 3WNOA 4LCUB 2Q7YA 1AQDA 1DQTA 5HGHA 35C8L 3VXME 3K2MC 5C0NC 1A6WL 1NSNL 3ET9F 4FQ2H 4KK5D 4G5ZH 1U8LB 3VFMA 2AJ3A 4XXCA 3VMPA 3L5JA 1VEMA 2AJZA 1SVZA 3W0WD 2NPLX 4LLYB 4Y7MA 3BE1H 4U7MA 5BRZA 4F57L 4U1NB 5FGSA 1FDLH 3GMMB 4JHWH 5DWUH 2J88L 4DKAA 4LLUA 3ULUF 2XN9A 3G6JB 2DLFH 4NJ9L 3SGJA 5EU6A 4RZCB 3NABH 1NH6A 3WO4C 4KRNA 1IGTA 4P2OA 3ISWA 2JK5B 4C83A 4YDVB 2H9GB 3TT3L 4G7VL 3SJVA 4Y5XA 1ZT4B 3K4ZA 4QF1B 5M95B 3OL2A 4MD4B 5DQDH 5C3TA 3RVXC 3ZHLA 2F19L 4BZ1H 2A6DA 4JFFE 5GSVB 2DMBA 4EIZC 5D7IB 2YXMA 3CNKA 4RZCA 5DRZA 2X6MA 4Z7UA 1CQYA 2XPGB 2QQKL 4BZ1L 2QQQA 1WEJL 3EOBA 3D18B 1Q9KA 4XHQA 1FSKB 4C54A 4JHZA 3EGSA 4ETQA 3RNQB 1T1ZB 4OI9A 1G6RL 1YYLH 5H37H 4LEOB 1RUML 1S7QB 5FUOH 4D9RD 3GRWA 2DKUA 4TN9A 3QCVH 1QR4A 4CDGC 4PJ7E 4JFDA 3FQUB 3TYFA 4Z7WE 3RVVD 4M8QB 3D85B 4WI6A 1M05B 1K8IB 1C5DB 3H0TA 5D9SB 3KPNA 1G9NC 3QFJE 1ZSDA 3GSNH 3GZKA 4HC1H 4MAUH 4LHUB 4JHAH 4KAQL 5E4IA 3TO4A 2ZJSL 2EDEA 2HJKA 4WHDA 1EJOL 4NZTH 4ZOEA 2BNQE 4FQQA 2JCCE 2W9EL 5FKAB 4GXUM 2JF1A 5DT1H 5HBBA 2CSPA 1Q9LA 3FT3B 5ACMA 1AR1C 4OCSL 5EN2B 4XWGL 3GI9L 2YMXH 1SY6L 4OZFB 1ACYH 4MDIB 3MUGB 3H9HB 5I9QB 5JR1L 3BD3A 4LKCB 3QQ4A 3RKDC 2FR4B 4K9EL 5MENB 2QQNL 3KPSB 5CINH 1ORQA 3G5YB 1XEDA 3P11H 3QI9A 4ISVA 4HUKB 3QPXL 5EZLB 1IVLA 5DEFB 4MNQA 2XWJB 1U8MB 4YAQA 4X99B 3PHOB 5EO1A 3FOLA 1T21B 5ID1B 3MNWB 2GSGA 4YGVA 4JFEE 3LN5B 4JO2L 1QR1A 3V6BR 1RURH 3O6LH 5J13C 3GKWH 3C08H 4NQCE 3U30B 5EBLB 2JJSC 4KKLD 3FQRA 3MQIA 1TQCB 2HLAB 4MJ5A 3TN0B 2ITCB 2ZCLH 3LVEA 4YDLB 2Z9TA 1HINH 2AK1L 1SHMA 3O2VH 1EIBA 4LVEA 1U3HA 1E6OH 1VGEH 2ADFH 3CFJA 2D3VA 4XPHH 3RKPA 1Q0YH 3T1FB 4S2SA 2PO6A 4LU5H 4KDWA 1ZS8A 1G6RB 5CGYC 3U9UA 2BY2A 1C8PA 2PN5A 3DVGA 3C08L 4UDTB 2PYED 1JPTH 5IP4A 3BKMH 1JRHL 3SDCD 1UJ3B 1A7RL 4XPAL 3CFBB 5KS9F 5HHVL 2EO9A 2G9HB 3V4VL 5I1CH 5F1KC 5JZ7D 4R0LB 5E2WL 1KN4L 4HJGB 4EI6B 2ED9A 5FECB 3TLRA 3D85A 4OLVL 4FZEL 3WXWH 4YWGH 2K7PA 2H32H 2O26U 4FTVA 1SYSA 1HH9B 5D1QA 32C2A 4QTHA 1NUNB 3UDWA 4PJIA 4OFYA 1FGNH 2OL3H 1UEMA 5D7JB 2UVEA 2R2EB 4PJ8C 4XMPH 1UACH 2DIJA 3BP6B 3EFDH 1A7QH 1WBZA 4DKEH 2CUMA 2ZUTA 2FL5A 4G3YH 2VL4A 4PP2A 1V8HA 5C07E 3O8XC 2ZUWA 3HRZB 4DEPC 2PO6C 4BQ9A 1A6TB 4X9GA 5EORH 3HI1A 4TUKH 5IJVB 2PETA 5HYFA 5C0AD 1KIRB 5KTEH 3UJTL 3I3BA 4TSBH 1WJ3A 4OCXL 2QHRL 1ED3A 4YH6A 1EERB 3N1MC 3S8WA 4OGYL 3ULVD 3IFOA 1QRNA 2ORBH 5EBGA 2NR6C 5GS1B 3X17A 1WWBX 4QHMA 3UBXI 5I19H 4N0FB 1O0VA 3CU1A 4NZUH 1WWAX 2YUVA 3AREC 3MOBL 2IG2L 5MEQA 4ZAKA 4BFIB 5D1QD 1GIGH 4GQPH 4C56B 4P4KB 3GNML 4L8SB 4CJ0A 3WO3B 5ECJE 4XPGL 1GPOL 4YUEL 4ZO7A 3UPAA 5FM8A 3D85D 5ACZA 5BS0B 3TGXA 3O3UN 1PEWA 1IT9L 1E4KA 1GGUA 1MVUA 3QI9C 5FA4B 1TVDA 1LO4H 1GXEA 3P4NB 1DUZB 3N1PC 5CJBA 1INEL 5CSGA 5KSVB 2W07A 3ARFA 3IKCA 2VLJD 4QCIB 3LKQB 4TRPL 4MXQC 2VH5H 3HC4H 5GGRY 4HZLB 3RWFA 3BQUB 5TDPA 4KY1L 1MCOH 2DKSA 1YNKL 3ARBB 1JNNH 4EXKA 3W39B 4GW5B 1JPSL 4UV4H 3H9SA 2AK4B 4QT5A 4EDXB 4PUBL 1HZHH 4K3DH 1DQML 2W1NA 2I5YH 4OZGB 1UWXK 1A4JB 2AI0H 5I8KH 3FL7A 4APQD 1F90L 4WTXA 5AEAA 3TT1H 4Z7QE 4NNYB 4XPFH 5J4MA 2VQ1B 3QWRD 3Q48A 2VRAA 4Z77A 3ZSTA 4U1KB 3T09A 1KTDB 1MRDL 3GNMH 3U4EB 5CGYD 4NFBA 5IJVA 1E6JL 3LHPH 2BRRL 3WJJC 3V0AC 1W2KT 2VNCA 2ZCKL 1IMHC 4JM2D 2YD9A 3PQYE 4WU5B 5BV7B 1A4JA 1MJJB 4LL9A 5JIPA 3I84A 3KYMB 3FRPG 2DICA 3FFCB 2EC9T 1JNLH 1FYTA 4JQVC 3FO0L 4DN3H 3OBAA 4YBQD 5I1DA 4Q9RL 5GZND 4AL8L 3ARBA 3MYZA 3S34L 4BZ2L 5I1IH 3SDXF 5HYJD 4X80L 2PYFB 5JW5A 4RBPK 4KTYA 4CGTA 1TZHA 4Z7UF 4M62L 1VFUA 4LASH 5CEZD 3GBNL 4K7FB 1VFBA 4NN5B 2KUTA 3L6FA 3MLXH 3NTCL 3L7EA 1UWXH 5IROA 4K8RC 3MV8A 4HWZB 4EI5C 3PQYB 3QNXA 5J57B 5D2NE 2DIAA 2V5SA 4GMTL 3SGJC 1MCRA 1QQDA 4UV7L 4BFIA 1AO7D 1RUKL 1MNUH 3VWKD 3DETC 1DE4A 5I1LB 5D7JA 2B0SL 4XVJH 4HPOL 5GS0D 5EU6D 3RTQB 3LEYH 3REVA 1CGSH 1G7HA 1XF5B 4UOJA 2X89D 4TTGA 2FATH 5GPRA 3TZVC 1DVFC 2WLZA 3BGAA 4QRRD 1LE5B 3K81A 1G84A 3TEUA 1D6EB 2ENSA 1CVSC 3QWOB 4MNGB 3BISA 3L3JB 5FV2A 2ICWB 3ZKXB 5A3ID 5B21A 4HCRL 4XNQA 5BW7A 1IEBB 5JOFB 3HI1B 1BBJB 5AZEL 3NH7H 5BV7L 5DHVB 4WUUA 3WMSA 4CVXA 2HKHL 5ESAB 1RK1B 4PGCA 4LVOB 4Y4HB 4KKCC 1OPGH 5F89B 4KV5E 1A6PA 3BPLC 3QUXA 3KPSD 3IDUA 3TBSA 4I3SH 3HUJF 3MMEA 2YD5A 1QSFB 1KCUL 5EA0H 4FFYL 4P2RA 4DVRL 3CDGA 3JTTB 1CGXA 3O9WA 4U1GB 2VDRH 2BJMH 2A74A 2EH8H 4E42B 5DC9B 3HA0A 4L3ED 3QIBB 4PY7B 2IPTL 5AG9A 4HKJA 4JRYB 2B20A 4CW1A 2PYEB 4N0UB 1NCBH 5GGTL 3O3DB 1I8IB 4LCIL 4Q9QL 2OTUB 3GSRB 5CS7A 5IF0A 1W0YT 4YEFA 5C0EB 3RNQA 3W81A 3HLAA 1XFPA 5ENWA 3DUSB 1EGJA 4O00A 3ZHKA 4ZTOL 4HIEA 5H35B 3EOTH 1C16A 2NYYC 5B39A 3ARUA 2X7LB 5H8DA 2XV6B 1N0XH 3BZFA 4MSWB 2WUCH 5CHNA 1G7MA 3FQWB 1IC4L 2NXYC 5AWNL 2X4TB 4WV1A 1NAMB 2QTEA 1FORH 3VGBA 1SBBA 1OGAB 2NTSP 3ULUE 3VXUA 4ZFOL 5LGHL 2QADB 4YHKL 5T5FL 5EU3A 5C0BE 1LEKA 1WK0A 4X4ME 1FNGB 3WHE1 3BPCA 3BXNA 4XGZA 1J0ZA 4XTRD 5IB2A 3IAPA 5E2UH 1EUTA 4GSDH 1Q9LB 2IANE 4NM4H 2EDYA 3CSYA 2NZ9C 5KVGH 3P0GB 1QR1B 4M61B 5EBMB 4P23A 2C26A 2E27L 5F7UA 4KTDH 5DRWB 1KCKA 1U93A 2A9NL 5B22A 4YBQC 1XCTA 2VXSH 1MCHA 3QG7H 4JHBA 4NO0A 4FFVD 2ZSVA 3QJHB 3ARZA 2V2XA 3B2UC 2H32B 3O45B 3OF6D 4OGAC 5JQ6L 4P5TA 1YJDH 4P4KD 2CGRH 1SBSL 2NLJB 3JZ7A 3BYTA 4ODVH 3VXSA 1BHGA 3V4UH 2X44D 1KJ2L 2WLYA 5FDWB 4LSQH 1J1XL 1S7WB 2E7HA 1J8HB 1EEZB 1TIUA 4HUXA 3R4DA 4HKBA 4NOFA 2R1WA 1QBAA 2DYPA 1UKSA 2UYLA 4HULB 3R0NA 5BRZB 3UYRH 2DQFB 1RJYB 3IGAA 4FFWD 1NMBH 5EULV 3VXNA 3WJJA 5F1SA 3KDMB 1WBYA 2HVKA 3QULB 4Z78B 4PBXA 4LQFL 5FDWA 5JMOC 5IBTH 5DVOA 4TQEH 1GZPA 4K55A 5DQJB 3PV6B 3CJJA 1LEGB 4P2OB 4OM0L 4ZYKB 1JTTA 1I8MA 5FO8B 3QH3A 3VA6A 5F6HI 1S7QA 3QDAA 1FG2A 2Y4SA 3RGVD 1OQOA 3HCVB 3IS0X 4NQDD 4LCWE 1UJ3A 3WKML 2DQUH 1J8HE 2GUOA 2OTWA 1AGBA 2OM5A 2P5WA 2FH8A 5DEFA 4ALAH 5E24E 5KAQF 1FL3A 4J1UB 3NPSC 2AJ3B 1T21A 4KFZC 1IZKA 3MV11 1CL7L 4YHLL 5HGHB 3MRKA 2FHFA 1B2WL 4QRSB 1QRND 4F9LA 1HKFA 1C7TA 1IC5L 4UQ2A 4YXKH 5DGQA 1NFKA 3HAEH 3QEQE 4IRJD 1MWAA 2XZAL 2FEDC 4KTDL 5DO2C 5E2VH 5FYJL 3TYGL 4OCLC 3P77A 2GCYB 4G8IB 2YEZA 5DA0B 1RZGB 1UJ3C 1OM3H 1T1WA 1MREH 3PWPD 4DGIH 1N4XL 3E0GA 4O9HH 3UPRA 4I77H 3T4YB 3VI3E 1XGUA 2M8XA 4X9HA 5D7IE 1B2WH 3PHQA 1RZIA 1TPXB 1CZ8H 1DJSA 3HCVA 1CL7H 4XWOC 4HWBA 5D7KE 3U36B 5IW1A 5D7IA 5BOPA 4UIKL 4GW1B 3GHBH 2VAAB 1D9KA 3DMMC 1BECA 1AGFB 1KCRH 4GKOA 1RZKL 2HTLC 1OSZB 4YDKL 1K8IA 1JGDA 1TQCC 1AC0A 3T0EE 2P24B 3T2OA 2X70A 3RFZC 2JCCF 3AGVA 5GGQL 4HJJL 2QQLH 3P4LA 1T1YB 4HXAL 4O5LL 4F9PA 4JKPH 4JFXB 5CMAA 4EUPA 4LCYA 5GRZA 3DMMD 3VFTB 3UBXG 4Q2ZA 2ICWJ 1RURL 2XWBA 3O6LL 4G8EB 1SJEB 3THMH 2YS4A 1WTGT 3H0TB 3IJHB 1HSAB 3TVMD 3E6HB 2H9GA 1BZQK 4HJJH 5I9QC 5L9DH 3NCYP 1KCUH 1MLCA 1BBDL 4LP4A 3MCLL 1D5XB 4P5MA 1RZFH 4PGBA 5JA9A 1HSBB 3FCTB 2CGRL 4HJ0C 5C6WH 3KHOA 5C0ND 4HUMB 5EFIA 2PTTA 3CFDB 3HFML 1C12A 5GSRA 4NNPH 5MEND 1VFMA 3D2UB 3F5WA 7CGTA 2E6QA 3Q5OA 1F42A 1DBMH 3BKYL 5LAXA 5EC2A 4NNXA 3FHQA 1QLRB 1CE6A 3PL6A 1GGCL 1QHPA 2CMRL 2APTA 2DWDA 3B5GA 4O58L 4JKMA 1ZMYA 4AM0A 2YPLB 15C8L 1J1PL 3OKOA 4QRTB 2PTVA 3L7EB 1FH5L 9CGTA 1MIML 4HMEA 5MERB 1JTPA 25C8H 2A6KA 2MQCA 5IFAL 3KXFB 5C0GA 3OXSB 4F15B 5E9DD 1CFNA 3L3DB 5I1DB 4PJFB 4PTTB 3GMNA 4PJ9B 3IJSB 1FVDB 1N59B 2DLGA 1FSKC 1KLUA 5JIIA 5I19L 4ZNCD 4NZRH 4F9PC 3MXVH 3C5JB 4P23C 1U8JB 4R26L 1J86A 1MIMH 3QDMA 4WFGE 4N1HB 5ANMB 4PJ7F 1FO0A 3HC3L 2R1YA 1AO7B 3G5ZA 2CPCA 4D0BB 4Z7WF 2J8HA 4RWYH 4P2QA 3VRIB 2QSCL 1VGKB 1GAFH 2BHZA 4ZO6A 4PJHA 4K71C 3X14A 3ZE2F 3KLHC 4Z7QF 5IIEB 3L3GA 4PJDA 3SGEI 4U1KA 4E0RB 3T2PA 4JJ5B 4MNQD 4L5FH 1RPQA 1A7OH 3DVNA 1YEHL 3WBDA 4X7TB 4M4RA 2IPTH 2E7CA 2BNRA 2D0GA 3TV3L 3UAJD 5GJSH 3VXOB 2P47B 2NY5C 2NX5A 5EA0L 5FCSH 1UQSA 1CLYL 2X4NA 3Q6FB 1T22B 1C5BL 3BE1L 4KZDL 1KN4H 1F97A 1HKLL 1IAOA 4J6RH 4ZUWB 4P0DA 1C5CL 2H2SC 4JN2A 1VPOL 2W59A 3ARDD 1NMAH 3EJJX 3UJIL 5E6IA 2GJZA 2ED8A 1VEPA 5DZLA 5MHSE 3HMXH 4KRPD 2LFGA 4XRCA 5C0IB 3QG6A 5I71B 1R24B 4OZGF 4F7MB 3MYJB 4S0SD 4PRAB 2CLVA 3LKNA 4ZDHB 2HT3D 5FGCE 4UILH 2E9JA 1HXYB 1SM3L 3MBEB 5FO7B 1D9KD 2FATL 3RI5K 1T03L 1J10A 5B8CB 1ZVHA 5DZOA 1PAMA 1KEGL 2IH3A 4MGXA 3C8HA 4YHOL 2GJZB 3FO1A 4H1LG 2VXTH 2UWEA 4M8VA 4K07A 2BCKB 4QNPE 1DDHB 1QRNB 1KELL 4FTVB 2C1PB 5IMMB 2A6KB 4MD0A 2UY6A 4F80A 1E27A 1BVZA 2DLTA 5JDSA 4U2ZA 2LE9A 3NTCH 4PJHB 1S9YB 5J6HB 4R4NC 4FNLH 4WDIA 2IH3B 4NHUA 4HG4K 2J8UA 4JDVA 4GMSL 3EZ8A 5BO1H 3OZ9H 2ORBL 4IS6A 3FTGB 4P4RA 3WD5H 1FYTB 1P4BL 2ICWI 2LQRA 1FJ1B 3FFDB 1YY8B 5D2NA 3VH8A 5DURD 5TDOA 1G9EA 4Y8DC 1UCTA 2IAND 5D93B 4HZLA 3RWFB 1J0YA 2W9LA 4G6MH 4NQTA 5IT2H 1U42A 1KIRA 3GI9H 8CGTA 1CT8A 4U0QB 4XVSH 1Y18B 3G04B 2YK1L 4OQTH 4AM0B 5F7LB 4O51A 1S7UB 4IRJB 2RAMA 3BO8A 1ACZA 3BMVA 4RFOH 2YRZA 4Y1AE 4GW4B 4XT1C 4NZJA 4XC3L 1FZOB 1OD7A 4O2CB 3MV9E 4C56A 2DBLL 1MQKH 1BVKB 1R0AH 4YQXL 2Y72A 3IU4L 4CADA 3HE6A 1FYTE 2ARJA 5D8JL 4I5BA 5D1XD 2DS4A 2C5DC 3WUWA 3ULVH 1CDJA 1A3RL 2DBLH 2XA8H 1TTUA 5B8CC 5FHBH 2AJVH 2W0FA 5B39G 2I07B 3TESA 4QCIA 4WJ5B 3EYOB 1IGIL 5CP3A 1N3NB 3GMRB 2D4DA 3KPRE 3RWDB 4DZ8A 1AE6H 1WZKA 4P4KA 2FX9L 4P5TD 4XVSL 1RUAL 1K2DB 1TITA 1LO5A 4JVUA 5HGBA 3CH8A 2OQJA 2Y1VA 4IRSB 1FL3B 3UC0H 1J1XH 2X4RA 5I1KH 1S5IL 3IDJB 1YMMD 5MEPA 4PJGF 1NFDA 2BVQA 4KQ3H 3S4SA 2AJSH 2HT2D 1UGNA 3AFLA 1CGSL 4C59B 4BM7A 4PJGA 4U6XB 5INDA 4DGVH 2R0ZL 3GUTA 2K3TA 4L8CA 3SBWA 4G6AC 1KJ2B 3O8XA 4X5XB 3T8XB 1T80A 1XH3A 2AXFB 4FQIL 4PRNB 5DJZA 3VFVB 1EZVY 1EO5A 2X2YA 4GKZB 4OAWA 4U05A 4WFFE 1I7TB 5DLMH 1WAAF 3RWEA 2CD0A 5D1ZD 2G9HA 4LLWB 3UDWC 4KKBC 1UVQB 4HWEL 5GRJL 3QFDA 2DM4A 4S10A 1G7QA 1W0VB 3DI3B 4NRZA 2VDOH 2X9WA 5DJXB 3IDNA 1JHLL 4ODTH 3U36A 4OJFL 1MH5A 1YPZE 3OGOE 2FNBA 5EUOF 2N7BA 1I1FA 4ZAKC 1PX3A 2C3GA 2PXYA 2C3VB 5HVWA 3FO0H 3VGAB 1TQBC 4ACPA 4OZIB 4HLZG 4GRMB 1UXWA 3MJ8B 1NC4B 4PJBE 2HH0L 5EZIL 1ACYL 2LAGB 3W5MA 1T1WB 3BWAB 2QBWA 2IH1B 4R6UA 1IGYA 1E4WL 2ZCKH 5SWSE 5DYOA 4OKDA 4MAYB 3NIDE 3RP1A 4HIIA 5CIPA 1MRDH 4IIQC 3B2UD 3PP4L 4MA7H 5IW1B 4NQSB 4WUKL 4OV5A 1NLDL 4CBPA 1A7PH 3DSFH 1L9MA 1RHHA 5F72S 5D7KD 5DD0L 2GUOB 5EUKB 1MCCA 1BFOB 1D7FA 1PX4A 5C7XH 5I30L 3QRGL 3GHEL 4N1CA 3DYPA 4EI5A 4DN4L 4JRXD 5DI8B 5ICYA 1OWRM 3HE7A 2E5EA 4NRYA 2HFTA 3NZHH 2X70B 3MRRA 5L8JB 2B4CH 5I1HH 2VOTA 2D7TH 5DJ6A 4NBYB 1A64A 4FFYH 3CVHL 5HHQA 4QRUA 1T89C 3UTTD 4N5ED 2ADFL 3KDMA 1YN6B 2W60A 4WV1B 2LVCA 5FYLD 1NC4A 3MJ8A 1MHEB 3A67L 2XWBB 1ZT1B 4LIQH 3RQ3A 1CGUA 2FHBA 4YHZL 5E2TH 3M8OL 1IM3B 4MAYC 3CMOH 4MA1C 3BZDA 5GQBA 3U82B 4IDLA 2AJXH 1HEZA 4ONFL 2M2DA 2EYSB 2UYLB 1RZ7H 5D7IF 3AC0A 3L7FA 5FYLE 3CVIH 5E6YA 1FE8H 2EDXA 2AJZB 1RQ5A 3PIQB 2WWMC 3FT2B 5IKCB 5TE7H 3TZVD 5GIRA 4XHJD 4GRMA 2JK5A 4C83B 1GZPB 3H3PH 3MV7E 2VQUA 5DQJA 5MI0C 5LJYH 1KG0B 3O6FA 3MOAL 5CUSH 2VXQL 4PP1D 4OB5H 2VWEE 2ZPKL 4OUUA 4NRZB 4TUKL 2GIYA 5JHLH 4G6FD 4KWUA 5DRXA 4GSDL 3SE3A 1OTSC 2XPGA 1EUUA 2Q20A 3EYSL 4P46C 1A6ZB 2NY4C 3P77B 1F58L 3ZMRA 4HKZA 3DROA 5AYUH 2FO1A 3VWKB 2R69H 2YPLE 4GJTB 1CGWA 4ODXA 2BDNH 4PJXA 1TMCB 3CAFA 3HPJA 2HFGL 2CJUL 2FCBA 4PJEA 5CJ5A 4NQDE 1EMTH 3C6LD 5BZWA 4MD4A 1LP9A 5JHDB 2WUCL 2VR5A 3SE9H 3S34H 4WY7H 3JWDC 4RFEB 5DDHA 2HG5A 5DJ6B 4JRYE 5IESH 1CVRA 4PJDF 4GKSB 3ZHDA 1EV2E 2X7LA 1NGYB 2Z31B 3RX7A 2R2CA 3M45A 5C0AB 4ZXBC 1FVEB 5D7SH 1BFOA 2HJKB 2HKFL 3CFKA 1RUMH 1XGUB 1Z5LA 1A7RH 3CXDL 3FN0H 1F6FB 1RY7B 2BOBA 5FXCH 3QUZA 1MCIA 1UCBH 4TVPH 1AGBB 5TE6H 2RCSL 4FQCL 1LDPH 2AS5M 3EO9H 2QQKH 2KH2B 4LPVA 5T5NF 4OLZL 4QOKA 3QFJA 2Z92B 4P46A 3QO0A 3BUYA 3G6JA 4ZUVB 4X98A 5TPWL 1JPSH 3P0YL 1R3HA 4KXZI 3WLWC 3ZT6A 3S37H 4M7KL 1VERA 3U4BL 5C0RH 4RGND 5ABDE 4PJCA 2VTFA 5F6HJ 3C60A 2LU3A 2R1WB 3F12B 3X3GH 2OL3B 1EGJH 4IBLT 2DQFA 4JFHD 4PJCF 2A6DB 3SO5A 5D1QC 1BD2A 2V7HA 2DQGL 5DXWA 3VFGH 4U6VL 1OAXL 3X12A 1TFHA 4IRZH 4MS8C 5F9OH 3SCMC 1KCVL 3MRGA 4XBPB 4JFPA 1CFQA 3KPRB 4BA8A 5HVHC 1FFQA 2QV2A 3FB8A 4Y19A 2IFFH 4LGSB 4WEBL 5CSZB 1NGXB 2P7TB 4U1SA 3O3AA 3MFFB 5I2IB 4R2GB 3L9RB 1DCLA 4D9LH 1AXTH 2OR9H 4HDIB 1KEML 4LLUB 3ARED 3UBXB 1BOGB 3HR6A 3SE3C 1WTLA 2XWTA 2JB6A 5E8DL 1FJ1A 3FFDA 2ICEB 3U0PA 5AYQA 2CIKB 2DDQL 2IBBA 3PQYA 3QNXB 1EXUB 4X0KB 1KF9B 3NZ8B 2IANA 5DTFB 4TUJB 4LASL 3UTZA 5BRZE 5C08D 4OFIA 5IOPB 2XRAL 3H9ZA 2CIIB 1MAML 1AIFB 4WDIB 3MRCB 5IMLB 3S5LB 1NMCB 1AI1L 1FZMA 1UM6H 1L6XA 4XNYL 4OFYD 1I1CA 3GRWL 4YE4L 5J9PB 5D6CA 3VFPB 1JV5B 1RJCA 1UACL 2APBA 4F3FB 3IJYB 2IGFL 1VADB 4PP1C 4HIJA 1G1CA 3QNZA 3V95A 1KPUA 3LRHA 3SDCC 3D69A 4NKMA 5JW3H 2CK0H 1Q94B 1HNGA 1NL0L 4ZO8A 1VCAA 2AJXL 3C6SA 5L7XL 3KYNA 5ISZD 2BSRA 4L1DA 3MLTA 5I1EH 4QWWC 1L9NA 2G2RB 3C5SB 5DUBB 3DVFA 1CTOA 2ZOKA 1WSST 4GG8A 3WN5A 1GGCH 3RZCB 4D9QE 1JBJA 5CLTA 2J8OA 3LEVL 5L2JA 3QDJD 4PUBH 1PG7H 2VLRB 3HE6B 1VDGA 3LSOA 4KDVA 4CL7A 4D9RE 2DWEB 3ZTJH 4PJAE 5HGAB 3D39D 4NQXA 3MNZA 1KCSL 5DR5L 1WITA 4OLUL 1KIQA 2NY1D 5GGSY 3OJDB 2O5XL 1GGYA 5I8OH 5C0FA 2OMBA 3RPIA 2HWZL 2BNRE 3PP3K 3QIWB 1A6UL 4ODUB 1HWGB 2XTJB 3GBLA 2CXKA 2NX5D 2DWEA 4X83A 4G8GA 1P2CB 5TE6L 5IVOA 2H1PH 1NCWH 4LP5A 3GKWL 3LD8B 4WI8A 4Q7DA 1UCBL 1AO7A 3KYNB 1Y18A 3ALPA 2EDKA 3O6FC 1E0OB 1A6VL 4PJ9C 3QIBD 1RZJC 2ADJA 1KPVB 3FOMB 2R1YB 2W65A 5C0JA 2WP3O 4LSRL 3ME0A 2CLVB 3LKNB 4ZDHA 4MX7A 1CDUA 3MUJA 1YEFH 5FUZH 4M4PA 3TZVB 2J8UB 1RMFH 5T3ZL 3VFSA 1KCRL 1AP2B 4WNQB 4OD2B 3I6GA 3RTQC 3ARFB 3IKCB 3LIZH 2K1MA 4QO1A 4OCSH 1JFQL 4Y19E 5M94B 2XI9A 3IB4A 5T1DH 1B6DA 3V7AE 5DUBA 2I07A 3WFBL 3BZ4A 3FB6A 3S36L 3C87A 4NO0D 4JFYB 4OFKA 1QZ1A 1EJOH 4NZTL 5DMYA 1UQSB 1ONQA 2EO1A 1WC7A 1AXTL 3QUXC 4WTWA 2VDRL 4GRLA 1WFUA 4DGIL 3BIAX 3TYGH 2XKSA 3H3KA 1PY4A 1FV1A 4FZEH 5BOZG 5GS1A 5IWLC 3V5DA 4NN6B 4JREB 5E9DE 4YXKL 3QEUA 3U46B 5A40E 2DQJH 4JFYA 3QA3A 4PJ7B 4ZFOA 5B3NA 2HN7A 2H3NB 1S9WA 3G5VA 2X4UA 4PB9L 1U6AH 5LGJB 1T0NB 1YEIL 3SPVB 3OKEA 1TVBB 5EU5A 1FL5B 2NY1B 4NC2B 3OR7A 5BV7C 1OTTD 5HHOB 3W11D 4L8BA 3ZE1E 6FABL 2FJFB 1FO0B 3UTSB 1MCWW 4APQB 2CO7B 5DRNB 1S9KC 1SEBA 5EC1A 2O93L 3QQ9D 3FTGA 3QB7C 1E28B 3LN5A 3TO2B 4O2FB 5TPWH 4LQ1A 4BZYA 1P6AB 4LBEA 5TDPB 3SDAD 1J5OH 4HUNB 2YBRA 3IKKA 5GGSA 1JE6A 4F33A 1YMHA 2JELH 4YK4B 4ELMA 1NGPH 1MCSA 1D5MA 2P1YA 5TJWK 3EJZC 2ATKA 4TVPL 4F7EB 4RFOL 1KUMA 1J1OL 4PJBF 1MOEA 2DI8A 2IWGA 5T3ZE 2F8XC 1TJHL 4L5FL 2HLFD 3Q5YA 4L4TB 5SV4A 3RZCA 3T1WA 3A6CL 3ARBC 4AMKH 1LWRA 4UZGA 5C1MB 2ZUXA 3BQUC 3DSFL 4NQUA 2WMPA 2IFGA 1AKJA 4BH7B 3P11L 3KJ4B 3DVGB 3MBEA 3QUKA 4L29B 4PJ5E 2ZNXA 4OQ1A 4K9EH 3RGVB 5DSCB 3KPOB 4MQSB 1WCBB 5GISL 4RIRB 2BSED 3T4YA 4JDTH 5E8DH 1II4E 2YWZA 2A6JB 3V7MA 4XXCC 1Q1JH 4P4KC 3B9KC 5F7EH 1OAQL 3O4OC 5E8OB 1U8HB 2BRRH 3NCYS 3D25B 5EC2B 4WEBH 2W9EH 4M7ZC 1NGWB 4RGMB 1QTYT 3BP4B 3GMPB 3Q5TA 5LQBL 4UT6H 2M1KA 2WSKA 3HPLA 3HPJB 1MSPA 3V5KA 1YMME 4DZBA 1H15B 3DX9B 3MRIB 3TT1L 2OI9C 5CAYB 5EH1A 5I15L 4P2OC 4I48A 4O58H 2ZG2A 3ZL4L 1BJ1H 3MV7D 3KR3L 4ODHH 4JR9L 4PRIE 5DD1H 1RD6A 5KS9A 3NCJL 1S78D 4BSVA 4DEPB 1UT9A 5C0DB 1FNLA 4GKSA 1IL1B 1D5BA 4DFHA 4HK3J 3OB8A 4M7ZB 1UC6A 5FF6A 2YUXA 1AQDB 1K6QH 3TCLA 1JNNL 1ERNA 1WAAE 4ZUVA 4YDJA 4U31A 3IDMB 3OAZK 4K3EH 3D1MC 1I1AB 1ZHKA 5ITBH 2IAMA 3QISA 1OOAA 5EWIL 1JHKH 4JQXC 4BH8A 5TDNA 3CMOL 1K9TA 4PFEA 3O11A 1RK0A 2GTWB 2UZIL 3VRJB 4BSVB 1T1XB 2MKWA 1HHIA 3EYFB 3IDGA 4LVHC 2NY2D 5JPMA 2X1PA 3D0VA 3SDXA 3INUH 4K23L 4XAKE 4AY0A 1TXKA 5F6IC 2CK0L 3KPPB 3MLZL 2VWEC 5LWYH 3CSYB 3GSNA 3KPNB 5I8CA 1KULA 1U8LA 4NZUL 2OP4H 3E3QC 4WEUD 3VFMB 4CDHA 4GUPB 5TDNB 3NACL 2IGFH 3QDGA 3G5XB 5ICZA 1KT2B 4RMWA 4FHBD 2VISB 1MY7A 3ARDB 1GJIA 4LOUD 2HRPL 2DQHL 3PV7A 4Q58C 4RISL 4YK4C 3PGCA 3UJTH 3K74B 1ZLUH 1MCQA 3O3EB 5F9WB 4PJFE 4KJPD 2BP3A 5E00B 4J1UA 4FQ2L 3CFEB 5HYSG 3K1DA 4HUXB 1K3IA 3H6JA 5C8JA 1RZIB 4Z95L 1GGIH 3U30C 3GFUA 2V2TB 4TPRL 2FR4A 5BMFL 3GDBA 4OGAD 5KN5B 5J13B 4LOUC 1ZKAA 4ISVB 4XMLL 3SO3B 3WN5C 4ZS7L 4M5YL 4K7PH 4BKLB 1U8OB 3P2TA 3MA9L 4NQDA 4HSQA 5FF6B 4KJYA 1CFSB 3FQNA 1BLNB 3MRRB 4Y5YB 1ZLSL 2Q7YB 4MJID 5L88H 5BZWB 1U93B 4PJGE 4U2YA 4NO5A 5I1GL 2P45B 5CSBA 1B0RB 3K80A 1MCBA 2R15A 3FT3A 5CD5D 3ARGA 3IDGB 1IQDB 2CR6A 5JPMB 1JUFA 4L29A 3V6OC 1C5DA 4H0GA 3X13A 1I7TA 4IEFB 4XP5H 3ZSSA 4UAOC 4YHPA 3L3HA 5T3XD 3UP1A 3MXWL 4LU5L 5L6YL 3LQAH 4H8WH 2P42B 1LP9B 2AEPH 2VZ3A 4YZFE 2RQ8A 4NBXB 1CN4A 1X7QA 5C0CD 1MHPH 1OD9A 4NO0B 4OZ4B 4H20L 1ZHLA 3NCFB 5IKCA 1DQDL 1HEZB 3OKMA 5CD5C 1FO0L 2FYYB 1YPZF 1H3WM 1MCPH 1HHGB 5IUSA 5D70H 1FBIL 5IVXA 3UJIH 3DHJA 3MLSH 1D5ZA 4P2OD 3ARSA 4JM4H 1MHCA 5J6GB 5BQ7A 1KJVB 3E8UL 3O6FB 5DMIH 4G7YH 3UPCA 5DHYA 2XA8L 3FO9B 2EXYD 4FRWA 2MQ0A 3HNSH 3L3OB 3NIDF 5CILH 4ELKB 1A6UH 4QYOA 5D8JH 2Q7NA 2W60B 1NFIA 3CUPB 3FQUA 4GRWH 4KKAD 4LCUA 5E2JA 3V4UL 3LB6C 3N0PB 4X5WA 3ARQA 4EI5B 2R8SH 4K3EL 4XHJC 1XGTA 4HK0A 4AJ0A 2CLRA 2L7JA 4IOFC 4PLKC 3K3QA 1P53A 2GJ6A 5DD3H 3ALWA 3DX7B 2FECI 3GMLB 5IBLD 1T1XA 1T3FB 3EYFA 4OF3A 4WI5A 3CCHB 5DUPH 2YK1H 5GSVA 4QRRA 3ZL4H 1F2QA 1IBGL 3RA7L 3OXRA 4XCCL 4NC1C 4Q97A 2HLFC 2ZJSH 4FQXC 12E8L 1ZK9A 3BX7C 1JWSB 2IBZX 4YPGA 3NAAH 5FYJH 3CDFA 1KIPB 4JZOB 2GFBB 1I85C 2IPUK 1IKFH 3GUTB 1BWMA 4MXVE 2QKIA 3TJHC 1U8QA 1X9QA 1OAQH 1OGAD 4ZOBA 5FOJA 3VFSB 4URTB 2JB5L 1RV6X 3QXAB 5B38B 3PWPA 4AH2A 5C09B 2Z4QA 3SE8L 1F4XL 5C0CA 4P3DB 4DGVL 2J6EA 1QBBA 1T89A 2ITDB 3ELAT 4RFNB 1JZ3A 2F74A 3ILQC 1LE9A 1DZBA 5I1AA 1CU4H 1S9VA 4JFQA 3RUGE 1AI1H 2AEIT 4D0CB 4ALAL 4IMKC 2PW1B 1WWCA 2VABA 3RDTA 1KGCD 1TVBA 1B4JL 5IEHA 1EH9A 2EDRA 4U6YA 3TO4C 3TBVA 1DUYA 3CX2A 4HS3B 4W6XB 3QZWA 3OQ3B 1CFTA 3TT3H 5E8NA 4ONHB 4FQXA 1XR8B 2AJVL 3DYOA 1H3TA 1OARL 3GIVB 1JWMB 1MEXH 4I9WD 4L8SA 1MFAH 4JZJA 5F7MC 5GS2H 2X9YA 5IWLA 3QG6B 1FHGA 4H1LB 2R0KL 2IBGA 3MLYL 5DWUL 3GEWB 2DJ4A 2MWCA 3JWNC 3UZQA 2FGWH 1F8TH 3RVUD 4L8BB 1NANH 5MERA 4HS8L 4PJDE 4Y16A 1A22B 5A43C 1LP9F 1NDMB 4B41A 3EIFA 3BKML 5HYJE 4PJAB 1G0XA 3JWOC 4NOBA 4JQVA 4RAUB 3QO1A 4JKPL 1PG7W 2UV3A 3MODL 4U6HB 5B4MC 4PV8B 3DOSA 3QNZB 1U8KA 5C09E 2WUBH 1DQDH 1G7JB 4H20H 1QNZH 2BNRB 1YNLL 5HY9A 3DV4B 4LSVL 2DQDL 3HHRB 2Z4QB 4U1LB 5C2BL 5HD8D 4F8TA 1GAFL 2V2WA 1CCZA 1CXEA 3CK0H 3BMWA 4RGOH 3X14B 4OFDA 4MD5A 3SDDD 1LDPL 4FQCH 1CLZL 1A2YA 3T0VA 1A6TA 1CK0H 4KK9C 3I85A 3RDTB 3VRLF 4GS7B 1S3KH 4D94A 5D1ZA 3BESR 5IB3A 3MLTB 4Z0BL 5HDLA 1T22A 3VGGA 4WHYG 1F4WH 1G7HB 3GBMH 4G9DB 1IAIM 3SQBA 4MXQD 5JHDD 4YHKH 5T5FH 4O2EA 4D0DB 2R0ZH 4FG6C 2B8OT 1QO3B 1BIIA 1EXUA 4YHOH 5D2NB 1ZLSH 3VH8B 3GIVA 1JWMA 1SEBB 5EC1B 3ARGC 4ZXBB 4R0LC 3G6JE 5HGAA 5C09D 4PV8A 5DJ2A 3QUZC 1HHHB 4KMTH 5ESAA 4F7PB 2VLRA 5D1XA 1VFBB 2HFGH 4U6YB 4NQCB 1GGIL 5FIEA 2R69L 4K7PY 2LU4A 5JORA 3NGBB 1W0WB 1A7BA 4P5TC 3WUWG 1F58H 4AYFA 3G5ZB 3WJLA 4ZFOB 5D5MF 1TNMA 2R0LH 1OSPL 5BVPH 3NZ8A 5DTFA 1A14L 3RWJA 4MQTB 1TZIA 2YD7A 3QIWA 2DWDB 1G9NH 3D69B 4NKMB 4IOIA 3RIAK 4NGHL 5DHVH 1CFBA 1FVCB 3S35X 3PWPB 1YEJH 3S6CA 4L9DA 4YHNB 1UA6H 3H3PL 2IEPA 4QHMB 1DQMH 1FLRL 3GSVA 4NGHH 1CFNB 1WVZA 4R4BA 5K9OA 2CUIA 5I16A 3RVVC 4I0PB 4HXBH 1A14H 1AXSA 3THML 3VFWA 3IJHA 2R23B 1F3RB 3BAEL 1ZANL 5HYSB 1KTLB 1N6VA 2WQRA 2KZ1B 2PCPA 4NP4H 4LCCB 4FQJH 4W6YB 5L2KE 1B4JH 1G9MC 3C6SB 4G6ML 2DD8H 4ZO9A 3P4OA 4GQ9H 5KANI 2OBGA 5EWIH 1H3GA 4QHKJ 3W2DL 5CBEB 1HE7A 2QL1A 4MA1B 4P49A 2PTTB 5EFIB 3DJ9A 5HHNA 1P4BH 3KLDA 1YJDL 2ADGA 1IGJB 3EYVA 5BO1L 4M1DH 1HH9A 2IG2H 32C2B 4QTHB 4UINL 4UV7H 4GXVL 1ZV5A 3RVXD 4M48H 3FQNB 5KVEL 2WAHA 1Z9LA 3NIFE 2MHAA 1QHOA 3WYRA 3KR3H 3BHBB 3QT2A 1KPRB 2BOCB 2R56H 4XVTL 2W38A 2QHRH 5C9KA 3LAFA 5D71L 5JPNB 4P99A 5INCB 1BQHG 2CUHA 3DX8B 1I7ZA 4R7NB 4UT6L 1JGLH 4GAJL 1JZ2A 2QR0B 1DLFH 4G5ZL 4OT1L 4LSTH 3M17B 3V0WH 1WFTA 5E6ZA 3V8OA 4XBGB 3JV4A 2Z31A 4GLRI 2NTFB 3ARXA 5F3HA 4OBRA 1INDL 3RZWA 1OTUD 2MKLC 4W81A 2DM3A 3WS3A 4Q6IC 3RRQA 4F7TA 1F5WA 4ZD3H 3Q6GH 1B0GB 4QRTA 4YNYA 2JJVA 3LEXA 1UWEL 1LGVA 3RBGA 5C0GB 1LK3L 1WWWX 5ICZB 3DHMA 5F88A 3DO7B 1E6JH 5A2KH 1FNEB 4UBDC 2R4RH 1TQBB 3FO2B 4PLJC 5ERWA 4BQ8A 3FB7A 5DF0A 4M6MH 4UQ3B 1P5UA 3QUML 1ZA6B 4X6FB 3BN3B 4JM2A 4U6VH 5CJXA 4KTEL 4NT6B 1OTTC 3ZYOA 5IMKA 5E8EB 3RWIA 2VC2H 1JZ5A 1SEQL 3AM8A 3B3IA 3IJYA 4LNRB 1XGQA 3MX0A 4UV4L 1P1ZB 3JWOH 2DMKA 1ZHLB 5E0QA 2I24N 3OB0H 3RI5F 1I7RB 1U8HA 5HHOD 1Y6KR 1YN6A 1NMBL 4AIZA 4GG6F 3MLUL 2J3SA 2WV3A 1E6OL 1VGEL 3MBXH 3OGCB 2VH5L 3AM8C 1XF2A 4NM8H 5CJOH 3D87B 1XCTB 4OF0A 2DYPB 3WFDL 2XN9E 3HNTL 2IMMA 4PJEF 5AG8A 4MZ2A 4KZEL 4N0CD 5DRXB 5EUKA 4FABH 4IRSC 2FBJH 4KDTC 5ALCH 4BYHA 5M7QA 1A1OB 1X5LA 1W72L 1F4XH 4NUJA 4Q6IB 1JIBA 4NZRL 4HEME 4P9HH 2DM2A 4O9HL 4XNZC 1WFNA 4F7CA 5HYJB 4JG0H 5KSBF 5IBUB 4CVZA 4X9FA 3RAJH 1A3RH 3QDGB 4AZ8A 4QY8A 4BK5A 2JIXA 3ZE1F 4P59H 2GITA 3IU4H 3JV6B 4TSBL 5EB9A 3VXNB 1J8KA 3C09B 1D5IH 3FRUA 1A1OA 4N0RA 4GAGH 2XFXB 1W8OA 4GW1A 4NM4L 5C0DA 3SDXB 1KLGA 5SWZD 4K8RD 4TPRH 3FB7B 1HHGA 3VRJA 4EN3D 2WBJC 1S7WA 1M4KA 4G3YL 2IADA 5MENA 1F00I 4MAYA 3RWDA 4JEGB 3TIEA 2FX8L 2HVJB 4Y88A 4NKDA 4X80H 1TJGH 4Y5XB 4QF1A 2VISA 2WINB 4OB5L 1IEHA 4JRXB 3EOTL 4PJ8D 4AT6A 3MR9B 3JV5A 4OM0H 1MCDA 4X4ZA 3T4AA 4HPYH 1LK2A 4X7DC 3VXUB 2C7UA 3MROB 1F2XK 5IBTL 1BVLB 4I48B 4JY4B 3WS6C 3V2AR 2P5WE 1Q9KB 1YYML 5C08A 4U3CA 3IVKB 1RSFA 2N7AA 3PF2A 1EO8L 1MAKA 3TPUB 4R7DA 1TENA 5EZLA 3RVTD 1ZHNA 3QUYC 4ODWB 3AY4A 3VXMD 3ARDA 1YY9C 5TQ0H 5EUOB 1WCQA 1NGWA 1F3JA 3C5ZB 3DGGB 5CBAA 1ZT1A 3AREA 4WTZG 4MJ4A 4NFDA 1Q0YL 1BFVL 5D1ZC 1I8IA 3OAZH 1KEGH 5ITBL 3VA2C 3GI8L 3KPQB 4X8JA 5KN5A 3C9NB 4QRPE 3PJSB 4FQPA 2EH7L 4UILL 4PJ7A 4U7SA 5E9DA 1T66D 3JSSA 2BY0A 4PRHB 3U4AA 3UTSD 1W72B 2BY1A 4EEEA 1YNKH 3AROA 3RJDA 4HIEB 3MBEC 1RIVH 3RTQA 3KPPA 3BZEB 1A3QA 3PE9A 4IRSA 4HGKC 4Y5VC 2QADD 2OTUA 1T20B 5IBLC 3QUMH 1J7VR 4KK8C 2CRZA 4CN1A 1FG9C 2C4XA 2JIXB 1JMZA 3AMLA 3MRFB 2Z8SA 4LVNC 2ZSWA 5CINL 3TYFB 3SJVE 5MENE 5C6PB 2B5IC 3DLQR 1U8NB 2AJYH 5L8LB 3PWJB 1FFNB 2V2WB 2VE6B 4XCEB 5FDYA 3OMZA 1BQLH 3QEGL 2YMXL 2HH0H 5EZIH 2BVQB 1PYWA 4WIQA 5EU7C 4XNMA 1DVFD 3IDNB 1PKQB 1AHWC 5SWZB 3DETD 3BPCB 4WFEE 5F9JA 4DKDC 3ES6B 1QSEE 2UUDK 1I8KB 4KKNA 1CG9A 3MRBB 4LPWA 1HILB 3BGFB 1CGYA 3NFSH 4ZNEE 2ZOKB 3LRGA 3FN9A 4RISH 3PWNB 2Y5EA 2YD6A 5JO5A 4JQXA 4R90L 2Q6WB 1KC5L 2JJSA 3LQZA 5JOPD 3ECBB 4FQIH 3VXSD 2OYPA 2AJYL 3LHPL 1U41A 3QQ3A 2ZUVA 5IQ9B 1I9RL 1P4IL 3E3QE 1PZ5B 3PGDB 3QUYA 1QSFE 3WXWL 4JB9H 1XR8A 3UTSA 1IM9B 2VMFA 3SJVD 5TFSL 2HJFA 3CVHA 2UZXB 4XPFL 1DTUA 4R97B 6FABH 4FXLA 2AI0L 2ZUYA 4MCYA 1RUAH 3BFOA 2Z93A 3QDME 2D7OA 4CMHC 1SY6A 3IAQA 5FYJD 3X3GL 8FABB 2VR9A 5TF1H 3GJEA 1KV3A 5DEGA 2ERJC 3GK8H 2CLZB 2BVYA 2O5ZH 3GSVB 3PWPE 4FQ1L 2VUYA 5I6XC 4FXGA 5T1KB 1OWWA 2NZIA 2VB5A 3B9KA 3NABL 2H26B 2YPKA 1S7RA 4OUOA 2WW8A 3P9MA 1JGUH 1MCLA 1G7PB 1YEJL 3C6LC 4U1SB 1S5HB 4QTIH 5IEHB 2FD6H 3ROLB 5JIHA 3MJ9L 2OTPA 3BHBA 1VESA 2PNDA 4XC3H 4ESKA 3TNMA 5DO2D 5JQHC 1NBZB 5IB1B 3QNYB 4UOW1 1NSNH 3CSPA 5DS8B 2UZYB 2HKFH 1B3JA 1YECL 2A6JA 2ZWLT 1J0JA 1S7RB 3C5SA 4OQTL 3X3FH 2WWKO 3I02B 4KROD 2W91A 5FO7A 2YXFA 4JDTL 2R39A 3VGDA 1NJ9A 3H42L 1BD2E 3OJ2C 4AQOA 4FQXB 5KTEL 4I8DA 3N50A 3KWWA 3LKPA 4CUCA 4O2EB 3QFJD 4V1DE 5FUCC 2E8YA 5GXBB 1SY6H 1M7DB 2H2PC 4GMSH 4UIKH 1EEYA 5TFSH 1HH6B 4OF5A 1J11A 1LVEA 2PYFA 4NKQB 4NQED 2YUZA 5E4EC 4MJ6B 4DKEL 1XF4A 4QHUA 4O02L 1SJHA 3GSUB 4PRHE 3MRCA 4FFZL 1NEZG 1AR1D 2ITDA 5DC4B 2BHUA 3H7BA 4Y1AB 1TPXC 4PP2B 3FAWA 1J5OL 4OF7A 2X1XR 4GFTB 4F3FA 1CIDA 1CI5A 2F54D 1U8KB 1AHWA 2Q86B 4S2SB 4Z7VE 4I18C 4JKLA 3FOMA 4JFEB 1XZ0A 1QEWA 1KCSH 2VN4A 3HMXA 5J11C 2HRLA 2RR3A 4Z77B 1JK8A 4XVUD 4R2GD 3CZFA 1FE8L 4O51B 3RPKA 4EI5D 5ALCL 1D5XA 2PYEE 4N0UE 4NQCA 4ZUTA 1KYOJ 2G75B 4E41B 1IAOB 2I26N 1M71B 1QP1A 1ZLUK 2IJ0C 4TUJA 4HHAA 1IGML 3UTZB 3WFDH 5TDOB 5KOVC 1V3LA 5I1AB 5ETUA 3G6JF 3PG2A 4OV6F 4NM8L 3VXUD 3SGEH 4XB8A 4N8CH 4HBCL 1A6AB 4KI5C 3VXTB 3I75B 3VXQB 4ZFGH 5CP7A 3G9VA 5FKPA 3K46A 3ZE2E 1KNOA 3AB0C 1A5FH 2PXYD 4QOKB 3TNMB 4LPXA 2DLFL 2EIZB 4LHUD 4NJ9H 4X6DE 1RJLB 2FJHB 3KXFD 1YEHH 1JVKA 4M93B 5I1JH 4EN3B 1MHCB 1NKOA 4Y4KB 4J8RA 5DK3A 4MJ5B 5FYKE 4DK3A 5ESVB 3W9DA 3FRPA 5LAXB 2YHGA 1IAMA 4EDXA 3TIDB 5ACZB 5BS0A 1RMFL 2ZUUA 2JCCA 2C4FU 4PRPB 4LCWA 1U8JA 4XWOD 3VDBA 1CU4L 1J0IA 3IFOB 1RZ8B 2KPNA 4R26H 1ZLWH 1VKXA 3HB3C 4HF5H 4HK0B 4C56D 2CKBH 4JVPA 4L3EE 1JYNA 3QEGH 3RU8L 4Y0GA 4WVRA 1G7LA 1BM3H 1MLCB 3BJ91 1YEEL 3P4NA 4PJBB 3T0BA 2NW2B 3W11C 4G8GD 1DANU 3KG5A 1WLHA 1CE1L 1N6QL 1FCGA 3RHWF 4KDTA 3QAZC 4GAJH 25C8L 4J12A 1NCWL 1V3KA 3U0WL 2H41A 4NDMA 2D9QB 3HUJA 1QBLH 2I25N 2F9BT 2BVOA 3GSNL 3F5WB 4LLYA 4FN0A 4KQ4L 1T5WA 4LLVA 3RWCA 1P7QD 3ZKND 4FS0A 4OI8A 3UYPA 2GHWB 1CD9B 3EBAA 3C2SA 1E4KC 1CD1B 3D48R 4QXUL 5DVNA 4NNPL 2MNUA 1ED3B 4MB5A 3WNLA 1DR9A 3DX6B 1I4FA 4Z5RB 5C0RL 3G6DH 4J3SA 1RJZB 5HJ3B 4G6AD 2EDJA 5I74C 3O2VL 3BGMB 5EU6E 1NCAH 4JFZL 1A47A 4IIQA 5T1MB 2ZSVB 4GRWF 3FO9A 4D0CA 3MCLH 2EYSA 2FIRT 1G7IA 2DI9A 4R4FL 3UC0L 2AQ3A 3EO9L 3C5JA 2JTDA 3A6BL 4KVNL 4J3XA 1S7XB 2YUWA 4XPGH 4ZTPL 1I7ZB 5HGDA 4M7LH 4JO2H 5E56A 3M1BA 1UXSA 4V1DB 5IR1A 2OJEB 4X4MA 2R9HD 5J3HC 5D7SL 4QRUB 1AD0A 2EDOA 4UTBH 1KT2A 4ENEC 1XCQA 1KN2L 3OKDB 4XMKL 4AG4L 1IM9D 2ZP0T 3T8XA 4Z7NE 4MA3A 1MVFA 1PZUB 1H5BA 4XPBL 4J4PD 4U1GC 4W70A 3MRMA 1MF2H 3D9AH 5J12C 1ULVA 4YDKH 2OJZL 5E5UB 3PQYD 4XNMB 1FIGH 2FHCA 1QVOA 4S1RH 1JGVH 3GJFH 2EDWA 1K2DA 5KW9L 3EO0A 3L1OL 3GMOA 3MLRH 1T04A 4OZHB 5BZDB 1HHJA 3PWJA 2YEZB 4CU8A 4MNGE 3DRTA 1HYSC 4JM2C 3RGVC 2PYEA 4N0UA 4JHAL 1HN1A 5CWSB 4JANB 2W0FB 3G5XA 4P2RE 3GSXA 4YHIA 4RIRA 2IADB 1LEKB 5E8PA 3HE7B 2AKRB 4H26B 1KJ2A 2HVJA 2YA2A 2F53A 4JG0L 3OV6A 2ADGB 2QR0A 4M6ML 2JJWA 5CGMA 5FUOL 4JO4L 2XFXA 4HKZB 4KK5C 1W72H 3PHOA 3QDMD 5F3HB 2VLJE 1ADQH 5SX5H 1EFXB 5HHPA 4FABL 2C7UB 2YOCA 4HLZH 4Y4FD 1KG0A 5KSBE 2YKLH 3VE0A 1KPRA 3QFDB 5DJDA 4X8XA 4KK6C 1A0QL 3V52L 4NHCH 1J8HD 1KB5H 4LIQL 5FO8A 3HNVL 2D9CA 2X9XA 3DUUA 4NUJB 1S9WB 5IGXH 1HINL 3CSBA 3DGGA 5CBAB 1YMMB 5ALBL 3WNNA 1JF5A 3HTLX 1OY3B 4OSUH 4PRBB 3WFEL 4OZHF 3HMXL 4L1HA 4IMLB 4ERSL 4QKXB 5D2LE 4ZUUA 3T3MF 1N64L 2ZG1A 3PXHA 2BVOB 1T2JA 4K3HA 4WEMB 1N8ZB 2D7QA 1T4KB 2A6IA 1X5YA 3N1FC 3RWJB 1CLOH 4HQQH 4X7CC 4F57H 1KFAL 4M48L 1FNEA 3BDBA 2X4UB 1CD0A 2MSPA 4M8QA 4WUKH 4M1DL 1NUFA 1UM5L 1X5ZA 3O2WH 1FL5A 4X7FC 5DD6A 1WF5A 3S35L 1I4FB 3EDEA 5H2BB 3SDAB 3GSNB 4B7LA 3ULUL 3BW9A 4KHXH 1FZKB 5GJSL 2R0WL 2X4TA 3SE9L 3UO1H 3C6LB 4ETQB 3WHXA 2VN7A 4M6NL 4FFWC 2IAMD 2V9TA 1E28A 4RWHA 3P0VH 2BDNL 1MH5B 3WXVL 1IARB 1UZ8B 5GGRB 5I6XB 5EIIB 3SHSA 5EBMA 4JFDD 4ZFFB 2HAZA 4U1NA 3EYSH 1KJMB 1TJIL 1I1AA 3PWUA 1XGYH 2ZOLB 1IAKA 3B4NA 4RX4D 4KGJA 1DBJL 1KENL 1Q8MA 3QHFH 3EYOA 4OZIE 1XF4B 4MQXD 2KDGA 3V6FB 3QXWA 3C2AL 4UB0L 1UB5B 5E2UL 3MXVL 2VZ1A 3SE8H 1U95B 3UTSE 5KVEH 3GSQA 4HGWA 5TGBA 4HFUH 2VLKA 1Q1JL 3ULUD 4PLKD 4LRNH 3LD8C 4U3HA 5DSCA 4M6OH 1B6UA 4FXGB 5T1KA 3BP7B 1V3MA 3DXAD 1MELA 1NCUA 4OGXH 2V5YA 4NKIH 3HS0B 5KANG 3S88L 2D03L 3AAZA 3LSOB 1QLEL 1X5HA 4FZ8H 4ZUTB 3TBVB 3EHBC 4AQ1B 4QHKI 3TCLB 3GMQA 4MS8D 1ZANH 4JZJC 3FQWA 3C60C 1AQKH 1HXMB 1WGOA 3QR2A 1AHWB 4LKXA 43C9B 1MJ8H 4NCC2 4NRXA 4ODUA 5DI8A 4Q9CA 1HIMH 1WZ1H 2BMKB 2H6PA 3B2VH 5I75C 4ZUSA 5EU4A 3LN9A 4OIIH 5GGUA 1EHLH 5D7JC 5HY9B 3V6OA 4U1JA 4HW6A 3HI5L 1S3KL 5CILL 2VDQL 5C0CE 5DD0H 1CLCA 1CK0L 1CLZH 2B5IB 3VXRA 2WBJD 4LSSH 1JWSA 2HT2C 4LHQB 3F7VA 3ZDXE 4M7JL 3OJVC 4X6BB 1E4XL 1CBVL 2BNQD 3UAJC 5E5RB 3JTSB 5LGKA 3NCBB 5EIQA 3VXTA 2PW1A 4HCRH 3OF6A 1NGQH 4RQQA 1U6AL 1B88A 2CR3A 4KMTL 3N9GH 4JY5H 4MNHA 1P9MA 2IQAB 2PR4H 3FFCA 3VFPA 2OR7A 3WD5L 1FFOA 4OJFH 1PVHA 1N5YH 4A6YH 1NEUA 4KUCD 5J6HA 4JZOA 1RUKH 2VITA 5D1ZB 5I73C 4MYWB 3TC9A 4E0RA 3TH2T 3CFCH 4GRLD 5DFVC 1EX0A 3WUZA 2V17L 3QUYB 5T1DL 1JFQH 3R8QA 2Y36L 3WEXA 4M62H 5F7DA 4H1LA 4C57C 2W0PA 1QFWM 4PJCE 1L7IH 4X9IA 1F6AA 5HVHB 2OXHA 4JFXA 3HAEG 1EBAA 5ETUB 1IILE 2CLZA 3JV0A 4KQ3L 4MJIE 4P57B 1MFCL 3OPZL 2XWTB 4ZS7H 3IFPA 5C0BB 3QXAA 4LSRH 3QZWB 3QEQB 4X5WB 4PGBB 1FFPA 2R29H 1M7DA 5JOEA 4LSPL 4Y5XC 2ICWA 3F7VB 1VACB 2GJ6D 4NYLB 3S3SA 4X6DF 4LIQE 3ROLA 4UTAL 2E3VA 3SQOH 2WBJB 1NC4D 4D8PA 4Y4FC 4QXTA 5E95B 1DBAL 2HRPH 4FG6D 4XPTL 1T6WA 4KKCD 5CJQH 1M6OA 1RZGA 1I9JL 4JZNA 1VADA 1FZOA 1FNFA 3MSPA 3SOBH 4OCNC 4C58B 1PKQE 1NCNA 3OXSA 4M1GH 5JO5B 1OTUC 3O2DL 3O3BA 3FFCD 4K2UH 4HIXH 1CFQB 1E27B 3KPRA 3BSZH 4LDEB 5DDHB 5JW4N 1RFDL 4OM1L 2ARWA 4WW2B 4OI7A 4DGYH 5HYQA 3S5LA 5EO0A 3EHBD 2C3XA 4QYOB 4M9OA 1P4LA 1D9KB 4I18B 4M9PA 4Q2ZB 2BNQA 2E9IA 1INEH 2XQBL 3HRZA 1QLEH 5ANMA 2JIXD 2R2HA 3FONB 4TNWK 2X4QA 4HX1B 4PLJD 3RIAF 4ZXBA 3ZKSD 2BOBB 5CIPH 2R8SL 1G6RA 3U9UB 1ORQB 1SBSH 5DK2A 3S35H 2YA0A 5D7JD 4PJDB 3ESUF 3EFFA 2RHEA 3KPLB 2IQ9L 3O3AB 5IB5B 3X11B 4Y1AD 3N1GC 5E8NB 4WCYL 4P46B 4JN2B 1Q72H 1NBZA 1Z0MA 3QCTH 3JXAA 5FECA 2C1PA 5IIEA 3BIKA 5F70A 1DBKH 1BZ9B 4ZXBD 4LSPH 5K93A 3QHFL 3EO0B 2XT1B 3EGSB 4KJQD 2AW2A 1ZOXA 3V5HB 1OGTB 4GAYB 2E6JA 5MI0B 4I2XB 1A3LL 3IETB 3LZFH 1U8QB 4Y5VA 4XC1L 5HPMB 3PWLB 3VI4F 5KZCD 1DBML 2PW2B 4QHLB 5C0CB 4N8VG 4ORGA 1MJUL 3FB5B 4H8WL 1ZHKB 1OW0A 3OR6A 1K4CA 5SWSA 3GJFA 2F53B 4XMPL 3H9HA 1QA9B 2R1XB 3QEHB 3VWJD 3KNBA 4YC2B 1GCFA 1LDSA 1MRCL 5JLZA 2V2XB 4XP9H 1WIPA 1U9KA 5IV2B 4YBLB 2AK4D 1NC2A 3C5ZA 3R0MA 1JNHB 3L3KA 3CFCL 5ICYB 3BDYL 3SKJL 1NLBH 3ZYZA 5HYIA 3BH9A 3HNSL 5E08L 4WV1C 5J1SC 3QYCA 1ZVSB 1DN2A 4X6CB 2F5AH 4NSKB 5TQ2H 1MFNA 1QVOB 1FVDA 5KOMC 3KLHD 2ERJB 3H9SD 4TSAH 4BSWB 1YMMA 2XZZA 5FYLL 1BD2D 4OSUL 4HXAH 3CU7A 2FO4A 2B1HL 2ILLA 1GC1C 2FEEI 1LO2L 2H2PD 3RJQB 3P0YH 3QDJB 2OJEA 4I3SL 2L4OA 4X6EB 2NY7H 3ZT7A 4ENED 1CFVL 4RAHA 3D2UD 2GK0A 3MUZ1 3I6KB 3JUZA 3VGFA 3V0VA 1NKRA 2HKHH 1T5WB 1QFHA 1QLFA 3WIHL 1OGTA 1GGBH 5AZEH 3FKUS 4WHCA 1B4RA 1MPAL 1ADQL 3FN0L 3VGAC 2LAAA 4HUUA 4NN7C 3UXFA 3BW9B 4KI1A 1IEAA 5HI4C 1NBYA 2FJHA 2OXGA 5I1GH 3WLWD 3BXNB 3DO7A 1G0DA 2BZDA 1EA9C 5GRUH 1XGQB 5IESL 3RY6A 1MFEL 3PIQA 3RTQD 1NBVH 4P2QE 1NFDE 3DX6A 4WHYH 3T0EB 4WY7L 4K7PL 2QSQA 4J3UA 2CKBB 2V6HA 4MLIA 3SE4C 3UPRB 1O7VA 5DRNA 4XBEH 1I3UA 1FP5A 4DFIA 1ORSA 4N5UA 2YZ1A 5DT1L 3HFMH 4M6OL 1TZGH 4PS4L 5IW3A 3GMRA 1OT1A 2WINA 4P5TB 3WKMH 2W0KA 4Y5YA 3STZB 1S7VB 2XIDA 4HBQA 4Q9RH 1GYAA 4CNIB 1QYGH 4HWBL 4KKBD 2VXQH 4WUUE 3NCJH 1BQUA 1D6VH 3MOAH 4I3GA 5IJKA 43CAA 4XP1L 2HTLD 3MREB 5H35A 3M1BB 1IGJA 2E7MA 3IRPX 2APWA 3ARGB 4U6XA 2XZQL 5D2NC 1AKJB 4G6JL 2EZ0C 2XZCL 2YPVL 3OJMB 1QQDB 4FMFA 4EUPB 3FMGL 1OP9A 2A9MH 2GTZB 4NUGL 2AABH 5C0AA 4K23H 3D39A 4X6CF 4EDWH 2IC2A 3LKOB 1J05B 4L3EB 1PBYA 3NIGE 1LEGA 4QY8B 4XX1G 2NY6D 5F3BA 1FNGA 3MRMB 3VDCA 4JANA 2Q76B 4WI4A 5E2TL 2R1XA 3QEHA 3LS4L 1S8DB 4P2RB 3STBA 3VFWB 2BNRD 3DVIA 1YQVL 1I1RA 1QEWB 2DQCL 2R2BB 1Z2KA 3DPBA 4PJIF 2HVKB 3QULA 4Z78A 5F71A 3F58H 3GHBL 4IJ3B 2F58L 5FCUL 4GBXA 1V7ML 5DJXA 5HPOA 3VJ6B 3EOAA 4ODHL 5DJ8B 1PKOA 4DGYL 1NCDL 5I30H 4MVBD 4NO5B 4S1QL 4PY8J 4NN7B 5E6ID 4L4TA 3WL9A 3RVTC 2DRUA 1IT9H 3O2DH 2AKRA 4H26A 1T0NA 4L3AA 4HIIB 4OIAA 5CIPB 1MREL 3W0WE 4GBXC 3OX8A 4GRWE 3DRQA 3QI9D 4QRPB 1I9JH 4KJWD 4MA7L 5GIRB 4BKLA 5B3JE 4HIHA 3U2SB 1E4XI 5FKPB 4XCFL 2PKDA 1JZ6A 3KPMB 3DI2B 3LRSA 1WCBA 5TE4L 1I7UA 4Z76A 1RVFH 2FJGB 1NAMH 5DJYB 3TBYA 3MNVB 3OAYK 1FAKT 1IC4H 4OZGE 5CBEA 1H8OA 3S36X 5JXED 2FSEB 5DQ9B 3MYJA 3QHZH 1C08B 3HZVA 5EOTB 4ZODA 2AP2A 4LPUA 5EORL 4YHYB 1HQ4A 4LRIA 1UADC 3EDJA 2J2ZA 4LLWA 5FOBB 5AD0B 2VIRA 3IDMA 4PJHE 1MFCH 4MB3A 1LD9B 4I13B 4QEGA 1A7NL 4RNRA 3PV6A 1VKXB 1NCBL 4LAQH 4P2CG 3HZMB 4R96B 4WI7A 3L95A 5KS9B 1ZA3B 3MO1A 4LQFH 5CJ8A 4OLYL 3QQ3B 4TYUA 3S5LG 3BVNA 4BQ6A 2A77L 2Z8RA 3D3VA 3GMMA 4UOW0 1CDBA 1NCCH 3T2NH 5CCKL 4YC2C 1MRFH 2DQIL 1P7QB 2ZUQC 2VDKH 3T3PE 1XGPA 1ZT7B 1DP0A 1J8HA 4ZPVB 1J0KA 2EECA 3QO1B 3VH8G 4LCWD 1BBJA 1JRHH 2VITB 1QKZH 3VG0L 1AE6L 4L4TE 5H94A 2G2RA 4YDIL 1FCCA 3EJZD 1M1SA 2I60H 4MDJB 3H42H 4QRRE 4PB9H 4XPHL 1NGQL 4XCYA 3REWA 3U0PB 3LV3B 3QG7L 4GKNA 3QCUL 1V7NL 2CH8A 1A6VH 4TUOB 3DV6A 3HKFA 2H6PB 1TCRB 3OKKB 2P8MB 2E27H 4HGWB 5TGBB 2AXGA 4PRPE 2QKIB 3MO1B 4HK3N 4JRYD 2H8PA 2BHYA 3A6BH 3MCKB 5GRXG 5T3XL 3TM6A 2EKJA 4R8WH 4Y4KD 4XVUC 1QPXA 3W9EB 5KSAC 4P3CL 4RAVB 4IDJL 1LEIA 2AXGB 1F4AA 4NNXB 3Q2CA 4JGMA 4TTDC 4EVNB 5F7HA 5IMOA 4KRMB 5D72L 5E6IC 4D8PB 1JPFA 1DQQB 4R3SA 2I9LA 4Z7OF 2CLRB 1KPVA 3GJEB 4DN3L 3LEVH 3ZDXF 5IM7B 4KJWC 3MRQB 3BEWB 1AFVL 2GY5A 3Q3GB 4LMQE 1JRHI 2GYSA 4TOYL 5I17B 2CJUH 4YFLF 1FLTX 4MVBC 3FHAA 4P23D 1KBGL 4OLXL 2W0LA 1YN7B 3QIUB 2XN9D 1WZMA 3B9EA 5CZKA 4NBZB 3SY0A 3S97C 3B43A 3L3OA 3TN0A 5T33H 3MACH 4Y4FB 5KBNC 1L4IA 1JJUA 2VDKL 1ES0A 3IFPB 5FV1L 5C0BA 1N6QH 5I8EA 2I9LB 4MWFB 1ZGLB 1S5HA 1T2XA 1IAII 2AV1B 2ICEA 1BD2B 4QTIL 4I1NB 3SKNA 5ID1A 1GRWA 3I02A 4HAFA 3OJDA 2V7NA 3BRFA 4JY6B 5L2KA 1ZE3C 1BVLA 4EZMA 5T5NG 1HZHL 4DTGH 1BEYL 1N7MH 2J6EL 1UM6L 1DBJH 1QD0A 3SKMA 2ARJQ 4WTZA 2OSLA 1F4YH 2VDLH 4POYA 2G75A 4YXHH 4U1IA 5FOBA 1FFPB 1T7YA 4GG8B 3WN5B 4I0PC 1SJEA 4U4BA 5EDXA 3Q3GA 1CR9L 5DJDB 4U33A 1RIHL 3PNWA 3GO1L 1YEDA 1PKQA 1QOKA 2FGZA 3HS0A 3Q6FA 3G08A 5IJKC 4C56E 3ARTA 2VZOA 2JB6B 4PRHA 5I73B 3L5XH 2QSTA 2R2EA 3TCXA 4Y1AA 3ZZ1A 3D3VB 1GC1H 4HPOH 4N0FA 1TDQA 1A21A 1IC7L 4PJFA 4PTTA 4AIXA 2VJXA 2PUQT 1KFAH 1RU9H 4NQVB 2OS7A 4MJ6A 2QJDA 4LKCA 4PRID 4F58L 1IGMH 1NCDH 3TA3C 5C7XL 3MLXL 2K9UA 2VLLB 5GJTH 3F7QA 3AS1A 3BEVA 1AIFA 1EGJL 3TPKA 3ROOA 3KWWB 3VW3H 3VXOA 5F6IB 5JW4R 5SX5K 1VHPA 2FL5B 1IQWL 1DQQA 4R3SB 4Y2OA 1IZJA 2GI7A 1OAZL 5GGTA 3HG1B 4JO1L 1JV5A 3SDXE 3SDDA 4FFVC 3C6LA 3WHXB 3Q1SH 2EE2A 3GSWB 4TSCH 3JTSA 3STZA 1O7SA 3MV8E 4EOWH 5KSBB 5ISZB 4I3RL 1NFIB 1QG3A 1MFDL 1WT5C 2OR9L 5IG7A 5FA4A 1CDCA 1L0YA 4KJPC 3DXAB 3SKOA 3P4MA 2BSRB 2VDNL 4BELD 3DYMA 4DUWA 3TWCH 3LQMA 4Y2DA 2AV7B 2YSSA 2F5AL 4XNUL 4J4PC 5DJAA 4PRIA 3VDAA 1PSKH 4Q0XH 5A1AA 3VXRE 2FIKB 3PHQB 5KVDH 3G6AB 5BCAA 4UDTA 3V4PH 2Y9RT 4LSUH 4G80A 4XPAH 5DLML 3O6MH 3RL2A 1N2RA 1JPTL 1CTNA 2JJTC 1ZAGA 3W82A 2HA1A 1YUHA 1P84J 5FEBA 1U36A 3ARWA 1U91A 2J7LA 4PRHD 3O2DA 2GSIB 3DECA 4PG9A 1S8DA 1TZGL 4PS4H 1UWGH 1IEAB 2BSTA 2EDBA 4U0RB 1VGKA 3BIBX 3QUXD 2ATPB 2CIIA 3K8LA 1BF8A 2EEDA 2FEDD 5EOCH 3LZFL 3QJFB 3LKOA 2XXCB 4HWNA 4QOKD 3VMNA 3AUVA 4R8WL 4BUGA 1IGFH 1WBZB 2Q1EA 2YRLA 3ARRA 4K94L 3KJ4C 1RHFA 1IGIH 5MEQB 1JYXA 1U3HB 3KPRD 4P59L 4XAWH 1HHIB 4WI3A 1KN2H 4XMKH 2BX5A 3SGDH 3U7WL 1HCVA 1MI5B 4YIQB 1V7NH 3KPSA 1U92A 1X6NA 4GKZA 2NW2A 1FN4B 3ULVL 4JPVH 5JHDE 2X4OA 1B0WA 1FPTH 5K59F 5ISZA 1RJZA 5I8CB 4AEIH 2ZOLA 5SWSB 1UZ6F 3RWIB 1WV7T 1M7IA 1TCMA 1MAJA 5LBSH 1K5NA 2A1WL 1EAPB 1S7SB 4MXWL 3O9WC 4ORGB 1FC1A 4HZAA 3NA9H 3TBTA 1HHKA 3MRJB 2P5EA 4MQ7A 4LCCA 3IS1X 3T0AA 3O3EA 2LABA 5DHXB 3H8NA 1CGVA 4X6CA 5IF0B 3BSZL 2IH1A 3VGHA 4LDOB 3T4AB 2XG5A 1JNHA 3L3KB 4XP4L 1AY1H 5SWZE 4PJ9D 4UT7H 5F3BB 1Q9OB 5E8OA 2VC2L 5BW7C 4KUZH 2VLKD 2COQA 4OD3L 5GHWH 4EKXA 3GHEH 1MI5A 1EEQA 3NPZB 4KTEH 3RAJL 4NN6C 3D39E 5CP7B 4LEXH 1QBLL 4NWTL 3IETA 2FBOJ 2EDDA 3AU1A 2CKBA 4YXLL 2NY0C 4AK1A 4ODBD 4EUPG 3QUXB 3IDJA 1WIUA 3L3IA 1E4WH 2PXYC 4OZ4A 5T1MA 5LVEA 1N5AB 3E2HB 3M8OH 4JAMB 4YHZH 4I9WE 1O5DT 5CJOL 1FRGH 4OZFG 4N8PA 4WI9A 4HUUB 3CZFB 4XP6L 5ADPH 1CF8H 3L3HB 3MLUH 4GLRH 1FIEA 1NBYB 4HT1H 1RZ8A 1SJVA 1PEZA 2B7DT 4TULL 3V7AG 3DRTB 2EDFA 3MGOA 4WFED 4YHNA 2B4CL 5I1HL 5SV3A 2MTPA 4BUHA 1FYHB 3ZKXC 5IHUH 5KG9A 1S7SA 3DUSA 1ZLVK 2FIKA 4LHJB 4BFBD 3UYRL 5ERWB 1QFWH 2WBJA 3MUY1 1PLGL 2OK0L 1Q72L 3MR9A 1BZ7B 3S9DB 1A7PL 3OR7B 4YHIB 2PCPB 4S1DC 1TETL 4G8GE 2VDPL 4EBQH 3QQ9C 3E1F1 4ELMF 5A16B 4PJHF 3SDDC 2D7PA 2PXYB 3N9GL 4JY5L 3UCRA 5GS0L 2HFEA 4NQCD 2UWEE 3ARFD 4C4KO 3MRJA 1HHKB 4MQ7B 3L5HA 3CDCA 4X6CE 1I9IL 4NP4L 1GHFL 4WU7B 3TIDA 2Q3ZA 2QSVA 5F7DB 2BNQB 4O4YH 1BREA 3F65A 5DYOB 4OM1H 1F11A 3R06B 3TA3D 4CVWA 3HE6C 4BQBA 2MJWA 2XXMB 4HXBL 4Y5YC 1T2QL 5JPNA 1DN0B 2OZ4L 1JPGA 3ZO0A 2VL5A 1ES0B 2AQ1A 1EVTC 3RZCC 1YC7A 5CD3B 3KLSA 3QIBA 4PY7A 5E94A 1FN4A 4G8GB 4JFHE 4PRNA 3OWEA 4LLMB 5F44A 3MV9D 4H25B 4L3CB 4WFHE 3EFFB 3KPLA 4K8RH 4PIRF 4PJEE 3X11A 5IB5A 1XIWC 3MRPA 1G9NL 1NDGB 3BEWA 4RGNE 1CGTA 3KPSE 4JE4B 2F53D 5CZVL 5I74B 5HHNB 1EJ6A 4LLAA 4MAYD 3V79C 5T3XE 3IXTA 5T33L 1HI6B 5CJXC 5F9WC 3MV8B 4HWZA 4NQSA 3O11B 2GY7B 1KJ3L 5JDSB 4WU5A 5IT2L 2EIEA 2MCPL 3HZYA 4FXKB 1MWAL 1TVHB 3O3DA 3BWAA 4UDUB 3VD3A 2RFXB 5INDB 1WBXB 1NBVL 4LCIH 4Q9QH 3P9WB 3O3BB 5CFHA 1FL6A 5I76A 1UYWL 1LE5A 2PF6A 5K9QI 3NN8B 4G42B 1L7IL 2HT3C 2J4WL 1Z3GH 3WFCH 1U3HC 3O41A 4V2BA 3AVEA 3M17A 5GGUB 4FNLL 1RZFL 4WO4A 3WIFA 4M61A 4I18A 4LVHB 1KIQB 4OKVB 2MFNA 3FT4B 3U7YL 1KB5A 2G5BB 1G0YR 5C9JB 3FONA 2XNAA 3MA7A 3JVGA 1VEOA 5I76B 5HI5D 4Z7OE 4U0RC 5C6TH 5IB4A 1P2CA 2R0LL 2A73A 2W9DH 3NA4A 1I1YA 1RUQH 4NFCA 2EICA 1U3HD 5F97E 1JF1B 1T03H 1HQ4B 2L7UA 4J2XA 4WWKA 3ES6A 3QCUH 5BXFA 4CKVX 3C8KA 4ZFFA 4C4KT 3VWJA 2HJFB 5GGQH 1CICD 3U6RA 4A6YB 1P7HL 5KS9E 2D31B 1I3GL 3BKJH 3NFNA