3BT2H

Structure of urokinase receptor, urokinase and vitronectin complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
213
structure length
212
Chain Sequence
GVKLQQSGPEVVKPGASVKISCKASGYSFTNFYIHWVKQRPGQGLEWIGWIFHGSDNTEYNEKFKDKATLTADTSSSTAYMQLSSLTSEDSAVYFCARWGPHWYFDVWGQGTTVTVSSAKTTPPSVYPLAPNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of two human vitronectin, urokinase and urokinase receptor complexes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Urokinase-type plasminogen activator
total genus 43
structure length 212
sequence length 213
ec nomenclature
pdb deposition date 2007-12-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bt2H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bt2H02
4P48A 4PJFE 5T1LB 1NC4B 4QO1A 3DX8A 5JZ7C 4M6NL 5ACZA 3V4VH 2ZWLT 4G42A 5JPMB 5FK9A 1F3RB 2Y5TB 4O00A 5MERA 5TDOB 5KTEL 4HG4K 4YC2C 1P7QA 4U6HA 1JWSA 1IBGL 3S35X 2VSCA 4KFZC 1TJGL 1N5YH 1A4KA 1JYNA 2HMIC 3HRZA 4P3CL 1F2QA 1A7OL 5D5MB 3MLYL 4KDTA 3DMMA 1Y0LA 1YMMD 4OZGE 5JUEH 4W68A 1E4XI 2H3NA 5JR1L 5GS2D 2I9LA 3GKWH 4NRZA 3QIWB 3HZKB 5GQBA 4QT5B 3ORJA 3HE7D 1K2DB 1UQSB 1X4XA 4HUWA 1A9EA 1YEDB 1A5FL 4LLWA 4BUGA 3H9SD 5DRZB 4FQLL 3PGDB 4PYGA 5BV7H 1WFOA 1T6WA 3WLWC 4C56E 2GTWA 2VLKE 3BP6B 2AW2A 3MLWH 1A2YB 1S8DA 3QNZB 2APTA 4GW4B 3MNZB 3SKJH 2MCG1 1Q9OA 3DNKA 1A6VL 3RFZC 4JZNA 1QBLL 2MNUA 4YPGA 1FIGH 1ZLVH 1NGZB 2QQNH 2ZJSL 3P9LB 1YMMB 5JW4R 3UBXB 3P11H 3I3DA 5GGRY 3QWOB 3S5LG 1FDLL 2IWGA 3FOLB 4U2ZA 3RWGB 4XMKH 2DQHH 5ICYB 4BUHA 4ZUTA 4YWGH 2D4FA 4HPYL 4ETYA 4LCWD 1WSST 4ODSL 3QXVA 1XGTA 1M05B 4BZ2L 2P8LB 1VPOL 4ELMB 2RCSL 4APQD 1RZKL 2R2CA 3M8OH 5ALBH 2XKUA 4OBSA 4XTRC 3CDFA 3D48R 1P1ZB 2X42A 3GKZA 1QR1A 5JMRA 2DS4A 1T1YB 3NPSB 1A3RL 5DJCA 1MEXL 4W4OC 2DQEL 4Z7QF 5CZXC 5CMAA 4OF0A 5JOFB 1JN6B 5E6YA 1XGPA 4JZJC 4UV7L 4PLNC 4LCUB 2B4CH 1YDPB 3ZZ1A 2DIBA 1YQVH 2FL5B 1UC6A 1XH3B 5SWZB 1ES0A 1OAUL 4D9QE 5I1EL 2P5EB 3TJHC 5IWLA 1BQHA 5DRNB 4YQXH 4JDVB 5GGTL 1LDSA 3E2HB 4KROD 5T1KD 5I66A 4A6YH 3QEUA 4P9HH 5SWQA 3OR6B 3BXNB 5E6IB 3PQYB 1JHKL 1FC1A 4ZYKB 1CD9B 4JZOA 5KW9H 1JGEA 2W60A 1N8ZA 2KBGA 4OIBA 3RWEB 4K3EL 3OR7B 3UTTB 3WFEH 2EDFA 5IHBA 1F6AA 2FHBA 4CDHA 4WFEE 4DW2L 5EC1B 5F7DB 1RI8A 4XPGL 2CIIA 4KJPD 5I1HL 2J4WL 4Q2ZA 3RX5A 4QXTB 4U7MA 4YZFF 4LVOB 5SWZD 1JGVH 1L7TL 1U3ZA 2H1PL 3T08A 4XB7A 5IJKC 4HEME 4JO1H 1J12A 1FNLA 5EOTA 2PYED 1OP5H 1IEAB 2XWBB 4UINH 4UOW1 2WBJD 3EOTH 1IKFH 1JZ5A 1DTUA 4LL9A 1KIRB 5E6ID 4GG6B 1V5JA 2IANA 3NZ8B 3VRJA 4PJIF 1MQ8A 1YYLH 4PG2A 3CFJB 5HHOA 4PJAF 4ZSOA 3TPUA 4KK9C 4TUJB 1H5BB 4GS7B 5J1AB 4QRQA 5D5MF 2VITA 4XP9L 3EOAB 2W9DH 1A22B 2NNAA 3QXTA 4OM0L 2VL4A 3EYSH 3MV9A 1AO7E 3SDDC 4NZRL 1RUAH 3IXTA 3KPOB 3ALPA 1DQTA 4PTTA 2DWEA 1DDHB 5HPMA 4EUPA 3OKMB 4Y7MA 3WFDH 3VWKB 4XCFL 1I3VA 1ORSA 3MC0A 1SY6L 4Z0BL 2W07A 5F1OB 1S7UB 4YDKH 3QDGB 3E6FA 2UZIH 3BQUD 3T2OA 2PW2B 1NC2A 4HIJB 2IAMD 4HFWB 3ZT5A 1JPSH 2J8UF 3BW9A 4WTZG 4WY7L 4K71B 1D6EA 5A3ID 1U36A 4HDIB 5HY9A 3SDCC 3ET9F 3OGCB 2G5BA 4XTRD 5BQ7A 2PO6A 5HDBE 4H20L 3LKPA 1IGTB 4N9GA 3PDOA 4YHMH 3MREA 1ZTXH 5LGJB 1V7ML 5DVNA 1M7DA 4X5WB 5DLML 2CDEA 3VI4E 5ID0B 5HHPB 4MJIE 4XP6H 3RZCD 3OKKB 1AGEA 1NAML 1HDMA 1U58A 4PJ7A 1EO7A 1IGJB 3DUUB 1YPZB 2M1KA 4YHNB 2YD3A 2D0HA 4UILL 3A67H 3BQUB 1M7DB 4X5WA 1YEFL 1WZ1L 3B3IB 4E42B 4LRNH 5D70H 4RCAA 4IMLB 4KKLC 4WVRA 5FO7A 1NCTA 4POZC 4NNPL 5FIEA 2Q7NA 3KPNB 2YZ1A 4WV1B 5IOPB 32C2A 5SWSB 3TA3C 1NUGA 3D85B 3CH8A 2AJZA 4H88H 3C5ZC 1A47A 5L88H 1D5XA 3HC4L 2WWMD 5C0EA 5ERWA 2WLYA 2CKNA 3QG6B 5C1MB 3VG0H 1NSNL 2Z9TA 4WV1A 3KXFD 4Z7WE 1HILA 4IRJB 4KTEL 5HHNA 4NZJA 1BFVL 3ESUF 3LKOB 3LQAC 1WVZA 3D0VA 3SE9L 3I3BA 4FFVD 3FQXA 4WHCA 1Q94B 1GC1C 4B5EA 2VN4A 5JHLH 4OZGF 3FO9A 3GMMB 2F54B 1HDMB 2VDPH 4QRPD 3GSNH 3WNNA 2HJLB 3D0VB 2WQ8A 3BWUC 4WHYG 2B20A 1FZKB 3U0TA 5HHMB 4HC1L 3SCMA 1B88A 2DYPB 2FD6H 3QG7L 3FB8A 4MNGB 1NEZG 2I5YL 4U1LB 5E9DB 2P8MA 3MCKA 4UB0L 4NQEB 5HI3C 1RIUH 3ARDC 2KPNA 2XI9A 2YA2A 2Q7YA 4EI6A 3UJTL 1FO0L 2VZOA 1F4WH 4OCMC 3DI2B 1KTDA 5IFHL 3VGHA 3X3FL 1BBDH 1MJJA 3HC0A 4P4KD 3NZ8A 3VRJB 4IRJD 5LGKA 5D7IB 1BIIB 1IQWL 5BJTA 1AP2B 5C0GB 4Z7WB 4KZEH 4XP5L 4LVOC 3E3QE 4XXCC 4HBCH 2DM4A 2VXSL 5EBMB 2A6KA 1XF5B 3QULA 2FB4L 3VFPA 1G7IA 2AXGB 2YD1A 2D9CA 1TDQA 1XEDA 3DETD 4V1DD 1X7QB 3GUTA 1RZ7H 4HJ0C 4MD4B 3TO2A 1KIQA 4KC3B 5C2UB 1UM5H 5CS7A 1JF1A 4IOFC 3GSNL 5D4QA 5DQJA 3TM6A 1E4JA 1S5HB 5J1AA 3K1DA 5CZXD 1T2XA 4MSWB 4PJCB 3DV6A 4F7TA 5B8CC 3ALXA 5FGSA 4K7FA 2X05A 3ZYZA 5AD0A 3CC5A 3G5VA 3BP5B 2FEDC 2BRRH 5IVZA 3QUMB 5C0AE 4ZPVA 3K4DA 2DLIA 5D2NA 3U0PA 3EZ8A 4QT5A 3VG0L 5DTFB 3KPSD 1W72B 1ORSB 4OD1L 3LN5A 1ZGLB 2OL3H 3BDYL 2H6PA 3H3PL 1T7XA 3VXTB 1CTOA 5CJOL 4R90H 1SBSL 1TZIA 3RVUD 3VD3A 4D9LL 3GM0A 4RFNB 4KMLB 5IEHB 1EPFA 1U8JB 4FQIL 4MQSB 4F2MB 1E4XH 4YC2B 2VLKB 3NA4A 2NNAB 2BCKB 1XGYH 3OAZH 3VI3F 5AYUL 1ADQL 2WP3T 4M7KL 3WFHA 5AEAA 3CZFB 3OR6A 1NCNA 2CJUH 4OGYL 3S97C 2PW1A 2GTZA 1UJ3B 5F7FA 4KMTL 1KCRH 1L6XA 1P7HL 3OB8A 4AMKL 4L8SA 4OLYL 5E99H 1FBIL 1T22B 1RZ8B 4IRSC 3H9ZA 4NOBA 4FTVB 4MA3A 3MV8A 3KLDA 5GRYA 2W92A 4M48H 1NAMB 2YSSA 3HC3L 5IB4A 1IM3B 5DEGA 4KJYB 4W6XB 3UYPA 3O6KH 1UKTA 3RAJL 2ESVD 4O51B 3U1SH 5KSBB 5IW6B 1TVHB 4X7CC 5HGAB 4HLJA 3G6JA 4QTIL 4YHKH 2H9GA 4Z76A 3NCJL 1QPPA 5C0DB 1FSKC 2P24B 4DJMA 1AQKH 1MUJB 3ZKMC 3AS2A 3L5XL 1S9XA 1NLDH 3TBWA 3WFBL 4E0RB 1Y0LB 3EO9L 4NO3A 1MFNA 2WWKT 4PP2B 3RHWF 2AEQL 3VXSA 2OZ4A 2Y9RT 3TVMA 2ORBL 4NT6A 1WIUA 2Y5TA 1U95B 1F3JB 3BZFA 2ESVB 4QHUB 5IHZB 5CGMA 2G60L 2FZ3B 4JO2H 1J8HD 4DK3A 2OI9C 3ELAT 3SGJA 1L6ZA 1PKQA 1MCDA 4P2QD 4LPVA 1MF2H 2BOCB 3RUGB 1ACZA 5IW6A 1LP9F 4LQFH 2DI8A 5M95B 5IFHH 5K93A 2AJVL 1IGIH 4PJ9D 4XNZB 5DUBA 2WUBH 3IDJA 1V7NH 5J4MA 3C8KA 4DW2H 1MCWW 3MCLL 4FQHA 3KJ4C 1OSPL 5F9OL 1BM3H 4LOUC 4N8CL 5GGSA 1A6PA 3THML 3EHBC 2CPCA 5T1MA 5JPNA 2K1MA 4WO4A 3AM8C 4X6CA 1QNZH 4CJ1A 4NP4L 4PJEE 5FCUL 2XFXA 1A21A 4JVWA 1X5HA 4FXGA 1YEGH 4GRMA 3GHBH 1KPRA 4EN3B 1WC7B 4O4YH 5IK3B 3FAXA 4F37F 4FQ2L 4G6FB 3EAKA 2ZOKA 5E6ZA 1A6ZA 2V17L 4RGNE 4JFYA 1JCKA 1R3HB 3GBNH 3MLRL 3HS0B 3VDBA 3MACL 1HNGA 3B9EA 4HC1A 4ZUVB 4G9FA 4MCYB 1A1MA 3P0YH 1PD6A 4KVNH 2HTKD 3W0WA 5JIHA 1B2WH 5C71A 3DGGA 4M7JH 3TPKA 4HHAB 4R7NB 5IB3A 5TH2B 1V05A 3C08L 4M8QB 4ZODA 3MA9H 1T80A 4P2OA 4I1NB 4HSQA 5AD0B 3AROA 3JSSA 4JFDE 1JTOA 1ROWA 1YYML 1ZLWK 3L3GB 1N4XH 1F3DJ 2B5IB 5GRUL 3PHOA 5DS8B 5HYSA 5JHDA 3I6GA 4P2RD 4O02L 2HFTA 4HGWA 4OSUH 3F62A 2VDNH 4YHOL 3T0XA 1F90H 1MHHB 1MRDH 2UVFA 3RKDD 4N8VB 4BFEA 3BSZL 5JO5A 1UG9A 2DBLH 2VABB 2OP4L 5I18H 3AUVA 1BQLH 4HK0B 2ICWB 4YO0A 3T04D 4JJ5A 4XP1H 4ONFH 4E5XA 3IDMB 2PYEA 3F5WA 2YPLB 4XCCH 2YBRA 4PRBA 4JKMA 3CFKA 5BZWA 3ZE0E 3WD5L 2Q3ZA 4OKVA 5T5NG 5MI0C 3W9EA 4OD3L 1BGXL 2R2HA 1J1XH 2YPKA 2QQLL 4IRSB 3L7FA 4OCYH 5D1XC 4Y16C 3U7WL 5F3BB 4LLQB 1U8IA 1FP5A 1T0MB 3A6BL 5D71L 4W6WB 2VDOH 4YXHL 2VB5A 3MODL 4ZDHB 3VH8B 3EDJA 1RZFL 4OD2A 3V4UL 3I6KA 5INDA 1IQDA 1DBMH 3D3VD 3DARA 1A7PH 1XZ0A 4RBPH 4I2XE 2B39A 5FECB 2NX5E 1FJ1A 2AJUH 4JO1L 1X3DA 4JO3L 5IFJB 1TQCC 3KHOA 2YPLD 3VXMD 5DQDL 1HWHB 4RZCB 4GRWE 1CLCA 3VH8G 4FP8L 3ZKXC 2H6PB 2FIKB 5J3HD 3S34H 3GJEB 3RVTC 4G6KL 1I8IA 3E1F1 5EO0B 5FYJL 1P4LA 3HR5A 1EFXD 4RGNC 2R1WB 1KB5B 2XIDA 3UTPE 3UMTA 1U93A 3CC5B 2ZCHL 4TUKL 4GG8B 1X9QA 4U0QB 1T7WA 1CTNA 3S3PA 1KTRL 2YD6A 3BDYH 3D3VA 4RDQG 3QPQC 5GRWA 1OPGL 5DFVC 2FX8L 4K8RC 4G9DA 1PX3A 4M93C 4B50A 1JF1B 2EXWC 1JI1A 2W9EL 4ODHH 4XP5H 4ODWB 1ZT7A 4KDWA 5TFSL 1WEJH 2J3SA 2HT2D 1OTTC 4MA3B 5HYJE 4NO0B 1YQVL 1A9BB 5CP7B 1JRHH 1X6NA 4RRPG 2APWA 1BOYA 4XH2A 1D5IL 5FDWA 3QEQE 4XAKD 4S1SL 1J1PH 1OGAB 3TN0D 4JY5L 2R9HD 2GSGA 2OK0L 4XVTH 5LKNA 4ETQA 2J88L 2BHUA 3UBXG 4HPOL 4ODXA 3SKNA 3HTLX 5K9JH 3GI8H 5D2LF 4NN7B 1JWMB 2V7HA 3F7VA 3OL2A 4YE4H 1MI5B 3D85A 4J3UA 2DRUA 3H8NA 4MWFA 4GKNA 2R4RL 4Y2DA 5I1LA 1CD0A 3MCKB 4AQ1B 3HMXA 3RQ3A 1S7QB 3ZSTA 1AD9A 1UACH 2B2XL 2VH5H 3H42H 5FHAH 3SDAB 2P47B 1A7NL 1TTFA 3DPBA 1VSCA 2W9EH 5K9QI 1GCFA 1OGTB 4P57A 1OGAD 5DJ2A 1T89C 1IAOB 2D9QB 1G6RL 1F4WL 4XNXL 1IAKB 1JUFB 4Y16D 4WU5A 5JW5A 1JP5A 1QKZH 2YRZA 3JV4B 4HXBL 3EGSA 1P9MA 1IAOA 3QQ9C 1F45A 4P57B 5DJ2B 1H0DB 4HUVA 1OP5K 4ZFZB 5CJQH 3HAEA 5EO1A 3FQRB 4GKZB 3EYSL 5JHLL 3R0MA 2YUVA 2J8UA 3NIGF 4N8VG 3UPCA 5MEOB 4DEPB 4UAOC 4GKNB 3P4MA 1WZLA 1KEMH 1Q1JL 4P5TC 4S1DC 2QQKL 1FFNB 3ARBC 3ES6A 1YECH 2XZCL 5DUMH 1DUYA 4JREB 5D1ZA 1KLUA 4UQ2A 4LEXL 3U6RA 1BFSA 1OAKL 3Q2CA 3FQUB 3O4OB 3TA3A 5GZOD 4J23A 3H3BC 4QRSA 2BNQA 2J2ZA 5T1KA 3MLTA 3RGVD 1T0MA 4PJGE 4HK3J 2BVYA 2KKQA 5CJ8A 3MLSH 3ARFA 1XGQB 4TNWF 3QISA 5I1DA 4PREA 4L4TE 1KBGH 43CAA 1QFUH 2AV7B 3G5XB 5H2BA 2X44D 1DFBL 3WNOA 3GMMA 4LPYA 1OTTD 3SDYH 2R1XA 2BERA 3CNKA 3BKYH 3CDCA 4B53A 4LSSH 1ZE3C 2ZG1A 5FOJA 2X2YA 4RISL 1NMCB 2BSTB 5SV4A 3V6OE 2APFA 2OP4H 5I18L 5IBLC 2NXZC 4IRJA 1AIFA 4KROB 4PJBA 2EO1A 1WV7T 2FGWH 3CUPB 2DMCA 1BWWA 1DVFB 2DQDH 3FB5A 5C6WH 2ZG2A 2N7BA 3F12A 1H5BC 4GS7C 1NFIA 1EVUA 1UWXH 2O61A 3B5HA 2I27N 4D3CL 1CLOH 3QUYA 5A3IC 4JN2B 3I6GB 1FBIH 3JXAA 3NIFE 4WUKL 4OZHA 1MCHA 1F4XL 1EHAA 4Y19E 5BCAA 3QRGL 1LO5B 3N85H 3PL6B 1Z6JT 5CJXC 1LE9A 2AVGA 5HYJB 2P7TB 1JPTH 1NCWH 3UPRA 3PWVB 5HHXL 3EYVB 2CKBB 3MA7A 1I1AA 4FOMA 2EDOA 1XR8A 2WUCL 4O2CB 4GG8A 2BFVH 3L95A 4MJIA 4IDJH 5DJDB 1AGDB 1DBAL 1YEHL 4OLUH 3L3DB 3QNXA 1T7VA 4POZD 3REVB 5DYOA 4OT1L 1EAJA 5CGYD 5TQ2L 3ARED 5I1EH 5MI0B 3TBTB 1CU4L 1P53A 3ULUL 1VADA 3DHJA 3HI5H 1HZHL 5AZ2L 1TJHH 3EUUA 2RJMA 1LK3H 3TVMD 5GSVB 3BAEH 4XNYL 1DDHA 1F6FB 4XC1L 2NMSA 5DWUH 2CQVA 4LLUB 2XN9D 4FFVC 3QDGD 4OF5A 4FQJL 5ACZB 3VCLA 1GL4B 3EFFB 2EEBA 1OSPH 5HDOA 1ZSDB 2F74A 1E4WL 3FT2A 1VFUA 4CMHB 2H8PB 5FB8A 5KVDH 3BP6A 4QHNA 5D7LB 5JW3L 4I5BA 1IAMA 3QI9B 4ZS7L 4JY4B 2H9GB 5SX4H 2QL1A 5GS0H 5E8PA 1J1OH 1P1ZA 1X5ZA 1BLNB 1NGYA 3VFVA 3GI9H 4WUUE 5DMIH 3TJHD 4TTGA 2D7MA 5IHZA 3QPXL 1D9KC 3B9KB 3EIFA 3PABB 4H8WC 3BEVB 3PWJB 1A4JA 2E7HA 4E41B 2CXKA 4X9IA 4ZUTB 3X3FH 5E4EC 1LO2H 2GJZA 4PJGA 5TGBA 3L3IA 2C4FT 3L5WA 3Q5OA 1AY1H 4PJAA 1A4KB 3BPLB 4UILH 1LO3L 3MRCA 1R3HA 4CU7A 3WO3B 1T4KA 1Q9OB 3EJZD 1P84K 5DVOA 4OCRL 5C70A 2MHAB 1SBBA 3PGCA 3QI9D 4FHBD 2ATPA 3G5ZA 4P23B 3RVTD 2HKHL 4O2EA 1PQZA 3CAFA 2BXZA 4RNRB 2FH6A 4PS4L 3KPRE 3L3JB 4FQXC 1A8JH 1AHWB 1NCUA 1MREL 4HUKB 3HNVL 3JV5A 2VXQL 4L9LB 2UWEF 4M48L 3VFNB 4ZUVA 3NAAH 3LSOB 3VFRA 1AR1C 5ACLA 1NFDE 4LASH 4X7FC 5E9DD 1A6AA 1OT2A 1YY9D 3QQ9D 1JK8A 4RGMB 1R0AL 1QSFA 4R6UA 3PP3H 2MOVA 2OI9B 1CFNA 4PJGF 3NCEB 4M7KH 4XRCB 3I3EA 3GB7A 3LRGA 4I3RH 3WFCL 1YEIL 3T3MF 3HE7A 3UYRL 3MXVH 4NZDA 1SEQH 2FSEB 4GW1B 3VFSB 5IMOB 5E8NB 1CFNB 4BH7B 3BRFA 2Z93A 3ARBD 1BEYL 2OJZL 1IM9D 4L4VD 4G8GD 4LP4A 1KIQB 4YDVA 5FUCE 1OP3H 1VFOA 4H0GA 5CJOH 5HHOD 4JB9H 1KXTB 3MRMA 4P99A 1NBQA 2V9QA 4TSCH 5F88B 2IBZX 4U3HA 3O8XA 4CMMB 2W91A 2AI0L 4XX1G 4ZAKB 4V1DB 2YXFA 2NLJA 3ECBB 1OSZA 1GSMA 4WUUB 4YR6B 3BYTA 3DX6A 4JRXE 4QRUA 2ID5A 1A6TA 3MRJA 4Z7VF 1N26A 1HHIA 1II4E 2CUHA 1TENA 3VWJC 1IC4L 2XA8L 2LFGA 4YFEA 4YUEH 4UZGA 5AUMB 3SPVB 2DOCA 3MJ7A 3B9DA 3L6FA 4OUOA 1RULH 3O11B 2DQIH 3FB8B 4MNGA 5AYQA 4UIMA 2DD8L 4M9PA 2YD2A 1FNGB 3BHBA 4H25A 1IGFH 1ZVHA 4JFEB 3GJFB 4LLUA 2WBWB 4PRPB 3RVUC 2A73B 3R06B 3D39D 5F7UA 3F7QA 4HGMA 5D5ME 3TH3T 4XNUL 4WU7A 2QQQA 5F7LB 1KJVA 4KHTL 1EGJA 3LEXB 2R39A 4KZEL 2VDRL 2BMKA 3BGMB 3S37X 3ZHDA 1S9WB 4MNHB 4AJ0A 5F7EH 2GY7B 4KH2A 3UDWC 3VXSE 5HGBA 5ERWB 5EC2A 1NFIB 3T1FA 3FZUC 2P5WE 4ORGA 3N9GH 2GT9A 2NY0B 4IMKC 2AKRA 4JREC 1YN6B 1Y18A 1ZGLA 2MQ0A 5ESAB 4PRPD 2DICA 4KJQC 3TZVC 5DFVD 4YXKL 2Y7QA 1QSED 5LGHL 4YBQC 1ZT1B 5D7SH 1D6VL 4BSVA 4DN3L 3NCYP 3AXLA 4JQIH 2AGJH 1UXWB 3JWDC 2CDEB 2QADD 3H7BA 2NY4D 4OUUB 2VYRE 5I19L 3LN4A 3B2UC 3U30B 1HYSD 3IJYB 5B8CB 4Z8FL 1UWEL 4ONGH 2WBJA 4MX7A 1ED3A 3MSPA 1QQDA 1VDGA 3TO2B 5HJ3B 4LSDA 3OGCA 3MV8D 1XCQA 1NQBA 1MCEA 3L5WB 4Y2DD 4HKJA 1NJ9B 2XQBL 4QHKI 5E2JA 4IRZH 1D3CA 3ZYOA 4R7DB 2P49B 2ZPKH 2M2DA 3VE0B 2IH3B 4P46C 4I9WD 1IZKA 3S36L 1U9KA 3W5MA 2VDQL 4TN9A 3QZWB 1CXLA 1INDL 1RURL 3PHSA 1ZMYA 2Q8AH 5HVGB 2LQRA 1F4XH 3HE6C 1J88A 5I8OL 3C6LB 5KZCD 4ENED 4P2QB 3NPZB 1NCAL 2Q1EA 3HKFA 5HVHB 3NFPB 5DO2C 1TMCB 1FNSL 4LSUL 3CK0L 4U1LA 5E9DA 4K8RL 5E9DE 1KG0A 3EO1A 1GGYA 5LXGH 5K9KB 4XBGA 2D7OA 4JDTL 4J1UB 5DZNA 4BELD 3RWDB 4WCYH 2QQLH 1DBJH 1YUHB 5CILL 1KLUB 2AV1B 2VLME 4FNLH 5EORH 3AVEA 1E6OL 4YDKL 5FAAA 3TN0A 4HIHB 1F11B 2VLJD 3UROR 3LKOA 5FGCB 4J2XA 3UTZB 3NFSH 1N0LA 4HKBA 1MCPH 3RU8H 1BZQK 4XVUD 4ZUSA 1GC1L 1ZHNA 4UNUA 4U1HA 3ROLA 4KK6C 4C56A 5KZCB 2WSKA 5J6HA 5C0ND 4EN3D 1I7UA 4K9EH 4OZFB 4DGYL 4MA8L 3ARFD 4CU6A 2X7LA 3O8XD 4RWYL 3DLQR 3EYFB 3IDXH 1JI2A 1BX2A 4P2QE 3JV4A 4P2QA 2QHRL 4TULH 3QWRA 1XAUA 4PJHF 3RWJA 5JW5B 5CP7A 2AXJA 1PKOA 5IB5B 4ZTPL 1QG3A 4QEGA 1BD2E 4ZQKA 3UTOA 4U31A 3OBAA 1IRAY 5D7JB 4YBQD 1DSFL 2Q87A 4FA8A 1N0XH 4AMKH 3RUGE 3NCCB 1GGBH 4K55A 4DUVA 1LVEA 4TVPH 1XGPB 3QQ4A 4OGAC 3KR3H 3V5KB 5KOMC 1P5UA 3WIIH 5J6HB 1DJSA 2NXZB 4F15B 3NFNA 2NY5C 4Z7VE 4XC1H 2V7NB 1OT1A 3QQ4B 5K59F 5MEQA 4S11A 2PKDA 4RGND 1ZVSB 3HAEH 2VXQH 1E27A 4H1LG 4CGTA 1CCZA 5GGTH 4FMKA 4LBEB 1ZS8B 3O9WD 2LU7A 3OSKA 4AK1A 3BESR 4PJ8A 2DM2A 2EE6A 5I19H 3V7AG 4NO0A 5CEZE 3SOBL 1KB9K 1OTUD 4FQXD 3FFDA 1RY7B 4NM4H 4DN3H 3JVGC 4LDEB 4X7SH 4YHYC 1J18A 3HHRB 4O58L 2X7LB 1CXHA 3O6ML 1T83A 4Q6IA 3OGOE 4PRPE 5D7IE 1HHHA 5T1KB 1VACB 5J9PB 2OZ4L 3CFDB 3LPWA 1F97A 2BC4A 2C3VA 3WSQH 5K9JL 4NN7C 3C60C 5C92A 1FG2B 3S5LB 1EV2E 4J4PA 4PUBL 5EZLB 3ARDB 5I1KL 2X4UA 1FNAA 1OM3L 1TQCB 4BZ2H 1NFDF 2F53D 3LZFH 4H1LA 4LQFL 4X99A 3T8XB 4NKQB 5C0IA 1GAFL 3DSFH 4TUOA 4XXCA 1NLBL 4G8IB 1T2QL 1QTYT 4Z78B 2IGFH 4J1UA 3S6CA 1R5VA 3TO4B 4HJGB 2F54E 1GPOL 3KPSA 4HFUL 2HLAA 4PJ9A 1S3KL 1WITA 3T0ED 1P6FA 2EEDA 1NGQL 1SEBA 1I8MB 2JB5L 4ZFGH 5FM5M 4FMFA 2ERJC 5JO5B 4TUJA 3RZWA 3CPLB 4C83B 1G9ML 2BMKB 5GGVH 2NTSP 4Z0BH 1IFHH 1YPZE 4J4PC 3BO8B 4XP4H 3CVHB 1CK0L 5B4MC 2EDKA 6FABL 1T0PB 1M7XA 4WW2C 5C0BA 2QLVB 4P59L 4R97C 1I7TA 3HZKA 3NFSL 3TZVB 3BAEL 3MROB 5E1HB 4ODTH 1YC8A 1BVZA 2Z8WC 1NH6A 5EORL 4H5SA 3VDAA 3HUJA 1ZK9A 4XPAL 4KZDL 1MJ7H 2NY1C 4JKPL 4PY8I 3KJ4B 1LEIA 4LFHG 1A1OA 2HN7B 4XNQA 2ZKHL 5EIIA 1AXSA 3RKDC 1BREA 1CG9B 3N1MC 5IBUB 4JDZB 2DLGA 3HFMH 5BS0D 2AABH 3PV6A 4FZEL 3QAZB 1EHLH 5T1LA 1UFUA 3WJJC 2W0PA 3STLA 3SDCD 3S37H 4JQVA 1T4KB 4KKNA 1OW0A 4Y1AA 3MRCB 2GAZB 3BFOA 4Y4FD 3CIQA 1FPTL 3A0OA 1I1RA 4XI5D 4IOFD 1CR9H 3NCBB 4PB9L 4UNVA 4GMSH 5K33A 5I2IA 1CDIA 2RIKA 2DTML 3SGEH 4MNQE 5EOCL 5BRZB 1S9KC 1KXQE 4KDTC 4N0UE 2FX9L 3OZ9H 3OAYH 4MAYD 1NDGB 1B6DA 4JN1H 4X7DC 3SO3B 2VC2H 4X6DB 1A1MB 3SO5A 4PJXE 5BW7C 2AXHA 1W8NA 1HQ4A 4LCYB 2YWYA 2IMNA 3MLXL 1QSVA 1XGTB 1JPSL 4OSUL 2BNRA 5I76B 5IK3A 4N9OB 4NQCD 3SE8H 5ACMA 3DSFL 1RQ5A 5F88A 4LNRB 3S36X 3BIBX 3JZ7A 1G1YA 3MBEA 2RGSA 3MUGA 5TE6L 5AZEH 1RMFH 5EH1A 5BRZD 1FO0A 2ZUWA 4YHPA 2X4OB 4CADA 1MCFA 4HXAH 5I74C 4F7MB 4NQSA 3W0WB 3NMEA 2HJKB 4JFOB 4TOYH 1W2KT 1F4HA 3WE6A 1EHLL 2N4IA 2R69L 1BF2A 4NQED 5HYIA 3MJ7B 3RWHB 1DUZB 1QLEH 3LEVH 1UM4L 2PXYC 2QR0A 1BVLB 1I9IH 3H0TB 4XVSL 1OSZB 1GZPB 5ESVA 4XCYA 4KZDH 5H8DA 2LABA 5TE7H 3PGFL 5EFIB 4OI9A 5HGDA 5AWNH 3F6IA 4LSQL 1AHWA 1VFMA 5L6YL 2A1WH 5BRZA 2AP2A 1RHFA 4YDVB 4OB5L 4JG0H 4O5LH 3S36H 4M5ZL 1AGCB 1JNNL 1UWGL 2WINB 2DF3A 4HCRL 2CDGB 2F53E 5JDSA 3X13A 3KLSA 4G43A 2VIRA 4GXVL 1OCWL 2NQCA 1FNEB 1U8KA 4D8PB 4DZ8B 3T0WA 2WWMC 4PJEF 4EI5D 1DP0A 3FT2B 1DVFD 5CEXB 2FATL 1CGSL 1A7RH 4P9HC 1A1OB 1PY9A 4WDIB 2A83B 5EU4B 2ZCKH 4HWEH 3F12B 2LU4A 5DJ8A 1TJHL 3VXMA 1FL3B 1FH5H 2BCKA 2YD8A 3VGFA 1AI1H 4JHAH 4M8QA 3DXAD 1I9IL 1I9RH 5J7CC 4MDIA 4NQXA 1MCKA 3BEVA 3PWJA 4X4MA 2ZUTA 3RPIB 1F3JA 4TRPH 4DGIL 5L0QC 2CD0A 4AH2B 1EEYB 4NKDB 3N1PC 5M94B 5KSBF 1CFSA 4KKBC 2Y07H 4XPHL 5ANMA 4AENA 4UU9B 4W81A 1F2XK 3GMNB 1JPTL 1NCWL 3HZYB 4ZUWA 1YEKL 3LY6A 5I1JH 5IT2L 4A2MA 4GAGL 4XWGL 2ADJB 4PTUB 3WUWB 1N7MH 4P2YA 4Y1AE 1LP9B 1L4IA 3L95B 4D8PA 3CZJA 5A2FA 5K9QG 2MWCA 2O5ZH 5IEKA 2XA8H 2H32H 3AB0C 1X7QA 1T1ZB 2IQAA 3ARYA 1KPVB 2DM7A 3Q6FB 5EBWA 3S35L 4BFBD 4HWZA 3DXAB 1BZ9A 5TGBB 1JV5A 1X6LA 2ZNWA 4HH9A 5BS0A 4K94L 3H9HA 4PRAA 1WT5C 4IMKA 1W0VA 3BDBA 2XNAB 1U8NB 3STZA 5IB4B 3K2UL 4NKIH 4S1QH 3TT1L 3AS3A 1RZGB 1LE5B 1BLNA 1NGYB 1IAIH 3TBYB 4D9RD 4JM4H 2NPLX 2VR4A 3D87B 3X3GL 4Y4KB 5DHVH 3WL9B 4BH8A 1N6QL 4XMPH 1CD8A 5IB1A 4EQ3A 5TPWH 3QUMH 1H0DA 5CFHA 5DC9B 1K9TA 1NEZA 3U9UA 1ZSDA 3P73B 5L8LB 4D2NA 3QQNA 1A14H 2FZ3A 3CPLA 4GAGH 4PJCE 3SKOB 3C87A 5FO8A 2YUXA 1BQSA 5AAMA 5HHME 4WFHD 2XQBH 1CI5A 3RHWK 1AY1L 1LK2B 1P2CB 3G08B 2GK2A 3GSWB 4I0CC 1J05B 5F9WC 3MUGB 5GSVA 5IGXH 4DQOH 4HJGA 3Q0HA 5DXWA 4YZFE 3RA7L 2LAAA 4OZHB 1IKFL 4DOHB 5I1LB 4E41E 4ZSOE 1OAXL 3NA9L 4WFGD 3OKDA 3VXNA 4Z6AT 4Y2DC 3RL2B 4FQCH 4EVNB 2BDNL 1IKNA 3FQRA 5F7MC 4KJPC 5IMMB 1L9MA 2CK0H 3QXWA 1CIUA 2XY2A 1XFPA 3BO8A 3BGFC 2V2XA 3SJVB 4LLDA 1I8LA 4P23D 4RMQA 2A9MH 4NCC1 2AQ3A 2J5LB 2XZQL 5LCVH 2NY2D 1IAKA 1Q0YL 3F65A 3IDNA 4PJBE 1AGDA 3MGTB 2FYYA 3NIDF 3D69A 1J0ZA 4JFXB 1B6UA 4JZJA 5MP6L 1R0AH 3SHSA 1F00I 2WUBL 5C07D 1TETL 5GS2H 2YA1A 5EO1B 3IJHA 3LEYL 3L3KA 4GLRI 2N7AA 3KPLA 2FYYB 3RX8A 4Z7QE 2IPKA 2NW2A 4M61B 1G7JB 1W8OA 3C5ZB 5IB5A 1S3KH 1G7LA 1JNLL 5FUOH 3QPXH 4PRHE 1XMWA 3HNSL 5HHNB 2NTFB 1NLBH 4X4ME 1WBYB 1YA5A 1ZKAA 2ICEA 3GIVB 1PVHA 1EVTC 3D5OF 3MRIB 4M43H 4M7ZC 3BQUC 5BQ7B 1HEZB 3QCVH 5J3HC 3KPNA 4G8GB 3Q3GA 4X8XA 3GRWH 3DETC 3T3PE 1B2WL 4MQ7A 1MNUH 4HJ0D 4UBDC 2OTUA 4NFDA 4XNMB 1DN2A 5EO9B 3DJ9A 5E2WH 1C1EH 1JF6A 4C59B 4ZQKB 1R24B 2IADB 4QTIH 5FV2A 1KYOK 1U92A 4HWNA 1P6AB 3P0VH 1EH9A 2HT3D 1RK0B 4BK5A 1DLFL 4WUUD 3MBED 2PO6C 3QWRD 3MLTB 3VXRB 1RUQH 5EDXA 1BFVH 1B0RA 4DVBB 3LQZA 3DV6B 4F7TB 1S5HA 4PJ9C 4NIKB 1FC2D 3BEWA 5IBTL 3ZT7A 4P4KA 1FL5B 4IRJC 5DC4B 1EX0A 3A6CH 5IQ7H 2FX8H 1P5VA 4GBXA 3IAPA 4L9DA 1HINH 4LU5H 1EK3A 4NNYA 4XWOC 3X17A 2BNUA 3CVIL 3W39B 2UVEA 3B83A 1ITCA 1NJ9A 4HCRA 2X4NA 4H8WL 1JHLL 4G8GE 5C6PB 1WCBB 3GIZH 4DGVH 4NNYB 3ARQA 4IM8A 1AJ7L 2YKLL 5EU3B 2X4UB 5F6HI 1DZBA 3KJ6L 4WI9A 4OV6F 1N8ZB 1RZIA 2V5RA 4JM2D 2Z4QB 4NC1C 1EJOH 3HPLB 1G9NC 4N8VA 4NN6C 2CR3A 4IIQB 3MZGB 3HI5L 1K4DA 4C58B 5EA0L 5HVHC 1ZEAH 3ZTNL 5D2LB 1X5AA 2VITB 4BSVB 5FUZH 1ZT1A 3HNTL 1MHCA 3MODH 1J8HA 3VFMB 2HVJB 1UXWA 2OTUB 2EDQA 2C3GA 2V5SA 2X6MA 5FECA 3QHFL 2AEQH 2EH7L 3ZT6A 2ICES 4KJQD 3LS4H 3ZHKA 2MTPA 4NCC2 3AGVA 3D3VB 4LKXB 3O81A 4HXAL 1KLFA 1JWMA 4LCUA 3C9NB 1GC1H 4HKJB 4OZIF 2WK2A 3ZKMD 4MWFB 4MNHA 1ZLSL 3T0DA 3VFOA 4YHKL 3JTTB 1I7UB 3WYRA 4KY1H 3U30C 4YFLF 3SDXA 1CLYH 4U1IB 2D03H 3JUYA 2ZUUA 2NY6D 3O45B 5BZWB 5EZIH 3P30L 4MJ5A 3IFLL 2A73A 3UBXA 5T1DH 2E9IA 5LWYH 2K3TA 1LHZA 4W6YB 4CKVX 2F5AH 4I77L 3SQOH 3V52H 4N1HB 4P5MA 5D7JC 5JOEA 4N0RA 4L8SC 3SE3C 4BM7A 4WEMB 4K8RD 3GMQB 4QXTA 1G0DA 2DJ4A 4P4RA 3IKCB 4G6FD 4LF3A 4U7SA 1RIUL 4NSKA 2OR7A 1CFVL 4DTGH 4JO4H 2OR9L 3UTSD 5J56B 4MA7L 3T3ME 4UTAL 2J88H 5CKGA 1J7VR 1JMZA 2BOCA 3RUGA 5KSUB 3GBMH 3MBXH 4LLWB 3VRIA 5JQ6L 1EEYA 1O0VA 3K2MC 4U1MA 1LO2L 1Y6KR 1A7QL 2K7QA 3EBAA 2VZSA 2PW2A 4X7SL 4S1RH 5IMKB 5CHNA 5ESQB 4Y4HD 2W0FA 4GOSA 1S7TB 4KRPD 4WEUD 4NQDB 1UWEH 4NWTL 4MCYA 4JRYA 4X6CB 5T3ZL 1VEPA 4G9FB 2VLJB 1J0JA 3LV3A 4R4NC 4EBQH 3P9LA 3B43A 4NHUB 3QIBC 1AFVL 3BN3B 5IEKB 1Q1JH 1E0OB 4LNRA 4I9WE 1Y18B 4MJ4A 3SDAD 2J7LA 5BVJB 1FSKB 5MERB 3FO1A 3BGFB 2OQJB 3ULVC 4NQVA 1K4CA 1A0QH 3WUZA 3A6OA 1RIVH 1BM3L 1KLGB 2OR9H 3N9GL 5F71A 5JA9A 3DX6B 3BZEA 3LRHA 2Q3AA 4MDIB 3ABZA 3ULUH 1FL6B 1HXYA 2IG2L 1KFAL 3INUH 2VOTA 2VDRH 2XV6B 4WI3A 5EU4A 2DQUH 4WDIA 2XKNA 1RZFH 5SX5K 2ZOKB 3B9KC 1FHGA 2CLVB 3L3OB 1BFOB 3IFLH 4Z5RB 4PTUA 2CGRH 3WUWA 5HYSB 4JCMA 3ESVF 3HE7B 4YHIB 2WUCH 2IAND 4RMTA 4ZYKA 1FIEA 2DQIL 4H0HB 4J7RA 3MRHB 1N6VA 2FX7L 1KT2B 2V9TA 1CDJA 2LU3A 4UOW0 2XFXB 1DQDL 2ADGB 2VDKL 5CJBA 2E9JA 1UQSA 4RGMC 5E2TH 3NGBC 3MJ6A 5F1NA 4OZGA 3DGGB 5HYSG 4IJ3C 4RIRA 3V6OA 4WWKC 3C6SB 3O9WB 4GMTH 2D7TH 2NZIA 4CMMA 2V9RA 2FGZA 3L7EB 3JV6B 5KVMC 3TV3L 1EFXB 4GKOA 4FQXB 1A3LL 1OVZA 5CCKL 2HWZL 4X6FB 1B4JL 1JNHB 5DR5L 4QHNB 1KIPB 1VFAB 3P4OA 1OPGH 3GSXA 2FSEA 5IMOA 3VFSA 3HC3H 2OTPA 4UINL 1BD2B 4NDMA 2APXA 3WO4B 3RA7H 5DJ6B 4OLXH 1UVQA 4M6MH 4KVCH 1WAAA 3PHQA 2CH8A 4JKWA 2EC9U 1PEWA 4HLZH 4BKLB 5E2UH 1A1NB 1QSEA 5C0CA 4R4FH 3VXUA 3QUXC 4JFEA 4XVUC 1CR9L 4FTVA 4MJ6B 3OJMB 5D2LE 4ZTOL 2COQA 3HB3D 1JHTA 2GSIA 4GSDH 3CSGA 4GBXD 5J57B 1F13A 1J5OH 1BQUA 4E0RA 3PL6D 4XC3L 3IFPB 4K3JH 4JRXA 1SBSH 4XX1E 4PJCF 3T0EB 4MVBC 4GLRH 3MRDB 3VFTB 4IS6B 3H3PH 4H26A 1BD2D 4QNPF 1GHFH 1I3RA 3MRPA 5HGAA 2BC4B 5DRXB 4C4KO 2Y1VA 3KS0H 3CCHA 2C1PB 2OCFD 4FFWC 3DECA 5T5FL 4JRWA 3ECBA 1B90A 2I9LB 4NRZB 2I9TA 5FB8B 2VAJA 2NY7L 4GXUM 4RAUA 3PWPB 5C07A 4WNQA 3C8HA 3FFDB 1R3KA 5DT1L 4EDWH 3QO1B 5EWIL 1QLFB 4FG6D 1I7TB 4YNYA 4X4XB 4NQDE 3BN9D 3PWUB 4L4TB 5I8EB 3TVMB 4LVHB 4AEEA 3IDUA 1T1WA 2FX7H 3PABA 1VPOH 2OK0H 3ARSA 3GB7B 1NC4D 5CP3A 1CFBA 1ULVA 1EEZA 5EU6A 3V5HB 2W65B 3PUCA 2CDFA 2XPGB 2Y6SD 5ELIA 5CEZD 4LSTH 5C08D 3WCYA 1CL7L 2M26A 2JTDA 2Q7YB 5EBLB 3WDIA 2GCYB 4ODHL 4G6AD 4L3CB 1T66C 3V2AR 4E42A 4HJJL 3BQUA 5EPMB 2AXFA 3VXOB 1RVFH 3PF2A 4OZGB 4MAUH 2CK2A 4LSVH 4HULB 1BIIA 1UM6L 3VWKD 4G80B 1HIMH 5DDHB 2OL3B 2F8XC 1XGQA 3WJLC 1AJ7H 1U8QA 1ZWIA 5DD3H 2GFBA 3O2WH 4X6EB 3RGVB 4XVTL 4XXDB 3WIHH 3L5XH 4AIXA 3S7GA 2C3WA 1QKZL 3ZDYE 4ALAH 3GRWA 1AO7A 4LHJB 3STLB 3BUYB 5T33L 3VA6A 3U6RB 4KQ4L 1JFQH 1EGJH 5BOPA 1S7SA 4HW6A 4LCCA 3KLAA 4K7PL 3PP4L 1VGEH 4PJ5A 4QRPA 2XZAH 3WDJA 3WIFB 1REIA 4OIIL 3FB6B 3HB3C 3VMPA 4F2MA 4KXZI 1WISA 4I18A 4MAYA 4HIHA 5ESQA 2IH1B 2PETA 3AS1A 4MDJB 3BOVA 5D8JH 5C0BB 5IVZB 5MEQB 4HMCA 1YEHH 3QFJB 4OLUL 5I0DA 4L8CA 5A16A 1AGEB 4J4PD 4MNQD 5D70L 5E8OB 2CKBH 4NOFA 2QKIA 4LCWA 4J3SA 1BIHA 4QXWA 1QRNA 2XYCA 3O3DB 4DKEH 3DBXA 4AIZA 2JIXB 4UT7H 3HRPA 5FO7B 4JFEE 4L1HA 3RGHA 3QCVL 4ZOBA 4LCCC 1XIWB 3BH9B 1L0YA 4OFIA 3SDAA 3UC0H 2B1AL 1MPAL 4UAOB 3FB5B 4GG6A 5DT1H 2JLLA 3FONB 3BD4A 2JCCF 4D9LH 3V52L 3ARBB 5LWYL 1CL7H 1LO4L 4LPTA 1MH5A 5F9WB 3EJYD 1IL1B 2D31B 1LEKB 1A7BA 3QXAA 1DLHA 1JGDA 3OB0H 3W39A 5I6XB 4K94H 4CVZB 2D7NA 1I3GH 1QRND 2DD8H 3I9GL 5C0GA 5BJTB 3JBG7 3SDYL 1R5IB 5IESL 5DZLA 4DKAA 4HF5H 3OJDB 1H5BA 3SDAC 4NQEA 1IT9H 4DVBA 3W9DB 1HQRA 1WWAX 1F8TL 4PLKD 4BSWB 2VZ3A 1ZHKB 4LKXA 1F58H 3O2VL 3TGXA 4MGXA 1WF5A 3KPLB 4TTDD 3V4PL 3ZDXE 4PTTB 5EOTB 1XF3A 1LO5A 5KVEH 1ZHKA 3MYJB 3WXVH 4BSWA 3ARXA 1YYLL 2Q76A 2YRLA 1OAYL 3HCVB 5MEOA 3HFML 4PREB 3SY0A 1N59A 4G5ZL 1B3JA 5F7DA 3BYYA 4RAHA 1MI5A 1SJXA 5IJVA 3GSUB 1P4LB 1ZEAL 4XPAH 3GJEA 3D0LA 5ADOH 1MPAH 5EU7E 5LAXB 2ZG3A 3L1OH 4KPHH 2IEPA 1KB5A 3B9KD 3QFJE 3PE9A 4OGYH 1IEAA 1NANH 5IJVB 4QTHB 3WHXB 2FBOJ 3RRQA 1ADQH 4R4BB 5FEBA 2O93L 5SV3A 1YMME 4K3DL 5LVEA 1XF1A 1NCDH 1MCOL 3E6HB 2XTJD 5KANG 3DO7B 3M45A 5HHVL 4JFQA 5F9DC 3IRZA 5B39G 4ZO6A 3MLUH 4FABL 4MAUL 3MLRH 3K3QA 3QB7C 3B4NA 2X4TA 3FRPG 4YAQB 1FL5A 2BNRD 5C2BL 3NIFF 1P7KB 1N64H 1DEEB 4F33A 1JYXA 1MVUA 2VLKD 1TNMA 5CSZA 3BXNA 5E6IA 5TQ2H 1JGUL 4NYLA 4OGXL 5EUOA 2DBJA 4H26B 5DEFB 4ETQB 1BMGA 3UTZA 3W2DL 3T65B 1C8PA 4PJDF 1FVCA 1PDKA 1U8HA 1CVRA 3FT4B 2VZTA 3WIHA 3TFKC 4C56B 5D96B 3MRFB 3GI8L 4Z18A 4KMQA 4U1SB 1MCRA 4ISVA 4LIQE 4Y2DB 5L9DL 1MNUL 4FN0A 1U8NA 3I50L 3OXRB 4LCWE 4U6TA 3FN0L 1SJEA 4GQPH 3W82A 3DVNA 4YPGB 4PBVC 3T1FB 5DJCB 3ARBA 1XZ0B 3LKQA 4RAVB 3LH2H 4FS0A 1IGMH 4BKLA 3SKNB 2X9XA 1NGWA 3QXUA 1YY8B 3QXDB 1MLCA 4GJTB 5HDBF 1T1ZA 3K1KC 5B22A 2GIYA 4KUCF 1WGOA 2A6IA 1KB5L 3RAJH 1A6WH 4LVHC 3C6LD 1MFBL 4L4JA 5ICZB 2HFEA 3ZE1E 5J1SC 4ENEC 2R8SH 1BPVA 3IDYC 2RFXA 3P30H 3VWKC 1S7QA 2OMNA 3BHBB 4H25B 4OBRA 3MLUL 4ZAKD 5HHMD 2BVPB 3ULVH 4Y1AD 1I75A 4QWWD 5FO9A 5ALCL 2KH2B 3RPIA 4JGMA 1WZ1H 4TSAL 3WXWH 2E7LA 1SVCP 2E8YA 1G1CA 1KBGL 2ARWA 1XIWC 4R3SB 1YQ2A 2IFGA 4MXVE 3C5ZD 1URLA 1EEZB 2GI7A 2EZ0D 4OD2B 5DJ8B 3SE9H 4P3CH 5JIKA 1G7PB 5DURB 5DHVB 3MLYH 4XCNB 3FN3A 1G7LB 2CUIA 4WUUA 5F96L 4NO2A 4ESKA 3WBDA 3ME0A 4EUPG 4ZO8A 3WV0A 3FOLA 3RWGA 1HHJA 4XCEB 5CIPB 1BAFH 3GSRA 4DAGH 4PJ8C 1AGBB 2EE9A 2BRRL 1HH9A 3GHEL 4M6OL 3TV3H 4U3CA 2ZOLA 5FO8B 2VUYA 1BQHG 4XZUB 1LD9A 2IMMA 1MY5A 2FJFA 2UWEA 5TF1L 4R9HA 4XBPA 4Z7VA 1QR1B 5DK0A 3MFGB 3P4LA 4WFHE 1CS6A 4IHOB 2VQTA 5CMAB 3P40A 1RJLB 4DGVL 3QWQB 5IB1B 4NWUL 4PRHD 3LEXA 5DVMA 5CAYB 1EFXA 1WBXB 3PDGA 3Q6GH 1JVKA 4ELKB 1FAKT 3VFNA 5HXMA 5DK0B 3BE1L 4KKLD 3QHFH 1J10A 1TQBC 3F5WB 4BK4A 1A3QA 1FVDB 2YOCA 4U05A 3S35H 3AB0B 3GJFA 4HT1L 4LHUD 2EDWA 3L5JA 2AJSH 2FEEI 4OLVL 4M1DL 4WFED 2CIKA 2D0FA 4G8EA 3T2QA 4PLKC 3MRBB 1R5WB 4GAYA 1GZPA 3MV9E 5KSBA 4UOJA 4KK8D 4N1EA 3HE7C 3OKLA 5D7IF 3HZYA 4ZUWB 4XWGH 4OQTA 4AENB 4YDIL 3ZDXF 4MJID 3L3DA 2PXYA 4L3EB 5DMGC 4EI5A 3MRBA 2GJ6E 5E4EB 2H3NB 3I02A 3OG4B 3CVHH 1MWAA 1N3NA 3WEXB 3KWWA 4KDVA 3ARDD 5KOVC 5J0BA 3FCTB 4KJYA 2HG5A 2XY1A 2FJGB 3GSVB 1IM3A 4KTEH 5FYKU 4LHUB 3OKEA 3DXAA 4HWZB 1FVDA 1JNLH 5FUOL 4MJ6A 3GMPB 5JHDE 3SGDI 5C86A 1OHQA 5GGSB 2Y5EA 1OOAA 4OLZH 4PP1D 3FO1B 4ODTL 2AQ1A 4JHZA 4ALAL 5C0DA 2HH0H 3BWAB 3BISA 4EI5C 3JTTA 4X98A 4HK3N 1UM5L 4I3GA 5DGRA 1U3JA 3RBGA 2BVUA 4ZFOA 2RQ8A 3SO3C 3EDFA 5DMYA 2ADIA 5FF6B 1IGIL 2Y72A 4OQTL 4WTWA 5SX5H 1A6AB 5B21A 2FECI 3EOBB 3U0PB 2W0LA 1EXUA 3BIAX 5AZ2H 2NZ9C 1CGUA 3KPPA 1K8IA 4J8RA 1T66D 3TZVD 5IFAH 4GUPA 1U42A 3L3JA 2AJUL 4JO3H 2ARJB 3VXMB 3QH3A 5KSUA 2VJXA 5HI4C 1DQJA 4I48B 3EYQD 1FVCB 4JRYD 5CINH 4Y89A 1RUQL 3OKLB 3G6JE 3JWDL 1T2QH 5FKPA 3B2UD 9CGTA 1UH4A 1Z5LB 5B39A 3PV6B 2X1WL 5CBEB 1NGXB 5IR1A 5LJYH 1S7RA 4UUJB 1YEFH 4UT9L 4LAQL 2XACC 3T0AA 1F58L 1FLTX 3O2VH 3ROOA 3U9PL 2WLZA 3CFBB 1G0YR 1W72H 3DV4A 4V1DE 3U7YH 5JPNB 5CSGA 1KJ3L 4MHHI 2ZSWA 4OLVH 2X5PA 5EZJA 3ZE2E 4ISVB 5EBMA 1FDLH 1R6VA 3QIWD 2OBGA 1WTGT 3DURA 4DEPC 5ESVB 1KNOA 1ZGLM 3SE8L 5C0FA 3MV11 5DUBB 1JZ2A 4I13B 1B9ZA 4FXKA 4OZIB 3Q5TA 5FYLH 3FRUA 5HHQB 1PAMA 1NMCC 2P8PA 5C0AD 2XWTB 1CFQA 1MJJB 3HC0B 3ARTA 5DD6A 1IC7L 2B4CC 5BO1H 4GW5A 5HI3D 1L7TH 3T4YA 4HWBL 2H8PA 3OMZA 2HFGL 4OCWH 4LGRB 5I16B 4Q9RH 3RI5F 4JPKH 2O5ZL 3ETBF 4PG9B 4NQCB 2DYPA 5H35B 1H3TA 2AV7A 15C8H 4ZOEA 4JO4L 5JIPA 3TO4A 3BRDA 4ZO9A 5D93C 4M7LL 3VFPB 1ITBB 2Z92B 3Q3GB 4WW1B 3VWJA 5KSBE 4LSRH 3FQWA 1TZGL 3HMWH 4JFDB 2DQTH 4PRIA 1A7OH 1WBXA 2XN9E 3LS4L 5DYOB 3W81A 5J6GB 5C0RH 4LPWA 3T65A 4Q9BA 1T7YA 1AP2A 4P9HL 3SE4C 3W9DA 4LASL 3S88L 1HINL 4ZOAA 1KCSH 1FFPB 2EYRB 3P3YA 4JM4L 3CUPA 1OD7A 4YHLH 5IOPA 4JGUA 4NQTA 1LDPL 3BPOC 1U3HB 3QDMD 1D5XB 3V5DB 1B4JH 4MNGE 1TCMA 4OF6A 3WNMA 1QSFD 5FYJD 2WP3O 4CVZA 1FZJA 4HV8B 1FFNA 2QSCH 4Q9CA 5CBAB 3GHBL 5DJDA 3VMOA 3IXAB 1OTUC 2UZIL 1YPZA 3V4PH 4ZFFB 3HCVA 3TO4D 3HI1A 3RWCB 1C7SA 3JWNC 3QHZL 4NN5B 4JM2A 4TTDC 3T77A 3GSOA 4ZFZA 4LIQH 2LE9A 3KYAA 4X6CF 1F3DH 3CVHA 1CK0H 1OQOA 4AM0A 1T6VN 2DL2A 2DQCL 3RIAF 1PLGH 1UJ3C 1B0RB 4LAQH 4QF1A 5C6TH 4JPVL 3IYLW 3ZHLA 3U0WH 3M1BB 3UTTD 1RZIB 4W4OA 1C5BH 4JN2A 1SEBB 1I8MA 4WTXA 5JHDD 2R1WA 2HVKA 3MGOA 1KTDB 4TQEH 2NY5L 3GUTB 5IMLA 4L8DA 2Q6WA 5JXEA 3V5KA 4DUXA 4L8CB 1S7XA 2A6JA 1G7MB 4L8BB 5HPMB 1QRKA 2R0WL 4X99B 3T8XA 4M5YH 4M7ZB 1CT8A 3OB0K 5HYQB 2C7UB 4M3KB 1WIPA 3TWCL 5C09E 3CDGB 3FZUD 2LVEA 2NY3C 5EUOB 4QRQB 2R0ZL 2N1KA 1YEKH 5I1JL 5KW9L 4FQJH 3FAWA 1OGAA 1J1PL 1OLZA 3MREB 4X9HA 4N9GB 5HVWA 1KXVC 2BXYA 4Y4FB 3ARGB 3FQTB 1U91B 5EZOL 5A2LH 3WL9A 3QJFA 4P46A 3SCMB 4BH8B 3CFIC 3AAZB 4PV8A 4U6XB 1SJEB 1ETZA 3MFFB 3U79A 4HUUA 5DDHA 2NX5A 4PGDA 3BN9C 3SKJL 3ULUE 4YBHA 3MUY1 4R4BA 3IFOA 5IV2A 4MAYB 2OTWA 1JJUA 4YHLL 5HHOE 3IF1B 1OL0A 2BVTA 4AYFA 2EXYD 3W11C 4NC1E 1QLEL 1JIBA 3HG1D 1CYGA 3S5LA 2GCYA 4HUUB 4KI5E 4KKAC 3GBML 4OI7A 1C1EL 3CGTA 4JANA 1F4YL 5JQ6H 5I8CA 4WI2A 1TZGH 2FECL 2HVKB 5LGJA 3TT3L 2HRPH 2CJUL 5GGRA 4EVNA 4U1GB 4DTGL 1I7RA 3ARGD 5MENA 2R1YA 3MMEB 1RMFL 1NCCH 3L3KB 3TPUB 2R0LL 1CDBA 1XGYL 3IDIA 3QDAA 1A9BA 3RGVA 5ANMB 1TZHA 4DWHA 5KG9A 5TQ0H 3E6HA 1FGNL 3FO9B 1LK2A 1P2CA 1RU9H 3KPMA 4YHML 3PP3K 4PY7A 1OLLA 5FA3A 1BF8A 4XGZB 4MD0A 4BYHA 4Y16B 3BP4B 2IFFL 3I6LE 4PJ5B 1GZQB 3TNMA 5D9SB 4WW2F 5DVKA 1D5BB 4MXWL 1RFDL 2A83A 1CLYL 1MRCH 2XPGA 1KENH 2DQCH 1WTLA 4R0LA 4Q74A 4NNXB 1RUAL 5LG1A 1IT9L 3CFKB 4G8FB 5EU6D 1K6QH 4IMLA 4P59H 2Y06H 3FFCE 3E2HC 1DQDH 3MUJA 1E28A 3VWKA 5MEPA 4J3OC 2Y07L 3P9WB 1KSRA 2FB4H 1DBJL 4P2CG 4GW5B 4OGZA 1KB9J 4KAQH 3BPOB 4JDTH 5EFIA 5HGDB 3VI3E 3SE3A 3S3JA 5C07B 5FYJU 1H3WM 2NY0C 4GAFB 4M62L 4LSUH 1YNTB 3WLBB 3MNZA 2A38A 3DVGA 2DJSA 1MAJA 1VGKB 2XWJB 2MQCA 2VLRE 3JTSA 1QLRA 1VKXA 1D5MB 3QIWA 5EULV 2Q8AL 3RWIA 1BBDL 3RWHA 1KIRA 1EJOL 4HUWB 1XIWD 1IL1A 3UYRH 3BGMA 1JNHA 5BW7A 3BGAA 2YKLH 5GS3A 2WZPD 5EO0A 12E8L 4PYHA 4MCZA 4A6YB 5CJQL 3JWOC 2X4OA 4OV5A 1AC6A 3UZVB 2C4XA 1F4YH 1T83C 4Q6IC 5LBSL 2SEBB 5FM8A 4HKXB 4M5ZH 4X4XA 3HS0A 5IHUL 1KC5H 4I2XB 3OAZK 4MXQD 4JCLA 5KSAA 1P69B 3VFUB 1K3ZA 1WFUA 3A6CL 4PJ8D 5IQ7L 3TBWB 1B4RA 3DROB 3T2NH 4QCIA 4Y4FC 1N5AA 2W60B 4GW1A 4DZ8A 1QRNB 4Z7UF 3FHQA 1MY7A 4UDTB 1A7NH 4UU9A 5DHYB 3VXRD 1FFOA 1BOGB 4LLQA 3ULVD 2DLFH 1OW0C 1SM3L 1ACYL 2BK8A 2X1PA 3HE6D 4ERSH 1SMOA 4JDVA 1MFCH 1LO0H 2VXVL 1C16A 5LGHH 1MLBB 1J87A 4WO4B 3U7YL 3U36A 1A3RH 3FQNA 1N7ML 4LPXA 3L7EA 4ONOA 4XHJC 1MWAL 3RP1A 3SKUD 5JXAL 1KCUL 3I50H 4Y4KD 1DANU 5JOFA 3G04A 1FYTB 5F7NC 5ISZA 2PXYB 4L3EA 2RCSH 3C60D 4Y5XC 4JPWH 4CBPA 2X4SB 4W4NA 4Y2OA 2CDFB 3S96A 4Z0XB 4YWGL 2R0WH 4PB0L 2YR3A 1ZA6B 4M5YL 5BZDA 1UXSA 1INEL 3LDBC 3LN4B 5JOPE 1CLOL 4RDQF 3SQOL 3QEUB 5E5UB 3BT2L 3E3QC 4Z0XA 4ZUUB 1KJMA 1PY4A 4JQVC 5GGSY 3L9RA 4MA1C 2H32B 1C5DA 1YC7A 3LV3B 5CEYB 1CIDA 1KTLB 3QZWG 1U8MA 1RULL 3UTPD 1M6OB 5D96C 5HYEA 2X70A 4JFED 3GJFH 2YS4A 3KPTA 4X5XA 2OM5A 3WMSA 3MRKA 4QRRD 5IG7B 4B7IA 4GAYB 1RUKH 3H9SA 3G9AB 4H0IA 5CLWA 2MCPH 1UEYA 4M7LT 5C8JB 3CH1A 1HHGB 1IARB 1N0XL 3PGCB 2E7BA 4NBXB 3DYMA 3ULUC 4V2BA 4F7CB 4KROC 1FO0B 3IVKB 1JHTB 2GSIB 5F9AC 1U41A 1JE6A 4YHZH 2FJHB 3SBWA 1HKLL 1V3MA 2DLTA 3BPLC 4UIMB 4P5MB 2YD7A 3MV7E 4K7PY 3OPZH 3S4SG 4PJXA 2W0FB 2GJJA 3F58H 4G42B 1BZ7A 2BSSA 3L5HA 4K9EL 3HMWL 3O6FD 4S0TD 1QEWB 1YN7B 5H94A 1AKJA 3O45A 1M7IB 4IHOA 5TE6H 1EERB 1X5IA 3G6JF 1KN2H 2NY1B 3Q1SH 4O51A 3QIUC 4N0CD 4O9HH 3VW3L 5GS1C 2WBJC 4YGAB 2MMXA 4L5FL 5DJZA 2DQGH 3LB6C 2R2BB 3BZFB 4OCWL 3TNMB 1FCCA 4KKBD 5DEZA 3RNKA 3FTGB 1XR9A 3DX9A 4PJEB 5ADPH 5FYLD 3MV8B 4AQOA 3U0TB 5HGHB 1EA9C 4ZNEE 1T20A 2VLRD 1SMAA 3OHXA 5C08A 5IWLC 3DRQA 1KJ2L 2Y4SA 5CCKH 3QUMA 1ZLWH 4BZ1L 2AEIT 3MBEB 3AREC 4PJAE 2AK4D 4PP2A 5GGUA 4FXLA 3OJVC 1FVEA 2R2EA 4PJFA 1OAQL 4GMTL 1U8PA 2CLZA 4XNZC 1OWRM 4UDTA 1T03H 4XRCA 2DTMH 3V0VB 4Y8AA 3BZ4A 3EYOA 3I84A 3PJSB 1G7HB 5DFWH 3IS0X 5FM4A 3OV6A 2HP4A 5IROA 4APQC 4D94A 1IM9B 2YUWA 4L4VB 2ZCLL 4X80L 4WWID 1MQKH 2V2TA 4PRNB 4Y5XB 2UY7A 2UY6A 3IKCA 2EDJA 1I85C 1INQA 3WS3B 4Q58C 5D7KE 1W72A 1NMBH 3F6LA 2IFFH 1H8OA 3VGGA 4K23L 3WKMH 4JJHA 4L8SB 5JXEC 3LQMA 5IW3A 2VZUA 1QBLH 5E94A 3OXSB 1AI1L 1FFOB 4GAJH 4F7EA 3MOBH 3RWJB 4Z95H 4KK5C 1CGSH 1CDUA 5DF0A 4HIEA 2PTVA 5IHUH 5DK2A 3LQZB 1EAPA 1OCWH 4KI5C 5KSAB 4Y5VA 3VXPB 3GMLA 1EFQA 3UO1L 3O3BB 3AU1A 1MLCB 2VXUL 3G04B 2WIIA 2VDPL 1PZ5A 3SDXE 2BOBB 3C9NA 2R0ZH 1ZS8A 2EYTA 4GRWF 4CL7A 2BSTA 4BA8A 3MRFA 1Z9MA 1U8JA 1MH5B 4UIKH 2VZ1A 1B0WA 4DCQA 3NCYS 2EYSB 4BFIA 2JB5H 1C16B 4MZ2A 3RVWC 5TE7L 5GGQL 1WJ3A 3LDBB 3Q48A 4L8DB 1U6AH 2Q6WB 1J9CT 2Q86B 1NBVH 4FQCL 3CLFL 5BV7C 1HHHB 3ARVA 5MEND 4KK8C 1G84A 4NRXA 2AGJL 4QCIB 1I7RB 4S1RL 3DROA 3EYQC 2NY0D 5KSAD 3LH2L 3MUZ1 1K4DB 5DQ9A 1QVOB 1Q0XL 3MV7A 1P7KA 5T3ZE 1KEGL 3U4EB 3BH8A 4DOHE 3LHPH 4CRPA 2H26B 3WFCH 2BVQA 3H3KA 2F58H 3KPQA 3NN8B 4PJHB 1S7VB 3G5YB 4YUEL 2KL6A 2GK0A 2IBGA 1FORH 5L2JB 2IALB 3OKOA 1ZXQA 3AAZA 5CWSA 1XF2A 2NY7H 3IDGA 1B0GA 4L1DA 3TT1H 1FZOA 3CU1A 1QQDB 3HLAA 2GITB 2O5YL 3IRPX 4EIZC 5GJSL 1G9NL 4M03A 5J89A 4LF3B 4Z77B 3O3EB 1P9MC 2D31A 4QGTA 1RHHA 3LMJH 4HIJA 1NC2B 2J6EH 2C9AA 2VQUA 3BX7C 3QDGA 4F33B 3QA3B 4KRPB 2JJVA 1XGUA 5E6IC 4PD4J 2KQMA 3R8QA 1IKNC 2CO7B 4X9GA 4XBGB 1ETZB 2HLFD 3MV9B 1JMXA 4NUJB 1D9KD 1UYWH 2XZQH 3IDIB 1QFHA 3D2UB 5D6DA 3LHPL 3ALWA 1Z3GH 3MXWH 4JFXA 5T3XD 5DMKB 2LTQC 4R4FL 2Z91A 5TDNB 3O41B 3QG6A 2DQFB 3SDCA 3PDDA 3F7VB 3BIKA 4PR5B 2IPUK 4WENB 4G7VH 3TA3D 3MRLA 2ED8A 4FFZL 5L2KE 4JQXA 4L29A 1BAFL 2AK4E 3BP4A 4F80A 2O5XH 1D5ZB 4KKAD 2DQFA 3TJEH 3FO0H 4R4ND 1K3IA 4JM2C 5F1IA 1G9MC 4B41A 1YUHA 1RUPL 3MV9D 2WIIB 3BKMH 1H3UA 1NMAL 5D6DC 5T33H 4HS8H 2WNGA 1NUFA 4DFHA 1YEIH 4PRHA 2ADFH 4ODWA 4QXUH 2GJ6D 1FRGH 3PWPA 1S5IH 4GW4A 5IESH 3SKOA 2OLDA 1O5DT 4X0KA 2X9YA 4NKOB 2HFGH 4GRLB 4QRSB 1QYGL 1RHHB 2EH8H 3WLWD 5SWQB 5KSAC 1FV1B 3EYFA 3RBSA 1IGTA 3FRUB 4HMEA 2VDMH 4WV1C 4FXKB 1WQVT 2KUTA 3CU7A 4Y19A 3WJJA 2VL5A 4Z8FH 4PRIB 3RL2A 3AS0A 2UZXB 3H42L 4D0DB 1S9VB 3WIFA 1NCAH 3H7LA 1RJCA 1Z9OA 2ZSWB 5F1IB 4WWKB 3INUL 2KZWA 3DVFA 1ZV5A 1YJDC 1IJ9A 2HKHH 1TTUA 4CNIB 2NY6C 4Q0XL 4JPWL 1J05A 3NABH 4O2FA 3RL1A 3RWDA 2N56A 4OCRH 1T7ZA 5D6CA 1CDHA 4GRLD 4YDIH 2ZPKL 3P4NB 4LQ1A 4MNQB 3JWOH 1MHHA 3VXRA 2P8PB 1U8IB 2V5MA 3GFUA 3OXSA 1K8DA 3ULSA 3IJSA 1TXKA 5CEXA 5DK3A 3CDYA 4LK4A 4G80A 1HXMA 2JIXD 1VFAA 3N1QC 5EWIH 5DRNA 3BD5A 1QSFB 1ZANL 4EQ2A 3UBXI 5DD5L 2RR3A 2GFBB 2OS7A 4JRYE 5I17B 4HT1H 3WNKA 4YBLB 5HI4D 3UAJD 1BECA 4PG9A 5JW4N 4OZ4B 5HYFA 5I75C 3QSKB 3O9WA 3C5JB 1JN6A 1FH5L 4EDXA 1EXUB 4WO4C 5HPOA 1WUNT 1I1FA 5JW3H 4PRAB 2Q20A 3MRIA 3OR7A 1RAMA 2BOBA 2JJWA 4LVNB 3DIFB 4NO5A 2P5WA 2GITA 3B6SB 5F8RC 5FXCH 4PJIA 4JFYB 2EZ0C 4UTAH 1Z5LA 4M61A 1KNOB 1LP9A 1R5WA 3S98A 3TYGH 4N5UA 3VFWA 5JHDB 3MJGX 3KYMA 4NPYA 4JZOB 5DS8A 3RTQB 1FPTH 3WIIL 4PJAB 2A9NH 1X5JA 5B38A 5F93C 4I4WB 7CGTA 5KS9B 3HI1B 2ATKB 1ZT7B 4M6OH 2JCCE 1BJMA 4AH2A 1ND0B 3C5SA 5L2KA 1W0WA 3PWNA 2WBKA 4C54A 1XT5A 3CH1B 4LMQE 3MUHL 1T5WA 3LKSA 2ADIB 4FFWD 2FGWL 4P9ML 2XZCH 5EBLA 1FL3A 3OAUH 1MJ7L 5KJRH 2DKUA 3CVHL 3K8MA 3MRDA 2D0GA 5C9JA 5A2JH 1AD0A 5D7LA 1HOCA 2QADC 4UDUA 4IEFB 4I3SH 1GGIL 5K9OB 1GIGH 3VFGH 15C8L 4M8VA 4QGYA 3V6OC 3FMGH 1BFTA 3QRGH 5I15H 1ZVYA 4JFFB 4S1DD 3IAGC 2F53A 3PWLB 2X41A 5L2KD 3G08A 4WGWB 1KJ2A 2FJGA 4FFYH 3I6KB 2J6EL 3QDJE 4YNYB 3LPGA 4LLAA 4M9OA 1NGZA 1UVQB 3DX8B 1QSFE 2W9LA 5FYJE 1FCGA 3GNMH 1F90L 4LLMB 3UJJL 5D7LD 3C8KB 1SY6A 4IRSA 5IG7A 3RDTB 4J3TA 4RQQA 5SWZE 3MRKB 4JN1L 4Y8DC 4X6FA 1F6LL 2OXHA 4QXGL 4ZS7H 1R3LA 3BKYL 3IAQA 4Z9KB 1C08A 4NWUH 2VDQH 4JHWH 2F58L 4JFOA 4DFIA 2F15A 1TVBA 2JJSA 4YR6A 4ELMF 1NCCL 4UV4L 3T0BA 4Z7NE 5J11B 1FAIL 5C0BD 5L2KB 4AEFA 2ZOLB 2YD9A 2PTTA 4LOUD 2QSTA 5I1CL 1M6OA 4QY8B 5AG8A 2VAAB 2YSSB 5DWUL 3VFVB 3F58L 4MB4A 1T04B 4OTXL 2BZDA 4U33A 3KYKH 3BWAA 3QHTC 3V6ZA 5KSVA 1MCJA 2VQ1B 4FQ2H 1N5AB 1QFWI 1XGRB 3X12A 4ZG1A 1AFVH 3CLFH 4YQXL 1YPZF 5CLTA 3GI9L 2BX5A 3VGEA 1TJIH 3OJ2C 4C83A 2A77H 4RFEA 1OQXA 1GH7A 1W0YT 4R8WH 3B6SA 4LDOB 2CDGA 1HI6B 4XB8A 1NCBL 1CBVH 1BFOA 4K7PH 3RZCB 4JFHE 1MJUL 1H15B 4NQDA 3KXFE 4Z7VB 4QLRA 5TH2A 2RAMA 1NDGA 4WHYH 3AC0A 3NVQA 4YXKH 4EEEA 5CIPH 3VFRB 3MBXL 2XKSA 5FGBC 5FOBB 3GK8H 4HZLB 4D0CA 4MS8C 3MO1A 1PKQE 3VI4F 3O2WL 1AGBA 5DMGD 4IDLA 4R26H 3QEGL 1K4CB 2R29L 3QJHB 5KANI 2R15A 4F9LC 2BVOB 2Z31B 2YZ8A 3OX8B 4KPHL 2WMPA 4U1NB 5I1DB 3I6LD 5IHLB 1U8KB 5CZKA 1FNEA 4M6AA 5TF0A 4YHIA 5IVXF 5D6CB 4XVSH 2JCCA 2VLJA 1LNUA 4ZTPH 3HG1E 4Q9QL 2R9HC 4XPBH 3P77A 1NMBL 2ATKA 1C5BL 3ZKQD 2F54D 3DRTB 3BE1H 1DN0B 4KXZH 3TP4A 1E4WH 3T0EE 5GISH 3MJ8A 5DJYB 1H3XA 2HTLC 4Q6YA 4XMLH 4OV5B 5GIRA 2XICA 4JVPA 4X6DF 2H2SD 4OZIE 1NLDL 1K85A 3KVQA 4EI5B 3NIGE 2NXYC 1BVLA 1MLBA 4QTHA 4F9PC 5DHVA 3T0VA 4P23C 5LCVL 4QOKA 3QIUB 1ZHBA 4P4KB 1R3IL 4WHDA 4F37K 3W2DH 3GGWB 2C3VB 3LS5L 1WIOA 4QRPE 1YMHB 1VESA 1JRHL 4NCDA 3U1SL 3KPSE 2ESVE 3FO2A 2EDEA 5LQBH 2VXTH 1TITA 1LE9B 4YXLL 4OLEA 5J11C 3BUTA 3GMQA 5DC0A 5L88L 1FZKA 3D39A 5I17A 4LEXH 4N68A 1R5VB 1QHPA 2VISB 1WBZB 2C26A 3CMGA 3DGCR 4NO2B 4NBZB 4ODUA 4LARH 4UDUB 3B5GA 2X4QB 3RDTC 4K3DH 1YNLH 2FRGP 3WS6C 1QA9A 3BMVA 4XPFH 4LCIL 3D0LB 2NTFA 3QUZC 3PG2A 4X8JA 3IF1A 3RVWD 4HXBH 1UB5B 4S0SD 1LD9B 2LAGB 5IVXE 3GSNB 4LKCB 5IVXA 1WCBA 7FABL 1KTKE 3DVGB 4OLXL 3ULVE 4MJIB 4M3JA 3L3HB 3KG5A 3I75B 3B8YA 4GXUN 2BVPA 2DBLL 4I18C 5BO1L 2F19L 2YEZB 3D9AL 3B3IA 3CXHJ 3AREA 4M62H 5JXED 1JYVA 1OAYH 3QJFB 2VXTL 4HGKC 4P46B 3ZLQC 5GGTA 2VDNL 1J11A 2VWEE 3MMEA 2VMFA 2EIDA 2QADB 4OIAA 3MGTA 4RWYH 4OZFH 5KG9B 1GJIA 4JQIL 3LS5H 1ZANH 1J8HB 3VFMA 4PJIB 3VRLF 1RZJL 5JTWA 5EUKA 2UUDH 4G8FA 4JDZA 2P44B 2OYPA 4HAGA 1B0GB 3VFUA 4PJ9B 5ALCH 4XCCL 1NANI 5IQ9A 5ALBL 1GZQA 2E8ZA 4PJ7F 2ITCA 2EDNA 1RFDH 2E7MA 4MXQC 3TIEB 1BQLL 4Y0GA 3EFDL 2NX5B 4P0DA 5E0QA 4OF7A 3V8OA 2V2WB 5C0JB 2DQHL 1MCSA 4HJJH 2XTJC 3JWDH 1F11A 5L8JB 4HFUH 3R1GL 2QQNL 2ZJSH 3OWEA 2DIAA 4EXKA 1FGVL 1MCWM 3TYFA 3WN5A 4U1KA 1VKXB 3F7YA 3I2CL 1PYWA 1VCAA 2AK4A 4YH6A 1G7JA 1P84J 3UJTH 4QRRA 5EOCJ 5F8QC 5DJAA 4XPGH 3C09B 4TUKH 3IJYA 5B8CA 1A5FH 4MAYC 1EO5A 2BSRA 4FQ1H 2PTUA 1A0QL 2NW3A 1JGDB 4L3EE 1JHLH 3QULB 4HKBB 2FWOA 2GEEA 4LIQL 1DUYB 5D1ZB 1NL0L 4IBLT 4K71C 5BXFB 1WLHA 2Y7QB 2VLRB 1D5IH 4DCQB 2DJUA 2AJ3B 4MQ7B 3DI3B 4Y19B 1A64A 5F97E 1MJUH 2YPVL 1JGUH 2V2XB 2NW3B 4HS3B 3QEHB 1T89A 2HFFB 2DKMA 4GKZA 4JLRB 3VXQB 2EECA 3GMLB 4PR5A 3AY4C 5FKAA 1CZ8L 4UV7H 4JFDA 1DLFH 3S4SB 3RNQA 4TYUA 2JIXA 3N1FC 3ZKND 4WHTB 1FN4A 4CVUA 3F8UB 4FZ8H 3O3AA 1KN4H 5E99L 4NUJA 2UV3A 5D1QC 5FA3B 3UP1A 1X5FA 2IPKB 4LSRL 4YHNA 5D1ZD 2QSVA 3X11A 2JJTA 1UA6H 3BRGC 4NFCA 4ZAKC 5CBAA 3TCLA 4PLOB 4XHQA 1YNLL 4R96B 1CWVA 1CFVH 4GRWH 4FP8H 2IC2A 5IW1B 2YEZA 2AJVH 4NQDD 4M1DH 4URTB 5DLMH 1RZJH 2V7NA 3N1GC 1HSAA 5GZNC 3O3DA 5J8OA 4JFDD 1D7FA 2QHLA 4KHXH 3BD3A 4M00A 3ZTJG 3ZL4L 5HDQL 5HGBB 5D1XB 1DQMH 1OB1B 5EZJB 5JA8B 3EJYC 1QEWA 3FFCA 3QQ3B 4JKKA 3PQYA 1U3HD 2D7PA 5DRWB 4Z7UB 4OCXH 2HTLD 5F7WC 5KVFH 1J0YA 4PS4H 4WIQA 3TH4T 4ODUB 4FQQA 1AGCA 2EEAA 5F7HA 1YJDL 1JWUA 2YUZA 3QIBD 3V6BR 4F57L 1BZ9B 1NCDL 3QWOA 1T0NB 3EW3B 3T77B 2J5LC 1XH3A 4JM2B 5KBNC 4G6AC 3O9WC 1ONQB 3ZO0A 3FQTA 5DQ9B 1GIGL 3L6FB 1IC4H 3QUYD 2H2PC 4UT6L 3QNZA 1NGPL 1UZ6F 3MLSL 3GSNA 5E8EB 5DO2D 3OPZL 3V5DA 3ZMRA 1P4IL 5D1XD 5FYKH 2DM3A 2CGRL 3MX0A 4HH8A 3LAFA 1ZLVK 3RVVC 5T3XL 3ARUA 4D0CB 3V6FA 3VDCA 1GHFL 3HNTH 3E6FB 5J6GA 3S88H 4POUB 3W5NA 4HBQA 1L7IL 4P2RE 1N6UA 3MJ8B 5DJYA 2UWEE 3ARRA 2F5BL 1KEML 4PLJD 4Q2ZB 3U4EA 5FCUH 4N0YH 4Y5XA 5K9KA 1YNKH 1S7WB 2FO1A 1R3IH 5F1NB 1Q9LA 3QEGH 3IFNL 3S9DB 3IVKA 5DK2B 4F8TA 4PJHE 1BJ8A 1EO8L 4EN3C 1ED3B 4H8WH 3ISWA 2VIRB 4DK6A 2PF6A 2Y23A 5E03A 4K3HA 3ZDZE 3NACH 4OB5H 5DHXB 1MCCA 3P73A 4OCXL 1CFSB 1TVHA 5FKPB 4Z7WF 1NC2D 2VXSH 5AWNL 4D9RE 4ZFGL 1MI5D 4RMRA 3DRQB 3VE0A 3IFPA 1CGYA 5D2NC 43C9A 4OI8A 4PJFF 1GPOH 3WS3A 5FF6A 5I9QC 1UCBH 2AJYL 3I75A 1MHEB 2AKRB 2JB6B 3KPPB 4HEPG 4MLIA 5EZOH 5GS1B 3IU4L 5CJ5A 4LCCB 1DBAH 3H0TA 3VXUB 3HZVB 4I0KA 1G7HA 5BS0B 3BP7B 3V0WL 3ZE2F 3V5HA 4BFGA 1W72L 1T5XB 1PQZB 2OJEB 5E2WL 1MQKL 2PW1B 3QDHA 4LLMA 2FH8A 4KUZH 2ICCA 4LDLB 1FYHB 2C3XA 5I73B 3CX2A 2F74B 4PBWD 1Y6NR 4EZMA 1AXSB 5I8EA 1CDGA 2A0LC 4U1JB 3ARPA 1D9KA 1JYWA 1J8KA 4M4PA 1T21A 2G75B 2CLRA 1XR9B 1U6AL 4PJXF 5I16A 1CXIA 3RNKB 2PTTB 4RAUB 4R2GC 4OFDA 4NWTH 3TZVA 2E6JA 4NKMB 5GS0C 3MLWL 2V2TB 4JR9L 1XCTB 5B3JE 1T1YA 1HQ4B 3MTRA 4LCYA 4U1MB 2VDML 3CLEH 4S10A 5E2VL 2A6DA 5T3XE 5BV7L 1BOGA 4KK9D 2ENSA 1K2DA 4KY1L 4EOWL 1S5IL 2FJFB 3VD9A 1FVEB 2R2EB 1EO8H 5C07E 5DD3L 1RV6X 1KJVB 3VGAB 4CW1A 5ICYA 4POYA 3S34L 1V3KA 4XAKE 1UM6H 4MD4A 3VXSB 4KWUA 3OHXB 5C08B 1ODAA 5D93B 2FR4A 5CUSH 4P5TD 2FO4B 2IQ9L 4PJIE 2EDDA 2WV3A 1HXYB 1RIHL 4YBLC 1DCLA 3W0WD 1OAXH 4MCZB 4A6YA 1I85A 2FBJL 2BNQD 4HMDA 4HWBA 1CICA 5CHNB 4KRMB 3GNML 1RD6A 5I73C 1KLGA 3RIFK 3DUSB 3AMKA 1Z9LA 5IGXL 4APQA 3P4OB 5DMJB 3IDJB 1QLRB 1T2JA 1P4IH 1AD0B 2XWJA 5CEZL 1JK8B 4OCYL 1WICA 5ISZB 1OP3K 4P2RA 2HT3C 4V1DA 3WFDL 3MRQB 3ARWA 3WE6B 5BVJA 3C8DA 3MBEC 1ZLSH 1G6RB 2HT2C 5KAQF 3FMGL 3MJ9A 3ZKSD 3DMMD 4M1CD 4XMLL 3SKMB 3BP5A 1N6QH 1E6OH 1KF9B 3X11B 4EUPH 4PGEA 3CJJA 3G5XA 4WCYL 2GTZB 4OCNC 5E1AB 4WW2B 3BVNB 1LO4H 3WHE1 4ELKA 3RNQB 3H6JA 2FHCA 2L7UA 3GMRB 5IEHA 1FGNH 1CG9A 4KK6D 5CD5D 5IVNA 1AC0A 4Z78A 5C0NC 5F9JB 3GDBA 4TUOB 3HN3A 4GSDL 5J1TC 3HAEG 1DQLH 3NCFB 3NBNA 3O6LL 5ICXA 1TFHA 5DJXA 4R96A 5E2TL 4ELME 3C2SA 3CXDL 4B0MM 2MKWA 4EDXB 4ZXBB 3C5JA 3J7HA 4KUCD 2HRPL 5EZLA 2ADGA 3MRRB 4YEFA 2BJML 1QFWM 3HE6A 1RZ8A 3BKJH 3CVIH 3KDMB 5A2KH 1NBZB 3C60B 3GBNL 5FYKE 3U83A 4DGIH 4CMHC 4U1IA 4YDLC 3M17B 5GJTH 5IROC 1JUFA 4F58H 1YECL 4JHAL 5F7KC 1SYVA 2VUOA 4ZMAT 3UJIH 1YY8A 6CGTA 5ITBH 3F7RA 4P3DA 3LEYH 5MEPB 4HWEL 4UIKL 1I1FB 2DQEH 1AD9B 4ZXBD 3NACL 4GBXC 1TZIB 1UZ6E 4LRNL 4PJ5D 2UYLA 2X1OA 2X4NB 3K81A 4HUNB 2IAMB 2GHWB 5MHSE 2QSQA 4UV4H 1I9EA 2FEEL 2IPTL 1JNNH 1UWGH 3MCLH 1I1CA 3ARGC 4AZ8A 3TIDA 5E2VH 4F3FA 5GHWL 3NH7L 4Q0XH 1DBKL 2X40A 1HYRC 2PO6D 1NCBH 5KS9E 4XMKL 1CBVL 5L6YH 3KYOA 3QEQB 3WDHA 1CGWA 4QF1B 1NSNH 3KYNB 1ONQA 4U1KB 5GRJL 5KTEH 3ZKXB 1OGTA 3QR2A 3GMOA 5E5MA 3P0VL 3DVNB 1QD0A 2ZUQB 2V2WA 5C0JA 1MEXH 1TETH 2XTJB 1K5NA 3WNLA 2EH8L 1HILB 4UB0H 4L4VE 5I1CH 1XF4B 3JWOL 2DWDA 4OZFA 2VL5B 1OARH 1DVFC 3HAEB 3VMNA 1S9YB 3PIQB 3EJZC 1AE6L 1EZVY 3Q5YA 4WI5A 4YDJB 1JGEB 3JVGA 4ONFL 3HMXH 2EC8A 2BNQE 4LEOA 4NKOA 5ISZE 4AL8L 4YK4B 4OGXH 3JV0A 3O4LB 4BZ1H 4Q6IB 4DZBA 3TCLB 5IVOA 4EI6B 1U8OA 1UH3A 4PY7B 3D18B 2G2RB 2QSCL 3MOAL 5BVPH 5KVGL 2R1XB 3BPNC 3O2DH 1BBJA 2W1NA 1IGJA 3KPRD 3IJHB 5F72S 3FONA 1N64L 4C56D 3EOYG 5EZIL 3EO1B 5D1ZC