3BT2L

Structure of urokinase receptor, urokinase and vitronectin complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
211
structure length
211
Chain Sequence
DIVLTQSPDITAASLGQKVTITCSASSSVSYMHWYQQKSGTSPKPWIFEISKLASGVPARFSGSGSGTSYSLTISSMEAEDAAIYYCQQWNYPFTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title Crystal structures of two human vitronectin, urokinase and urokinase receptor complexes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 50
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2007-12-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bt2L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bt2L01
1YPZF 4HX1B 1ZKAA 2Q86B 1ZLSL 3D6GA 3NPSB 3TO4B 1HILA 2E9JA 1ITBB 3HFMH 4ZFFB 4MVBD 3T0XA 1ZVSB 5BZWB 4ODTH 1JYXA 4O51B 4GRLB 4CUCA 4RQQB 1KLGA 2HKFH 3QRGL 5D7LD 5J6HB 5K9KB 1KIQA 5I74B 4JKMA 4DAGH 3KYKH 3QUXA 3BISA 4KJPC 2FATL 4DN3H 5CEXB 4UTBL 4YXLL 3BAEH 3LRHA 5HGHA 1KJ2H 3EOTH 5ILTL 1ZVSA 3V4UL 2Z31D 4O51A 3HE6C 3BUYA 5F9WC 3BEVB 1QFPA 5AG8A 1A6WL 5J7CC 3OMZA 2IH3B 1EUUA 3RKDD 4QNPF 4PTUB 1XIWB 3FO9B 5DJYB 4PR5B 3QIBC 1NUFA 3PQYB 4ACPA 4PJ9C 1JGDB 1F11A 1ZT7A 3O8XB 3AREA 4NZUH 3S35L 4HH9B 3ZT7A 4XWGH 4FQQB 4NBZB 4XMPH 3H3BC 2IH3A 3MRCB 1QHOA 3MCLH 3KPTA 5F9OH 1LEGA 4KHXH 4LCUB 4JZOA 1QD0A 2QR0B 2R2CA 4OLWL 4WWKC 4MD4A 5L8JB 4FABH 1E4XL 3HE6D 3VXOA 4TULL 2XOTA 4WFHD 3U7YL 3CSYB 4Y16B 4PJHF 1IGCL 1MCKA 5EO0B 4WU5A 5IW6A 3DHJA 3PP3K 3REVA 4IRZH 2E7LC 5H2BA 2A9ML 3QIBD 4MZ3A 3HAEG 5JPNA 1KENL 2FBJH 2NY2C 5BRZE 5HVFB 4JM2B 5HXMA 4L4VD 4MJIE 3V4PH 3ZHDA 4YDVB 5B8CC 3WL9B 3TN0C 3MV7E 5F8QC 3SKMB 5TE7H 1QA9B 4L3CB 2NY6C 5FYJU 3IFOB 3MLYH 4WWKD 3GSXB 5EU4B 4AIXA 4ZFOB 2XXMB 3CFJA 5DDHA 4TSBL 2HJLB 3QCVH 2FWOB 2V5SA 4UB0L 1BIHA 5EORL 3RGVC 3DVIA 4GQ9L 5I8CA 1AXSB 1PDKA 2FX9L 4LCWB 5FECA 1OVZA 3LH2H 1JMXA 3VH8A 4M7KH 4R26H 2YD4A 3O4OB 3KPRA 2VN7A 3FQTB 1UM4H 3IFOA 5EU4A 4X5LA 2BMKA 1F4XL 4DGYH 5I1IL 1K4CA 1YPZA 1I1AA 3NCJH 3TN0D 5DQDL 1VCAA 4LASL 4NNYA 1AXSA 3I50L 2GJ6D 4G7YL 1NGXA 5EZOL 4YGVB 2GJZA 4LLWA 3G6AA 3VU2A 5GS0C 4IRSA 2NY6D 4X6CB 4XNXL 4XXDA 5BS0E 4XAWH 3X14B 4GSDH 1MFNA 4R0LA 1CD0A 4XCEA 5IWLA 4K94C 3ZHLA 1HYRC 3RGVD 3BZ4B 3VXNA 5CBAB 4BM7A 4IS6A 4GKOA 1RZ8A 1X5ZA 1KPRB 1IT9H 1DBKH 3MSPA 3P4OA 4OM0L 2VUYA 5DRWB 4DEPC 4BFGA 1P2CA 4BZ1L 3EOYG 1CXLA 4PV8A 4I3SL 4KI5F 3K2MC 3B9EA 2B1HH 1SYVA 2X1XR 1P4LB 4WI4A 4PJEB 3RWDA 1NBYA 1KJMB 5C0BE 3H42L 3VGFA 2EDRA 4XAKD 4JPVH 3KYOB 4QRPE 5GS0D 1VACA 4KMTL 2OTUA 4NFDA 3WIFA 1QBBA 1UB5B 2ZNXA 5T33H 4NQCD 4EDXB 4LLUB 3PJSA 1JTTA 3MROA 2F54E 3WJLC 1QRNE 1NCNA 3V79C 5ACLA 4K55A 1WBXB 2BRQA 1A7QH 4PJHA 4RGNB 1IM3B 4PRPE 5TFSL 3PUCA 1MCPL 3MRHB 1IBGL 3VG9C 2FR4B 1ACYL 3KLSA 1L0XA 5DUBB 1XR8B 1OAXL 4ODXB 5C6TH 1R24B 3GMMB 2DQDL 3SGEH 1PKQE 3BYYA 5HHXH 3QUYB 3BW9A 4H1LH 3J7HA 4QCIA 3WEXB 2X70B 1S8DA 3QUKB 3NFPA 2XN9D 5IHUL 3TV3L 1C1EL 1J8HA 1H3XA 1W0YT 5CZKA 1FQ9C 1UZ8A 3FQXA 3MXWH 5LGJB 1IC4L 4IIQC 5HDBE 5IIEB 5KVMC 1XR8A 2O5ZL 3RZCA 4ODXA 2FH6A 1S7SA 1NGPH 1CFSB 3FAXA 5EOQH 2Y23A 4QEGA 2QSVA 3B2VH 3DURB 1EBAA 1RY7B 4QRTA 3NZ8A 3MLZL 4HDIA 5IBLD 5IIEA 1K5NB 2VDML 1KELL 2BHZA 4J12A 1Z5LA 1T0MA 1A4JA 4P23C 3U7AA 1T1ZB 1KEGH 5D2NB 1KXQE 3QYCA 3T0DA 3T77A 3W9DA 2YMXL 2DBJA 4N8VG 4TSCH 2A0LD 4LSVL 1NEUA 3N1GC 4ZOEA 4ODWB 2Y4SA 4NN7B 4RBPH 5T3XH 3W0WB 3C8HA 2VIRB 4M7JL 1XMWA 2B2XH 1PG7L 2FD6L 1JFQL 4WV1A 3SO3C 4F57H 5H94A 1NFDB 5MI0B 3VFMB 2XKNA 5EC1A 5F93C 2BSSA 4LSSL 2GSIB 4LVNB 5DEGB 4MNGE 2BY0A 5I16B 2VMFA 3MOQA 5ANME 1A6UL 5EH1A 3W0WA 3EFFA 3TESA 1S9YB 5JDSB 2VITB 4P23D 1NAMH 4M1GH 4Y1AE 4WUUB 3QDJD 4R8WL 2QHRL 5C0CA 2Q6WB 2ADJA 1MRCH 1N0XL 2GSIA 1ZLUK 4F7MB 4WCYL 3F7RA 2FO1A 1U3HB 3HI6H 5I1JH 3U2SB 1P5UA 3UO1H 2DRUA 4XVTH 3O3EA 4H20L 2I27N 1R3JA 3HTLX 5FAAA 1T03H 4GAFB 1DANU 4MA3A 1W0WB 3FOLB 4D8PB 3QA3B 4F7MA 2ZUWA 4FNLH 5LXGL 4NJAH 1MHEB 4KZEH 3HHRB 3TPUA 3WNMA 3KDMB 1VESA 3QXTA 5AAMA 3OJMB 1VB9A 4Y2OA 4PBWD 3SDCA 5T1KB 1UH2A 3E6HA 1OAYH 2X10A 1F00I 3GSUB 4J8RB 4XI5C 4PYGA 3RVWD 4JREB 1F4WH 1J0JA 1V05A 1HH6A 3FOLA 2P4AB 1KJ2B 5J4MA 3MNVB 3RGHA 1PEWA 5F88A 1RIHH 3O2DL 3X3GH 1K8DA 3ARDA 3KDMA 2ARJQ 1Q0YL 3RVVC 4ETQB 3PG2A 4OFYD 1V7NL 1FFNA 4IMLB 3HB3C 2N56A 4YFLI 5FM5M 3OJDA 1RJCA 3EGSA 1FE8L 1FVCB 1XF2A 4JQIH 1YEHL 3MYJA 2EYTA 1A47A 4K2UL 5GGVL 1GGYA 3TZVB 1UGNA 1JHLL 5I30L 3T1WA 4ZQKB 4XVJH 1MJ8H 3SE4C 5HTSA 3U9UB 4XCFH 1S9XB 3ESUF 4ETQA 4HKZA 5E6IA 3JVGA 2ICWA 1BMGA 2W9DH 4I8DA 3P11L 4BJLA 4NCC2 4F7EA 5DD5H 4AJ0A 3THML 2FNBA 4HK0A 2Y9RT 5MHSE 3VMNA 5DLMH 4Q6IC 5C09D 2W1NA 4PREB 4AK1A 5BCAA 3BJ91 4RX4A 4XP5L 3HC4L 3IAPA 1OAZL 3PGFH 4K23H 3FCTA 4DUXA 2Z8WC 4ZDHA 3VGAB 3HLAB 1MHHB 2ZOKB 3ARZA 3D3VD 1RUMH 2CKBB 2YEZA 2DDQL 4XT1C 5D72H 5DJ6B 1ES0A 3IDNB 2BERA 3QISA 1YNLL 3HNVH 4YE4L 3FKUS 1UXSB 3LRSB 2EE6A 4P2RB 3H0TA 2WIMA 4OGZA 1BVKA 5DJ8A 4HIXH 1E6OL 5JUEH 2HWZH 4K7FA 3BPNB 4PB0L 1H8NA 1LK2A 4LLAA 3IS1X 4Z7QF 4KK9C 1U58A 1IGYA 3OXSB 1QACA 1G7LA 5EOTA 15C8H 3IDNA 2V2TB 3GMNB 5IESH 5FUOL 5I18H 5D8JH 5ICYA 4MLSA 3U0PB 4YHPB 3ARFB 4G6ML 4WEBH 4YHML 1OTTD 1NCCL 1OSPH 3SGKC 1J18A 3OXSA 3GMQA 2DM4A 1J0HA 3MLTB 3FN0H 1U8LB 3I3EA 4AM0B 2UZXB 5H35A 1FVDA 1JYWA 5HPOA 3F65A 4GBXB 1H3VA 2VABB 5HY9A 1MI5E 4HKBB 4KK9D 5I8KL 2CIIA 2JJSC 1FH5L 1K4DA 1NMCC 3STZA 1ZXQA 5I1KL 2B39A 4Z7WB 1ND0B 1GGIH 3ILQC 3DUSA 4PJFF 5A1AA 4AM0A 4JY4B 4CW1A 2DMKA 2VDNH 4OF7A 4KH2A 3BVNA 1WISA 4U6HB 5E8DH 3BO8B 1CCZA 4XRCB 3S36X 4D0DA 2WANA 5DURB 1JWSB 4PP2B 1LD9A 4M5ZL 3PDDA 4TUJA 5DA0B 2KBGA 3FB8B 1UC6A 2DM2A 2BNUB 4NJ9L 5F9JB 5CCKH 3JSSA 2A74A 4XP1L 1CF8H 3OKMB 4KROB 1NCDL 4PRDB 4OLYH 5ITBH 2FJGB 2Z92B 3MGAA 3EJZD 3ILQD 4PP2A 5IR1B 5JTWA 3HZYA 3HRZA 3NGBB 4KK8C 4TPRL 1EFXB 4U4BA 4MJIA 5DRNA 1SVCP 4MCYB 5FK9B 3WD5L 4GW5A 2WUBH 1EV2E 4UILL 3O9WB 3UJTL 3QEGL 1IQDA 3MV7A 2Q7NA 4JO1L 1HHKA 2I07B 4G5ZH 4H88L 5CJQL 1IGML 3UTTD 4ALAH 1F3JB 4F9PC 3QR2A 4H1LB 5AD0B 2BNRE 5HDBF 5DD6B 2BSTB 5I0DA 1DE4A 1XEDA 3T3ME 2R0WH 1HK6A 1P7HL 3VXSD 3C09B 3ZE1E 3IXAB 4HF5H 3O9WA 5HVGB 4R9HA 4Z0XA 2F8OA 5DF0A 3T65A 4FQ1H 2UZIL 4FQCL 1MRDH 4LAJH 5IBUG 1FN4B 3QUZB 4N0CC 1BAFH 3K8LA 3HMXH 1KB5H 2NNAA 3C6SA 1HDMA 3LKOB 1I7RB 3E3QC 4UI2A 4CVZB 1ADQH 3KHQA 4P9HL 5CZVH 2XYCA 3RRQA 2O61B 1S3KH 3PV6B 5BS0A 3TYFB 4B7LA 2I25N 3PXHA 5FHBH 3FFCD 3O3UN 1I85C 1H5BB 3RDTB 2ZUUA 4PJFB 5LQBL 2XKSA 2B0SL 4J4PA 1I7RA 1R5IB 5GS0H 3T0EE 1RIVH 1EHXA 5TH2B 3P73A 3HAEH 4ZD3L 4P46C 1GRWA 4PJ8D 4K94H 4N0CD 5I1DA 4NNXB 5DSCB 2GFBA 1H5BA 4NHUA 5AG9A 1KB9J 1K8IB 4O2FB 5C0BA 5A2KH 4NDMA 4OSUH 4YHKL 1TCRA 4R4BA 4RWYH 3GJEB 3VRJB 1NAMB 2Q8BL 3HE7C 1WWWX 4HBQA 4KRMB 1G6VK 1OARH 2G5BA 5D71L 2EYRB 3QNYB 1DQLL 2Q7YA 5E2VH 1K8IA 5F3BB 3W5MA 2F54A 1I3GH 1QSFD 1T4KA 4NM4H 1MNUH 1H8OA 3HS0B 4P46D 4AL8L 4QXTB 4H8WC 3MACL 3VRJA 1QSZA 3IDGB 1P53A 3AUVA 4AH2B 2MTPA 2R4SH 2LFGA 2SEBA 4A2MA 3KJ6H 5D1XA 4YXHH 3QNYA 4QTHA 3KPOB 3L3IA 4RWHA 4XP4H 1N2RA 3P9LA 3WFEL 3VCLA 3GMOA 5I8EB 4DZ8B 1PKQA 2EDLA 3WHXB 5C86A 5CJ8A 3KR3H 3MJ7A 2ZSWB 3CUPA 3HG1A 4PLKC 2IQ9H 1MCOL 3TT3H 3ZDYE 4LARH 2EIEA 4LKCA 4ZUUB 1MCNA 4KK5C 5TQ0H 1Y6KR 2J6EL 4LCYA 2O26U 4RNRB 1FL5B 4FFYL 2IMMA 3VXME 4NUJB 2R1XA 1BQHA 1PYWB 3QQ4A 5FOBA 2APTA 4U6TA 4NWTH 1ZWIB 3PP3H 2XZAL 5EU6B 3G08B 3S5LB 2ZG3A 4G8IB 4HUUB 3MLRH 4P2OB 4XXCC 4YLQT 3SGJC 4PLKD 1FL5A 1U41A 4JN2A 2ZUTA 1BD2E 1UCBH 4KK5D 4JFYA 5D1QC 5IFJA 1BFOB 2OS7A 4HUUA 4LLQA 1UADC 2DQHH 4M5YH 3QPXH 5GJTH 4HBCH 4HGWB 3UPAA 4HQQL 4NCDA 5IMLA 4XPGL 2BHYA 1YEKH 3MLUL 4WO4C 5ACMA 1HKLL 4Y4KD 2MQ0A 4X6FB 3TBTB 3B2UD 2AABL 4R4ND 2P43B 1EZVX 2BNQD 2W59A 1UWXK 2Z91A 2PKDA 1TPXB 5EBMB 4F7CB 1T89C 2P5WD 2W0LA 2VWEC 4HGWA 3PABB 4R3SB 1OAUL 3MLXL 2B8OT 4XPHH 5DVMA 3R0NA 2EC9T 5D7LB 3DMMA 4JPIB 4R7NA 3WHE1 4YHIB 3U36A 2QSCL 3AM8A 1ZVYA 1UB6B 1CICD 3FQNA 1U8MB 2ZUYA 4ZTPH 4X0KB 1CT8A 3PABA 3UJIH 4OI8A 5GIRB 1D5IL 3L5XH 1C7TA 1EK3A 4F58H 1OP9A 4GMTL 4NSKA 1DN0B 1XF5A 2R0LH 4M03A 4D0CB 2VB5A 5I1HL 4JFPA 2GQHA 1JE6A 2WMPA 2B1AH 2G75B 3GMPA 4P5KB 4RGOH 1I7TB 3CVHB 4FQXC 3W9EB 3QB7C 1MEXL 2XNAB 5CINL 2K1MA 5CD3B 1URLA 5C6WH 1V5JA 1BF8A 3O3DB 5J1AB 2B5IC 1NDGB 4YQXH 2HA1A 1PVHA 4JB9H 1JI2A 3SJVD 1KJVA 5EU3B 3H9ZA 4O58H 1JGUH 1QEWA 2NX5D 2PTVA 4AENB 4GRWE 4HIEB 5K59E 2R2BA 1R5VA 5GGSB 2GK0B 4PRBB 1I3UA 1M6OA 1TJIL 5D7IE 3U7WH 3FB6A 1FFRA 3D39A 5F9WB 5CD3A 3VXTB 2OL3A 3MCKB 3QI9A 4GMSH 3WFHB 2EXYD 1X7QB 3T0AA 5DR5H 3QIBB 2FZ3A 3A6CL 4GAGH 5J13B 5DMKA 3HNTH 5SWZD 5C71A 3C5ZA 3BRDA 1MFAL 3K80A 4OLZH 5M95B 3QHFH 3PWPB 5GGSA 3RAJL 4L4VB 1KIUA 3S34L 2GK0A 5GJSL 5I6XC 2YWYA 1BQSA 4NWUL 2D03H 2HFEA 4KK6D 4W6XB 2BY3A 4JDVA 4U1JB 4LL9A 1S5IH 2ADFH 2J4WL 5JOPD 3WN5C 3EHBD 5HDQH 4WWKB 1BJMA 1OHQA 4F7PB 1G7JA 1YEEH 2AEQL 1I9EA 4XNMB 1FNEB 5D93B 4I18C 5EZJB 1UEYA 2PXYC 4U1JA 1HHJA 4HIIB 1LDSA 3ZE1F 4HLJA 1NGWB 4WW1A 1HXYA 3DSFL 1XGTA 5FHAL 5D6CB 3EOAA 5B8CB 5HI5C 5IFAH 4LKXB 3TN0B 1H15A 1KCUL 4ZUTB 3ZDZE 2GJ6B 5I73C 1KC5H 2HJKB 3DX8B 5FA4B 5CJXA 4MNQE 4J6RH 2WWKT 3H7BA 2PW1B 3RWJB 1I1YA 1DBBH 2DS4A 2FJFA 4K9EH 1NGWA 4AG4H 5ID1A 3MLPA 2ZUVA 3CNKA 4OCSL 4M7LT 4ODBD 5T5NG 4X7DC 1T2QH 4MAYA 5D1ZD 5A16B 3MR9B 3MV9A 1Y18A 3FQRA 2VQUA 1L6ZA 4ODSH 3G6DH 3L6FB 3IJSA 4LLVB 4TVPE 1DTUA 2IBBA 2VDRH 5CP7B 3BN9C 5E03A 5FYJE 3S6CA 2DM7A 3VXQA 3ARGA 5KN5B 2ZUQC 3QULA 1BZ9B 3HAEB 1D5ZB 3QQ3B 5D96C 5J11B 4NQED 1FVEA 1WBYB 1ZLUH 4ZO6A 1X5KA 4NQCB 4DCQB 1LDPH 1AE6L 1QPXA 5LAXA 2R4RH 5FV2A 3QJFB 5JW5B 5KN5A 4DEPB 1CD8A 1S5HB 2AJYL 4IDJL 2FGZA 4RFNB 1G9NL 4L3EA 2F5BH 1T5WB 5LWYH 1NL0L 4J2XA 4ISVB 5FKPA 1S9WA 2VDPH 4NT6B 1MHPH 1HWHB 1MFEH 5HHPB 3KYMA 2R29H 1MY7A 4NHCH 3QJFA 5JW5A 4E0RB 1GZQA 2J6EA 3O6FA 1ZA6B 1U95B 3D87B 1BGXL 1IEBB 2D4DA 2XN9B 1W0VB 4FXGB 4OCRH 3ARTA 2FYYB 5HJ3B 3OX8A 4FFZH 4ISVA 3U46B 5B3NA 5CSGA 1P69B 3JZ7A 3IS0X 3IDXL 5A43C 1CFBA 1RUAL 1UXWA 1IKNA 1I9JH 1AY1H 4TNVK 3QDGD 1RMFH 4NKMB 2M8XA 1CFTB 1EO5A 4LRNL 3D1MC 4HAFA 2AEPH 4L1HA 1U95A 1Q9WA 4TOYL 4P59L 2JCCF 4PRAA 5FDYA 4I77H 2GJJA 2ZCKH 3V6BR 3VW3L 2A9NH 3RHWK 4EQ2A 4YR6B 5GRJL 1T04B 2QQNH 4HWZB 5HGBA 2IANE 5BJTA 5KVFL 4YZFE 1TLKA 4WU7B 1FAKT 2NY0C 3CX5K 1UM6L 1DDHB 4LNVA 3IU4L 3R0MA 1IGJB 2X09A 3QIWC 1Z9MA 2GK2A 4HWZA 5EPMA 3P0VH 4QXUL 5DFTA 2X4QA 5C7XL 3PDOB 2VAJA 1MRFL 4XCNA 4WI5A 3KNBB 5F6IC 2OR7A 4P23B 1DVFB 3QDJB 5I1CL 1I1FB 1YQ2A 4NN5B 2P42B 4S0TD 5C92A 7FABH 4KVNH 5HVHC 2ZSVB 5HGAA 1NEZB 1T0NB 4OLUH 2FLBT 4X4XB 2QQKH 3ZYOA 3QIWD 1QBML 3TBWB 1OCWL 2ESVD 2Y72A 5I9QC 1WGOA 4OD1H 5EO9B 4G6JL 4KJWC 4NO0B 2FGWL 2XY1A 4XPAH 1NGQL 3UTSE 1WVZA 2FO4A 4NPYB 1CD1B 3WSQH 2VL5B 4M1CC 1U8NA 4FQHB 4I0CC 4S1RH 5I19H 4HUXB 5IB3B 3F5WA 4D0BA 5EA0L 2LU3A 4NO0A 4ZUWA 1FIGH 5JW4M 3O4LE 3VFRB 2J7LA 2BRRH 3B5HA 3WJJC 3KYNA 4H8WH 2JCCB 1OT2A 1MAMH 1MWAL 4OUOA 2AJVL 5E2UL 2DKSA 4YUEH 4RMVA 4YK4B 4N8VB 1SJVA 3DNKA 5KTEH 1EVTC 3D5OF 4KJWD 4HUXA 3HNSH 5EC2B 3UTOA 2VDKL 1NSNL 3SDXB 3R4DA 4HZLB 4YNYA 2CD0A 3ARBA 4QYOB 3CCHA 2JCCA 1WWAX 3PL6D 5FA3A 1JZ3A 5K59F 3VRLF 2DTSA 3MUGB 5J56B 1FZMA 1Z9LA 1OWWA 2ZZUT 5EC2A 5D6DC 1J1XL 2FHBA 3HCVA 3UTZA 3DV6A 2MHAB 2P8PB 3S4SG 3E6FA 1SM3H 4HK3J 2EDHA 2R1WB 4XPFH 3WKML 3EW3B 1GGBH 2IGFL 2DQFB 3MRMA 1KNOA 1MCJA 5IVXB 1A1OB 4RGMB 1A4KA 1WFTA 3ARRA 1MH5B 1B4JL 2OMNA 4Z7OE 2DQEL 3AU1B 1N8ZB 3DI3B 5TF1H 1TQCC 3D3VB 3IJHB 2P8PA 2R9HC 1BD2A 3TCLB 5I1EH 5JA8B 2WK2A 3LN4B 4PY8I 4E41E 1Q8MA 5DMYA 4K3HA 2P48B 5E9DD 5D2LE 1YY9D 4Z7WE 3UTPE 4NQSB 5L2JA 1IAIH 5E6YA 2UY7A 1EPFA 4KDTA 1RUPL 5C07D 3MA9L 3U0TB 2B4CH 3AFLA 3EDJA 4LGSB 1CDHA 2VLKD 3GSOA 3U4BL 1EJOL 3VG0L 3TP4A 1UJ3C 1XF4A 3MLSL 5DS8B 2E6QA 3C9NB 2R9HD 3VFNA 3KYKL 1N6VA 5IMKB 3VXRD 5J9PA 1QLEH 1NC4A 4DN3L 3TH2T 3TFKC 2K7PA 2E27L 4JCMA 3TA3C 2ORBL 4V1DE 4PJ7E 4XC1L 4ZUSA 2AGJH 3UMTA 2YSSB 3GBNL 2QSTA 4GS7C 2EICA 1B2WH 1I9IL 3QCUH 1CS6A 2C3GA 2YC1B 3P0GB 1NDMA 1T83C 3NH7L 2IPUK 3L5WA 2EO1A 1T20B 4L3AA 2C3HA 5IK3B 4XH2B 1TXKA 1MVFA 4NZUL 5IKCB 4Y5YA 5HHMD 3IDJA 5JA9A 2VXUH 3FQUB 5E4EC 1RK1A 4P5MA 2YC1A 1IEAB 2EDTA 4HPYH 3MCLL 2P8LB 4KHTL 4NC1C 5DK2A 3VJ6B 3VDAA 4PJ5E 5C08D 3BQUA 1QLRB 4ERSH 5E8PA 5C2BH 5IK3A 4FABL 4Y5XA 4KY1H 1P6AB 2E3VA 1QZ1A 4XBGB 1AIFB 5FO9B 2H2PD 3MRGA 4CNIB 1CXEA 1DLFL 2GCYA 4JFED 1IQWL 5EBLB 1BBJA 2MQCA 1C08A 1E27A 1SHMA 4BZYA 1IEAA 5JNYB 2O5YL 4HUMB 4HH8A 1AP2B 5TJWK 2FBJL 2P5EE 3UC0H 4F33A 1FAIL 4NM8L 4CMMB 3Q0HA 2KZ1B 2QSQA 3BI9X 1F3RB 1G7PB 3EYFB 3NCMA 2R8SH 5KSUB 5FFLA 4NYLB 3NA9H 5T3XE 3MLYL 2AV7B 1N7MH 3QSKB 2BCKA 3UTTB 3QCVL 1FRGL 1MCCA 3PXJA 1JPSH 1ZHNB 4AT6B 1ROWA 4EBQH 5F9AC 4M8QA 3PGCA 1U2HA 4L4TD 1FJ1B 4AYFA 2HH0L 5IQ7L 2KQMA 1IAIM 4HIHA 3K1KC 1TNMA 1UM4L 1P7QD 3PWLA 1OTSC 4CVWA 3PGDB 2EDNA 3MJ8A 3AGVA 3JV0A 1XT5A 2Z9TA 1DQTA 3NCJL 4KUCD 4LVEA 4Z78A 1FNSL 3SDDC 3QAZB 5GS1B 2H8PB 3MRDB 3MBXL 4GLRI 3LD8B 3MOAH 4IRJB 5GGRA 3WIHL 1FJ1A 4I0PA 3BRGC 1CD9B 2OJZL 3OTTA 5C3TA 2HRPH 1R5WB 4YZFF 4LDEB 4MNQA 1ZANH 4JRYE 4C59B 4KPHH 3FFCB 3GKWL 4WHTA 5EU7C 3VRIA 1V7MH 4C54A 2B1HL 3K1DA 5D4QA 3U30B 1F42A 1GIGL 4J3TA 1YMMD 4PJ8B 4I2XB 5HGGS 3V6ZB 3SDDD 2ENSA 4NRXB 4HJGA 3RNQB 4YBLC 3TH3T 4JPVL 3UPRB 3C60D 2Y6SC 2J8UF 3D2UB 1JCKA 1NBVH 2N7BA 2YA1A 3FO2B 2X42A 1YEFH 2X9YA 5FGCB 5EBWA 4LPUA 5J6GA 1FSKC 2Z93B 5T33L 1VHPA 1KTLB 3J8F7 4MD0B 5EOCL 1UWXH 2DTML 5HYSA 4MSWB 4PUBL 4XP6H 3FZUC 4BFIA 2OYPA 1R3LA 1HCVA 3C87A 4N1CA 2BDNH 5ECJE 3ZTJH 1MWAA 2WP3O 1HHGB 1A7QL 1AGFA 1V3JA 3P2TA 4QXGH 4Z77A 1QSFB 1JPTH 2Q76B 4P46B 3TWCH 3MRQA 4BSJA 5CKAA 3ROOA 4G6AD 4ZFGH 3LPWA 3BGFC 2Y6SD 3TNMB 2NY1D 5E2WH 4MWFA 3GGWB 5C0GA 1YQVL 4LRIC 2ICEA 3TO2A 2K7QA 1FG2A 1SYSA 5HHXL 4C56B 4ZYKB 3LN9A 4M3KB 3FTGB 5ALCH 4JY5H 2OI9C 5F3HA 4HXBH 5HDOA 5INDB 2Z35B 5IBUB 2YRZA 3FZUD 5C0JB 5I76B 4OLXH 1NFIB 3BN3B 1RD6A 2DLGA 3DVGA 1WFOA 4N9OB 1U0QA 1RULH 1QYGL 5EOQL 3FO0L 3RIAK 2AEIT 3VXPB 5I71B 1E4WH 3RWIA 3BH8A 2OTWB 2BJMH 5JHDD 4ODHH 1YJDC 4NKOB 4JFDE 5EBGA 1YN7B 5B39G 3WHE0 3B3IB 5C0JA 1NJ9B 2MOVA 5AWNH 5CBEB 2QL1A 1NFIA 4WENB 2QADD 5SWSD 3GEWB 3QG7L 4KZDH 4FZ8H 4MQTB 1ONQA 1F3DH 1AXTL 5D5MB 5KW9H 4EVNA 3JXAA 4QHLB 3DV4B 3OXRA 3DI2B 3L3JB 4MDJA 1LE9A 1BJ1H 1PEZA 5HGDB 2VE6A 5D7LE 5T3XL 3QPQC 1MFDH 3P4NB 2IANA 3LEYL 3B3IA 3BFOA 5CILH 5CBEA 2CGRL 2IPKA 3E1F1 3HZMB 4QHNB 3EFDH 1K6QH 1I7ZB 2J8UB 3RFZC 1HEZA 3A67L 1BBDL 3MRLA 5A3IC 3EYQC 3CFKB 3LQAL 4DK3A 2Q8AH 5GRVK 4O9HH 5GISH 4M1GL 3TYGH 2FIKA 3WFCL 3I75A 3AAZA 3LKPA 4JHWH 1ITCA 4Z5RB 2AJ3A 3I2CH 5D2LF 1MRCL 3BP4A 1UH3A 4FFWC 4Y4KB 5FKAB 4KVCH 1EAJA 2BNQB 3CFKA 3OR7B 1Q94A 4M00A 5KJRL 3ZT5A 1NCWL 1NAKL 4POUB 2YS4A 3N1FC 4OFVA 2VOTA 1F02I 1RFDH 2AV1A 3AS0A 4UDUB 4Y5VC 4Q9QL 5IT2L 5A3ID 3EYQD 4RDQG 4NQXA 4X8JA 5IB2B 4P9ML 1CICB 1DBAH 4NJAL 3MRRB 3BOVA 4QKXB 1WCBA 2ZKHH 2NTFA 4HV8A 1U8PA 4DTGH 4UDUA 4J3UA 1KYOJ 4WI2A 5DRXA 3C6LA 3BZEA 2MQ3A 2E7BA 3K46A 2HN7A 3UTQA 3NAAL 1JRHI 3G04A 5ABDE 1UVQB 3IJYA 5D7JA 3O4LA 3WS6C 4JZNB 1YY8B 2D0GA 4JKPL 2EC8A 3GKZA 3G5XA 5KSBB 4ZNCD 4JQIL 3VWKC 4WI9A 3SJVB 5AZEL 2NX5B 1IL1A 3F7YA 3HI1A 3CDCA 3LMJH 5IMMA 1GXEA 2F74B 1NANH 4CVUA 4LSUH 3K2UH 1A3LH 1VEPA 1BVLA 4QRQB 1F6AA 4NZTH 2W9DL 1YY8A 1D5BB 3Q6GH 1MCEA 1OTUC 4R2GC 2GJ6E 1PD6A 3W2DL 3GHBH 3ROLA 5FF6A 3QFJE 1XGUA 4ZFZA 3BIBX 2IMNA 1QPPA 5SWZB 5L6YH 4O2CA 3CD4A 4OF6A 1UWEL 5JHLL 4KUZH 4EIGB 3QEQD 3VFTA 1UWGH 4JKLA 1OGAE 4FFVD 3CFBA 1GL4B 3D69A 2Z8SA 1L7TH 1GC1C 1DUZA 3AB0C 5L9DH 4K23L 5LGHL 4LU5L 3ZTNH 3TIDA 3WIHA 4QHMB 4OZFH 3SKOB 3IFLH 5CEYA 3H9SE 1VEMA 3DVNB 5IMOB 5FO8B 1D7FA 1OTUD 1OSZA 1AGCA 4UU9A 4MD5B 4OZIB 4XAKE 1KBGL 2AJUL 2D3VA 3ZE0E 2V2WA 1JHTA 5D2LA 1JTOA 4TNWK 5GRXG 4XX1E 2R0KL 2J88H 2IPTH 2JKXA 5ICZA 2FDBP 1F2QA 3D85A 2AJZA 5D8JL 4UAOC 4F7TA 5JOFB 4L29B 2D31B 1JF5A 5JW4N 3MNWB 4HHAB 4U7MA 3IT8D 3ZKMD 4PTTA 3PWJA 3DOSA 1OSPL 3G6JB 4PBVC 3Q6FA 4HKXB 3OG6B 4QRRE 1SVZA 5DJXB 5D1ZB 2PR4H 5L88L 3H9YA 1FZKA 4LSQH 4L4JA 2OR8A 3TBSB 2ICCA 4TYUA 4HLZG 4QT5A 1G6RL 1B0RB 5T5FH 4POYA 3VFVB 1NMAH 3T4AB 2JJWA 5T1LA 2G60H 2QLVB 4MDIA 3DX6B 3GMLA 1RJZB 5TDOB 1AHWB 3MRKA 3OGCB 4N0UE 5C0IA 1JGVH 4PGBB 2L0DA 4JPKH 4O4YH 4NQEB 3P9WB 2MMXA 3RL2A 1I8IA 1RZ7H 4DVRH 5KSAC 1LO3H 3QFDA 5DD1H 1X5AA 3DX6A 3CFDB 4WUKH 3RA7H 4PJ5A 4YBQC 5CMAA 3C2AL 4PY7B 1MHCA 2D0FA 5E08L 1CF8L 1DBML 4E5XA 1S7XA 3DXAD 4OLYL 2VZVA 3Q3GA 3IDIA 1A1MA 3MV8D 5BMFH 4YHZH 2GKIA 3Q1SH 2E8YA 5TE4H 4APQB 2P5EA 1U93B 4YGAB 1WV7T 5D96B 2UUDK 1WC7A 3FT4A 3AS3A 2X4RA 1MREL 2XTJC 1KCLA 4DOHB 2PW2A 1MJUH 3WMSA 12E8H 2C1PB 2P1YA 3MLVH 5BW7C 3SCMC 1LNUA 4JFQB 3MRJB 4CN6A 2I24N 1N5AB 3FL7A 4XP9L 4APQA 3JWOC 4JG1L 1XZ0B 3A0OA 2LTQC 2JB6B 4PJDF 5CSZA 4BH8A 3DVFA 4BK4A 1ZT4B 5F70A 2ATKA 2ZNWA 4OD2A 4Z7UE 4KQ3L 3VWJC 1RZKL 1A9BB 1BAFL 4JR9H 5DI8A 4G80B 4KRPC 3FQWA 4HS8L 5HPMA 4QHUB 3LPFA 2D7QA 3IKKA 5J8OA 5CD5D 1OF2A 2F53B 5E1AA 5DC4B 4X6DB 5CGMA 1WBZB 3DBXB 5JXEA 5CZVL 4JY6B 3IGAA 1S3KL 3PP4H 1UACH 4NCC1 5IVNA 5HYFA 5FHBL 3X11B 3DHMA 4DGIH 1A9BA 4G80A 2PCPB 3PWUB 1FZOB 4WJ5B 1CBVH 1KIRB 4JRYA 4F15B 5L2KA 4YX2L 4YHYC 3SDAC 4C83B 1JUFB 3M8OL 4LF3A 3SKJH 4L8SA 2DYPA 1FYTD 1LE5B 4K94L 1FFPB 4MJ6A 4KRPD 4M48H 2R1YA 3RTQA 4MQXC 1FC1A 4ONOA 3MRBA 4JQVA 3RX7A 4Y4FC 3BE1H 2PCPA 3HUJF 1F8TL 4EUPA 3VGHA 1RZGB 4FQ2H 3KPSD 1A6AA 1MFBH 1X4ZA 3G5ZA 2DLTA 5E1HB 2YZ1A 4EIZC 3PHQB 3WFBL 1O7SA 3QIWB 1FFOB 3EO9H 3P77B 3P30H 2H3NB 4IBLT 5JLZA 1IC7H 2BVTA 1NUNB 3LEXB 2ESVB 1HSBA 1CI5A 5CIPA 3V8OA 2BOBA 2MNUA 3I6LD 2BOCB 4OAWA 3SDAD 1MNUL 1GCFA 3BXNA 1QTYT 2GT9A 5BXFB 1MCWW 4PJAB 4XNUL 3UBXA 2HMIC 5GHWL 4Y4FD 1FFOA 2DM3A 5ERWB 2HTKC 2CRYA 4RFEB 4YXHL 4M1DL 5C09E 3RJQB 1J1PH 4G8EA 3SN6N 3T3PE 4P4KB 4RISL 1AR2A 3NVQA 4G8FA 2XWJA 1N5YH 3CMOL 1D5XB 4X6BA 2CPCA 1K2DB 3TM6A 4PJDB 4CADA 4Y4HC 4ZPTA 4PFEA 1CGTA 3KWWB 4Y8AA 5AZ2H 5EZIH 5I9QB 4G42A 2NW3B 1RURH 4M6AA 3UZVB 4Y19D 4P2QA 3TBYB 3IETA 1MIEH 2Q3AA 2VXTL 4LARL 4QOKD 5FO7A 4P4KA 3D25A 2X9WA 1KN4H 1DEEB 1HHHA 3MMEA 3MRPB 4K07A 4PJXF 2HMID 3CSPA 2JK5B 4LEOB 4D9RD 4M6OH 2HTKD 5KBNC 3PL6B 4W4OC 1YN6B 1D6EA 3BKJH 3TBYA 5ETUA 1IGTB 3I9GL 3NN8B 3VGBA 2NZ9D 2CIKB 4ZXBB 4WHDA 5E8EB 5JIHA 1X44A 3F8UB 1DEEA 1QFWI 2IFGA 3DX9A 4Y4HD 5MERB 5IEHB 3IVKB 1YJDH 3U83A 4U1IB 1U36A 1J05B 2VUOA 1ERNA 5HYJD 1CGSH 3HR5A 2J3SA 1DQDL 2HVJA 1IGTA 4EXKA 1AO7E 1U8KA 4U1NA 1JWUA 4WTZG 1AFVH 4BZ2L 4EOWL 4OIBA 3I6GA 4X98A 3CLEL 5MERA 3TBVB 5GJTL 5IEHA 4LHJB 1BPVA 4OJFH 1D9KC 1G6RB 4HUNB 1XGPB 4QHKJ 2A6IB 4L1DA 5E9DB 3AC0A 1XFPA 4BUHA 4JDTH 3HUJA 3S98A 4N0FA 2EYSB 1YNKH 2RFXB 1RI8A 1TZHA 5I15H 4JZJB 1JPGA 4NZRH 1CTNA 2VLKB 3CFCH 4JFFD 1BIIB 1DLHB 3QIUC 5GGQH 4IJ3C 4OFDA 5MEOB 5LG1A 1RUKH 2JF1A 5ACZA 2ITDB 4UT9H 2EYSA 3VXRB 2RFXA 3HE6A 4HS6A 3WUWB 3D0LA 5C0AD 5DEFB 3QDMD 3UJIL 3WFDH 4LLYA 2LAAA 4ELKA 3RKPA 3MREB 5DEZA 1T5XA 1DLHA 3QHTC 3ZKXC 1WCQA 3V0WL 4PJ9A 1N3NA 4EN3C 4G9DB 5F6HJ 3RUGB 5IW1A 4NN6B 2IFFL 2YUWA 2VJXA 1T66D 4YDIH 4RAUB 5EUOB 4DKEL 5DYOA 3WUWA 3HI5L 1YYLH 2X4OB 5HHMB 1I8MA 1NBZB 3S4SB 5C9JB 4JRXE 3DIFA 3VXSE 1WTGT 2YXMA 3H7LA 5C08B 1M7DB 4EDWL 1JP5A 3NTCL 1WZLA 1CDBA 3T8XB 4TUOB 1DZBA 4PJXA 2BSRB 4PG2C 5HHOE 3O6LL 2PYEE 4U0RB 3L1OH 5E99H 3JV6A 4EN3D 2A77H 5DT1L 4M62H 1X5FA 1KCSL 2C4FT 1ORSB 1FLRH 2H1PH 1ZS8B 4PJGE 3RU8H 3F7QA 2IH1B 3MJ6A 1JNHA 1T1XA 4K3EH 4U1LA 2V17H 5LCVL 3F7VB 4X7SH 1MCIA 1ZV5A 3QFJA 1A9EA 1U2CA 3BH9A 1NPUA 4CKVX 3ULUC 2HKHL 1QO3B 2DQGH 3FFCE 2WWMC 4OBRA 2C5DC 1OGAA 2HFGH 2KH2B 5F96H 1AI1H 1S9VB 3U1SL 1C5CH 3LV3A 1HHIB 2VXQH 4JQXC 1CLYH 1YEEL 4GW1A 3CVIL 4I2XE 1ADQA 1YUHB 3QUXC 1W2KT 4U1HA 2XZQH 3NPSC 3TO4C 3H9SA 5CGYD 4YDJA 2Y07H 5TDNB 1AD9B 1GC1H 2NY7L 5T3ZD 2VQTA 3H3PL 1J88A 1P7QB 3E3QE 1S9VA 2EO9A 3WUZA 2KL6A 3CZFB 4LOUC 4YC2C 2I9LB 3GSVB 2ZOLB 5I74C 3TNNB 3O41B 4WEMB 4HCRL 1AQKL 4JG0L 4BQ6A 3GHEL 1U8QB 5TDNA 1N4XH 4BSVB 3WS3A 5GGUB 5B4MC 2AJSL 3C5SB 1ZHKB 4XBPA 2ARJB 1NLDL 1GPOH 3VH8G 3VD9A 2VISA 3QUXD 1E4JA 4J1UB 1XIWC 3QXDB 4ZOAA 4GW4A 3G6DL 2RR3A 1AGBB 3GZKA 1MFCL 3MGTA 1P4IH 1U8QA 4QRRA 2LVEA 1TNNA 4PJCF 5GGUA 5INCA 3NIDE 1A6ZA 1TZIA 2F58H 4LVHB 4Z7VB 5KVEH 2I9TB 1QSEA 1QFUL 1KB9K 1CDJA 1YMMB 3TEUA 3V0VA 1ZEAH 4Q58C 5IFHH 3SDDB 2L4OA 5E8NA 3F62A 1T7VA 4KDWA 1OB1A 3I6KB 2MWCA 3DLQR 5JPMA 4J1UA 1WAAE 3C60B 4MXQC 3IDMB 3ARED 1HCFX 1WQVT 1H8SA 2VH5H 5B4MD 1LEKB 1UKQA 5DO2C 1EEUA 4Y16C 2HLFD 4ZTOH 4UQ3B 1V3KA 1RHHB 1I3RB 1KG0B 4ZSOA 4N0UA 2QBWA 3V7MA 1LDPL 3RL1A 3QXUA 4Q9RH 1R3HB 5CWSB 4YFLF 1KLUB 4G9FA 1CG9B 5EIIA 4NFBA 1C5DA 4JM2C 2F5BL 3B6SB 2HRLA 5D5ME 1K9TA 4D3CL 2APXA 43C9A 5CEZD 4O00A 1MFEL 4UQ2B 1KG0A 3L3OA 4MCZB 5AYUH 4P99A 4YBLB 1TETL 2R23A 3QO1A 2XI9A 1CR9H 1UQSB 1CL7H 4MXQD 2NY1B 2VYRE 4LNRB 4PLJC 32C2B 2CLRA 4NOFA 5DD3L 3KPQA 3LSOB 3LHPL 3QHZH 4IIQA 2ZJSL 3QXWA 5DO2D 4D2NA 5FYKD 3T3PF 4DZBA 4F2MB 5KOMC 5ESQA 3NFNA 4AEEA 2OK0L 3WIIL 3BRFA 5IB1A 1IAOA 4X9GA 3L3DA 1QLFA 3EYSL 5I1GL 1FZJB 1Z6JT 4RSVA 1UQSA 1BJ1J 5C0DB 5IWLC 1Q38A 4LNRA 2WINA 4YO0A 4ZPVA 4FQLL 2D2OA 3K4ZA 1U42A 2XWTB 3V7AE 3D0VB 1QFHA 3KPRD 4UT6H 1QUNA 2A9NL 3U0WH 1XF1A 4PLJD 2E9WA 2QADB 5SWSB 2P5WE 4HFWB 4L8BB 3RWFB 3B43A 3FHQA 3HPJB 1RZFL 3JWOH 3NCCB 4N0YL 4ONFH 1CFQA 4JLRB 1XR9A 5DK0B 3DROB 4ODUA 1ZT1A 4IRSD 1T2XA 5J12C 1IGIH 3REWB 1FV1A 3N9GL 1ZGLP 1JK8B 4M6NH 2JELL 3BPOB 4JCLA 1HZHH 5F1OB 5ESVB 3RWFA 2EEDA 4NQUA 3RVXC 3LS4H 1NMBL 1KTDB 3QH3A 4JLRA 5LBSH 4OGXL 3FFDB 3REWA 4PJCA 3JWNC 3RWHB 1JK8A 3FHAA 1A6TA 2VWEE 3K8MA 2BVQA 3U48A 2DWEA 5DRZA 1W72L 3SKNB 4XMLL 3OZ9H 1C5BL 1MAKA 2V9RA 4XGZB 4JM4H 3MJ9L 4JFXA 1RZJC 5KSBE 1YNTA 3KGRA 3QEHB 2X1WL 4RGNC 3C5JB 4ZOBA 4OCWL 3K81A 4KI1A 3RVXD 1RVFH 2N4IA 3FMGH 3LDBB 3MV11 4XGZA 3RZCC 4P4RB 4H25A 2ED7A 4ELMB 2X4UB 3QUYC 1CGYA 3SHSA 3L7EB 1MUJA 3O6KH 4NQVA 5F1KC 5K93A 1SEQH 1RZIB 4XCCL 4UINH 2CMRL 3P4MA 2VQ1A 2VN4A 4YHNB 5I17B 2MPAL 5B39B 2IAMA 1ZGLM 4M7LH 3S96A 4HUWA 2AI0L 4KGLA 3MRIB 2ZUXA 1DSFL 1J8HD 2YUXA 3INUH 5I8OH 1F4YL 2X4SB 4PD4J 3VI4F 1XGRB 4MZ2A 5A2IH 3TJHD 1RZIA 3EOBB 3RZCD 1IRAY 4P3WA 3SE4A 2YPLB 1SY6H 4KTDL 3PWNA 4JFHD 5D2NC 3PIQB 5BO1L 4ETYA 3GO1H 4KTEH 2X4SA 1U8IB 3FO1B 1X6NA 1QFWH 4R97B 2YD7A 5SX4H 2FEEL 2CLZB 4Q74A 4U7KA 4KI5C 4U1GC 1IZJA 1T1WB 4LK4A 2XXCB 4MA8H 5MI0C 4PJGF 3DJ9A 4LP5A 3AS1A 1FGVL 1JPFA 5IJVA 1QVOB 1X4YA 1IGFL 1G7HA 1FBIL 3QEQB 3K4AA 4LVNC 4QRUB 4JGJA 3G6JE 3HZVB 3QQNA 3SDYH 3I3DA 3LB6C 2UUDH 3VFWB 2XQYK 2EC9U 4HCRA 3SQOL 1HQ4A 3SBWA 2P44B 3BP6B 4KAQL 3UJJL 1AO7A 5ESAA 3B9DA 2WLZA 5CUSL 1UH4A 2EH7H 4X4YB 4QRUA 4ZO9A 4OT1L 3W0WD 4KI5D 1AJ7H 4MA7H 3FT2A 5CJOH 5HHVL 4JGUA 1UYWL 4ZNEA 3OF6A 3VFWA 3E2HB 4YWGL 5C0CD 3CX5J 2OQJB 1LP9F 1S78C 1TVBA 4YIQA 1EEYB 1U8OB 3U4EA 3BWUC 3LB6D 2Q3ZA 1VGKB 3LKRB 3SGKA 1I7UB 4AQ1B 3MOBH 4K7PH 1FL3A 5DHVH 5GGVY 1TZGL 4I3GA 2XFXB 3P9MA 3HPLA 1RUQH 3P0YH 4JREC 4OD3L 4UTAL 2PUQT 1LMKA 1ODAA 1P7KB 2JJSA 4Z7NE 1ETZB 4HT1H 1HINL 2OJEA 2R2HA 4R4FL 3SDCD 4EEEA 4G8GA 5JO5A 4DOHE 1OGTA 4S2SA 3JVGC 4ZUVA 1S78D 3NIDF 5D7KD 3EO0A 3ESVF 2GTZA 2ZCLH 3ARDD 1HXMA 1PX4A 2R2EB 2VXUL 4LPYA 4QRSB 3TZVC 2RIKA 3QDGE 4HWEL 4HWNA 4J7RA 3W39B 4M8VA 5DQ9B 1IMHC 4LQFL 2DN7A 2W9EL 4OIIH 5KS9B 1G84A 4J3VA 5C2BL 5E2TH 6FABH 3GFUA 1H0DA 4JRXA 4DQOL 4W68A 5TE6H 3HZKB 1EJ6A 2FX7L 1KEMH 4NKDA 4KWUA 3NABH 1P84K 5DJAA 5I1LB 2V5MA 3L3GA 3GK8H 3V8CA 2HT4C 1TVHA 2R56H 1U3JA 1P4BH 5E6ID 5HHOA 1S7WB 2PYEA 2H6PA 1AGDA 3OKNB 1KFAH 2XQYG 3CLFH 5GZNC 4JN1H 1R3IH 3MV8B 1HIML 4N8CL 4PJGA 4IHOA 3VGAC 3VGEA 4LHUA 5ADPH 5KANG 5E8OB 1F90L 1XGQB 1A7NL 1MIMH 3GSRA 2P24A 4LPTA 2DQCH 4XC3H 5B21A 4F9PA 5J06A 4RX4D 1MCRA 4G6FD 5K9JH 4DGVL 1F6FB 3MO1B 1M71B 3F58H 1U91A 1M7XA 4YDLB 3JUYA 3EYUH 1ZGLB 1LP9B 1D6VH 3ZMRA 2HT4D 4F8TA 5E8OA 3NCYS 5IB4B 1RK0B 1EO7A 2WNGA 1J1OH 4WFFE 3DECA 2AJXH 1QRKA 2D4FA 4KJYB 2XA8H 1OOAA 2YA0A 5JZ7C 1L0QA 2X2YA 1R0AL 2IQAA 1PZ5A 2ZCHH 2VXVL 2AK4E 3GI9L 2MKLC 2V7NA 4UOJA 2WSKA 4PGDA 1A0QH 4NO2B 4PRHE 3OKOB 3QO0B 1W72A 5HHQB 3H8NA 5C0NC 1Z0NA 1XGYL 3MJ9A 4MNHB 2HJFA 4OKVB 3IXTA 3EO1B 4PJBF 2VZUA 4BH7B 5F7DB 4PJAE 4MQSB 4Y2DB 3X13B 3ULVL 1MF2H 1T6WA 1NC2A 2CR3A 4X9BA 5ICXA 4NZDA 4X5XA 1V7ML 4NO2A 5EN2A 5JZ7D 3OKDB 4J3OC 1FYTB 2GEEA 1BFVH 1EHLH 4MNHA 5TDPA 2CDFA 4KRPB 4IOFD 4BH7A 3LS5H 4NO3B 1KXVC 3BKYH 4Y2DA 1DJSA 5T3ZL 5JQ6H 4P5TA 4WNQA 3HE7A 2BC4A 3UYOD 3BZDA 3KPSB 3DTXA 1G1CA 4PS4H 1KULA 4WVRA 4FXKB 1CE1H 4GRMA 5CEZH 1G7QB 2HP4A 3R1GL 2JJTA 4KROC 3OHXB 3N85H 4BKLB 2PNDA 3JTSA 2V7HB 2FL5A 2HT3C 3UYPA 4NNPL 3NGBC 1LO0L 4GG8B 2CUMA 2NY4B 4PG9B 2C3XA 5FYKH 1WEJH 5F89B 1F58H 4Y4FB 2CUIA 3V6FA 2C26A 3O9WC 5E2WL 3T4YB 1OLZA 4MA1B 3NZHL 3OR6B 1KLFA 1B9ZA 4I3RL 4HAGA 3I3BA 2EKSA 4L8CB 4N9GA 4OLEA 3OKEA 1PY9A 2VR9A 1EMTL 2BXYA 2H32B 4MJID 3RWGB 2H41A 3BKMH 4OZ4A 4NIKB 1H3PL 4JO3H 5BZDB 4KROD 1CXIA 4L5FL 3VXUB 3MV7D 4NKIL 1JTPA 3BPCB 4ENED 2DWDB 3V6OC 4Y19B 5CAYB 1A7PH 2HT3D 4QOKB 3QNZB 25C8L 3VFGH 5EUKA 4WGVB 2YPVL 3TGXA 1TJHH 2VDLH 4ZS7L 2AVGA 3QUZC 4U6YA 1NCAH 1PGRB 4U1KA 5IEKA 3O9WD 5AWNL 4LBEA 5C07E 1GHFH 3GB7B 4LCIL 3VXUA 2DB8A 1HNGA 1IILE 3BIKB 3MQIA 4IOIB 1SJEB 3BP7B 3HMWL 2EH8H 4PJBB 4GUPA 3WXVL 3V4VH 5K9QG 3ILPB 4YXKH 1MAJA 4JO2L 4G7VH 2R0ZH 4K3DL 1H5BC 3RDTC 2YUVA 2AK1L 1YA5A 5CILL 3L9RA 1CLZH 4MXVE 4E42B 5HYJB 5D1QA 5BV7L 4XZUB 2FSEB 3BP7A 1MJ7H 2FB4H 4PJBA 1CYGA 3DSNA 3EFDL 2OSLA 3QUZD 3CFIC 5DFVC 3QNXA 2EDFA 1UJTA 4FZEL 4J4PD 4WO4A 3RUGE 2EZ0D 1BQHG 2ZG2A 5F1NB 2Z8RA 3GNML 5JR1H 2QQQA 5EUOE 4E42A 5BVPH 3BZFB 1KIPB 3ULVF 3I2CL 1HI6A 4LLDB 2DLFH 4KVCL 5D1XC 1U6AH 1A3RL 1VFBB 2O5XH 3T1FA 4KGJA 2QTEA 4JFFB 1DANT 4OUUB 5EWIH 4N0RA 2W0FA 3WLBA 2ARWA 5FCUL 1MCDA 1EGJL 1JMZA 5DFVD 4WW2F 3UYRL 4CVXB 1Z0MA 4JFEE 1A6PA 3B9KB 3GRWH 1OPGL 1AR1D 3U4AA 4L9LB 5C0AB 2X89D 3QDMB 1JF1B 4DN4L 1U8JB 5DHVB 2W65A 4PJIB 4Z95H 2VXSL 4AIZB 4FQXA 4OCMC 5D1XD 1AC6A 5L8KB 3OAUL 4JHBA 4QWWC 4P3DB 5D7SH 3B9KA 4NC1E 4NRYB 2XRAL 5E6ZA 3WE6B 4OGAC 1QBLL 4PB9L 2OP4H 1EO8H 3HG1D 5MEQA 3BKCL 3PE9A 3UCRA 4L4TE 3DX7A 3OJ2C 4OCLC 1U92A 1DBJH 3STLB 1CLCA 4NRYA 3ORJA 3JUZA 4KKAC 5IB5A 4GKZA 1J10A 4NZTL 4I5BB 2DLIA 4P2OC 1REIA 1BJ8A 4GAJL 4YBHA 4QWWD 4UIKH 1FO0L 3L95B 4LSTH 1MLBA 1BQLL 1VGEL 1ZLSH 1HE7A 1UKTA 4OCXL 3LN5A 4JFOB 3FOMB 3EYOA 4FG6D 3RWCA 2UWEF 4GKNB 1LO4L 3N0PB 3WN5A 1AD0A 4UIMA 3QRGH 5FYKU 1FNHA 3JTTA 1AQDB 4AEIL 2X7LB 4RMQA 1A2YA 2FATH 4I18A 1C16A 3ECBB 4UTBH 2PXYA 4YXLH 3KJ4B 3AM8C 4P2OD 5ILTH 1YMME 3V4UH 5IV2A 3EIFA 1TPXC 3MFGB 2VC2L 2P8MB 5E94B 1A6WH 1GGUA 4O2EB 1I9RH 5GSVA 3SE9L 1LHZA 3DYMA 1DUYA 1DL7H 1YMHA 1DCLA 4OQTL 5K33A 4Y7MA 3PF2A 3S35H 1FP5A 1HILB 4WWID 1I4FA 2P8MA 3CJJA 1F97A 2ENYA 3RNKA 5EU7E 3DGCR 1H9VA 1N0LA 1KLGB 3DMMD 5KVDL 4WW2A 2NXZC 3V9FA 4DKAA 3PWVA 4OLWH 5DQJA 1X5HA 3QUXB 3RKDC 4TULH 3KPLA 2UV3A 1IGCH 5HGHB 2W0PA 5IBTL 3BSZL 1KJ3L 4DJMA 2A9MH 3BUYB 5T1DL 1TJGL 1KENH 4YC2B 4H26A 1VKXA 1KXTB 4H5SA 5CP3H 1YC7A 5LJYH 1WITA 1F11B 1ZT7B 1NCBL 3QEUA 3AREB 3MPCA 3IFNL 2EDDA 2AW2A 2CDGA 2O93L 2NXZD 3R06A 3K8KA 4LPXA 3QDGA 5JHDE 2BVOA 4TSBH 1LEGB 3X3FH 4UB0H 5DD1L 4OZGF 2NXYD 5EORH 4JZOB 4WUKL 3RA7L 4GQ9H 5FYLL 5J13C 2FX9H 4MD4B 4MXWL 3VXOB 4M61A 3D39D 4F9LA 1CGXA 3W81A 4JVUA 4OGYL 4WU5B 3QI9D 4P9HC 5IW6B 4AIOA 1RPQA 3REVB 2LU7A 1H3GA 5H2BB 5I1IH 1F4XH 5JPNB 4YHZL 2UYLA 3C5ZD 1KCVL 3W11C 4LASH 1PQZA 4LLMA 3I50H 4G7YH 1IC1A 1OQXA 3V2AR 2PTTA 2V2XA 3ARWA 4KQ4L 2UWEA 4P48A 2K3TA 5MHSD 4XNXH 2KUTA 4PRIE 2KQNA 1GAFH 1MJUL 2F19L 3VFPB 2GTWA 4UUJA 4YDKH 5D93C 1ED3B 5CJXC 1A6VL 2ATPA 1Q1JL 4A6YL 2HG5A 3BUTA 5EZLA 3CFJB 5DDHB 3PWPD 5FDWA 2CKBH 3DARA 2X41A 5I8CB 3BGAA 3S97C 5FECB 3VFPA 3VH8B 1A1NA 5IROC 3V5DA 1ED3A 3UAJD 4LCCA 3L5HA 3W11D 3KPRB 1X3DA 3H42H 5IM7A 2BMKB 1G0YR 1K4CB 1YPZB 1I1AB 4KMTH 4TNVF 4CMHC 3DO7A 4NNYB 1JI1A 1NGXB 5BVJA 1B90A 3ARGC 2GJZB 2AK4A 4LLWB 4CGTA 3G6AB 5IF0A 4X99A 4IRSB 4XXDB 2VDQH 1UACL 4PRHA 4R0LB 3CC5A 4XCEB 4YPGA 2XZCL 3VXNB 4ODVL 3GBML 1YEIL 3Q5YA 4IS6B 4XNQA 3CFEA 1RZ8B 3P4OB 3MV9D 5TFSH 1MCPH 1IBGH 1P2CB 1EGJA 1ACYH 1CQKA 4N68A 4PV8B 5J11C 1LO5A 1GZPB 4B53A 4JPWL 1OAXH 1SYVB 1JZ4A 3RWDB 1S7UA 1NBYB 2DQDH 5K9OA 4HSQA 2DOCA 5C0RL 5HYQA 3RBSA 4NO5A 4OZGB 3U79A 3ARGD 3OKKA 1VACB 3ZL4H 5J12B 5IHUH 5MENE 1C1EH 2OTUB 4LFHG 3V52H 3WIFB 4GXUM 1GOGA 1IC4H 3A6BH 4RFNC 3D18A 1GZPA 2O5ZH 3P30L 4F3FA 3PJSB 3KXFA 3MROB 3PDGA 4OZGA 1BFSA 5KG9A 2EE3A 3AROA 4BK5A 4YEFA 4L3ED 4PJHB 2N1KA 4RAVA 4AZ8A 2WUCL 4L8DA 2VDMH 1KELH 1KYOK 3RX5A 4HJ0D 1L6XA 3ABZA 3WJJA 3QXAA 4Z76A 3GSNL 1N5YL 4OM1L 2YMXH 1CGVA 1E6JL 3O6FD 4LSVH 3SY0A 3BW9B 4QCIB 3FRUA 3FRPA 4HGKC 1S8DB 3KPMA 4DKFL 1INQA 3NFPB 4CRPA 5ITFA 1FO0A 4M7JH 1J8HB 1PG7H 2FD6H 1JFQH 2FECI 1UZ8B 3FQXB 5EZIL 2NMSA 2FLRT 3RZCB 4I9WD 5IBLC 1EHNA 1NEZG 1S7SB 4P57B 2EIZA 5E0QA 1JWMA 1NUDA 1KPVA 4KV5E 2A73A 4EI5B 5GGRY 1IKFL 4LSRH 4M6OL 1A6UH 1QKZL 1GYAA 2XACC 4QRTB 5TPWL 4OZFA 1CWVA 2A0LC 1QHPA 3NZ8B 4HDIB 4MHHG 3VGDA 2V5TA 2QHRH 4RIRA 1Z5LB 1T0MB 2Y5TA 4P57A 3LEVL 1A4JB 1N0XH 1BWMA 2CO6B 4WCYH 1VA9A 4PV9A 4ONHA 4UV4L 5I75C 3T77B 5AYQA 5D9SA 3W9DB 4EI5A 2YZ8A 3BT2L 4KRLB 5CFHA 4H20H 1Q9OA 3ETBF 4WV1B 4I48A 4LFHD 4U05A 4OQTA 5H94B 2CQVA 5IGXL 3GMRA 1FGNL 2XKNB 1DVFC 1MVUA 5EC1B 2BSSB 5LXGH 4NN5C 4FTVA 5F7WC 1J0KA 3WLWD 3ZDXF 3EFFB 2WV3A 4POZC 4U1GB 1BX2A 4U6VL 1CXHA 4X5WA 5C0CB 3CAFA 1S7TA 2ADJB 3QJHB 1ZSDA 1SMOA 3O2DH 3TT1L 1UJ3A 2CK0L 2XY2A 3FONA 2I60H 1Q0YH 5C3LD 1ZTXH 1V7NH 2D7TH 3O3EB 2F15A 1KUMA 4NP4L 1GGCL 1KCRL 1LVEA 1R3JB 3TA3A 4CJ0A 1DVFD 2MJWA 1YEHH 3QJHA 2AKRA 4K2UH 4MA3B 1BZ7A 1JHLH 5I30H 3DXAE 3RVWC 1TTUA 2IADA 4POZD 1J5OL 4N90D 4JFEA 1T83A 3LIZL 2F9BT 4QY8A 3TPUB 3KPPA 1JRHL 3P11H 1O7VA 2YKLL 1VPOH 4M7ZB 3SDCB 3THMH 3MBEA 3E6HB 2AXFA 5DGQA 4YK4C 4NRZA 3WYRA 1Q9LB 1JZ7A 3MUJA 1HH6B 4NO0D 3TJEL 2I5YL 1B0GA 1DQQB 3H9HA 5F88B 2YD8A 1YYLL 1K8DB 3ARDB 3ZYZA 3O3BA 4XP5H 1N6UA 3HC4H 5E5MA 1T80A 5ALBL 1OAZH 2H9GA 1FFNB 3DRTA 2VL4A 3OJDB 4M93B 1Q9LA 2DDQH 3EGSB 1XF2B 2YD5A 1L0YA 2VLRE 3MYJB 2EYTB 1DQQA 2WQRA 1YNLH 4YE4H 5GZOD 2A6JA 4ONGL 5E99L 1J86A 4DK6A 3ARSA 4FP8L 5IOPB 1FL6A 4A6YA 2XTJE 4HKZB 5E6IB 4PB0H 1LEIA 2ICWB 3RU8L 4HMCA 43CAA 4F7EB 1WZ1L 4RGMC 1NGYA 4ZODA 4HK0B 3O2VH 2V17L 5L7XL 3CXHJ 4KKCD 5F1SA 2APWA 5JQHC 5DJDA 5IOPA 4JJHA 2DQGL 2HFFA 2KKQA 4PGEB 2VLLA 1I8LC 4G6FB 4GG6E 4G6MH 5ELIA 4YH6A 4GXVL 4YHMH 3FCTB 1FNGA 1NCCH 2DQTL 4R6UA 1BM3L 4ZDHB 2QQLL 1BD2D 2YEZB 3X12A 3S37X 1ES0B 5KSVA 1YEJH 3QCTL 1DN2A 2JTDA 1BHGA 1EBPA 4TSAH 2ADIA 2X4NB 4PGEA 5DMIL 3H0TB 1LK3L 4XVSL 1MJJA 1BVKB 4M6MH 4D9QE 5I8KH 1F45A 5DJ8B 1J8KA 1FH5H 4K7FB 5C1MB 1FYHB 4W4NA 3CGTA 3T2QA 4PGCA 5I1KH 1LK2B 4XBEH 1U58B 1IGYB 1P9MC 1G7LB 5EOTB 1G9NC 1OTTC 1JVKA 1N4XL 5F71A 2BFVL 2X4NA 2ADGB 3ALXA 5ICYB 3OB8A 3OBAA 4OLVL 2VLJE 4K9EC 5GRWA 1OM3L 5C0FA 1NC4D 2PF6A 3HRPA 4Q7DA 3GMQB 5MP6L 3T09A 3LKSA 5H35B 4NJ9H 4FA8A 4Y5XC 4XP1H 4FMKA 1FVDB 2ADGA 3LOWA 2AQ3A 2DKMA 1NH6A 9CGTA 5HY9B 2D7NA 1T21A 3VA6A 2CIIB 2VR4A 1K4DB 3STZB 2XPGA 1RSFA 4ZAKB 4TPRH 3TPKA 1BQUA 2VH5L 2CLVA 2A6KA 3DUSB 4LVOC 1T3FA 4Y19E 3WD5H 3CVHH 4OF0A 4CW1B 4Q2ZA 4UILH 4HJJL 2JE8A 3UJTH 2PYFA 3QEGH 4C55A 3BVNB 4GO6B 1F2XK 4JO1H 4H88H 5KAQF 3GSNA 5CJQH 5C70A 3N50A 4D0DB 3BQUD 3VFUA 4ZAKA 1LD9B 3LKQA 5JHDA 3EJZC 4TUJB 3IU3A 4R90L 5FEBA 3V5KA 3C08L 2GITA 2IWGA 1SBSL 3LZFH 2A74B 1MPAL 3WNOA 4JDZA 3I85A 5A2JH 2DI9A 4FQCH 3ZT6A 3DWTA 1L4IA 2OR9L 3QHZL 3HZYB 3U82B 5HYJE 3BGMA 3HRZB 3GI8L 5HYSG 2X4TA 4MJIB 5DRNB 2FCBA 5JIKA 3U6RA 3ZYJA 4GW5B 4P9HH 1Q0XH 4PRIA 4R7DA 1VFUA 1HYSC 1IQDB 3MV7B 1HHKB 3MYZA 4JKKA 1XCQA 1JL8A 4S1QL 5DWUH 4NQDE 2B0SH 3RWEA 1DE4B 5BRZA 4YAQB 3QAZC 5GS1C 3AS2A 3LD8C 4IRJC 4ZD3H 1BECA 1I8KA 3K3QA 1JZ5A 3TIEA 5I66A 2C1OB 3GUTB 1K85A 2OL3L 4Z0XB 5EO1A 3T65B 2EDWA 5IW3A 3TVMA 2DBLL 3JWOL 3RIAF 4RMRA 1ZHLA 2NNAB 4YHKH 3C6SB 2MCPL 1HDMB 4YAQA 4I0PD 1IGIL 3CK0L 3PNWA 2Q8BH 1HYSD 4HC1L 3O2WL 1IFHL 3BEWA 3LQZB 2V5YA 3PHOA 4MNQD 2HT2C 2C1OA 3GUTA 1HZHL 5BS0B 5C0AE 3U30C 3MODL 3QDME 1DQLH 4PJ8C 4U7SA 3LS4L 1INDH 5LBSL 4OCNC 4IRJD 2JIXA 2CSPA 3P73B 3O0RL 3LQZA 4G3YL 5ISZE 3QG6A 5C8JA 5I1DB 3OG4B 2GFBB 3WFEH 4NHUB 2OLDA 3BDBA 4PY8J 1N6QL 5LVEA 5C0BB 4NDMB 4QRPB 1TCRB 2HT2D 4Y5VA 1YEDA 2W38A 4R4BB 1PX3A 5MENA 4XPBL 3WXWL 2ZPKL 1MCOH 1QFOA 2G5BB 3D2UD 3ZKSD 1UT9A 2Q7YB 1G9ML 2F54B 1MCLA 4K8RL 1M7IA 1T4KB 4IMKA 5JIPA 4QRPA 4FFYH 3O6KL 5JXAL 1PZUB 3WFZA 3BHBA 3T08A 3VFSA 2SEBB 5D1XB 3SE8L 1WJ3A 3S3JA 1C12A 2XZAH 5DFWH 1WK0A 2HVKA 4QTHB 2YBRA 3WS6A 3L3IB 5I71C 3QRFM 1ZHBA 4X9HA 2DQJL 1N2RB 3P9LB 1QRNA 2DLHA 1CFNA 3VCLB 3GMOB 4Z8FL 5E56A 1PKQB 5E95B 5F7EL 1NFKA 2FIRT 5IQ9A 3VWKA 3HC3H 1NLBL 3GJFA 5AUMA 4PRPA 4UNVA 3MJ7B 1HH9A 3EJYD 3CUPB 3HG1B 2BXZA 4JANA 4C56D 1NGZA 4X80L 4LKCB 2GW5A 5EU5A 3GO1L 4ZO7A 1IARB 4HQQH 4BYHA 4XPGH 2A1WL 4LCYB 1B0WA 1B4RA 1EDQA 3ULUE 4X4ME 3TLRA 1PLGH 1HKLH 2R1XB 4LMQE 2AABH 4OZHE 1BQHB 3QQ4B 5FOBB 4MA8L 1CK0H 4LAQH 3V5HA 4RRPA 5DVKA 1RJYA 2IAND 1BF2A 3WDJA 3MLXH 4MS8D 3A6OA 5IG7A 4JN2B 1LO2H 3VA2C 3L5JA 2GI7A 1IE5A 2QSCH 1Q72L 3AY4A 1KCKA 3KVQA 4DVBA 4GG6F 4JAMA 4JFYB 1QQDA 5IFJB 4Y4KC 3B2UC 1JZ8A 5DJ2A 4LLQB 4XB8A 4R4NC 3EUUA 4LGRB 3HC0A 1D5IH 5F72S 2UVFA 5IMLB 4GMTH 5F97E 4N8PA 3E8UL 5ANMB 4YHLL 5I1HH 4WY7L 4U33A 2AXGA 4XMKL 2B4CC 4Y1AB 2IG2H 2Z91B 4M43L 3CXDL 1MEXH 5CINH 5CLTA 4MQ7B 1CICC 5GSRA 1ORQA 1OAQL 5IVOA 2YPKA 3DETC 3PQYE 4MNGA 2Q1EA 1KN2L 4P2YA 5D7JC 4BQCA 1JZ6A 5ANMA 3BP5A 3DMMB 4R7NB 5FGRA 3U36B 2OTPA 3P0YL 4Y1AA 4RMSA 5CEZE 3FQNB 4WI6A 1IAII 4MQ7A 1A7RL 4A2LA 1CT8B 3DXAA 3F12B 3R8QA 2QV2A 5H37G 2ICWJ 5M7QA 2NY5L 3A6CH 3C6LD 4NSKB 5FYKE 1XF5B 2C4FU 2LV4A 1MFAH 4JFPB 1GVIA 3RAJH 3S34H 5GJSH 3GMPB 2ZCLL 3BPLB 4C57C 4NWUH 5DJ0A 1WIPA 3DETD 2G5RA 5D7JD 4XVUC 3O4LD 3F12A 2ED9A 5KSAA 5FUZL 2NXZB 3S9DB 3LKNA 1IC5L 3EDKA 3UP1A 2DJUA 5CJ5A 5E2TL 6FABL 1KJVB 2EXYC 5TE6L 3GSWB 1QEWB 1KEML 3MRNA 2NXYB 1MSPA 1JZ2A 2AEQH 3KPRE 4FQIL 2R2BB 1R5VB 4HKJA 4EKXA 1M05B 1M6OB 2VLRA 1N64L 2R56L 3FB6B 3D39B 2OL3B 2QKIA 3AVEA 3QI9B 2ERJB 2G2RA 2QJDA 4KK6C 3JWDL 5IHZA 3BDYL 5I2IA 1FORH 4LCWE 4O5LL 3DSFH 5FHAH 4JN1L 4M3JA 1N59A 1R3IL 2FZ3B 3NIGE 3C8DA 1PSKL 3OL2A 3GSWA 5DMKB 3C5ZB 4KMLB 3B5GA 3FB5A 2XWBA 3O81A 4XVUD 5BW7A 3EHBC 3SCMA 2YOCA 1M05A 1TTGA 2HFEB 1WZKA 2DQCL 2DF3A 1BWWA 2J8OA 4JDVB 4G43A 2CXGA 4QTIL 5F6HI 4JJ5A 2X4PA 4OCSH 4YFEA 4X6CE 3NCEB 4GG6A 3MFFA 3S88H 5J3HC 1G7JB 4HC1A 2HYMA 4UDTA 4K71B 3ULUL 1DQML 4URTB 5F1IA 4M9OA 5ENWA 3VWJA 5DHYA 2XA8L 4JFZL 2HLAA 4WIQA 1HHJB 4B5EA 5KVGL 3UTPD 4AMKL 5T1MA 4WW1B 1HXYB 5C0EA 1XGTB 3PHSA 3I02A 4JO4L 3VFOA 3EOAB 3VE0A 3G5VA 4PJEE 1H15B 3T0BA 3D85D 5D1ZC 1XH3A 3T3MF 3MX0A 4J23A 3H7BB 4NGHL 1AE6H 1I1YB 2FJFB 2HFTA 5J3HD 5ID1B 1JBJA 2VLJA 3SDAA 2AJYH 4JGMA 1AGEA 4IDJH 1AH1A 2WW8A 1G9NH 4MAYB 3UPCA 3QZWA 3MV9B 1Y18B 3FQRB 3EJJX 1NL0H 1MY5A 2OZ4L 1AHWC 3KPNA 3C8KA 1FDLL 1CIUA 4MAUH 3QP3A 3IJSB 1A21A 5H8DA 3CH1A 4RGNE 1QG3A 4B50A 2JJVA 1UM5H 2GUOA 4CMHB 5T1LD 5A2LH 3VXQB 2RQ8A 4HS3A 4JHAH 3ARGB 3RQ3A 3QULB 5B38B 1FVEB 3IDXH 4Y0GA 4EQ3A 1WF5A 1RUAH 3G5YB 1JGLH 4JFHE 4HIJA 2XG4A 3OJVC 4U1MA 5LAXB 5JORA 1OAKL 2FX8L 4LRNH 1MI5A 1T7WA 3DGGA 4PJ5D 4BSWA 3DYOA 3OKLA 4APQC 5B38A 2Y06L 4P59H 4L3EB 4XWOC 3LRGA 5FKPB 1S9WB 1SY6A 3G5YA 4EUPG 5GRJH 2GHWB 2Y7QA 3T2OA 1S7VA 4KKNA 3KYMB 5DXWA 3S37L 4Y4HA 2P5ED 1TQBC 1YEGH 1GZQB 4PD4K 3O6FB 4X7TA 5BQ7B 3BKML 5DVNA 2YRLA 4YHOL 3MLWH 1JNLL 1P84J 3OX8B 5D2NE 1UM6H 3IU4H 3SPVA 4QGTA 3UDWA 2PETA 3RIFF 4OV5A 1A7PL 1UXWB 3N1QC 3T2NL 3GSQA 1GJIA 5T3XD 4APQD 3W0WE 4KI5E 4TRPL 4ZFOL 1CDCA 3UBXG 1TJHL 4W4OA 4XWOD 5C7XH 4QLRA 5DZNA 5BQ7A 2BNRB 4NQDA 1NFDE 1CVSC 1Q9WB 3BD4A 3S36H 1CU4L 1MRFH 4PRAB 3FT3A 5DMGC 1Y0LA 3AMLA 2EH8L 4L8SC 4U2YA 4YXKL 1UKSA 1ZOXA 3ULUF 5HGBB 5BJTB 3ZDYF 2BNRA 4FQJL 4WUUE 3WKNA 5MEPB 4F15C 1QBMH 5JXED 5CHNA 1OCWH 1G7IA 2ZG1A 2J5LB 3BWAA 2D0HA 2DD8L 4G6JH 1D9KA 2FGWH 1NGQH 1A14H 5EPMB 2F53D 5L2KD 4TUKL 2X4QB 5DMGD 5MEPA 1HSAA 4OQ1A 4RZCA 3IF1A 4X6EA 2DYPD 4XCNB 2VAAA 3T0EB 3RTQD 1QR4A 4EI6A 5EA0H 2DLFL 2RCSH 5I75B 5ISZA 3SQBA 1QNZL 3QIUA 2VSCA 4XPTL 3QDHA 1Z9SA 5HGAB 2AJVH 5E2UH 3ZLQC 5CGTA 1ZMYA 3MTRA 3QWRA 5F7NC 2CRMA 3T0EA 5D70L 1P6FA 3JV4B 4WEUD 3RVTD 1FPTL 2VDKH 1NSNH 2WP3T 4JHZA 2FHCA 3GRWL 1R3KB 4P4KC 1RZJL 2WIIA 2FO4B 1HQRA 1SEBA 1KPUA 5DUML 2C7UA 2IALB 4Z95L 4WFGD 1U8NB 3KS0J 1OWRM 2CK2A 4OTXL 5ADOL 8FABA 1J1XH 3JV4A 5J0BA 1YYML 2W60A 5SV4A 3F5WB 4D0BB 5DC0A 4BQ8A 1INEL 1R3KA 4ZUWB 2WBJB 1DQJA 3WKMH 1T1YB 4WTWA 3KYNB 4TVPL 2IALA 3F6LA 2CDEA 4HXAH 3NACH 5FYJL 4F37F 1VADA 3PL6C 3QUML 4P2QD 4UT7L 2DQEH 1WZMA 4JM2F 4PG2A 4JE4B 4P4KD 4LSPL 4HK3N 4ZXBC 1YECL 2WBJA 3M17A 1T22A 4ZO8A 1T1YA 3KLAA 4YNYB 3BMVA 3ARBB 3CCHB 2IBZY 2VDOL 1G7MA 3H3KA 5FA3B 2BZDA 5EFIA 3NFSL 5ID0B 3WUWG 1JHKL 4I13B 2NW2A 1FZMB 1RUPH 3MA9H 4P2RE 3VXMB 4X4MA 1PW3A 3HCVB 3UTZB 3DV6B 4OZHA 3E6FB 4H0HB 3U4BH 1EJOH 1JJUA 3NIGF 1FFQA 1XF3A 3VG0H 1S7QB 4GRWF 1BVZA 3MLSH 3MRMB 1KNOB 2XQBH 4JQXA 5ID0A 3OV6A 3MJGX 1JIBA 3AXLA 5D7IF 1A4KB 4ZXBD 1JN6B 1YY9C 4HX1A 4G6KH 3D9AL 8CGTA 2Q86A 1NANI 3TO4A 5FCSH 3VXMA 3WDHA 4PIRF 2E27H 1YC8A 1ZVHA 2ORBH 4XC1H 1BD2B 4ZFFA 3OKYA 5BZWA 4X6CF 2VO5A 1MCQA 3DPBA 3GBNH 4GRLA 1S7QA 4RQQA 1I9IH 4JZJC 4S1DD 4ORZC 5J6HA 1I9RL 2CJUH 5K9KA 5L2JB 2E6JA 3NH7H 2G9HB 1JN6A 4LQ1A 2CRZA 2NY3B 5CEXA 1AXIB 1BOYA 1DL7L 2H26B 2OZ4A 4OCYL 3RY6C 2WLYA 3GSOB 3MA7B 3BEVA 3M1BB 2J12B 4KJPD 4PJEF 1XF4B 2YUZA 1EIBA 3ARVA 4KHTH 2G9HA 1XIWA 4PTUA 1IM9B 3FO9A 5DJYA 4PR5A 1RJLB 3GIVB 3PQYA 5IJKC 1PJ9A 5GGTL 3VFNB 1JGDA 5GRUL 3O8XA 5J9PB 2H26A 1NC4B 4HH9A 4NN6C 4X4ZA 3HFML 3MA7A 1DLFH 4FQQA 4ZUSB 1IQWH 4PLNC 4ODTL 3M1BA 4PRNB 3MRCA 2O5YH 2HKFL 4PJ9D 3ZDZF 4LCUA 1IM9A 1TTFA 1RJLA 1NDMB 3GIVA 1VENA 4DAGL 2QR0A 4XX1G 1FAIH 3L5WB 4NM8H 3CDFA 2RGSA 3CSYA 4Y16A 3BAEL 5EO0A 1KJ2L 4BELD 1VFMA 3EOTL 3IDJB 4Y5YB 4KXZH 3BJLA 5EDXA 4PRNA 5E00B 4U0RC 1RK1B 4P5MB 3VGGA 2H2PC 1CLOH 4JM2A 1B6UA 1RZKC 3X3FL 5DK2B 1FRGH 1IVLA 4BFBD 3BQUB 5E8PB 4YDVA 3T0WA 3WL9A 4Y5XB 2YR3A 3SKMA 2HH0H 5IQ7H 4XWGL 2NY2D 1QA9A 4L3CA 4GRWB 4Z7QE 3MRGB 5E00A 2GCYB 1BBJB 3GSXA 1C08B 1E27B 5D7IB 4XMPL 4ZFOA 5F9OL 2HJLA 2FWOA 1X5IA 4KHXL 4OI7A 1F6LL 1FNSH 4LCWA 4F33B 4LVOB 3V6OE 3MBXH 3WIHH 3QFJD 4K3JH 4NZJA 1GAFL 2OJZH 4UNTA 3FQTA 4YDKL 4CAGA 4IRZL 5D7IA 1OGAD 2H45A 2BCKB 4YGVA 3V4PL 2CKBL 3GKWH 4X6CA 5H37H 1X5YA 4M8QB 3PGCB 1X4XA 3X14A 5JDJA 3H9SD 1GIGH 4HIHB 5TE7L 2FEDC 2MCG1 2D9CA 4PJFE 3BZ4A 5CBAA 4BA8A 3PWLB 1NFDF 1KPRA 4X7FC 4MB4A 3MJ8B 35C8H 3OAZK 3LAFA 2DL2A 3S3PA 5DRWA 4Z78B 3PV7A 1FNLA 3CSGA 1TMCB 5GGRB 3LH2L 3OQ3B 4M7KL 4R26L 4I0PB 3RX8A 5BOPA 1P4LA 4BUGA 2VDQL 4PJEA 3U9PH 5EOCH 2DTMH 1KJMA 4PUBH 1EA9C 4MNQB 3KYOA 4DGYL 1EFQA 4LVHC 3ZKNC 2BVPB 3GM0A 2FEDD 4WHTB 1UB5A 3VRIB 3C60C 4QRRD 3IRZA 3NOIA 4LLUA 4EDXA 4XAWL 2DLEA 4GSDL 1QSED 4AEHH 3GRWA 1YQVH 4HJGB 2E8ZA 1WBXA 1V3LA 1IT9L 1DBKL 2GYSA 2FRGP 3ZL4L 1IM3A 1KGCE 2BVPA 1MCFA 2BSED 3V52L 3STBA 3MRHA 3HG1E 5EBWB 5J6GB 2FR4A 2B7DT 3A6BL 3QUMB 4RCAA 5DUBA 3CU1A 4PGJA 3ZKND 1R24A 2AXJA 4HUVB 1QYGH 3GMMA 3FO0H 5HYSB 4G6AC 3QUYA 4G9FD 4BFIB 4PP1C 3WEXA 2X70A 1R3LB 3QUKA 5HI4C 3Q2CA 1MWAB 1UA6H 2NY1C 1AGFB 4Z77B 5LGJA 3QUMA 2DJ4A 2J2ZA 4Q97A 2UVEA 3MRQB 1HNFA 3ROOB 3QG7H 1CFSA 4HUVA 4OF8A 1AXTH 4HMDA 3FAWA 2IBZX 4MWFB 5C0GB 4NOBA 2ICEB 3TO2B 1FG2B 1SYSB 3DURA 2EKJA 5DGRA 4OB5H 3WO4C 4HWUA 3SGDI 5F3HB 3LEYH 1K5NA 2CGRH 3ARUA 4PP1D 5EU6E 3DVGB 1T1ZA 5HI4D 5C6TL 5D2NA 2QADC 3A67H 4X7CC 1MCBA 1BBDH 4HGMA 4ODWA 3RWIB 1MQKH 2VZTA 3BH8B 3CX2A 3LQAH 4LSRL 5TQ2H 2VIRA 3MXWL 3SOBH 1FCCA 5DHXB 3WFCH 2RAMA 1NFDA 3VFMA 2OM5A 1NGPL 2V6HA 1ONQB 3BPOC 4S0SD 4EVNB 2EDOA 5DEGA 1RU9H 3OXRB 5I16A 1QR1B 4MDJB 1LE9B 2FHFA 3B2VL 2DL9A 5KJRH 1EEZB 1NCWH 1NAKH 2VE6B 1S9YA 5JDSA 4KC3B 2VITA 5FGSA 2IANB 4WUUA 2Q6WA 1OP3K 4Q9QH 2IPKB 5IT2H 1AKJB 1KEGL 4NQTA 4P9MH 5F7HA 1U3HA 1QR1A 4TSCL 1HEZB 3U2SA 2HAZA 5I0ZA 1J12A 3B9AA 1EEZA 3KHOA 3MRLB 4EUPH 3VD4A 1YDPB 2B2XL 5GGTA 4UNUA 5IHLB 4F57L 2FIKB 1W0WA 3I75B 3AAZB 3LKPB 4D8PA 1AKJA 3QA3A 2AJ3B 2R15A 2Y1VA 3BP4B 3NAAH 3LDBC 1MHEA 5CIPH 5TGBB 2I60L 2IAMC 4Z7OF 1ZTXL 1Q94B 2VTFA 1YDPA 3MNZB 5T1KA 2D7TL 2BK8A 5CP3A 3ZHKA 3VD7A 4JKPH 3GSUA 1NAML 2JB5H 4J8RA 3SE3A 1KJ2A 2AV1B 3MNVA 3D39E 4Z7WF 5AZEH 2WM0A 4NQXB 4X8JB 5TGBA 4BQ9A 1VFAB 3HI6L 5I1JL 5DMJB 3UO1L 4XI5D 3MNZA 4P2CG 1WCBB 4IMLA 2NTFB 2COQA 1VPOL 4HV8B 4OI9A 4XVTL 3UTSB 3OB0K 5B22A 1T03L 3VI3E 1FVCA 3W2DH 5CSBA 1U8PB 4WFHE 5DRXB 3C6LB 4W6WB 3BZEB 3TZVA 2IAMD 3RVVD 1UWEH 2HN7B 3UTQB 5JHLH 4ZQKA 1VFAA 4FNLL 3U9UA 3HB3D 1S9XA 3G04B 4KZEL 3IJYB 5D7JB 3CMGA 3O4LB 3UTSA 5LGHH 4OIAA 3PWPE 5HYIA 4PJ7F 4L4VE 1OAYL 1V8HA 4LU5H 1A7BA 2F8XC 4R97C 3G5XB 1F4WL 4QF1B 4PREA 1IL1B 3ARPA 1WTLA 1RIHL 2C3WA 3F7YB 3HI1B 4N5EC 3SBWC 3X3GL 4E9LA 5IMMB 4LIQH 1KBGH 2AJUH 1BVLB 1F6AB 2X1OA 1MHHA 2ZOKA 3HLAA 3NBNA 4FFVC 1OLLA 2CKBA 3O2VL 5DJ6A 2YPLD 3ROLB 5FF6B 2R0KH 1MLCB 1XGUB 4QF1A 4ZFZB 4O2CB 4CDGC 1UXSA 3LRSA 4P2RA 4XVJL 3S7GA 1MJ8L 3VFTB 4XCFL 3CFBB 4M02A 3D69B 4ZS6C 2IEPA 2PO6B 4FHBD 1DUZB 5DD5L 3MV9E 1CE6B 4N5ED 3TIDB 1MLCA 3E2HC 5DLML 5CEYB 2V2TA 3GMNA 1AO7D 2QHLA 1FIEA 1YEJL 2Y5EA 5L88H 3U0PA 1EZVY 4TSAL 2DKUA 4YHPA 1OSZB 1AGCB 3ARFA 4UU9B 4M6ML 4I0KA 2CR6A 2PO6A 1G6RH 4E41B 3PGFL 4LHUG 3OF6D 2V2WB 1JHTB 1CE6A 1E4KC 5D2LB 2UZYB 3WV0A 1RUML 4XBEL 3MLTA 4HG4J