3BT2L

Structure of urokinase receptor, urokinase and vitronectin complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
211
structure length
211
Chain Sequence
DIVLTQSPDITAASLGQKVTITCSASSSVSYMHWYQQKSGTSPKPWIFEISKLASGVPARFSGSGSGTSYSLTISSMEAEDAAIYYCQQWNYPFTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title Crystal structures of two human vitronectin, urokinase and urokinase receptor complexes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 50
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2007-12-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bt2L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bt2L01
1CS6A 1I8IB 1DBMH 2ITDA 3PWNA 4RGNB 4WDIB 1XGPA 3BP4B 3TFKD 2EDNA 4YX2H 5CFHA 4G3YL 2OK0H 1DSFL 2G75B 1IC7H 4JY4B 3BGMB 3UTTE 3GBML 1IEAB 5F9JA 1JPTH 2M1KA 1DN2A 1JVKA 1P4LB 1II4E 4CUCA 3CCHB 1T3FB 3PWVB 4X6BB 4XXDB 4I0PA 4YDIH 3MUGA 5JORB 1U95A 1CDYA 3AAZB 3IFPB 5D1XD 3UTSE 4WW1A 4H26A 3PL6B 4TOYL 4G5ZL 3QDGA 2W65A 3GHEL 3LKSA 5D2NE 1BFOA 3L3DA 2AK4B 2P5WB 3MV9A 3QDME 3CZFB 1EFXB 5ENWA 3OPZH 5IKCA 4I2XA 4MJID 1T5WA 3TBTB 5BZDB 3RZWA 2G60L 4WRLA 4S0TD 4HIIA 2ITCB 4L3EA 3PWUA 3U1SH 1KB5H 1YEGL 1JBJA 1CXEA 4MDIA 4L4VD 4JO2L 3GSRB 4UNUA 2O5YL 3ZT5A 2YMXL 1QQDA 4XXCA 4Q6IB 4TTDC 4YDVB 1BFSA 1FVDA 3CLFL 2JELH 3QHZH 1G7JB 3O11B 4XGZB 2DIBA 4R7DA 1MWAH 3F7YB 2OI9C 3GKWH 2X4QB 3RBGA 1N4XL 4GRLC 4RFEB 4CL7A 5GS3A 4HX1A 1CXHA 3UC0H 2CO7B 2V2XB 3FJTA 4HUVA 5GIRA 4GG8B 5EORH 2DI8A 5E5MA 4D0DB 5F71A 1UWXK 5E4IA 1GSMA 4JRYE 4KK8D 3CK0H 5KSBE 1IE5A 1NAMH 1F3DJ 2P8MB 4X6DA 1QA9B 1ZA6B 4QXTB 3DTXB 3KPLA 3QUMB 2OYPA 3VFGH 1RURH 1VSCA 4J6RH 3MPCA 1RJYA 1RULL 4GMSL 4L9DA 5I71C 1JCKA 4FFVC 4HJ0C 4XCEA 5DFTA 1ZLUK 3TFKC 2XIDA 2D7MA 5HDQL 3ABZA 4RGOH 1W2KT 4ENEC 3KS0H 2YD2A 1MAKA 3CX5K 1WUNT 2HFEA 4P2OD 4C83A 5FOJA 1B6DA 1DQJB 3MRGB 1ZSDA 5DUPH 4JKPL 5FYLH 3MCLH 5A3ID 4K9EH 5JDJA 1JP5A 5FEBA 3WE6B 4GW1A 3EDDA 2DYPA 2ESVE 5F7DA 3W5NA 4OLYL 4QYOB 1FSKC 3MGOA 5C0EB 3CFJB 4HZLA 2X4TB 3BKML 4P4RA 4JPVH 4PJBE 1DQMH 1U8NB 5DF0A 5F44A 2IPKB 4G8EB 3RL2B 2CKBA 4OQTH 3I6KA 1UB6B 3N1FC 5GGRA 4JVPA 4JHBA 3DXAE 1X6NA 1U8HB 3DVFA 1VEMA 1F8TL 1A47A 2N1KA 1F4WH 2YWYA 3B9KB 3NPZB 1LE5B 5HHNB 1L0XA 2I25N 1I3GH 1OAKH 2NW2B 2APXA 2J6EH 3GRWH 4ZO6A 3G5ZA 3MQIA 4U1MB 5KAQG 2ZG1A 1NDMA 3G5YA 3MC0A 2L7UA 1KIPB 3D0VB 7FABL 2IH3B 2EDYA 5DUBA 5HVHB 2GJ6E 2HFTA 1CN4A 1DUYA 2LV4A 2VDKH 1CE6A 2CRZA 2HFFB 4WFGE 3GSOA 3OKYA 1I7ZA 3VJ6A 1T1WB 3NCBB 1J12A 1R5WB 3O8XD 3GDBA 1F4YH 5JMRA 4JY6A 5D71H 4KK8C 4Q74A 3GSNA 5HVFB 5C0JB 5CBEB 4LCUA 4HG4J 3B5GA 1WVZA 5DJ8B 3ULVH 4MA1B 3QJFA 4HPYH 3ARGA 1NGYA 2UWEF 4QOKE 2FIKA 1P84K 5CWSB 3A6CH 4LCWE 3ARTA 5DRNA 1CFVH 4G9DA 4G8IB 1VFBB 3OHXB 5CP7B 2BRQA 3QR2A 4GLRH 4NUGH 3MA9H 3V0AC 3REVB 4GW4A 4H25A 5IV2B 3QEGH 1QFWH 4PLOB 1WCQA 1S7QA 2DQHH 1PQZB 4KKNA 4AIZB 1B6UA 3DWTA 4P2OC 5J56B 1GZQB 3W82A 3B6SA 1NKOA 1CT8B 5DD1L 5A3IC 2BOCA 2ZCHH 4NJAH 5B39B 1MLBA 2GAZA 4AT6A 1X9QA 3EYSL 4BH7A 4OF3A 3KLAA 4LSTL 4KUZL 3KXFD 2W59A 1WCBA 2OTUB 4OB5L 2ZNXA 3GB7B 4Y19E 4NKMB 4Y8AA 4FQQB 1S7XB 3S3PA 1CD1A 4F80A 3MV8A 2X09A 1WTGT 1BVZA 3NCJL 2VDLL 3UBXI 5JLZA 4OCSH 3F58L 1F5WA 3ARFA 3G6DL 1JPFB 3FOMB 2BC4A 5DO2C 4GLRI 3QRGL 4HAFA 5EPMA 1C5BL 5HHQA 3C60D 3MCG1 1OB1A 3MRBA 2J7LA 5L9DH 1WQVT 4BK5A 1W0WA 3DV6A 4RMRA 5K33A 3ZYOA 3TIEA 2Q1EA 4M00A 4HIEA 4C56B 2VNCA 5KSAD 3K4AA 4XNXL 3M1BA 5CIPB 3UPAA 4YE4H 5I1CL 3OG6B 1RUKH 3UYOD 5A2KH 4EDXA 5J12B 2DQUL 3RL1A 3HZKA 2XICA 2R2CA 4ODTL 5DZOA 3MO1A 3WO4B 2X5PA 2PKDA 4X5LA 4KQ4L 4R8WL 1A22B 3BXNB 3EYVB 4PUBL 3ARDB 5MEND 4M9OA 2FX7L 2R8SH 2O61A 4MNQD 2FB4L 2Y7QA 4LLUB 4OD3H 4NSKB 4PGDA 2DQTH 3MZTA 3DX7A 1FBIL 1S7VB 3T4YA 5KS9A 3Q2CA 2X7LB 5E1AB 3KDMA 3FB6B 1AC6A 3C5SB 4JDZA 1U92B 4OTXH 1VPOL 1HXMB 4ZFOB 4HF5H 3UEZA 1BD2D 1UACL 5HYQB 1ED3A 1WIOA 1S7SB 1ADQA 2X4RA 4NNYB 5C6WH 5F7EL 4PY7B 5HYIA 5C9KA 1KPUA 1MJJB 4IRJB 4Y1AD 4PG2C 4KKCD 1FIGH 4OZGE 5C08E 3SGKA 1SBSL 1KXQE 3KPMA 3ZDXE 3NZHL 3DV4B 1QNZH 5EO9A 3VFWB 1X4YA 1AO7D 5GHWL 1U93A 2VDNL 3HCVA 5EWIL 4PRHE 4Z7UA 1IM9A 3U46B 3TWCH 4OIIL 1FL5A 4R96A 5AUMB 5L2KE 2YR3A 4E41D 4PPTA 4JJHA 4YPGA 2Y07L 4G80B 5KSAC 3NFPA 4WVRA 3HA0A 4NN5B 3H0TA 2DQJL 4X7SH 1Z5LA 3JTTB 1YN6A 1A9EB 3MRHB 1XIWC 4NKOA 1LK3H 2VXSH 4TSCH 5E4EC 3VE0B 5DC9B 2MPAH 3ZO0A 1MFEL 3DHJA 2CH8A 2QTEA 1GZPB 4Q2ZA 1J87A 1YY8A 1BM3L 3P0YH 1HOCA 1MCSA 2X42A 1MRDH 1CICB 5E7BA 1JWMB 3RAJL 4KQ3L 4PIRF 3SJVA 1T0NB 4UI2A 3GGWB 4XPBL 4K3JH 4XNQB 4JFZH 1EJOH 3UAJD 1HKLH 2HRLA 2FX8L 1MFCL 1I3RB 3LN4B 4P9HC 4ZNCD 2QKIB 3QDJE 1QLRA 4AEHH 5TDPA 4J4PA 5TF0A 4XP1H 4YFDB 4LASL 3VXRD 1OLLA 5I8EB 3MV01 5F8RC 2B4CH 4NQSB 4P2QD 4LSQH 5ECJE 3UTPD 2ZSVA 4UT6H 5FYKD 4WNQA 2VLJD 2NLJA 1GAFH 2HJKB 1BFVL 2NY4D 4TPRH 4KVCH 4XBEL 2K1MA 4FNLH 1YY9D 4WFFE 5FUCE 4E5XB 4XHJD 3MBXH 3ZHDA 4JM4L 3UO1L 3OGCA 4UOW0 3RVTC 1WAAF 1JTOA 1VEPA 1T21A 2F74A 1JPSL 4G9FD 1QKZH 3H9SE 1HH6A 1ZVSA 1I1AA 1JFQH 3MLWH 5IVXA 1MI5E 3BQUB 3HAEG 4PJAF 4NQDE 4LRIA 2BVYA 5D2LA 3SO3B 5J9PA 3BSZH 4RQQA 1BECA 4I3SL 5IMLA 2Z92A 4NBZB 5C0IA 2DLFH 1FZOA 4CBPA 3UJTH 3UTSB 4FTVD 2GITA 3IAGC 2A9NH 3MLUL 2WANA 5A16B 3CFCL 4GO6B 3WLBA 1R24A 4M93B 5FM4A 2PXYB 5JDSA 2ATKA 3MUJA 3WUZA 2ZWLT 3BP6B 5E8DL 1CFTB 4JFDB 3MRFB 1T5XB 1F4AA 1CG9B 3LEXB 1WITA 2BFVH 4XBPA 1M7IA 3GKZA 3MLSL 5IIEB 1IMHC 3ARRA 1MUJB 2E8YA 5ICYB 3WJJC 1DZBA 3RY6C 1AQKH 2W9LA 3I6LD 2F53A 4PJ9D 1YECL 4RGMC 1TTUA 4F58H 1HQ4B 4X8JA 1Z3GH 2NY1C 4WWID 1JNJA 5DQJA 2VR9A 1GC1L 2Y06H 4P3CL 4S0SD 5EOQL 5ITBH 4GRMB 4TUJA 4APQD 3DYOA 1U58A 3PP3H 4C55A 5D7IF 3S4SG 4UTAL 3ULVF 3P0GB 1KIQA 5C07E 1K9TA 2D0HA 1QPXA 1U42A 2B1AL 4YNYB 4JFFB 1Q1JH 4JFXB 4OF7A 1NCUA 4RBPH 2YUXA 3SQBA 4GKSB 1F6AB 2JB6A 5H35A 1G7LA 5I1AB 1N0XH 4MXQD 3T0EC 3QFDB 3HR6A 3WMSA 4HT1L 3U83A 3MUY1 4HS8L 1A7OH 3ECBA 4U6YA 4WI5A 5MI0B 3QUXB 2IPTH 4HDIB 1WBXA 3S88H 3FB5B 5DK0B 5HHXH 4NC2B 4W68A 2MKLC 4P5TC 1RZIB 1D5MA 1M05B 4LCCC 4XWGL 4P5KB 2VL5B 3VFOA 1NCWH 1MIEL 2Q76A 2VR5A 4ONGL 1IGFH 4KRNA 5CJOL 5T3ZL 3P40A 1X5GA 1VERA 4OFDA 3T1FB 4V2BA 4F33A 5HYJA 4YXKL 4X99B 5F6HJ 3WSQL 5ACZB 2IC2A 4ODXB 5I1LB 1DE4B 3LKPB 4WO4D 1J7VR 3KJ4B 5IG7B 4U6VL 3ZDYF 2EDJA 5IMKA 1JE6A 5I1GL 1D9KB 3HE6A 4PY8J 4S1QL 3D0LA 4KK5C 2HKHL 5KW9L 3FN9A 4Z7VB 1R3IL 5DSCA 2D03H 5TQ2H 3OR6A 2BSRB 4OGYL 3WCYA 1KXVC 1UM6H 3C5ZD 3FAXA 3IKCB 3VI4F 4ZODA 3WN5B 4BFIB 3MBEA 5C0AE 3OB0K 4XC3H 5F7YC 3DROB 4ZUVA 1ADQH 2PYED 3UTTA 1BF2A 1YJDH 1NSNL 2X4UA 4FFYL 5E6ID 5SWZB 4L3CA 4NM4H 5FHBH 5SX5H 4PRDB 4R90L 1MQ8A 1S7WA 4OD2A 4UIKL 2LTQB 1HZHL 4LOUD 4Y8DC 2FD6H 3QHTC 1FV1B 3A6BL 4NDMA 3BO8B 3LEYH 1QZ1A 1AXSA 4HH9A 2CK0H 4K07A 4NKDB 3VFMB 1FFNB 3WUWB 2NXYC 3S36X 4DVRH 1DP0A 2ATPA 3FQTA 4ZS7H 4LVNC 5EOTB 4J1UB 3GBLA 4FMKA 4E0RB 3P77A 5D2NA 3QDMA 3RI5F 3W0WD 2VUYA 2UV3A 4FQCH 5GS1A 4QHNA 4JFED 3QNZB 1DLFH 3A6OA 2NXZB 4XPHL 4MXQC 3SE4C 2AJ3B 2CJUL 5EU7E 2FO4B 1FL3B 3QUKB 4NO0A 4KUCD 3GEWB 5DTFB 4NQEE 1FG9C 1QTYT 1OAUL 1IQWH 3AMLA 4IIQB 1EGJA 4LSRL 4LLYB 1OLZA 4WWKC 2Q3ZA 4V1DD 5BS0D 1AI1H 4OZIE 1P9MC 1JK8A 3F12B 3C6SA 3NACL 3VXSE 1QSVA 2IH1A 1HK6A 2FCBA 4QWWD 3NIDE 4D8PA 1T7WA 1OGTB 3TJEL 1NGPL 3QUML 2XKUA 2OXHA 1JRHL 4XZUA 1U8KA 1IJ9A 3MV7D 2O5XL 3L1OL 2FECI 2EDWA 3I6GB 3DUUA 4AL8H 4DN3L 2QSCL 3V4UL 2V9QA 2RFXA 4M3KB 4JRYA 4L1DA 4YUEH 2ADJB 4X6DF 3RGVD 5D1ZB 3S34L 5KSBA 5KVEL 3DECA 1OAYL 1PX3A 5GGQL 4G7YH 5HGAB 4MJ6B 3X3FH 5F1KC 4H0HB 4ODHH 4G8GE 5IJVA 5F89B 5GJSL 2Q87A 5I0DA 5AG8A 3HC4H 5F1IA 1FC2D 3VXNB 5IESH 3C5ZC 2J2ZA 1RK0B 5FYJH 4KHXL 4RAVA 2ZNWA 1NMBL 4Y16B 3LD8B 4KJPC 3GBNL 1CL7H 3HC3H 3M17B 3U7YL 1NEUA 5D6CA 5J57B 5CBAB 3RWCA 4XP6H 3OSKA 5GS2H 4Q0XH 4K7PH 3CXHJ 1SVCP 32C2A 3IETA 4HHAB 4XCYB 6FABL 3TN0B 2ESVA 3LEVH 2BOBB 2QADC 4X4XA 4PV9B 4FXKB 4PJBA 3NBNA 2BSTA 1BPVA 3D85D 4QT5B 3DXAA 4DKFL 2Y5EA 3RX7A 3R1GH 1CK0L 2AJYL 4TVPD 1KIRB 2BVEA 1S8DB 4L8SC 3IGAA 5DD0L 3VRLF 3IS1X 3LHPH 1OP5K 4M6OL 3BUYA 5MEPB 2EZ0C 3VI3F 3PV6A 4R4ND 4Z78A 3LN5B 4M5YL 2EIZA 5J06A 2JLLA 2VZVA 2FWOA 1CU4H 3U36B 2IADA 3RWEB 1IGTA 2HT2C 3EFFB 2GJ6A 5D9SA 1MH5B 2YOCA 1CL7I 5C70A 1MEXL 4P46B 1EVTC 2N4IA 3NFNB 5CINL 3W2DH 2B0SH 4FZ8H 5D7LD 5C0BD 5SV4A 1ZS8A 3HN3A 5CLTA 5H8DA 4LBEA 2E7LC 1CF8L 1G9NC 2V5RA 2R4RH 3D2UB 3U7AA 4EVNA 4WCYH 4H8WL 5F1NB 1U8MA 1MAML 3VFNB 2GK0B 5I1JH 2HKFL 4LSSL 3RVUD 3RGVC 4DZ8A 5TE7H 2EH7H 5C08B 3PG2A 1IT9H 4JVUA 2AERT 4QOKA 3KPPB 4LCWA 3K1DA 4KH2A 4ISVA 4M4PA 2WSKA 3E8UL 3ARZA 2I9TB 5EUOE 1FLTX 4FQIL 4B5EA 4P23D 5KZCD 4PP2A 1YEDA 4GXUM 5KAQF 4ODWA 2VZUA 5EC2B 4I18B 2QQLH 2ZJSH 3CVHA 3UBXB 3EO0B 2XN9D 2D0FA 1KTDA 1NL0L 4QY8A 1CE1H 5DRZB 2B5IB 4ZOEA 3KLSA 1BOYA 4LHUD 5IF0A 5AWNL 1Z6JT 3BPOC 3HLAB 1BREA 1KB9K 1HIML 1AGFB 3CU1A 1YN7B 4KRPB 4LLWA 1E28A 2AABL 3HUJE 1OAXL 4Y19A 4LSPH 5T5FH 4OLZL 4ZDHB 2AJSL 3ARED 1LNUB 5GGRY 4H1LG 5GRVL 1CGSL 3QJHA 3U6RB 4IMLA 1F58L 1BJMA 1B2WL 3PNWB 1E0OB 4HIJA 1A6ZB 4N1HB 2BJML 4FQLH 1Q94A 3GSUA 3MLTB 4R4NC 1FO0A 4LLVA 2FGWH 4JDTL 4WI6A 2OR9H 2PW1A 3RJQB 43CAA 2EKJA 1RZJH 3B9EA 5JO5A 5E8NB 3P9LB 1A3QA 2G5BA 1JGLL 4XPAH 3V5KA 3BAEL 1MCWM 4HPOL 4XCNB 3BWAB 2FX9L 4NYLA 4A2LA 3HTLX 2YK1L 4M62L 2C3XA 2Q7YA 4JZJC 1U8LB 4O2FB 4Q9RL 2GTWB 2VTFA 4IM8A 1P6AB 4QHLA 3OR7A 4YR6B 3K8LA 3OZ9H 4EKXA 2AEWA 4L29B 3RVXC 5GS0H 2BCKB 3L5WB 1T22B 2CXGA 1GPOL 4UTBH 5SWQB 2NW3A 1HDMA 3IDIB 2WV3A 1T20A 1QEWA 4LCIH 1MI5B 2P5EB 3SDYH 1I7RB 4UT7H 2KPNA 2F19L 4MJIE 3U0TA 5GZOD 5AZEL 1FJ1B 5GSRA 3FB7B 1FGNL 2YWZA 2ADIB 2X40A 5IB5A 4P23C 1OHQA 4ZFOL 4ZUUA 5KS9F 4AG4H 1A3LH 2GFBA 3OKKB 4OM1L 5GQBA 4L4VE 1XH3A 5I73B 1N6QL 1L6ZA 1EZVX 3ARQA 4EZMA 4R26H 4F37K 3TEUA 4LARH 3GUTA 5JIPA 2PYFA 1Q0YL 4ZXBC 5MHSD 1ZHKA 2IBBA 4ELMB 4P57A 3DURA 1JUFB 1EGJH 2IAMD 5LBSH 5F96L 5JTWA 4OBSA 4TNWF 1P1ZB 4ZNEE 3B5TA 5TJWK 2DTML 4MJ4A 5I1HL 4HIXH 5HY9B 3UJIH 2EEBA 5F9DC 3MROA 4M4RA 5GISH 3SY0A 4JM2B 5ADPL 1SMAA 1AXTH 1FAIL 1LO4H 1N2RA 3MSPA 1TZIA 1R3LB 3GSXB 2YD4A 3NFSL 4JLRA 2FZ3A 5EU6D 4NO5A 3IDMB 4OZGA 1NUFA 2DF3A 4DAGL 1R0AH 3SQOH 5CJ8A 1A7NH 4HKZA 2APFA 5T3XL 2MJWA 4YAQA 2DL2A 1XT5A 4OCMC 1OF2B 1B0GB 1FVDB 2DIAA 4S1DD 5DD6A 5AEAA 3BEVB 4MAYC 3RDTA 4PRHA 3MJ8B 4Y5VB 2W38A 1J5OH 3VFVA 2BNQD 4L4TB 4WV1A 2NTSP 3L5JA 5L2KA 3WS3B 2DJSA 3TBVB 1AD9A 4NCDA 4LK4A 5HHOD 2XPGA 2EYTB 3JV6B 3WFZA 1ERNA 2I5YH 3BKJL 1HKFA 2C1OA 1IZKA 3L5IA 5TGBA 2HWZL 5L88L 3VWKB 4CW1B 2VITA 4PB0L 5IHZB 2YD1A 3C87A 1FVEB 1MCBA 3HI1A 4U0QB 1NGWB 3D9AL 3O6MH 2VLLB 5GRJH 4YDKL 3S6CA 3SBWA 3O6FC 1X5YA 3FFCD 5CEZL 3O4LD 5IW6B 1T66D 5IFHH 1PKQB 1E6OL 1H9VA 5DQDH 4UILH 4ZO7A 3STZA 5F9WB 3VRJB 3Q0HA 4LMQE 2R0WL 5C71A 3L6FA 3LRHA 5HHMD 3D69B 4KDVA 2JIXD 3F5WA 3SE3A 4HKXB 4L8DB 5CILL 3MRNB 3QDJA 5BCAA 4CVXB 3WIFA 1RHHA 3ZTNL 4U7KA 4NZTH 5C3LD 2IQ9L 3L9RA 2IAMC 1BZ7B 5IVZA 5DJCB 3TVMA 1OAQH 4L8BA 5DRWA 3WXVH 4J8RB 4DKDC 5AYQA 4P3DA 1IGYA 4JQIH 1TJGH 2R1XB 4I48B 4JQXA 1HXYA 4MA7L 1Y18B 3H9SA 1H3WM 1VFAB 1JGUL 1GGIL 1ND0A 4KTDL 1F90L 5D2LF 5IB2A 5LXGH 2X05A 4NQDA 1I9JH 3IDXH 5D4QA 4F57H 4DGYH 2FBOJ 1N64H 4NHCL 4KPHL 4EBQH 4XC1L 4S1DC 3ZYJA 4CVWA 1CDCA 1MJ7H 3GMNB 3LKNB 4YWGH 1QLEH 2R2EB 3I50L 4LSVL 1B4JL 4JHWH 2NY2C 3QUZC 3V6BR 3FFDA 2DWEB 3IDNA 3WLWD 4P59L 3ESVF 3T3ME 1QFOA 1KXTB 4NZUH 4YC2B 5CSZA 5KOVC 3WIIH 2H1PL 3LRGA 4NNXB 1U8JA 3G5VA 4O2CB 1OP9A 3SE9H 3CVHH 2OTWA 5DRXB 3TO4C 4LFHG 3PJSB 3MNWB 4I3RH 1A7RH 2PO6A 3KGRA 5E2UL 4ESKA 3H9YA 3KXFE 3SDDD 1RAMA 4KJYB 3S7GA 5B3JE 3FKUS 4KJWC 1JYWA 4BFBD 2RCSH 4OFIA 3ZT6A 5DHYB 2ZCKL 5LGHL 4F9LC 3P9MB 4P4KB 3GMQB 3QIBA 2CDGB 3L5XL 1T66C 5TQ0H 1PKOA 1YEFL 2VDOL 2IMNA 5HHVL 5ICXA 3WFEL 2GJZA 3BW9B 1JF5A 3VXOA 1RIHL 3OKMA 4ZOBA 2R29H 4WI4A 2EDDA 2V9RA 1S7UB 4QRQA 2Z35A 4FMFA 5C07A 1SJEA 3D39D 3QISA 4Z95L 3GI9L 4KROD 1RUMH 3EYFA 3PWJA 5F7UA 1JNHA 3QA3B 3RZCC 2JJSC 3TZVB 2Q7NA 1FNSL 5INCA 1W72L 1FO0H 1HI6A 5E2JA 4IOFD 3SCMB 3EW3B 4PJHB 4R3SA 1KLFA 3O2DL 3QNYA 4XPGL 2AV7B 5DMGC 2P8PB 2YEZA 5IMMB 5DK2B 2WLZA 4OUOA 4RAUA 4DCQB 1MHPH 3W81A 2Q6WB 4PJ8B 3MACL 3L3JB 3D18B 3HE7D 1MNUL 1S7TA 3MOAL 3ILPB 1ZANL 1ZHLB 1EK3A 2XZCL 1C08A 4LEXH 2ZOKA 2XFXB 5K9JH 3QULB 4YQXL 1KCRH 4K7PY 5MENE 3QI9A 3EOBA 4MNQE 2B1HL 2VH5H 4D9LL 3SOBL 4NC1C 4RMTA 2JK5B 1N5AB 3UPCA 5AD0A 2AEQH 5J6GA 3OB8A 2C3VA 3GI8H 1ZEAL 1DCLA 3E3QE 4LVOC 3G6JA 1YEIH 2LFGA 2X4SB 3P2TA 2CLVA 1QBMH 4AK1A 3JUYA 3UYRL 1KLUB 4MD0B 2FSEB 5T5NG 3KJ6L 4GW5B 2JB5H 1CR9L 2ZCLH 3BEWB 4OAWA 3V95A 1JHTA 1GVIA 3U4EB 5BRZA 2KBGA 3EHBD 5C0AA 5HJ3B 1W0YT 3ESUF 2X1OA 4Y1AE 4ELKB 3FL7A 3QUYA 2ICWJ 4YX2L 3T4YB 1UH2A 3GM8A 4XMPH 2V9TA 5CJQH 3RY5A 1DTUA 4XP9H 1AP2A 4K94H 2VXQH 3OAYH 3DUSA 3O9WA 2HVJA 3RWIB 4BKLB 3V0WH 2XWTB 4BYHA 4PYGA 2EDEA 3RI5K 1MCOL 3IJYA 3WS6C 1RD6A 4QXGL 4PREB 3IJHB 1UYWL 1T89A 4FQHA 5B8CC 5JHDD 1FZKB 4PJEE 4RA0C 4IOFC 4E41E 1WEJH 1U3ZA 4XMLH 4R6UA 2VIRA 4S1RL 1HWGB 2NTFA 3PHOA 4JANB 1OGAD 5I8OH 5EZJB 5C9JA 3R0NA 2DM2A 3CH1A 4NQEA 4TSAL 1YEHL 3PDOA 2AV1A 2UYLB 2VWEE 3LS4H 2Y72A 4QRSA 1KN2L 2VQ1A 1PW3A 2BMKB 4OZIA 3LH2H 3VXSA 1C7SA 3JVGA 4WGWB 2OI9B 3BPNC 1A7PL 3ULSB 4LIQE 2HJFA 5DWUL 2HFGH 3PWPD 4GRLB 3WYRA 3F7PC 2BVTA 2PTVA 2JELL 3IU4H 4JO3H 3BDXA 3OXSA 1BQUA 3VXRE 1Q9WA 2W92A 4P2QE 2AJUL 5FYKE 1J18A 4G42A 1K8IA 2VLJE 5MP6L 4RCAA 4JB9H 3D6GA 4RISH 4G8GA 4HCRL 4U1HB 3MRQA 4U3CA 3OX8A 2P49B 1S9XA 4EOWH 1UXWA 4MAUH 3ZT7A 3GMOA 3FQNB 2DMBA 3MFFB 3P11H 2Q8BL 3QG7H 4R97B 5I71B 4KKLD 4O2EA 1NDGB 1J0IA 4UQ3A 1ZGLA 5HI4D 1IGCL 1F2QA 3FQWA 4G9FE 5D93C 1SYSB 1LWRA 4KI5E 3TBSA 5DMJB 4CMMB 1JHLH 2VDRH 4J7RA 1RVFL 2NY3D 1RZ8A 5DQ9B 4QTIL 2GK2A 4YHNA 1FSKB 1FCCA 4ZFZB 2C1PA 4HXBL 4JZOA 4PJBF 5IHUH 3OF6A 4MMZC 2H26A 5CGTA 2VC2L 4FTVE 2GW5A 4NFDA 1A3RH 1ZKAA 2X4PB 1E4KC 1LK2A 4UV7L 1AE6H 1P6FA 4HS3A 4XX1E 5F6IC 1BOGB 2I9LB 2DQEH 1D5XB 3DMMD 2V5YA 5JOPD 1MCIA 3VFUB 5LQBH 1CLYL 5ANMB 5E0QA 4RMQA 5H2BB 3ULUC 1CYGA 4GFTB 5GPRA 1TETH 4UT9H 4JN1L 2VISB 5FYJU 3I6LE 4WJ5A 4M03A 1UJ3A 1XF2A 1VACA 1Q9KB 4Q9QH 4HMEA 2G2RA 3ZKMD 5DD5H 3TC9A 1BP3B 3RGHA 3TH2T 4FFZH 4DZBB 3NCFB 3MJ6A 5JQ6L 1L0QA 3GM0A 2HT4C 4AYFA 2P1YA 5KTEL 3MOBH 3G6AB 1J1XH 1H5BA 3QXDB 5DJDB 3ETBF 2ADFH 1UXSB 2GUOA 2V17L 3AVEA 4PJXE 4D9QD 3ROLB 5D71L 3LV3A 2XNAB 2HJLA 2LE9A 1I9RL 3B8SA 4I0KA 2HRPH 4ZFFB 1M71A 3I75B 1BX2A 4X8JB 5EUOA 5I9QC 4FQJL 1A6TB 3IRZA 3VFPA 1CFVL 3IFOB 4A6YA 3C5JB 1ZT1B 3HAEB 5AZ2L 3PWLA 3PL6D 4P2OB 2C4FT 3GSVB 3CDYA 5FECB 2AK4D 4RNRA 1T7YA 4TQEH 1EFXD 3MR9B 4YDJB 5F7MC 2NY3C 1G7IB 1MELA 1FG2B 1BBJA 2D9CA 4M48H 4UQ2A 3AU1A 4HWUA 1S5IL 4PJGB 4WTZA 1VA9A 3QXAA 4NQCA 1MIML 4FN0A 1T1YA 1ORQB 2CIKB 4OF8A 3QPXL 4YHKH 3WHXB 3HUJA 1QUNA 1TQCC 2ZUVA 2R4SH 3TNMB 4LCYA 5HD8D 1JF6A 1RJZA 3TNNB 3KYNA 4L1HA 5GJTL 4OJFH 1E4WL 4KKBC 4F9PA 3DMMC 1F3RB 4GXUN 1WISA 1MCQA 5F70A 1CFQA 5IB4A 3WIHL 2YPLB 4K71C 2EEAA 2XKNB 1AKJB 4F7TB 1TJHL 4ODUB 4PJCB 4ZPVB 3TCLA 4XNUH 5J1AA 3S4SB 1G6RB 4MD5A 2FL5B 2R69H 4GAYB 3IJSB 1FZMA 1HYSD 4I77L 2K3TA 3LOWA 3RX5A 2Y5TB 3BP7A 4OSUH 1EAPA 3J8F7 3WV0A 1IRAY 4PRBB 4UV4L 1OM3H 2H6PB 4LU5H 5D1XA 1U0QA 3THML 3MX0A 2QQKL 4EDWL 5JNYA 5LWYL 2HTKD 1GRWA 1FH5H 1JGDB 1ZGLP 3I3DA 3W0WE 2YD9A 1FHGA 3MODH 5GGUA 4HAGA 3KWWB 5JXED 4MJIA 3GJFB 3VXUB 1EO8H 5FGCB 3FT3A 3CX5J 5EO0B 1Y0LB 2ERJC 4HMDA 4OD1L 3KPOA 4I4WB 2BSSB 5K9QG 3EO9L 35C8H 2PTTA 3X11A 2Z93B 4RFOL 3QCVL 3OL2A 4L4VA 3CFDA 3AS3A 1ULVA 4ACPA 1XGTA 1HQRA 4MCZB 4HBCH 4N5ED 5BS0E 4NJ9H 3HZVA 4N8VB 3ISWA 5I74C 3QCTH 1BEYH 4K3HA 1RZ7L 1FN4B 1A6UH 2XYCA 3LKRB 5DS8B 5JUEH 1N59B 1I75A 1MFAH 3B9KD 3OAZH 3EDJA 5EBMB 2X9XA 1N7MH 4ZNEA 3KXFB 1BQLL 4PD4K 2BY2A 3CLEH 4DOHB 3MV7E 3AROA 1MF2H 8FABB 5IFAL 4O9HH 4FQPA 1U3HD 1YNKH 4LVEA 2OP4L 2EDHA 4HJGA 3VXME 1G7HB 3CMOL 4UBDD 1JHKL 3QWOB 3PGFL 3WDJA 5FUZL 3T2PA 5HI5D 2VSDA 4U1SB 3T77B 5FA4B 1HILB 1JK8B 2YA0A 1F3JA 4ZAKA 4NKQB 2A0LD 3DRTA 4HUNB 3OV6A 1H15A 4ORGB 2QEJA 2CRIA 5TPWH 3SKJL 2YSSA 3FMGH 4GQ9H 4XVUC 2XZZA 5KSAB 1OQOA 1ZT7A 2EDKA 3VA6A 3JWDL 2A77H 3U7WH 5IROA 2ED7A 1NGZB 3GMMA 1P84J 5FK9B 1MCKA 1XIWB 5FGBA 2P8LB 3CXDL 2YN3A 4OLUL 3QWRD 4ONHB 5E4EB 1VADB 1A6AB 4LF3A 2HTKC 1SEQL 3ELAT 1KT2B 2F15A 5ILTH 5FDYA 5JW4Q 2D4FA 5GGSB 4ORZC 3SDCA 5JXEC 3FRUB 3ILQD 4PLNC 4AEIH 1A4JB 1MCPL 4O51A 1EO5A 3C6LC 5F3BB 5A2FA 43C9A 2CKBL 4ZUSB 4OCWH 3BX7C 4PJ7B 2X4OB 2B2XL 4HKJB 2Z31C 4JFZL 5DHVA 3T2NL 1EJOL 4U4BA 5HGDA 1LP9B 4N5EC 3VWJA 2D2OA 1A7QL 4JJ5A 4Z77B 4Z76A 1BD2B 4QHMA 1CXKA 1OTTC 2CO6B 5CZVL 5FHAH 2B4CL 2IANB 3MRDA 1JZ3A 2CR3A 4LLDB 1I1YA 4XAWH 1KENL 3PABA 3PE9A 3VH8G 3O8XA 2E27H 2X6MA 4QHUA 5FOBB 5IR1A 5JQHC 1SM3H 4MXWH 2EDQA 3HPLA 1P53A 1U3HC 3E1F1 1CXFA 5I30L 2H9GB 2NY5L 3OBAA 1LD9B 1QRNB 4UBDC 5E2VH 4WW2A 3S5LG 4PJIB 4XNZC 1EEUA 1H8SA 3KLHD 4Z9KB 2EIZB 4C56D 1CZ8L 2WP3O 2R0ZL 2GSIB 3L3IA 1AO7B 4Z5RB 4ZQKA 3BD4A 3GSNL 1XF4A 1IAIH 1ZHBB 3IF1B 4XVSL 2XN9E 4NRZB 4A6YH 2VZ3A 1EO7A 4I9WD 4MNHB 1JI2A 4ELMF 3ARBD 1FZJA 4U6HB 3SKOB 4Y4HC 3EZ8A 3IS0X 2EIEA 4NM8L 5I1DA 5DJAB 5CEYB 1GGCL 1YDPA 5EU3A 1CDJA 4JGJA 5J1SC 5IEHA 3ZE0F 4Y2DD 3C2AH 5JW5B 3MRPA 4JM2F 3ET9F 4IRZH 3O41B 4Z0BL 3MLXL 4RGMB 2ZPKL 2NY1B 1NUNB 5D1QC 1K85A 5ESAA 2DQIH 1EEYA 1DDHA 4IDJH 4JFQA 3E0GA 3Q3GB 2HAZA 4F58L 1KNOB 2GHWB 1KTRL 1INQB 5GRZA 1CFNB 4JG0H 2DOCA 3GIVA 4MXVE 4OZHB 4BSWB 3AS1A 1HHIB 1NCBH 3BN9C 2R2BA 5ALBH 5F1SA 4PTTB 4IRJD 2A74A 3C60A 4HWEL 4LKCA 4MS8C 2A6DA 1IAII 1CLZL 3UTQB 3K8MA 4PB9H 3N85H 1RZFL 3T0BA 3T0EB 4N0UB 1EUUA 3CSYA 3EOTH 4KJQD 1YEEH 2SEBA 2JF1A 3P4OB 5DR5H 4IOSD 3CFBA 3VXPB 3LQZA 3V6OC 4W70A 1ZLVK 3SKNB 1FCGA 4NQXB 4X9BA 3QO1A 2LU7A 4P5TB 2EXYC 4YHML 4LCCB 4GXVH 4ALAL 1YPZE 1WLHA 2BRRH 1TDQA 1IGIH 4FP8H 3ZE1E 1P2CA 1RIVL 5MENA 4YH6A 3G04B 1PDKA 3NMEA 4MNQA 5I1IH 5IMOA 5IT2H 2D7TL 2CKNA 4AIXA 1RU9H 5INDB 1MLCB 5C0CB 2XRAL 3VFTA 2XA3A 4X0KA 3OJDA 3OR7B 5FKAA 5GRUL 3IFNL 4LQFH 4D0CA 2J1KA 4OM0H 3RNQB 4KRMB 3HC0B 3WFBH 3ARBC 5FF6B 2OX5A 1HDMB 4HFUH 1JZ4A 1RIUH 3ZHLA 4F2MB 2WBJA 4U6XB 3AS0A 3FT4A 4M9PA 4Y2DC 2E3VA 2MCPH 1SHMA 4H1LB 5CP3A 1PAMA 4MA8H 1U91B 1MCWW 3LDBC 3TYGH 4CU8A 4R7NB 3C08L 1UFUA 1H0DB 5CAYB 4Y1AA 5EU6E 2AEIT 1X5HA 3WFHB 4JFYA 5EA0H 1HN1A 1DL7L 3SHSA 2LAGB 1CDUA 1KC5L 4GBXC 4AENB 4LRNL 1C1EL 5GGTA 3AM8A 4YDLC 1DUZA 3KYKH 2NXYB 2XACC 4NRYA 3CVIL 4NNPL 1BVKB 3FAWA 1F00I 5H37H 4MSWB 5EZOH 1A4KB 1S9WA 3QZWB 4LVNB 4XNYL 5HI3C 5CCKH 2BNQE 4PJEA 4X7FC 1EEZB 1QR4A 2UVEA 1IGMH 3PHQA 4E41A 3DRQB 3BQUD 1DQQB 4OLXL 5HHOE 5T1DL 3B2VH 4LVHC 4ETQA 1N2RB 1NMCC 2AJZB 3FCTB 3W39B 1LO3L 4HUUA 4PJDB 5T5NF 4U1KA 2FO1A 1I9IL 1MHEB 4P48A 1G9MC 5DEGB 4P9ML 1SYVB 1M1SA 3PGDB 2Q8AL 3CC5B 5GZNC 4WWKB 4JN2A 4K3EL 3O4LE 5CHNB 3FTGB 4OZIF 1TIUA 4JFDD 3BRDA 4KTYA 1CD0A 3SDAC 4KV5F 1T7VA 1X5ZA 1KULA 1HINH 4JFPA 1MFDL 1UM4H 2FEEI 1P7KB 3HRZA 1Q9LA 3VXRA 2GKIA 3V8CA 4P2QA 4AL8L 4H5SA 2VLJA 4EJ1C 2GJJA 5DHVH 4OV5B 4LPCA 2EICA 3RWFB 5E8OA 1FVCA 2Z8VC 1UM5L 5K9QI 1RUPH 3C5ZB 5K9OB 15C8L 3KYOA 4ZSOE 1EMTH 4JFFD 4L9LA 4LGRB 2PYEB 2W9EH 2WWKT 3Q5TA 4G9FA 4EI5C 1AFVL 3BKYL 1WFTA 4HKBA 1R3JA 4YHPB 2NQCA 2DBJA 2UVFA 3RWGB 3JWOC 3QQ4B 1PG7X 2Z31A 3KPNB 3MMEB 2QADB 3K8KA 4X5WB 2AXFA 1ZE3C 4TUOB 3ZSSA 1RJLA 4LP5A 5JR1L 3U0WH 3GJFH 3QUXD 2X4NA 4KK9D 4NC0B 1DVFA 1L4IA 1X5LA 4H88H 1T03L 3P4LA 4Y89A 5MEQA 2YC1B 4JFEB 2B39A 4PJAE 4LMQI 5KVMC 3DX9B 4L8SB 1KTLB 4NT6A 3FRPG 2APBA 2RQ8A 3ZDZE 1D6VL 2BNUB 6CGTA 2XTJC 2XZAH 3HS0B 1F6FB 3RPIA 3WL9A 4MVBD 1NLBH 3NH7H 1I7TB 4ZFGH 4X9IA 4IDLA 1KACB 1AGBA 3LHPL 4ONFH 1HH9B 4PJ9A 1VKXA 4V1DB 1KJ2A 3ZE2E 4KVNH 3VG0L 4OI9A 1D9KD 5I15H 5IK3A 2WIIB 2VUOA 3GK8L 1HNFA 3BH9A 4APQA 3HMXL 1NUGA 4O58H 5KSVA 1UWGL 4DGIH 2H32B 4PV8A 1SY6L 3D39E 3KR3H 2B0SL 4TVSa 1NLDH 4LLMA 5D72L 2IQAB 3RGVB 2EH8L 3P30H 4NWUH 2DLGA 4K3DH 4PJXA 2C4XA 2J8UE 3RTQD 1WT5C 5SWZD 3ZTJG 4WEBH 1EHLH 3V6FA 4G43A 5BO1H 1IL1A 3LS5H 4QRUA 5EUOF 3FRPA 3S36L 4Z8FH 4M1DL 5C2BL 5EBWB 3H3KA 3IDJA 3A0OA 2DQCH 1QO3B 4HC1L 1TZGL 1UQSB 4GKZA 4BELD 1I7UA 1YC7A 2HA1A 1ES0A 2QJDA 1TVBA 4XH2B 4F8QA 2OJEB 5E99H 1DLHA 4JZNA 2XXMB 4U1NB 3UPRB 3S35X 4YGVA 4YHIA 4CVZA 4HULB 1AGDA 2ARJA 1B4RA 12E8L 1A1OA 2NXZD 1X7QB 4K23L 5J8OA 1U8IB 1QOKA 1KFAH 3MA7A 2JCCE 2R0LL 1XR9B 3KPRB 1BJ1J 4W4OA 3TBWB 1IBGH 1J1PH 4AIOA 3BPOB 5ESQB 3W9EB 1Q8MA 1HSBB 2MHAA 4L3AA 4RWYH 3QEQE 1O7SA 4F7MB 3D85B 2VDQH 4WO4A 4WHTB 5IHBA 3HUJF 3X12A 3MCKA 4X5XB 2AQ3A 2DI9A 4NP4L 2DQGL 3BPCB 2NPLX 4IS6A 4Y5XC 4LDOB 4HQQL 3BD3A 2XWBA 1A6VH 2FJGB 3JV0A 3T8XB 1GGBL 4M6MH 3T4AB 4MJ5B 4MVBC 4CDHA 3M07A 4FG6C 3E6HA 1TNMA 4Y4KA 4KY1L 2MSPA 3RNKB 3ROOA 5BZWB 3U48A 4U6TA 5DJXA 5D1ZD 4M7KL 5BV7H 5CP3H 5E6YA 5E6IA 4K3GA 3VXTA 4HEPG 1PFCA 3NA9H 1JNLH 4YHLH 4S10A 2DD8H 5D7LB 4JZJB 5C0BB 4QCIB 3FB8A 2V2WA 5HXMA 5DD3L 1YYLL 3V4PH 3WJLC 2WINB 2LVEA 1YMMA 3MYJA 1FORH 1WICA 1KELH 3VI4E 3O0RL 3QQ3B 4BUHA 5FO7A 2AK1L 5GGTH 5JZ7C 1A0QL 3P4NA 4HIHA 2AAVA 4PGJA 1B0RA 3EOYG 4OKDA 4F3FA 4G6AD 5F7FA 5BVPH 2RBLA 3H7BA 3RTQC 3LB6D 3TT3L 3W0WA 2O5ZH 1Q9OB 1YEJL 1A21A 4X98B 4Q7DA 3FO0H 3REWA 3TN0D 4P23B 3EYQD 5KZCB 2FHCA 3HG1B 3R06A 4MHHI 1OGAE 8CGTA 4R4BA 5EU4A 3WXWH 2A73A 4OFKA 4HK3J 5ID0A 1N3NA 5DEFB 1F45A 1L7TH 1DN0B 2PW2B 5BS0A 5I16B 4ZXBB 5C6TH 3AB0C 1AHWC 5FYLD 4R26L 3RA7H 3PWPE 1MQKL 5E9DD 4CKVX 5D6DA 1F4XH 2V7HA 5E2TH 7CGTA 1U3YA 5FUOL 5J4MA 2OR7A 3MV7A 1CI5A 3IU3B 1Q0XL 1MCCA 3HNSL 4R9HA 1NJ9A 2R0KH 4LIQH 2C7UB 1HHGA 5C8JA 3TIDA 3GJEB 3S98A 4UINL 3U2SA 2AJVL 5HDBE 3MRLA 3NTCH 1I4FA 4GRWE 4YHOL 4DW2L 2W91A 3VXMA 3MLRL 1FNGB 3DBXA 1TVHA 3L5HA 5D5MB 5L0QC 3BP5B 4EXKA 1C16A 2ZOLB 4KXZH 4MA3B 4NKIL 4P46D 5I1EL 1QR1B 3IFLL 2YUVA 1CQYA 5FYKH 3UP1A 4HWZA 3LSOB 3D2UD 4MAYB 2DI7A 4DQOL 3D25A 4OCXL 5CUSH 5F9OH 2LQRA 4FXGA 4ZO8A 3V4VL 2FJFB 1BLNB 3X3GL 4XVJL 1LO0L 3CFEA 5I76A 3CH8A 3TBYA 1I8LA 5HBBA 4X6CE 2XV6B 5KJRL 1JL8A 5CEXB 2CIIA 1UENA 3GIZL 3DVGA 2YPVL 4U7MA 2PUQT 1YQVH 3ZYZA 4F15C 2YA1A 4YBQD 5B38B 3MRRB 3STLA 5DFVD 5HYSG 4IRSA 3WEXB 5DVOA 1FQ9C 1JV5A 2QSQA 1PEZA 5FO9A 4M7LL 3O6FB 3IVKA 3FO2A 3VMOA 4P9HL 1BMGA 5I8CB 4N8CL 4XI5D 3MNZB 3VGHA 5DC0A 1QFUL 1SEBA 1PVHA 4OGZA 4OZFB 2A9MH 2VSCA 5DJ0A 5BW7C 5I8KH 3EYQC 2ICWB 3CFIC 4X6FA 4EI5A 4AEFA 5DJ2B 4IOIA 1CBVL 1J05A 2EIDA 4KXZI 2J4WH 2XWJA 5I19L 2E6QA 1GHFH 5ISZB 4KRPD 3QFJB 4JPWH 4PJCF 3KPSB 3SPVA 2W0KA 3T0AA 3KNBB 2OSLA 1WBZB 4QRRB 1MRFL 4HUXB 3UXFA 1KB9J 3WFCL 2IAMB 5T3ZE 1OPGL 5JPNA 1F02I 4WEMB 1XCTA 4E42A 5A2LH 4FZEH 1KJ2H 3FN0H 4LHUG 2FBJL 2NY7H 2EEDA 3QCUH 4RGNE 2HVKB 2CUHA 5IEKB 5HYSA 4JHAH 2Y36L 4UU9B 5DI8A 4CVUA 2Z4QB 3PQYA 1T4KB 4GAGL 2FHBA 2GT9B 1ORSA 2EKSA 3LMJL 3MNVA 1U8PB 4M5ZH 2A83B 4CNIB 5HHPA 3RHWK 4WW2F 4D9QE 1TTGA 2AXJA 4MNGB 1MPAH 5GGVL 4DTGL 4JKWA 4Y4FC 1Y6KR 1QBLL 4LPUA 1QVOB 2HN7B 2DQDL 2IGFL 3L3HB 4H20H 4R0LC 4KZDH 3EOAB 4WFHE 5DJ6B 2DICA 2NY2B 3QUZB 1TLKA 5BMFH 1M7DA 1UWEL 1PZ5A 5EO1A 2XN9A 4QLRA 4HJJH 3QIWA 3BZFB 1RZKH 4JREC 4D94A 1UEYA 2AK4E 3V79C 3ARPA 3CSPA 2P5ED 5L7XL 5HHOB 2H2SC 1DBKL 4N0CD 1FLRL 3OKLA 3TO4B 3H9HB 1D6EB 1X5XA 4MCYB 2FEDC 4LHUA 2BERA 3CDGB 2LU4A 5B3JF 3UJJL 4TNVF 4MWFA 4FQXC 1VGKA 5ETUA 1IAKA 2K7QA 1YNTA 1KPRA 4I0PD 1A7RL 4X4YB 3FFCB 4GG6B 4JCMA 2JE8A 1YEKH 3ALPA 5CZXD 3ULVC 1RZGA 3AREA 4GQPH 1KJMB 1LO5B 4HBQA 1V3JA 2F58H 4OUUA 3U0PA 5HHMB 2DS4A 3NABH 3VDAA 4FQ2L 1MJUH 3MV9D 4OKVB 4AH2A 2J5LC 3BDYH 3ZTJH 3ARUA 2F8OA 3Q1SH 2VDML 4G8FB 4D0BA 4WU5A 1IC4H 2X9YA 4EN3C 5E08L 3RZCB 4L3ED 2BDNH 3OQ3B 4ZYKB 2VLKB 2RJMA 2QR0B 1OWRM 4OFYD 4NO3A 1NCNA 2VE6A 5JW4M 3EFDH 2CLZB 3LAFA 3SKMB 3O2VH 4PRAB 1B3JA 3D48R 5FDWA 1M4KA 2ZUUA 2BVPB 2KQNA 3SE8H 2BHUA 1U8QA 4L4TD 3DX6B 5C0RL 3RU8H 5D7JC 4OLVL 2BXYA 3QIUC 3N06B 1YPZA 1DBAH 4NZJA 1A14H 1JGEA 1ZWIA 3VRIB 4UB0L 1MJ8H 1FNEA 1LDSA 4OCYL 3TF7C 5ITFA 5IB3A 3VWKD 5GRXG 1TVDA 1WWAX 4U49A 4DGVH 4YFLI 1ZK9A 4P2RA 5ALCL 4L4JA 5IGXH 1AJ7L 4LVOB 1J10A 3FQXB 3S37H 4R4FL 2VXTL 2MTPA 3BIKA 4Q97A 1XGRA 3O3DA 5HTSA 5EIIB 5DUMH 1S5HA 3MXVH 2ADGB 3ES6A 3FO1B 3FQUA 4HGWA 1JN6A 2ICES 2WNGA 5JOFA 1TZHB 3PIQA 1TPXB 1NCCH 4I0PC 1K3IA 2PN5A 3JTSA 1F97A 2O93L 1SVZA 1H3UA 3HI6L 1Q72H 5D7KD 5TF1L 5EN2B 2IPUG 5EU6A 1UEMA 3EYUH 4K2UL 4JRXA 4PJIF 3GO1H 1XF1A 2DDQH 3MRKB 1JNNL 4KKAD 5T1MA 3BZEB 2B7DT 5IQ7L 2P7TA 2ORBH 3FO9A 5F7NC 3D39B 4YIQB 1XGYH 4XPTL 2E7MA 4GKNA 3QEHB 1RFDH 1J1OL 2VL4A 2YBRB 2DWDB 5B8CB 2BNQA 4PJEF 2ZG2A 5HPMA 3JV4A 3KPQA 1K4DA 1OSPL 4XNMB 2Z91A 5T1KA 4XMKL 2J8UB 2ZSWB 1MFBL 2R15A 1N8ZB 1JF1A 1DFBH 3Q6GH 2D7NA 3HR5A 4MQ7B 1BGXH 5KVFH 1JYNA 5M94B 4XXCC 1S7RA 4LLQB 5FO8B 3IT8D 5BQ7A 4MD4A 5IW3A 2HT3D 1UZ6E 1D5IL 4OT1L 5CD5D 1U2HA 3HZMB 1AR1C 3IDGB 4Z7WB 5I18H 2L0DA 1ACYL 3TH4T 3BHBB 5E56A 2C4FU 1OW0A 3O4LA 2VDPH 1KPVA 4EEEA 4M8QA 1ZA3A 3AXLA 4JFOB 4XP5L 4QXUH 2FR4A 3BPNB 1OT1A 4NHUA 4X9FA 1LGVA 2R1YA 4U2YA 3EDEA 5BVJA 1K3ZA 2W0FB 5KN5A 5GGSY 3KG5A 3ARGD 3CPLA 2JIXA 1WZMA 4XPFH 2VAAB 1NCAL 1DBJH 4EUPB 5J6HA 1H8NA 3O3BB 5F88B 3MLZL 3OXRA 2OBGA 4QRTB 5HGBA 1Y6MR 5MERA 2P24B 1R5IA 1JZ2A 3JWDC 3RWDA 2FH6A 4HUKB 1T0PB 1FGVL 1CDGA 1EHAA 4X6EA 2PR4H 4FABH 2EDRA 1QD0A 4YK4C 3GMRB 4RWHA 4MX7B 1E4XL 2R56H 5F7WC 4YXHL 1INDH 1NAMA 3NN8A 4BQ8A 1YNLH 4OZ4B 4FRWA 1NC2B 2EYRA 4ZSOA 4YEEA 2ARWA 4L5FL 5D93B 5C0DB 2GCYB 3T65B 3LQAH 5KG9B 3RIFF 4N90E 3TZVD 4M61A 3H42H 4X80L 4KZEL 3BESR 1EAJA 3SCMD 5IM7B 3QWQB 4KKAC 2LABA 4C56E 1T0MA 2MFNA 3AFLA 3LPGA 5C0GB 1ODAA 4WY7H 1NBZA 4ZOCA 5JIKA 3DGGB 3IAPA 3MV8D 4M7ZC 5ADOL 1YMHA 1WAAA 4XRCB 2AGJL 3Q48A 3H2WA 4G3YH 4TRPL 5JHDB 4F7PB 1DSFH 1HHHB 4HS6A 1KUMA 3HFML 3ARFD 1K4CB 5F6IB 5I1KL 2B4CC 3NZ8A 3GBMH 4JPIA 4I9WE 3CFKB 4PJAA 3IXAB 4PYHA 3EYOB 4PGCB 2BVOB 1H3XA 4OQTA 1IEBB 1KLGA 3QG6A 4M8VA 3EO1B 1CWVA 3U9UB 1EFQA 3SDDA 3TH3T 3VGBA 2XZQL 5TE6L 1I8KA 3P73B 1G9NL 1IKFH 3O3AA 4TOYH 1A7BA 5JPMA 1I8MB 1DQDL 3V5HB 1K5NA 1RQ5A 4G5ZH 3GHEH 3BYTA 1SJHA 2J6EA 5EZLA 2PETA 5E8PA 2FJHA 3MUHL 2VB5A 1NEZB 2G60H 3ARGC 2AW2A 3E6FA 1QLFA 5HSFA 4PG9B 2FATL 1UVQB 1WFNA 4HFWA 1LE9A 1EVUA 1EZVY 1YEGH 2WWMC 2PTUA 3AY4A 4JO2H 3R0MA 1MRCL 1IAOB 2O5YH 2YMXH 3DVNA 4X7EC 3L7FB 1W0VA 1A8JH 4KDTA 4F7CB 1JPST 3PF2A 1G7QB 3VH8B 1KSRA 3CLFH 4F7EB 5FIEA 4U1LB 4X7TB 2R23A 5I9QB 5D7IA 3QHFL 1N4XH 1EERB 3IB4A 1FFPA 3S5LB 3I2CL 1RV6X 2H8PB 3HE7A 3TA3A 4B7LA 4ZD3L 5TDNA 4IHOA 4PGBB 1BWWA 3GIVB 5T3XE 1UJTA 4N0FA 5JA8B 1KN4L 2NY3B 1NC4B 1ROWA 3TO2B 2NNAA 1G7MA 3QNXB 4XVTL 2JCCA 3HNVL 1NAKL 4ZUTA 3VFSA 2I07A 2A6KA 4UDTA 5LAXB 1RULH 4GMSH 1ACZA 1OTSC 5I6XC 3H3PL 4OZFH 3QEQA 5HDQH 4Y5YA 5IFJA 4YFLF 3ARFC 4TTDD 1TQCB 2R1WB 3DMMB 3LKQA 3BGAA 3V5DB 4JKPH 1XR8A 1AGCB 1P7QA 5C0NC 4MMXC 1F11B 2YPKA 3LRSA 3TYFB 1G7PB 2MQ3A 4GRLD 2COQA 4M6NL 3SGJA 2VXUL 4HH8A 4OLYH 3UZVB 4K71B 1IQDA 5CEZE 1KOAA 2F5AL 1R5VB 1EHNA 5DT1L 5T1LB 3BJ91 1AIFB 3LIZL 5TDOA 1UKSA 2F54B 2LVCA 1F8TH 4NPYB 4U1GC 5C09B 1EJ6A 3EZJB 1AH1A 1XFPA 5FV2A 1JPGA 1E27B 1Z9MA 4FFVD 4HJ0D 4NO2A 2DJ4A 3BVNB 4ENED 3OKDA 4PRNB 1U36A 4C57C 1GGUA 4OSUL 3EJZD 1RK1B 3QH3B 3TPKA 2VLMD 1K8DB 5FA3B 4DVBA 4RZCB 1DBBL 2R2HB 2ERJB 3I9GL 4KUCF 4KAQL 1OGAA 1DQLL 3HI5L 2DQFA 5KSUA 3HZYA 3V6ZB 5BXFB 1JZ6A 2BVQA 2OJZL 1YJDC 2CLRB 5I17A 1FYTB 5I74B 3L95A 3UTZB 5IWLA 4JFDE 1S9YB 1DEEA 1D5BA 2GTZA 4G6ML 4I5BA 4HBCL 1T04B 3PWPA 3RUGB 2HTLC 3D5OF 1I1AD 4UUJA 3SGKC 2ICEA 1L9NA 3DYMA 2YUWA 1LEIA 2EYSA 1D5ZB 4PR5B 1MFAL 4R2GC 1A6WL 3GMLA 1QSFA 2EE3A 4GSDL 5H94A 2EDLA 2G9HB 3MJ9L 3OGOE 5DD1H 2DBLL 1R3HB 4BZYA 1F6LL 3MREA 1XF5B 3X13A 5J1TC 3EYSH 4BM7A 3O6LL 1XGQB 1PBYA 5IOPA 3EJYD 4KUZH 4LSTH 1MVUA 1A1MB 4JFFE 3GMPA 4OB5H 5F3HB 1T1XB 4LNVA 3VMNA 4X6CA 4TUKL 5IBLC 2XG4A 3NCJH 3WDIA 2VDLH 5KOMC 4XBGA 3ARYA 5K9KB 2IJ0C 3F58H 2VABA 1BZ9B 3G6DH 1J0KA 1WTLA 1JWUA 3F7VA 1YYML 2AS5M 3CD4A 3EJZC 3QRGH 3MRMB 4YJZL 2D31A 4NQTA 5EFIA 1LEGA 1C5BH 3D3VB 4OLWL 1UG9A 1QSZA 2OMBA 1M6OA 3DIFA 4J4PC 3C6LB 1BIIB 4PJ5B 2V7NA 3V0VB 1IM3A 1AD0B 1VFUA 5FYKU 4XNXH 1JI1A 1KG0A 5FFLA 5JMOC 2HMID 5I2IB 2FYYB 5I1CH 4BZ2L 2CDEA 2OL3A 2FIRT 1YQ2A 3DVIA 2DQUH 4U1JA 4NN7C 1XZ0A 1BVLB 4ODTH 5ID1B 5CS7A 2AEPL 2XTLA 2V2TA 1VDGA 4A2MA 4KQ4H 4R8WH 3FT2A 4PUBH 4Z7VE 1OSZB 1MHCA 2FX7H 4Q9BA 1I1AC 1I8IA 2FB4H 5C7XL 4LRIC 4WDIA 5E00B 1F42A 3P9WB 3BP4A 1FBIH 2H3NB 2YPLD 5DO2D 1U3HB 1AKJD 5DMYA 2G75A 3ARVA 4JY4A 1K2DB 3BGMA 3WNPA 1Y6NR 1IEAA 1FPTL 5SWZE 4XNZB 1P4LA 3I85A 3SDXB 3P4MB 1B90A 3CCHA 1T3FA 1UB5B 4N68A 3PWVA 4X6BA 4XHQA 4QTHB 4XXDA 1QYGL 1UACH 4PTUB 1TCMA 3QO0B 4O00A 3HE6D 3EJYC 5JORA 4O02L 5JW3L 4WI7A 3AAZA 5C0FB 3IFPA 2V5SA 5F7EH 5EC1B 3IKKA 4XT1C 3PL6A 2CD0A 2AI0L 3WNMA 3VXQB 2AK4A 2P5WA 3CZFA 1EFXA 1SBSH 3MBED 4Y4HB 3TBTA 3VXUD 2CQVA 5TFSL 5BZDA 3NZHH 2GY5A 2ITCA 2WQRA 5FKPB 4YZFE 4Y88A 4LKXB 5GHWH 1MCHA 3I02B 2VDNH 5EWIH 2UZXB 1S9VB 5IUSA 3GSRA 2EIBA 4OIIH 1FL6B 4Q6IA 4YDVA 3RWHB 5D1QB 1NFDE 4AQOA 4XCFL 5CD3B 2NZ9D 3HB3C 4EUPH 1XEDA 1BQSA 1G7JA 3O11A 4XGZA 3VFRB 2Y07H 3F7YA 1CLOL 1V7ML 3BH8A 2X4QA 1ETZB 3QXWA 4RFEA 4H0GA 4MXVF 2HMIC 2AJXL 2DQJH 4GOSA 2W0LA 4GG8A 4D0DA 2PCPB 2X9WA 1I85A 1ZLUH 1MFEH 4DKEL 3WD5L 4PD4J 2P8MA 1QA9A 2E9JA 1ZA6A 4QXTA 3DTXA 5BJTB 3QUMA 1BM3H 5ERWB 2YD5A 4KQ3H 3TPUB 1EBAA 5J11C 4QNPF 2Z8WC 1C12B 4W6XB 4XPBH 5MEOB 3B3IB 4CADB 1UH3A 1OAZL 5DK3A 3K2UL 4JY5L 5D8JL 5EOCL 2FX8H 1MFCH 4XCCL 5LJYH 4WU7B 2EO9A 3MV11 4I8DA 4LASH 1QFWI 2IBZY 1YPZF 1DQJA 2Y9RT 3ZE1F 1ZTXL 4ODVL 4ONOA 1BFVH 4XBEH 3O45B 4YXLH 1LDPL 3WE6A 4W81A 3GSWB 4J3UA 4JE4B 3ARWA 4MLIA 3HE6C 4U3XA 4QYOA 1IGIL 3CFJA 5C0EA 3O3EB 1AQDB 1XIWD 4JM4H 3UO1H 2X44D 4Z0XB 2IPKA 4G8EA 3RL2A 4POYA 1UB6A 1RZJC 2DLEA 2WUBL 5DDHB 1JPSH 1QHOA 3VW3L 3CX2A 1KEGL 1FE8L 3GHBL 1U8HA 4Z18A 3ARBB 5JHLL 1LEKB 1RMFL 3MBEC 5GSVB 1MFNA 4M7JL 5LGJB 5L2JB 2MCG1 4LNRB 3B9KA 4I3SH 5HHNA 1LE5A 3S96B 3HMWL 4HXAL 4Y2DB 1T1ZB 2NW2A 5E7FA 1CIUA 3LDBB 5GS0C 4U1MA 4YBLC 1DEDA 3MLUH 1A5FL 1KIPA 2R39A 3D0VA 3CFCH 3VU2A 2IH3A 1PY4A 4D3CL 4HD9A 2NZ9C 4BH8B 2VLRB 2AKRB 5E8DH 5E2WL 2BNRB 1FNLA 4GBXB 4RIRB 2HFFA 4GRWH 3BE1L 2IAND 5D2NC 4YDLB 2APVA 1JGVL 3HKFA 5GS1C 3B8YA 3FONB 5B4MD 1T1WA 3RVTD 4NRXB 1R5WA 2FEEL 2CGRL 3MLSH 4HEME 5C0JA 5CBEA 1BAFL 3PDGA 1RUAL 5DJ8A 1YECH 1QRND 4TSBL 2YA2A 5CWSA 4DUXA 4LVHB 2ZP0T 4G8IA 1VFBA 1GC1H 1NMCB 3OHXA 4MDJB 5CP7A 4P3CH 5EOQH 3REVA 4YHZL 2A1WL 5M95B 1U6AL 4UTAH 5SX4H 5JXAL 5IV2A 1BF8A 2X70B 1IKNA 3RFZC 4IEFB 3F62A 2B1AH 4Q58C 5EU5B 1PQZA 2JKXA 4AIZA 1TCRB 3KYAA 4GG6F 4U1IB 1GZQA 2YD6A 3BKCH 4HWBL 5DLML 1CT8A 1XGUB 1R3KB 3SDAB 2DIJA 4PGEB 4QOKD 4HT1H 4HS8H 3MRIA 4UDUB 2OTUA 5CMAB 5J3HD 3GB7A 4PJFB 4ODSL 4NKMA 2NY1D 4FQQA 1S7XA 2Z9TA 2EE6A 2OL3H 4XWGH 1ZOXA 3L3GB 3JZ7A 3CDCA 2XKSA 1MIEH 3MGAA 3K46A 4BSVB 4ONGH 4QF1B 5CJOH 5T3ZH 1JPFA 3CUPB 1KCSL 1XF3B 4QRPB 4YXKH 3FOMA 3WSQH 3H7LA 1KJVB 4U6VH 3M8OL 2AXGB 5SX4I 3HPJB 5LCVL 5I1GH 3IXTB 4S1QH 4LEOB 4C56A 5HGHB 4JGUA 2HKHH 5KW9H 5HVWA 3T0ED 4Y19D 1R3IH 2YKLL 1A2YB 3I84A 4BQCA 5B4MC 4OGYH 5CIPA 3B5HA 1A9BB 3ULUL 5D96C 3RJDA 2XQBL 4PRIB 4P5TD 1CGTA 3MRJB 4WUUB 2P5EE 1NSNH 4FFYH 1J88A 5TE4L 3X14B 4R90H 3BXNA 3EYVA 3ARDA 3EIFA 4UIKH 1HZHH 2IG2L 3WNLA 5IBTL 3ZDZF 4KHTL 3A6BH 4PP1C 2QSVA 4LLUA 2E9WA 4NSKA 3N0PB 1FFOB 1KBGL 3VGAC 3HRPA 2XTJB 1ONQB 3ZL4L 4DEPC 5C0CD 1S7VA 1TXKA 2PNDA 2X7LA 1CFSB 5E1AA 3ZE2F 1KYOK 3FB6A 1KJ3L 3QQ9C 2OZ4L 3C5SA 1U92A 1FRGL 4ELME 1HXMA 4KK5D 4ONFL 4PS4L 4ZFOA 2IALB 4XPHH 4HUWB 1K6QL 5HYQA 2CJUH 1BBDL 1VGEL 1JMXA 2UWEB 3S3SA 1MY5A 2QBWA 3ZE0E 1S7SA 1LO2L 4NNYA 2MKWA 4PY7A 5J3HC 1GL4B 3Q6FB 1OAUH 1MJJA 4P5MB 4IRJA 4LSRH 2J8UF 2NCMA 3KR3L 3PGCB 4NBXB 4G6JL 25C8L 5C92A 3NACH 3DV4A 3VFWA 4K3DL 3BIAX 3NGBC 2NR6D 3TJEH 1NGPH 3QUMH 4LPYA 3RVVC 1JRHH 2NXYD 2F8VA 1I1RA 4OQ1A 2O5XH 5I66B 3L1OH 4DN3H 5KVDL 2QSCH 3U46A 3V4UH 4L4TE 4D9RD 1ZXQA 5AUMA 3S34H 5KVEH 1OAYH 5FB8B 1UKTA 5GGQH 1NCDL 4G80A 2JCCF 3BGFC 4HV8B 3GZKA 4OIBA 5GJSH 2QQQA 3ZSTA 2X1PA 1GOGA 3JTTA 1W72B 3BFOA 1A9EA 3MRHA 4KHXH 1NMBH 2A6IB 3VE0A 4K7PX 3GBNH 5B3NA 4WWKD 4LHJB 1EXUB 4LQ1A 1GZPA 4JQVA 3BZ4B 4WHDA 3U7YH 1PKQE 4Y5XB 1CICA 1JWMA 3N9GL 4YFEA 2WW8A 3L3OB 5EZIL 2HG5B 1T0NA 3GGWA 1HCVA 4TULL 6FABH 4XNQA 3UDWA 2A6JB 4J3TA 2EC9T 1BQHB 1UZ8B 5TH2B 1I3RA 3LN4A 1NBVL 2QKIA 4M6ML 4KMTL 4WTXA 1KEML 4GAFB 1A1NB 2APWA 4UIMB 5I8EA 1JRHI 4JVWA 2XT1B 1RUQL 4NQSA 4DKFH 3G9AB 4MZ2A 1QACA 4M43L 4EI6B 2HJKA 5KVGL 1CK0H 2AJYH 1H3GA 1I1FB 4AM0A 2OQJB 5DD0H 4E5XA 1OARL 3C8KB 4M6OH 4NQVB 3P0VL 1FNFA 5F7KC 2KKQA 4KJPD 1QPPA 4ZTPH 4P2YA 4M5YH 4JFHD 5EH1A 5FCUL 2QHRL 3RTQB 2J88L 1WC7B 2MNUA 1PG7L 3BQUA 4MB4A 4GUPB 1MEXH 2GI7A 4M6AA 5CINH 2CMRL 2NR6C 5L6YL 2QADD 3K7UA 4ZUWB 3MLYL 5F7HA 3EDFA 1CF8H 3VD3A 3OKEB 4YGAB 2HLAB 4H8WH 3UTSA 3KYMB 1MAMH 2I60L 3OKNB 4PBXA 4U33A 5KANG 2HKFH 4LSSH 5A16A 1AY1L 1X5KA 1PLGL 4N9OB 2PXYA 3PXJA 2W60B 3AB0B 3BP6A 4LSUL 4FOMA 1CFTA 1AHWB 4JFDA 2Y6SC 3MRFA 1HHJB 4NUJB 5ICZB 4K94C 1T5XA 3E8UH 3L3KB 5DVNA 1CG9A 3LEXA 4FQIH 2EZ0D 4LHQB 1PYWB 5IIEA 4NQUA 1N26A 1MUJA 1T83A 5ICYA 4Y2OA 5HDBF 5DA4A 4LAQL 4GRWF 2FH8A 1NFDB 3RDTC 1HQ4A 2JTDA 2HT2D 2UZYB 5L0QB 1WZ1L 3HNTL 2Q86B 4WV1C 4GRMA 4CRPA 1J8HB 1NL0H 4HLJA 3NCMA 4KV5E 1C5DB 1KB5B 5AWNH 4KMLB 1V7NL 1MCLA 4YNYA 1NFIB 4JFXA 1HIMH 4JFFA 4P3WA 5C2UB 1MREL 5BVJB 5KN5B 3GSQB 2PO6D 5AYUL 4M1GL 2AABH 1OAXH 4X6CF 4OLZH 1VESA 1A02N 4GKSA 2AJSH 1F6AA 4PJHE 1CGSH 4KMQA 3SBWC 1MWAB 4C4KO 5I1AA 3QIBD 3DO7B 1F58H 4F15B 5DYOB 1NBQA 3BT2L 3PP4L 1KCUL 3QFDA 3FZUC 2ZKHH 4ZPTB 3BUTA 2BJMH 3VGEA 3S35L 4GMTH 3QUXA 4RFNC 4JDTH 4HDIA 3WKML 4XP4L 3FB5A 5DK0A 1MCJA 4CU6A 3SE3C 1JGLH 5CIPH 4BUGA 3O2DA 1RZIA 1M05A 3BAEH 4P5KA 2VL5A 4HPOH 1WBYB 2FX9H 1QG3A 3G5XB 1V5JA 4M62H 2YK1H 4Q9RH 2KUTA 3DO3A 4M61B 3WUWG 3KPRD 5GRWA 3KAAA 4LDEB 3T1FA 3A67L 2JJVA 2A2QT 4X99A 4NOBA 4NWTL 3TVMC 5ACZA 4ODXA 5I1LA 5FUCC 1DE4A 5DMKB 3LKPA 1PSKL 1GPOH 2CDFB 5IG7A 2NX5B 4LFHD 3O2WL 4V2CB 4JQXC 4JO4L 1D9KA 3OB0H 4N0YL 2F19H 1OQXA 5E9DB 5AZEH 3TJHC 3RPKA 4Z7VA 1IEHA 1NGXB 1PX4A 3VDCA 1ZHNB 2BSRA 2XQYG 4G7VL 5F8QC 3RKPA 1QSEB 3IKCA 3WN5A 4BFIA 4N0RA 4OM1H 3LPFA 3B43A 3I3BA 3K4ZA 3ARXA 1N6QH 3DROA 4JHAL 3MRCB 4XWOD 5SWZA 4PRDA 1Q0YH 1AR2A 5AG9A 4JAMB 1FV1A 1BJ1H 4Y4FB 4DN4L 5JPMB 3BO8A 5F96H 4NKDA 3VFMA 3CZJA 5I1HH 2DTMH 4U7SA 1FFNA 1DQTA 4R0LB 4RX4A 1MPAL 3EGSB 3WUWA 3RVXD 1UT9A 5D7SL 3G08B 4BFEA 5ADPH 2PO6C 5EOTA 4J1UA 4E0RA 1FAIH 4JREB 2W9DL 1AGEB 5SWSB 3NFSH 1NCTA 3V52L 3ZYIA 2JJTA 3MGTB 2DL9A 3QNZA 3L7EB 4DAGH 3QIBC 5BRZD 2AJ3A 1HSAB 5T3XH 2FO4A 1FL3A 3RUGF 1MHHB 1P5UA 2AP2A 3HG1D 3RQ3A 3QUKA 1KCVL 4YO0B 5DTFA 4FQXB 3QPQD 4IIQA 3NCEB 4EIZC 4LLYA 4AZ8A 4JDVB 5J0BA 4K7FB 5DJYB 4ZXBD 3V7AE 3F12A 4BQBA 1FYHB 4WI9A 4N9GB 3W9DB 3BKJH 1OGTA 3WKNA 2J5LB 2ZG3A 2HWZH 1EPFA 5L88H 1NMAL 4G6FB 1KF9B 5AAWA 3I6GA 2KQMA 4PB0H 4EN3B 5IQ9B 4H0IA 1KGCD 4S2SB 3D9AH 1XCQB 3NIGE 2ADJA 3MJ7B 1X5IA 3B2UC 3FQRB 5D1ZA 4YDKH 5CEZH 3K80A 4PFEA 4CDGC 4ERSL 5HGAA 4MJ6A 1E6OH 4BZ1L 5F89A 4JPKL 1HHKB 4PRPB 2EXWC 3VXNA 1HEZB 1RK0A 4MAYD 3VXSD 4FHBD 4WIQA 2V5MA 5T33L 3QI9C 4Y16A 5EBLB 5IW1B 5CILH 2HH0L 1JWSB 3M17A 1J0ZA 5D7JB 3O2VL 4XWOC 3QIUB 4HCRA 1NUDA 2VLME 3ZTNH 4P49A 5CBAA 2IQ9H 5DJZB 4OGXL 1IC5L 1P4BL 4HHAA 4XCYA 3TN0A 1O5DT 2BOBA 4PV9A 3RWJB 4FXKA 5DXWA 4XTRC 4FQ1L 1IGJB 1N6VA 3DSFL 4MA7H 2ITDB 3PWNB 3O6FD 4QT5A 1XGPB 4N5UA 1O0VA 1R6VA 1JGUH 1GGIH 4KTDH 3RKDC 1SBBA 1F90H 2BVUA 1U9KA 1KIRA 4C58B 1S8DA 5F9JB 4NHCH 3QUYC 4KPHH 2AQ2A 4JO1L 5ANME 5CSGA 5MEPA 1EX0A 3QPQC 4I0PB 1TITA 3I50H 3BMWA 1QFWM 4RRPG 4LSVH 1B4JH 3LN5A 3O9WC 5ISZD 3MUGB 3QFJD 1EBPA 1U95B 3KPSD 4P59H 3U36A 3RWEA 4WW1B 4QRRD 2H1PH 3EFFA 1UCBL 1LMKA 1MH5A 4H26B 1OP3H 3AS2A 1T89C 3QDGB 4P46A 3NFNA 2W65B 3LKSB 1BFOB 3L3DB 3MV9B 4O4YL 5ENWB 5IKCB 3QAZC 4I2XB 4U0RC 1T5WB 3D2UA 5E2UH 3UX9B 4YBHA 5F1NA 1IVLA 5EU7C 4HIIB 3VFNA 4L3EB 2GK0A 3PWUB 2ZCKH 5LGHH 1G9ML 1PEWA 1CGXA 5C08A 3L5XH 4MDIB 1INEL 3KPPA 1L0YA 4U31A 3MXWL 1YEFH 2IEPA 2VDOH 4DUWA 1QQDB 5IJKC 5HHVH 3WFEH 4AEEA 1QSFB 1RIHH 2I9TA 3TP4A 3O6KH 3JVGC 2IPUK 1UZ6F 4R7DB 5A43C 3F7QA 4Z95H 3GI9H 5CJ5A 5JW4R 2NY2D 3QUZD 5FXCH 4X8XA 4NCC2 4I18A 4HX1B 5EC2A 4RRPA 3EO0A 4UNVA 4HUVB 1FNSH 2X2YA 5GIRB 5E5MB 3U9PL 1W72H 4W4NA 4ZOAA 2IFGA 1SJXA 3TO4D 4X6DB 5DRZA 3O2DH 4WFED 4XPGH 2DM4A 3KPLB 4PJGE 3VCLA 4KJWD 3HLAA 1AGFA 4CAGA 2Q20A 1ZAGA 1RJYB 1YN7A 3MACH 2JJWA 4O5LL 3SEPA 4XCEB 1MNUH 3MOAH 1ZANH 4ZDHA 2XZCH 2ZUYA 1LNUA 3VG9C 5FGSA 4YQXH 3U6RA 1P4IL 2HFEB 2LU3A 2IFFL 4YK4B 4C83B 3PNWA 3RBSA 5DMIL 2B1HH 1ZSDB 1A6ZA 4D9LH 3JWOL 3SOBH 1N5YL 1WWBX 2YPLE 4GW1B 2DYPB 3MLTA 5F7DB 5KANI 3MGOB 4PJCE 3RZCD 1ZEAH 5E8NA 3P9LA 4HZLB 4NQCD 1UA6L 4P4RB 3TV3L 5GRYA 2VLKD 4POZD 1H3TA 2CKBB 3I6KB 4J3OC 4XCNA 5GGRB 3BWAA 3WIHA 5DZLA 3UYRH 4O2FA 1U8LA 3GFUA 5DMGD 2GTWA 4C59B 1PZUB 3G9VA 4M7ZB 4YR6A 1PG7W 1FDLL 3OAUL 3KJ6H 4L29A 1CR9H 2BCKA 1T22A 3L5WA 4ODBD 2DB8A 5SWQA 3IDIA 9CGTA 3NIFE 3G5ZB 1MI5A 1NDMB 2P5EA 3G5YB 4QO1A 1B0WA 1I7RA 3WFDL 3VXUE 1FJ1A 3FB7A 1UJ3C 5DUBB 2ADIA 5FGCE 1DUYB 4Z7OE 4ZMAT 4CJ1A 1CE6B 3NVQA 4GAJL 4OGAD 1MCOH 1OCWL 3OKKA 2FDBP 4KTEL 3GSOB 4QXGH 2J8HA 2YD8A 1I7ZB 3VJ6B 1UYWH 1J86A 3INUL 4JY6B 2VXVL 3CAFA 1P7HL 3GSNB 4NZDA 1IKFL 4LCUB 2DMKA 4ELMA 1H5BC 2RHEA 1C5CL 1JUFA 1ZLSL 3QJFB 4S1RH 3ARGB 1NGYB 4HLZG 2FIKB 1P1ZA 4NZRL 5DRNB 2OTPA 5HY9A 4DOHE 4G9DB 2IWGA 5DFWH 1G1YA 2WUCL 4JM2A 1I9EA 2F5BL 4GW4B 4H25B 4TSAH 1YEHH 4WUKL 1R3LA 3GSXA 1S7QB 3IDMA 3GNML 4OI8A 1GIGL 1KN2H 2XA8L 4OFYA 1A7PH 3B6SB 5DWUH 1OF2A 1H3PL 1B0GA 2CSPA 2BOCB 3BEVA 1GCFA 3DHMA 1MLBB 1MOEA 2GAZB 4AT6B 3U4BL 3MJ8A 4Y5VA 3BH8B 4BH7B 3KLAB 2GQHA 4L4TA 4QEGA 2WIMA 3DI2B 3WS3A 4POZC 3TBVA 2L7JA 1WCBB 2AJUH 3DI3B 1L7IL 5MP6H 1E6JL 2EYTA 3JV6A 1LHZA 1NBYA 3LZFL 4HCRH 1CD1B 3MV8B 5D70L 4F9PC 3VWKA 4CW1A 2Q8BH 3T3PE 1X44A 5I6XB 5JLZB 4AMKL 3TT1L 5IHZA 1FVEA 1TENA 4HK3N 1NGWA 2UZIL 3ARFB 1F4HA 2VLLA 1IGCH 4PJFF 4R97C 4OCRL 3VD7A 4ZAKD 5IW6A 2BC4B 1T2QL 1VEOA 1PKQA 3N1QC 1U3JA 3P3YA 5EPMB 1RVFH 4JR9L 5HHQB 4JG1L 1OB1B 3MRBB 3VRJA 1W0WB 3DV6B 4QTIH 1IFHH 3TIEB 3D69A 4HIEB 4OGAC 4HKXA 4HXBH 4PJ7E 4L8DA 3MRNA 2VC2H 4CVXA 3EBAA 4UV7H 5I75C 1LP9E 3M1BB 1NGQL 2OMNA 5D1XC 4EDXB 1MCNA 3RL1B 2VZOA 3HZKB 1BD2E 2EECA 1BZ7A 4U1GB 1NANH 3MO1B 5DJCA 2IANE 2DJUA 1EV2E 1CLYH 5ACLA 3SDCD 4J8RA 1O7VA 1V3LA 2O61B 1NC2D 1F2XK 1DBML 2R1XA 2Y7QB 4I48A 2P43B 4PGDB 3FN3A 5IB1A 4JN1H 3RRQA 1Y18A 3DX7B 1VFAA 3V2AR 1QRNE 5KS9B 2OK0L 1IC7L 4PJIE 4IMKA 4PLKD 3KDMB 1JPTL 4JDZB 3IDUA 3VWJD 1AO7E 4K8RH 3GMNA 3LKNA 5JQ6H 3OG4B 2R2EA 5HYEA 4YDIL 5KTEH 2HYMA 4EXPX 2DWEA 1ED3B 2X4RB 2V17H 2ENSA 2Z0BA 4NNXA 1KPUB 4O2CA 1I9RH 1X5FA 1Z9SA 5DRXA 3OPZL 3PJSA 2NY0D 3MNWA 3ULUD 3UZQA 4FQJH 2ZUWA 3KPMB 4KJYA 1WJ3A 4HZAA 5EO9B 1NANI 3LQMA 4R2GB 2GEEA 1X6LA 4NBYB 5DHYA 5AZ2H 3U1SL 5IJKA 1KB5L 3P9MA 4P4KA 3GMQA 1U93B 2CDGA 4ZAKC 3HCVB 2DLTA 4Z7UB 1IM9B 2VOTA 5E70A 1FL5B 4R96B 3BW9A 2X89A 3QHZL 5J89A 1S5IH 4YPGB 1S7UA 1MWAL 2HT4D 4OF0A 5DGRA 4OZHE 1CLCA 1MIMH 3GKWL 1UH4A 3NFPB 3H0TB 3QA3A 3UC0L 1Z0MA 5IROC 1Z5LB 3UTPE 1YN6B 3QPXH 3TZVA 5EORL 5FGBC 3R8BB 4NKOB 4LAJH 3CK0L 3MRIB 3SCMA 2MOVA 4PJHA 5GJTH 1NAML 1E4WH 4Q2ZB 3T0EE 4N0UE 2AV7A 1YY8B 1V3MA 1HOCB 2P8PA 3SDCC 4LSDA 5IMMA 5DK2A 2X1XR 3SJVB 3VFGL 3WIHH 4DCQA 1RURL 5K93A 2Q6WA 4J6RL 4PJ8A 3L3JA 2BX5A 3D18A 1CTNA 1TJHH 3ILPA 2DMCA 1ZHLA 2CRYA 2APTA 4DKAA 4RGOL 5CJXA 1QLRB 2XFXA 4PLKC 5TDPB 3QULA 1NC4D 4RMVA 4KDWA 5EG6C 4I77H 3VWJC 2ZSVB 4WNQB 5DUPL 2NLJB 5FYLL 3MCLL 4K9EL 3N1GC 2JK5A 5ACMA 5C0CE 1N5AA 4UV4H 4WTWA 3THMH 2QQKH 4EDWH 5LWYH 4NN7B 1CCZA 3OGCB 3KVQA 4JPVL 1DQML 3O8XC 5FV1L 4OQTL 1T21B 2X4SA 2F74B 4FFWD 3S3JA 4KKBD 1OD7A 2I26N 1KLUA 4Z7VF 1HH6B 1ZVSB 1I1AB 2H2PD 2NY0C 3VGDA 5IVXB 4MD0A 2FSEA 4WW2C 1F4WL 5D2LB 5SV3A 5IP4A 4OD1H 5J9PB 4GW5A 4RQQB 5IMLB 3EO9H 3BEWA 2Z92B 1I3GL 2VERN 1OAKL 3QCVH 4RFOH 2DM3A 2C9AA 5C0IB 3U4EA 1FZOB 2J6EL 5HJ3A 3GRWL 5EOCJ 4OI7A 5E1HB 5T1LD 4ELKA 3V7AG 1CXLA 2GITB 2F54D 5IVNA 5JIHA 4WTZG 3WLBB 1R24B 5C09D 1RZ7H 4ZO9A 5F21B 4DFIA 5JDSB 2ATKB 3RWIA 2VDKL 4BKLA 2XWTA 1BQLH 2D4DA 4PREA 5HDLA 5IFAH 3IJHA 4F37F 2WBJD 4XBPB 1M7IB 3V9FA 4D9RE 1FZKA 3C09C 1F4YL 2OP4H 3CMOH 1JHKH 2F53B 3ULVL 4JKLA 2BK8A 4HPYL 3PGFH 5FUZH 2P48B 3A6CL 3KHQA 5DQJB 4YZFF 4JANA 4PJDE 2M2DA 5EZJA 4NUGL 3MA9L 4JCLA 4TUJB 1JIBA 1U58B 3D87B 2UYLA 3QEGL 4HLZH 4UOJA 1KIQB 1QFWL 3MUZ1 1NFDF 3H9ZA 2DQHL 1FYTD 2BMKA 3SKJH 3C60C 3ULSA 2Y1VA 4GRLA 3PP3K 2JB6B 3JWDH 5H35B 1G7LB 2ZCHL 4NJAL 1CD8A 2KL6A 4LPWA 3CXDH 2CK2A 4OLUH 1SEQH 3ECBB 4U6YB 4PLJD 4FFWC 4RBPK 2V5TA 1WBXB 1U8OA 5J11B 1MCPH 2H2PC 4U1HA 1D5MB 3FQNA 3MFFA 3DX8A 3VFOB 2CKBH 2Q76B 1XMWA 4OCSL 3UCRA 1NDGA 2B2XH 2PYEE 4JFHE 4I3GA 1SYSA 3T2NH 4OF6A 4F33B 5HYJB 1GXEA 4U3HA 4CMMA 3NAAH 1A7QH 4XVUD 1I1CA 3E3QC 5L9DL 5DQ9A 5IMKB 2NMSA 5CZVH 4RMSA 3HE6B 4ZFZA 3D0LB 2VYRE 4YXLL 1KENH 5DSCB 3OR6B 2BY0A 2X4PA 2WBJC 4AM0B 4YE4L 5I30H 5BV7C 1RUKL 2NY5H 3D3VD 1BOGA 4JFEE 2I9LA 5H37G 3MBEB 1D5XA 4S1SH 2J3SA 2E9BA 4ZUVB 3UTTB 3C6LD 5HPOA 2X4UB 4M3JA 1CZ8H 4KI5D 4PJ5D 4KKCC 4L3CB 2R0ZH 3VFUA 2NZIA 5ANMA 1S7WB 4OD2B 2DN7A 5H2BA 2QHLA 3GSNH 2R8SL 4Y7MA 4NDMB 4OD3L 3K4DA 4X9GA 1F3DH 1AXSB 4HH9B 2DQTL 2Z31D 4YBLB 3AM8C 2VISA 4TNWK 1FNHA 2M8XA 4V1DE 4XVSH 4J2XA 3ORJA 1WWCA 3DARA 1Q9KA 4I1NB 2ATPB 3FQTB 4EIGB 5SX5K 1DVFD 1OTTD 4NCC1 4OTXL 3P77B 5D2NB 3QDMB 1CFBA 4QHKJ 4XAKD 4NM8H 4QHNB 5GS1B 3BYYA 4DZBA