3BT9A

Crystal structure of qacr(e57q) bound to dequalinium
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIQESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator qacR
publication title QacR-cation recognition is mediated by a redundancy of residues capable of charge neutralization
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 78
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2007-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3bt9A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3bt9A02
5HBUA 3AQTA 1AKHA 2YU9J 2LFBA 1OFCX 4BY7J 4XRMA 3P9TA 2CJJA 3NAUA 2NP3A 2IBDA 1ZTRA 1GV5A 4JX5A 1UG2A 1AU7A 3RZOJ 5M5YJ 1H8AC 2QF7A 1LFUP 3MN2A 2QIBA 3LJLA 3PASA 3VOXA 4PXIA 1RPWA 3FISA 2DN0A 3CDLA 4EEFG 4IHVA 1TWFJ 1XG1A 3FIWA 1H88C 1YRNA 1K83J 3SJMA 4A3FJ 2REKA 5M5WJ 1JUPA 4BBSJ 5FKKA 3M3YJ 2ZB9A 2G0EA 1MBEA 5IOYA 2RAEA 3PM1A 4CYCB 2KDZA 3VOKA 1FIAA 3K2AA 2IU5A 2VUMJ 3MNLA 2DA4A 3HGYA 4XRSG 5IYDJ 3S1RJ 4HKUA 3QBMA 2CQXA 3VVZA 1PUFA 4A69C 2K9NA 1X2MA 3HEFA 1FIPA 3HTAA 2CUEA 2DTZA 1RESA 1APLC 1U9NA 1ETYA 3BTJA 2N8GA 4CYCA 3W6VA 3TP0A 3ZQCA 2E1OA 1IDYA 4V2FA 5CXIA 3IH4A 1ETOA 2I10A 1F36A 4QSHA 1U9OA 4HNVA 1GT0C 3LHQA 3MKLA 4A3MJ 5EFYA 4DZPA 9ANTA 3VVXA 5K7HA 3GTJJ 4ABZA 3CMYA 2GM4A 2R5YB 1JTYA 4C3JJ 4V2GA 4FE4A 1WH5A 2W48A 1MBGA 3JREA 5HSZA 1NTCA 4NN1A 2QCOA 4C2MJ 2UXUA 2DMNA 3GZIA 1VI0A 3A01B 5C4YA 2VKVA 4UUSA 4I6ZA 2UXHA 1TC3C 2ELKA 3DEWA 1I6HJ 2R5YA 1W0TA 1JKPC 3JSJA 2ZOYA 2RASA 2OF7A 3BR3A 4MFEA 1UI5A 3LNQA 2YVHA 1Z77A 2LY9A 1T33A 2FJ1A 2Y31A 4W1UA 1CQTA 4MFDA 2FBQA 3Q0UA 4X1EA 3A02A 2WUIA 1FJLA 5HAWA 3VIBA 3HGGA 1GVDA 5GPCA 2G3BA 2FD5A 1QRYA 4MO7A 3SDGA 1GV2A 1POGA 1JT6A 1ZR2A 2JA6J 3BR1A 2M34A 4X6AJ 3GEUA 4M3FA 1NK3P 3JR9A 4A93J 3O8GA 3OSGA 2DMPA 4AF5A 2ECBA 2LR8A 5FGLA 4FTHA 3BG9A 1QVUA 1ETWA 2ME6A 2JJ7A 2O9LA 2VI6A 2DA2A 2L0KA 4JX4A 3LWJA 1Y1VJ 1WGXA 2DA7A 2Y9ZA 5H9TA 5D1RA 1JTXA 1MBHA 2JWTA 3OSFA 3ANPA 3NRGA 2JA8J 2K9QA 3A03A 2L7FP 2WGBA 4QTRA 2XB5A 3O8HA 2JMWA 2AO9A 3EUPA 2E2IJ 3HOVJ 1K61A 4Y7NJ 3ZOBA 3B6CA 2E19A 1B8IA 3PO2J 2JK3A 3ON4A 3HB9A 4DYRA 2F07A 2CUFA 3FK6A 3PO3J 1TWAJ 3DCFA 3HOYJ 2L7MP 2B63J 3Q3SA 3LSJA 5F27A 3F1BA 2NVQJ 4JP0A 3VPRA 1U8BA 5IOZA 2LTPA 5EG0B 1WI3A 2ZCMA 5E3MA 3H0GJ 3NARA 3IUVA 2GBYA 2NVXJ 2O8KA 5EDNA 1RKWA 3BR2A 3LOCA 3RZDJ 1SGMA 3ZQGA 4A3EJ 3GTMJ 1JUMA 4JX6A 3S17J 1FTZA 1HOMA 1HLVA 1IG7A 5EGOB 1EF4A 1MBFA 4J19A 2GUHA 3ZQLA 1JKQC 3G1LA 3FK7A 3T6NA 1JKRC 1S7EA 2OI8A 5E3OA 5IYCJ 2L7ZA 1WCMJ 3FKIJ 2MGQA 1B72B 1IGNA 4A3BJ 3I4NJ 3VUQA 2CQQA 4GCLA 1JUSA 3OIOA 1I3QJ 3ANGA 5GP9A 2R5ZB 4D5FA 1P7IA 2EH3A 5EGOA 1BJZA 5C3EJ 3BRUA 2MG4A 1VF9A 1IRZA 2CRGA 3BJBA 3V6GA 4BKXA 4FCYA 2VKEA 4L5EA 1GUUA 2K40A 5FKOA 3NNRA 3BTIA 2NOGA 2NS8A 1FTTA 2G7LA 2R5ZA 1P7JA 2EZKA 3EGQA 4AC0A 2DA3A 2LD5A 4KWAA 1RR7A 3S2DJ 3VW1A 2HYTA 4XRSA 1BA5A 3RH2A 2M8GX 4B4CA 4GFBA 4AUXA 3BQZA 3HTHA 1ETXA 4DYQA 4RDUA 3ZQFA 4JKZA 3LSPA 2LKXA 1W0UA 2FQ4A 5C44J 3GBGA 4S0HB 5AQCA 2E2HJ 3S16J 1MBKA 1UHSA 4M6VA 4AYBN 5M3FJ 1NK2P 5FLVA 2K9SA 1DU6A 3IH3A 1XC5A 2DMQA 4DZJA 2HOAA 4Y52J 5DTDA 4MLOA 3BG5A 4NDLA 2EZHA 4DW6A 3WHCA 1ZQ3P 3A01A 1RETA 2XDNA 3KKDA 2HKUA 4BBRJ 1LE8B 3BQYA 4XIDA 3CCYA 3UKGA 5J1RA 1HDDC 1G2HA 1QPIA 3HTIA 1ETKA 2LVSA 4A3CJ 4ACIA 2P81A 4IHWA 2R0QC 2HOSA 2XGCA 1MBJA 3HKZN 4A3IJ 4C3HJ 1XS9A 1JT0A 3I4MJ 2QKOA 2ZCXA 3RD3A 5EYRA 4XK4A 3GTGJ 1UI6A 3NI7A 5J3LA 2ZCNA 2PMZN 3CJDA 3BTLA 3Q0WA 3GTKJ 2IEKA 3RKQA 2G7GA 3G1OA 3TW7A 2XPVA 2DMUA 5K7FA 4IHXA 5FMPA 3Q0VA 3HOUJ 1X2NA 2DA1A 3GTQJ 1A5JA 3G7RA 3MVPA 2XRLA 1LFBA 1VNDA 4GCTA 5IYBJ 4GCKA 3LSRA 2MSYA 3QKXA 3KNWA 1DU0A 3SFIA 1ITYA 1MNMC 1ENHA 2NVTJ 3WHBA 1D5YA 5F04A 3BR5A 2QTQA 4LOCA 4XICA 3VP5A 3D1NI 4M3BA 2EZLA 1UMQA 4FISA 2LK2A 2Y2ZA 1JJ8C 2HQ5A 3F0CA 2ECCA 2HI3A 5EZHA 1RKTA 4QIWN 3GTOJ 2DA6A 3S2HJ 2O7TA 2M0CA 3COLA 2ID3A 1IC8A 5C4XJ 5DAJA 2UXPA 5IP9J 2YVEA 5GPAA 4GFLA 1JJ6C 1MSFC 5FJ8J 1QVTA 2Y0SN 3L1PA 4L62A 3TEDA 1GDTA 2HDDA 1SANA 4MK6A 2VPRA 2X9DA 3NXCA 3BG3A 3TW6A 1ZKGA 1HCRA 3E7QA 2OPTA 4FE7A 3BR6A 3BTCA 5EG0A 5FKLA 4JYKA 3JRDA 2WAQN 3QQAA 2R7ZJ 1JGGA 2M9HA 1YRNB 4B1RA 2OERA 3ZQHA 1BL0A 2ME0A 3S1MJ 4A3LJ 2M2EA 4D5CA 2UXOA 1MH3A 3S1NJ 3H3VK 3B6AA 2NX4A 3AQSA 2NS7A 2Q24A 5FKNA 1VFCA 3S1QJ 4BXXJ 5JLXA 1PUFB 1ZGWA 2DMTA 4I76A 1I50J 2Y30A 5IPAA 5M5XJ 4C3IJ 1E3OC 3S14J 1OCPA 1HF0A 2UXIA 3BHQA 2DA5A 4IHYA 3K7AJ 1B72A 1H89C 3HDDA 3HOWJ 3JRAA 2GLOA 1OCTC 2D6YA 5K7ZA 3G56A 5C4JJ 1SFOJ 3KKCA 5K58A 2CU7A 2YUSA 2RHAA 3TP3A 1OJLA 2AHQA 3LSGA 2WB1N 2H8RA 2XSDC 2GENA 2QOPA 4YZEA 4MIMA 5FKMA 1ORKA 2DJNA 1HDPA 2NP5A 5CW8A 3BT9A 4M3DA 3IV5A 2EBIA 3ON2A 5EEAA 3NPIA 2XGEA 2ZOZA 1BW5A 3CRJA 1BW6A 4RBOA 3O60A 5E3LA 3BCGA 3V78A 5D18A 2PBXA 3CWRA 4AC6A 5F0HA 2DG7A 2PZ9A 4UUSB 4DYCA 2TRTA 1O4XA 5F0FA 3GTLJ 5CXGA 1MSEC 4JNNA 4JL3A 2V57A 5JLWA 3HBLA 2FX0A 3C07A 3HM5A 2O7OA 3JRIA 1T56A 2COBA 3JRFA 1X58A 3M4OJ 2IAIA 3OOUA 3E7LA 5HODA 3PPBA 3S5RA 4ME9A 4GFKA 2HOTA 4UUTA 3JRGA 4IEJA 4A3JJ 5M3MJ 3BNIA 2G7SA 3BR0A 1WH7A 4M3EA 3IH2A 1LE8A 4M3GA 1Y1WJ 2XPUA 5IP6A 2LP0A 3B81A 2YS9A 3GTPJ 5D19A 4G12A 1Q1VA 4A3DJ 5EZGA 3HOZJ 2JN6A 2TCTA 3CQZJ 4ICHA 4D7MA 4B3AA 1IDZA 1IJWC 3FRQA 3C2BA 2R92J 2WV1A 5FLMJ 1F43A 4MXMA 2XPWA 3KZ9A 3JRCA 5BNGA 2LLKA 1MH4A 1ETVA 4A3GJ 4UDSA 4CGRA 5EF6A 5J1YA 1IUFA 5F0CA 2E2JJ 3JRBA 1AHDP 3RQIA 1R9TJ 4BY1J 2HYJA 1B8IB 3G1MA 3ZQIA 2MW8A 5IP7J 1Z0XA 3HOXJ 3QPSA 2QWTA 1ZR4A 3VW2A 2D5VA 2L9RA 2X6OA 3HTJA 2HXIA 2JA7J 5J1UA 3VVYA 2W53A 2R93J 3S15J 1IV6A 1ETQA 2KT0A 2EZIA 1JKOC 5E3NA 3DPJA 5DS9A 2Y9YA 4A3KJ 2XB0X 2NVYJ 3QPLA 5F1JA 3HIMA 2H1KA 1AKHB 4D7NA 1TWGJ 3JRHA 2EQRA 1U78A 1FEXA 3VW0A 3HE0A 5F08A 2DG8A 2XGDA 1WPKA 1TWCJ 2HXOA 2ID6A 4W97A 2JA5J 1A6IA 1TWHJ 5FHPA 2X48A 4NELA 2GFNA 1ZK8A
chains in the Genus database with same CATH superfamily
3LA7A 5D6FA 1R23A 2KIUA 5HBUA 5ICEA 2ZXWH 4I02A 4M9ZA 4XRMA 2CS3A 3BG7A 2CJJA 1UG2A 1AU7A 3LFKA 2M8EA 3HUGA 1H8AC 2ZY9A 2DXIA 1E3HA 1LFUP 2QIBA 3GXOA 1SMYF 3PASA 1XGOA 3AFHA 1RPWA 3FISA 2XDVA 5HDNA 3CCVI 3CC2I 2J5OA 2BXYA 4FETA 2HKOA 4ZYGA 4BQNA 5M5WJ 1JUPA 5FKKA 2M30A 2G0EA 4KMUX 2Y0MA 2MH2A 3J7AO 1SC7A 2KHMA 4WCGA 3ERED 3S3MA 2EINH 1GHCA 2IU5A 1D3YA 5IYDJ 1HW5A 2G7HA 6PAXA 3QBMA 2CQXA 4A69C 5J6XA 2NXNB 2XGXA 2IS1A 4H4KC 4M74A 3WU1B 3HTAA 2E71A 1APLC 1OYYA 2PFVA 1F36A 2FA5A 2WADA 4YIIA 5J47A 3TMOA 2ZJPF 5EFYA 4DZPA 9ANTA 4ABZA 1S72I 3K4BA 2HEOA 2CFOA 5FGMA 3L2RA 4V2GA 1IXCA 2AQFA 2DYRH 2Z9OA 3ZN1A 3LFUA 2WY7Q 2XF7A 4AYBA 2QCOA 2ZFUA 4M71A 1FSHA 3A01B 4YFNF 4I6ZA 3RKYA 3CJNA 2VJIA 1W0TA 3A1YA 4ENNA 3C2GA 3L09A 2VXZA 3ZCOA 3J80Z 1MNDA 2M7BA 3VDXA 2RASA 3S93A 3ECOA 2OF7A 3BR3A 4L18B 4K2EA 3OYMA 1YW7A 3LNQA 3GFLA 3PNVA 4N4NB 3CCEI 2CGPA 1MIJA 4A5NA 1ZREA 2HVSA 1ONVA 5ILVA 3M1CA 3F8BA 3HGGA 4MEYF 5HDGA 2OU2A 3WGHA 1R5GA 4BACA 4MO7A 2P5VA 2DODA 3D5SC 2VBXA 3I59B 1ZR2A 2JA6J 2M34A 3IKTA 1D0XA 3K4KA 3T1BA 2PMZA 2IA1A 5TJJA 3JR9A 3DEUA 5ILSA 3RSNA 3CCQI 4XKBA 2ECBA 4PSWA 1K7AA 5FGLA 4AF5A 1XX5A 4OMZA 2ME6A 3A0HC 3SZPA 3BC8A 1CGPA 1Y1VJ 2QQBA 2R7WA 3KFWX 1JTXA 1MBHA 1W7PA 2X4HA 2ZO4A 2Z33A 3C1DA 3NRGA 5CVRA 2W4SA 2L7FP 3V8JA 4UNOA 2XB5A 3FXKA 3O8HA 2YPRA 4FASD 1PP7U 3OYDA 1K61A 3VFZA 3ZOBA 1BC8C 3B6CA 1F4KA 2IXSA 3E6MA 3E6DA 4XOTA 3OYCA 3HPGA 3HPHA 1N78A 3H0DA 1YX5A 2ZNYA 4C2TA 2F4IA 1O7LA 2H6BA 3E97A 4ASNA 2NVQJ 3MMYB 5IOZA 2QEXI 1WI3A 2ZCMA 5ICFA 1Y6IA 4HF2A 4U88A 3IUVA 2GBYA 2QM3A 4HEA2 5CQGA 5EDNA 5DD4A 5JR3A 1FBQA 3K9TA 3NWSA 4G6QA 3F6VA 5FLXZ 1T38A 4E7IA 2ICWG 2W25A 4JX6A 1KU3A 4LG0B 1XN7A 2E7WA 4Y15A 2YX7A 5ILUA 1HLVA 4HV6A 3H36A 3ZP5A 2GUHA 4HDUA 2QSHX 5TISC 1H0MA 1D8KA 1HSJA 3T6NA 1S7EA 2K4BA 2NVUB 3PUFA 3VUQA 4GCLA 1LFPA 3I4NJ 3RJPA 2CUZA 1JUSA 2EB7A 4XONA 2EV0A 4D5FA 3CCMI 2BY2A 1XDSA 3LQQA 5EGOA 3TBIA 3V6GA 1DUXC 2F2EA 2LF7A 2Z1DA 2L01A 3BZ6A 2CV0A 3RDIA 3K4CA 4B47A 1FP1D 4ZTFA 3BTIA 1YS6A 3L00A 2NS8A 1RRJA 3PNYA 1VTNC 2P6SA 2R5ZA 4DOZA 3RPQA 4XQFA 2Q2EB 4HAMA 2R3SA 2XRNA 2DA3A 2EFPA 3ABTA 3BWGA 4MTDA 3WTZA 4BE0A 4KWAA 3J7YJ 5CLSA 3K1PA 4MQ9F 4GRIA 4HBLA 1WVRA 2M8GX 2KIFA 4GFBA 3HTHA 4JKZA 2DFEA 2A3SA 2HZTA 1RC9A 2AQEA 1FMWA 1LDDA 2L2OA 3OMYA 3S16J 2A6HF 4NQWA 4RGRA 2K9SA 1YS7A 1DU6A 1YO5C 2V4JC 4DZJA 2GQQA 1P4XA 1JI8A 1Z6TA 1IN6A 4UXNA 1BR1A 3BG5A 2D1HA 2KQRA 4NDLA 2EZHA 4XORA 4DW6A 1ZQ3P 4RAFA 3MCZA 1SFXA 2V1NA 1RETA 3UR3C 4L0ZB 3UNGC 4MHGA 4G7OF 2MD5A 1L0OC 3M8FA 1YHQI 2X0LA 3CCYA 3ZXSA 4ANJA 2HYGD 2V79A 3IL2A 1T98A 1D1BA 1DPRA 1ETKA 1W4MA 3CO6C 2RGVA 1SD5A 4I0BA 2R0QC 3WGIA 2LRDA 3I4MJ 2ZCXA 2M45A 4ON0A 4IQJA 3RD3A 1FYMA 4XK4A 2VJ5A 4U7DA 4KT6A 5EJCA 3H5RA 3L2VA 3BTLA 4OAYA 2HDWA 3VYSB 1EJ9A 3RKQA 2G7GA 1MMNA 4PGGA 3H9JA 1Z6RA 3BDDA 4GXOA 2Q1ZB 1E3PA 2DMUA 3ML6A 4Z6YA 3V8LA 3VSLA 4IHXA 4XKWA 2R7SA 3KP2A 1UJ8A 2CQKA 1LNWA 4HKUA 1D5VA 2BVLA 3WTUC 1VNDA 4YFXF 4GCTA 2MSYA 1X19A 1EA3A 4F55A 1MNMC 3HYIA 4L9VA 3BR5A 4EM0B 3R60A 4XICA 5CVJA 5DCMA 2JSCA 2PFBA 1UMQA 4IJAA 1TNTA 2DOFA 1WWXA 4EJVA 1S3JA 3BCAA 2Y2ZA 1JJ8C 2HQ5A 1RKTA 4QIWN 2IA2A 3B73A 3MFKA 3S2HJ 2X51A 4HG2A 4ESJA 2O7TA 5C4XJ 4C2MA 1QPMA 2UXPA 2CW0F 3BZCA 5IP9J 2YVEA 1JJ6C 1QA6A 2IW5A 3AL0C 2E5NA 3L1PA 4BQQA 2WAQA 2OZUA 5HS9A 2F6CA 3TEDA 2R7XA 2QLZA 4MK6A 1JE8A 2GIZA 2X9DA 3HUGB 3BG3A 1OQYA 3FMRA 1Y8RB 3TW6A 1DQUA 1QQIA 5D5VB 5EG0A 3QYEA 5J40A 4G94A 1T0FA 3QQAA 4WF2A 1XB4A 1YJ9I 3DQVC 2GA2A 3TO6A 2OERA 2ME0A 4IOAF 3GZ5A 2E35A 2XAQA 1Z21A 1HXDA 2X1DA 1R22A 2UXOA 3OYHA 5HLIA 2CFXA 1VZ0A 5L3FA 5FROA 2E7XA 5L3CA 4BXXJ 2ZJRF 3PFIA 3HTUA 1ZGWA 2DMTA 2F5VA 3OYEA 4KN4X 5E1ZB 1VQ6I 2K3PA 3CF5F 5IPAA 1SMTA 2NNNA 3S14J 1OCPA 3W3CA 1RUOA 2DA5A 5L3EA 5FRMA 1B72A 3HOWJ 1R49A 3HDDA 1OCTC 2JUCA 3FXUA 3TP3A 1OJLA 2WB1N 2H8RA 2JQ7A 3AKZA 3KP6A 5LEKA 4WX9A 2VB6A 3U2RA 2NNYA 1O3RA 2A61A 3I64A 4L0YB 3R6SA 1HDPA 1FLIA 5CW8A 2EBIA 2FMLA 5EEAA 2W57A 4KMFA 2H09A 2ZOZA 3E6CC 1BW5A 2GXGA 1SVMA 2KPMA 1R58A 3FWEA 1XGMA 5DV5A 5F0HA 3CUOA 1QU3A 1SVLA 2VE9A 4AU7A 3K70C 2QQ9A 1MSEC 4JNNA 3P5JA 3LSMA 3N97A 1UHMA 3C07A 3JRIA 2COBA 3JRFA 4XLEA 1LEAA 2XKPA 1AA7A 2PN6A 1QZZA 1SD4A 2VL8A 4GFKA 1LEBA 3GFMA 4ZYDA 1EH8A 4IXAA 4UUTA 4IEJA 3KP7A 4HA8A 3FM5A 1A36A 1YYVA 2XC7A 1V55H 1X3WB 4RAGA 1ODDA 2L4MA 3IH2A 1UB9A 2DLLA 2XV4S 3GO5A 3K4NA 4LITA 3DLLF 2OD5A 3JSPA 5E18F 1A35A 3GTPJ 4G12A 2P5KA 1Q1VA 5EZGA 2JN6A 2TCTA 3K0LA 3FXRA 2PX9A 3CO7C 4YRVA 2R92J 3H9GA 4RAYA 1W7PB 2IVMA 4S04A 4KJZA 3WTVC 1PYVA 2AS5F 4OIPF 3OYIA 5BNGA 1SFKA 2R7FA 1MH4A 1ETVA 3CP2A 3HIFA 3PSFA 3O3KA 3ELKA 4C9YA 3DXJF 2E2JJ 3JRBA 1AHDP 3IC7A 4D9JA 3RQIA 3BJ6A 3KP4A 2HYJA 3G1MA 5IP7J 3MZYA 1J2XA 1ZR4A 4I2OA 3KEOA 4ZJZA 4XLPF 3HTJA 5J8CA 5J1UA 2X85A 4CCKA 2KIMA 5DS9A 2Y9YA 3FZVA 4A3KJ 2XB0X 2NVYJ 3QPLA 4A12A 2VONA 4D7NA 3JRHA 4II2A 2UWMA 3H92A 1IN5A 1UCRA 1YE9A 3V4GA 1XSVA 4OIRF 4HDVA 3PJRA 2HXOA 1V3FA 2DT7B 2ID6A 4RB1A 2BW3A 4BAYA 1A6IA 2JA5J 1K6OA 3DU5A 1ZK8A 3A2KA 1AKHA 2LFBA 5A2QK 3W6JB 3WTSC 1IUYA 1R7JA 4BY7J 4J01A 2B7EA 3IWZA 2IBDA 1ZTRA 1I1GA 2XAFA 5CVIA 3RZOJ 5M5YJ 5HLTA 2KFDA 3LL7A 5JI6A 3LJLA 2W7NA 1FP2A 2XAJA 2DN0A 2CV1A 2PEXA 3FIWA 1YRNA 3SJMA 4A3FJ 5LGUA 2VXDA 4BBSJ 1K6YA 1X1DA 2LMDA 5BOXA 3RPUD 3TOAA 2LREA 3C2HA 3RI4A 1BJAA 2BOLA 2BV6A 4LK0F 3RKWA 2VUMJ 2GZWA 3CC4I 3MNLA 3HGYA 3VVZA 3EYYA 1PUFA 1XGNA 1R36A 4NBQA 1MDMA 1X2MA 3HEFA 1FIPA 2KJBA 3SFZA 1ZYRF 2VOOA 2K85A 3I55I 2CUEA 1VQ7I 2DTZA 2ESNA 2NYXA 2HU9A 1OPCA 4CYCA 3W6VA 1XCBA 4HX8A 5KHDA 3J80K 3ZGKA 4QSHA 4PFOA 1OCOH 1XMKA 3DF8A 1K4TA 3CD6I 5IT3A 1GT0C 4LD5A 4MQVA 2AXTC 3GMEA 5K5OA 4CSWA 1ZRCA 2FMYA 2EILH 1P4WA 1I1SA 2QQAA 2EWNA 5K7HA 3GTJJ 4Z2YA 1JTYA 2IGMA 2HVQA 2VE8A 5FO5A 4D1QA 4FE4A 2DDBA 5K1YA 3KP5A 5DYMA 2F4OB 5HSZA 4NN1A 3U1KA 1FC3A 2Q8KA 1VI0A 3GZIA 3FXJA 4DQ2A 2ELKA 2MABA 3DEWA 1HQCA 1I6HJ 2R5YA 2DO7A 5E8IA 1YX3A 3F3XA 4F52A 4IQ4A 3OY9A 2WC2A 1X1AA 2ZOYA 3T0YA 4MFEA 3RQ4A 1UI5A 5D4SA 3EUKL 4IF4A 2YVHA 2MH9A 4XLFA 4CZZA 1T33A 4W1UA 3QYBA 1CQTA 2LC2A 3ZQ7A 2EIJH 3Q0UA 2FBQA 3A02A 1Y8QB 3TO9A 2EPFA 3HKZA 2VKHA 1RR8C 5GPCA 2KMUA 2G3BA 2DFHA 3X2QH 4Q4ZF 2BE5F 4L5JA 3SEQA 3JAMZ 1NH3A 3BR1A 4S05A 1ZG3A 3O8GA 3OSGA 2DMPA 1BI0A 4QPOA 3P7NA 2ZXJA 1VQ4I 3DPTA 2GXAA 2JJ7A 2WBMA 3CLQA 2VI6A 2M7AA 4ESFA 3HSEA 3I53A 2DA7A 3H5AA 2Y9ZA 2QVOA 3QWLA 4Y3OA 4ENJA 4F93B 2JA8J 2K9QA 1HW2A 1QGPA 2KZVA 4QPQA 2WGBA 1LPQA 2JMWA 5DCMB 2E2IJ 2FEZA 4Y7NJ 4B43A 2A69F 1B8IA 3WTWC 3PO2J 2JPBA 1E0EA 3RYRA 1CF7A 4XMYA 2CUFA 3VTIA 3DCFA 3DTEA 2XKOA 3DP7A 4PCQA 2B63J 5GTIC 2XF6A 3LSJA 3F1BA 1I27A 1WI9A 2QSGX 1A6QA 4JP0A 3VPRA 1U8BA 1G4DA 2A2FX 1EH7A 2OV7A 3PQKA 5EG0B 4HV5A 2CO5A 5E3MA 1FNNA 3CDIA 3LA2A 2NVXJ 1R4NB 5HS7A 3ZN0A 1XMXA 4EVIA 5D4RA 4U9NA 4RS8A 2FBHA 3BR2A 2HQAA 4BHCA 4RB3C 3RZDJ 1R1UA 3OL4A 3ROUA 5J8FA 3GTMJ 1KU2A 2P4WA 4UY8I 1HOMA 2RQPA 4ZC3A 1IG7A 2STTA 1BOBA 1FY7A 1MBFA 2WTEA 1G3WA 5LRSA 1NG6A 1WJ5A 4XR6A 2RQQA 2L54A 3RCOA 3BY6A 3FKIJ 4H0EA 1B72B 4MNUA 3GWZA 4LB6B 4G7ZF 5A2QZ 3OIOA 1I3QJ 3ANGA 4HF0A 1Y0NA 2MG4A 1VF9A 4BNCA 2W85A 3NRVA 4BKXA 2W00A 3G2BA 4L5EA 3ECHA 4WIBA 2LBFA 3NNRA 5KAFC 3I9V2 5D5UB 4WXCA 2FRHA 2LYCA 2G7LA 2L4AA 3KPHA 2HQNA 3K4JA 3ERMA 5ED4A 2OJED 4BL0B 3U9GA 3OYFA 3WE3A 2V6EA 1TQPA 2LSOA 1W1WE 1MJ9A 3PQJA 3S2DJ 2FXAA 4RMNA 2F5EA 4ZH4F 3ZR8X 4XRSA 1BA5A 3PNTA 4P55A 3RH2A 4B4CA 4XLHA 4DYQA 4E7SA 2R7DA 5B3SH 3LSPA 2VLAA 2COMA 5HNFA 1V4RA 5AQCA 4S0HB 3DPLC 1J0RA 1V5EA 2MLKA 1MBKA 3HTSB 1O7FA 4PFPA 3HHHA 1NK2P 4L9NA 1XC5A 2DTRA 1EV7A 3WE2A 2R4GA 3PSIA 1Z1DA 3KKDA 1SEUA 1P2FA 4EV0A 3BQYA 2KZGA 4KDPA 3TL4X 4BEHA 5J1RA 5B1BH 1G2HA 2HPMA 3HTIA 2E36A 2P81A 2F5FA 5H6RA 2Y48A 2DK5A 3E5UA 1Y0UA 2HDCA 3K1MA 2O3FA 4A3IJ 4NC6A 1XS9A 3KX2A 2QKOA 2ZMEA 5B66C 2L5QA 3OS0A 4B48A 4CCNA 1IN4A 4RLFA 1SAXA 3CJDA 2MC4A 1TW2A 4KN7X 3GTKJ 3N4MA 1OKRA 1XTAA 3ABLH 3DBLB 5B5EC 1FOYA 3TW7A 2XPVA 3WTXC 5LGTA 1SVOA 4E7LA 5K7FA 2A5YB 1KONA 5KAIC 2DBBA 1X1CA 2L9VA 2IS6A 5FMPA 5JVGF 1N77A 3HOUJ 1X2NA 2V26A 3MVPA 5BPDA 3I0TA 1LFBA 3VYRB 2WV0A 1WJBA 2Z16A 4R8HA 3KYLA 1OR7C 3LSRA 1IN7A 4CCOA 1R1VA 1DU0A 3SFIA 2JTVA 3SHFA 3HHGA 4DIQA 4GO1A 4BQOA 3VP5A 3D1NI 1B59A 3BOQA 4O6JA 2VBZA 2ZNZA 3TQNA 5EZHA 2HI3A 4U7BA 2BW3B 4DNCA 3ZMZA 3FXQA 2PJRA 5DM6F 2HOEA 4AWXB 4GFLA 5E8GA 5JVTA 1QVTA 1W5SA 4ZTJA 2Y0SN 5B1AH 3DU6A 4HPQA 3PIOF 2HDDA 4QLCU 1HCRA 1ZKGA 3Q9VA 3E7QA 1J09A 1XMAA 5FKLA 4JYKA 4LMYA 1QZEA 2WAQN 4KISA 2M3AA 1JXSA 2M9HA 2D1VA 2X1EA 3ZMVA 1YRNB 4B1RA 2KP6A 1VQKI 3ZQHA 1ZG5A 1BL0A 1SAUA 2P5LC 3CESA 2M4KA 2M2EA 2Z2SB 4D5CA 3LWFA 2DT6A 4FX0A 3S1NJ 4IPAA 1ON1A 2F4MB 2I8DA 3L2CA 5GADJ 3ISPA 4UVCA 2NS7A 2YX4A 3JW4A 1VFCA 1VQOI 1PUFB 5ICCA 1MDMB 4U0VA 3HZJA 2HGCA 4G9YA 1HF0A 2UXIA 4PGHA 2VBWA 2V6CA 3TOBA 3JRAA 1YG2A 3KZYA 4JQFA 3KLNA 2CU7A 4IL6C 4Y33A 2LY2A 2MC3A 1YW9A 3ZMSA 1MMGA 1WFXA 3WTTC 4HNUA 1BIAA 2GENA 2QOPA 4CGZA 4EJUA 5HS8A 5DD8A 1GVJA 5BQTA 5FKMA 1YQAA 5CJ9A 4IOCF 5D5WB 1YTYA 2GOMA 4M73A 1ZRFA 2NRAC 2QBYA 4M3DA 3CMMA 2CMPA 1IN8A 3NPIA 4NNJA 1V5GA 2VC1A 1ZAOA 2OQRA 3WTYC 4KIBA 2EFOA 3W6KB 4HLXA 1L3LA 2PBXA 4ITVA 4AC6A 2M87A 2DG7A 3L7WA 2O8XA 1B9MA 2H1LA 1D0YA 3B02A 1S29A 2O03A 5F0FA 3GTLJ 5CXGA 2BYVE 4JL3A 2V57A 4ZYEA 5LHIA 3GEZA 1B1BA 2XAUA 3F72A 3MEXA 5H2FC 2BBYA 2IAIA 2VJJA 3E7LA 5LRRA 2AXLA 1YLFA 1OYIA 5GAGJ 2IS4A 1VQNI 1IXRC 3JRGA 3RYPA 4I01A 2UZKA 3EETA 5L3GA 1WH7A 4M3EA 4BUPA 1Y1WJ 2O0YA 2MBFA 4KYWA 5IP6A 1XSDA 2GIVA 2YS9A 1MNEA 1J5YA 4UHTA 3HOZJ 2DFIA 3CQZJ 3DTKA 4OINF 2BHYA 3P9IA 4OD5A 1WJDA 1IJWC 2F5DA 1FOWA 3G6EI 3C2BA 1V5FA 5JHUA 3VODA 2TDXA 5FLMJ 2XPWA 1F43A 2IA0A 4QWQA 5E79C 4JOMA 3V42A 2FNPA 2CQNA 3OS2A 5F0CA 1LQ1A 3CC7I 2KIQA 3SYTA 4HQMA 2YSRA 3MQ0A 5AONA 3HSRA 4A2UA 5KVRA 1B9NA 2ZJQF 1R9TJ 4BY1J 1B8IB 4OD4A 3VYUB 2J5PA 4BDYA 3HOXJ 3QPSA 2L3DA 4A5MA 1SD7A 5HOOA 2RV8A 3VW2A 2L9RA 3AG2H 2ADUA 2ELJA 1UHWA 1T39A 3EUAA 3CCUI 3U1DA 3VVYA 2DW4A 2A6EF 3V7RA 2KT0A 3BZKA 4RGXA 1USSA 1YFHA 1XSXA 2KL4A 1MD0A 3C18A 1U78A 2EQRA 1ZGAA 4L9TA 1X1BA 3SQNA 4P96A 4RAZA 2WAFA 3FBNB 1WHUA 1TWCJ 3KZZA 4NELA 2R7VA 2MA3A 5FHPA 1TWHJ 4ZZLA 2CV2A 1ZRDA 4PJLA 2DU9A 4EM1A 1FMVA 4KT5C 1P9QC 4LIVA 4BHBA 4DBQA 2STWA 3AQTA 5K5RA 1A31A 1OFCX 3P9TA 1IAWA 4KNYA 3IUOA 2B3WA 4F91B 2Z3YA 2JA2A 3KE2A 2QF7A 3M7GA 3VOXA 3MN2A 4PXIA 3CDLA 3S3OA 4IHVA 1DGRM 1TWFJ 2CYYA 1XG1A 1H88C 1K83J 4GYGA 2REKA 4HOBA 3OR2C 3M3YJ 2PMHA 1HKQA 2KRCA 2XROA 4KA4A 1FBUA 3PM1A 2DPUA 3VOKA 4ENKA 1FIAA 1W5CC 1FX7A 2KDOA 5BS6A 2LBFB 2I5UA 1XDUA 1W7PD 3SXYA 4KUMA 2HKXA 2EK5A 2EJRA 2QUFA 4OOIA 1SFUA 1RESA 1U9NA 3BTJA 4HSRA 4U9LA 3WU0A 2P6TA 4BDZA 2DOAA 1EKEA 3E5QA 2BXZA 4V2FA 1IDYA 1ETOA 2VN2A 2D45A 4CXFA 4HNVA 2CSOA 3L2WA 1U3EM 3LHQA 3WG7H 3FBIB 3LSIA 4BYYA 2JT1A 1MZBA 2ZSIB 3VVXA 2QGUA 3CMYA 4I7HA 3DWLE 1Z67A 3JAMK 2ISYA 4U87A 4C3JJ 2WA0A 1YJWI 1WH5A 2W48A 1MBGA 1BI3A 3FHZA 2P7CB 3JREA 3HOSA 1VQ8I 1MMSA 2DMNA 3KEQA 4LLGF 2QENA 3A4CA 2HPIA 4UUSA 2UXHA 3WG9A 1X3UA 1UG0A 4BEHB 1JKPC 4GDFA 2JRMA 3JSJA 1IRXA 3R4KA 1KA8A 1I3AA 1WQ2A 4XSXF 5LHHA 1Z77A 3QRFF 4FHTA 4X1EA 1J9IA 3D0SA 3VYTB 1FJLA 1GVDA 2K3FA 2A07F 1QRYA 3SDGA 1GV2A 2LKPA 1POGA 2QKMB 2BY1A 1R4MB 2BGCA 2KJCA 4UVAA 5BPIA 2E1MC 4LJZF 1NHAA 4M3FA 1S7AA 5CPRB 4A93J 3D5LA 1YJNI 5LBQA 3E1SA 2LR8A 4AIDA 1QBJA 3BG9A 2W82A 2V9KA 1RZ4A 2LF8A 3E6BA 2O9LA 2DA2A 1N25A 3K70D 2L0KA 5CVUA 2W84A 2PBIA 1PDNC 5CVVA 5H9TA 3OIQA 3BROA 2IPQX 3WODF 5D1RA 3OSFA 1ZLKA 2F48A 3ANPA 3ZQQA 3PUBA 3A03A 5AIPA 3Q9SA 1KU7A 2B0LA 2AO9A 2K9MA 1MMAA 4F7ZA 1TL8A 3DBHB 4E7JA 2ZXHA 3ON4A 2JRTA 4A6DA 2PJRB 4KIGA 4B44A 1H9TA 4C2UA 1R5HA 3J7AY 3FK6A 3PO3J 1VQPI 1TWAJ 3CCRI 3KYCB 3R61A 2L7MP 2QZ8A 3JTHA 4G6TB 4P5OA 1IO2A 4M9SA 5KCMA 2JZYA 3EYIA 2MLGA 1M1EB 5DM7F 3CJQB 1Z9CA 1ULYA 1U0JA 4BS9A 2O8KA 5CKTA 1GXPA 4XNFA 1RKWA 4WWCA 1U8RA 3I5UA 3ZQGA 2NOJB 5KK1A 4A3EJ 3TKYA 3WU2C 1JUMA 3JTGA 2K02A 3S17J 1U6GA 3CMEI 3GVAA 3GZNB 3QU6A 5EGOB 1EF4A 2YU3A 1JGSA 2DJIA 2P0WA 5LD2C 1JKQC 3G1LA 1I6XA 3U21A 4KICA 4XRFA 3VOEA 1D0ZA 1JKRC 5IYCJ 3V7CA 1WCMJ 4NC7A 2MGQA 4YEJA 1IGNA 2PLYA 4A3BJ 1T0FC 3LSKA 4LG0A 4PJJA 4FT8A 2R5ZB 1P7IA 2EH3A 4KITB 5D5XB 1BJZA 4RB2C 3NEUA 5CQEA 3OV8A 5C3EJ 3JCUC 3QOEA 3BRUA 3BJBA 1IRZA 1FSEA 2CRGA 3GLXA 1XGSA 3PFYA 3LA3A 4FCYA 4A0XA 1ON2A 2VKEA 5FKOA 1GUUA 2K40A 2WB1A 2IRFG 1DGWY 2JVGA 3I54A 3QP6A 3KEYA 2V9PA 2NOGA 3P9CA 3TDUC 1FTTA 3QPHA 1WJAA 1P7JA 2EIMH 2EZKA 2OZ6A 4XKVA 2KISA 1TT0A 4AC0A 2LD5A 4HX4A 1RR7A 3DBRB 1T2KA 4EQQA 4NQWB 5FRNA 2HYTA 1RNLA 4BGDA 2DPDA 3BPVA 3L2QA 3EUHA 2A05A 3J81K 3TDZC 4N9IA 3BQZA 4AUXA 2BHZA 3CCSI 2VJ4A 4IHSA 3ONQA 4HNTA 4BE2A 2LKXA 1W0UA 2V9VA 2E1MB 3CF2A 5C44J 1W5TA 1E17A 3OYGA 4R1HA 1Y56A 2BZTA 1S8NA 4AYBN 5M3FJ 5FFZA 3IHUA 3KETA 3IH3A 4BJ5C 2DMQA 2HOAA 2NAZA 1ZG1A 3FMSA 4MLOA 3WHCA 2XDNA 3M8EA 4BBRJ 2PI0A 2OUMA 4XIDA 1HDDC 1QPIA 4A3CJ 2XAHA 1K79A 4PK4A 1S9HA 2OBPA 5LFAA 4IHWA 1QNTA 2HOSA 4Y13A 1IRGA 3LAJA 3HSFA 4A6EA 4CICA 2EFWA 1K4SA 2KRFA 2RNGA 1LB2A 1WSUA 3K6GA 5EYRA 4BE1A 2V1DA 3ABUA 1UZCA 3SEZA 4M9XA 3HOTA 2PMZN 3HRUA 3Q0WA 2IEKA 4XKCA 1C0WA 2W24A 3G1OA 2ACJA 3BG6A 2IT0A 2FE3A 4IRHA 3K8PC 4OU0A 2ZSHB 1P6RA 4ZDOA 1X3ZB 1KYWA 2MFZA 3W2WA 3NQOA 2UXXA 1X4OA 2RREA 2LKSA 1A5JA 4PZJA 3OWTA 4D0PA 3DV8A 2RVCA 3AG4H 1FYLA 2V7FA 2QKLB 4GCKA 1Z3XA 4M6XA 1QO0D 1WJEA 3QKXA 1P92A 1ITYA 3EPZA 3H9QA 1P4AA 1S7OA 3WHBA 2GOXB 4G8XA 5F04A 4LOCA 2CG4A 2Z5UA 2VT3A 3GUDA 3CCLI 4F3QA 1PP8F 4RLQA 4PJMA 2DI3A 2E1CA 1UFMA 1H9GA 2DA6A 2HR3A 2JUGA 2PMUA 1OMIA 2VPLA 3QP5A 1IXSB 2UUZA 3QAHA 4WXHA 5GPAA 5DEQA 1FWZA 2UXNA 4PDKA 2VQHA 4L62A 2LG4A 2FBIA 2X1CA 2HTSA 2HVRA 3NXCA 1IF1A 1BC7C 1BR4A 2EA4A 2LH9A 2OPTA 3BR6A 3BTCA 3E5XA 4FE7A 3JRDA 1ZH5A 1PVEA 3IWFA 4DJAA 1RUNA 2L9SA 4ETSA 3GFIA 5F1RA 1FBSA 3DKWA 2XF5A 3JSOA 4C30A 2RKHA 3KIOA 2BVMA 1T6SA 4MGRA 1MH3A 2ZJ2A 2CQ7A 3FHNA 2ETHA 4OWRB 3OYLA 1KYZA 3B6AA 1NG7A 3H3VK 3HRMA 2NX4A 2VOPA 2Q24A 2XHKA 4AVZA 3OL3A 3S1QJ 5JLXA 4BXUA 2NS0A 4NUBA 5JFRA 4PJ0C 2QYOA 1B6AA 4OAZA 1TP4A 1I50J 1X1PA 1BBYA 2Y30A 4A0ZA 3ZMTA 4LLNA 4C3IJ 3E3VA 2VQCA 2LDUA 4IHYA 3K7AJ 4RGSA 4BU2A 1H89C 2D6YA 5K58A 1IRFA 2Y69H 3FKJA 1U5TA 4LIUA 5C4JJ 1SFOJ 3KKCA 1BM9A 1MGTA 2RHAA 2AHQA 3LSGA 5E1WA 2BY0A 2XSDC 1OCRH 5HDKA 4YZEA 2QA4I 2FBKA 1LKXA 4MEXF 2VQLA 3ASNH 2Z99A 3F8MA 3GCMA 4ESBA 4P9UA 2OCCH 1D1CA 2NP5A 4EM2A 2L9NA 3AAFA 3IV5A 4HF1A 4I0AA 4ZDLA 3R0JA 2DQLA 1BW6A 2VKDA 2HNHA 2R7UA 2K27A 3OR1C 4FQGA 2ESHA 1DPUA 1ZELA 1WKMA 3BCGA 5E1XA 5E20A 5D18A 2O61A 1VQMI 3DPUA 4UUSB 4DYCA 1O4XA 4CUGA 1KQ9A 4HQEA 5JLWA 5ICGA 3HC7A 2FX0A 4XLCA 2CUJA 4CDGA 5HLGA 2WWYA 3CUQA 1USTA 3M4OJ 1U2WA 4M6YA 3OOUA 5HODA 2HTJA 2QSFX 4NC8A 1XD7A 1TQMA 2HOTA 4PUSA 4P9FA 4A3JJ 1R5ID 5M3MJ 1R1TA 3EUHC 2DAOA 2EA2A 3DLAA 3J81Z 2G7SA 4FX4A 3PIPF 1LE8A 4L5IA 4F92B 3CMAI 2F5CA 2XPUA 5IT9Z 3OIPA 3KCCA 2CW7A 2LP0A 2L02A 4RA2A 5D19A 2MD0A 5D8KB 2OTLI 2KKOA 1QHGA 3BCBA 3CJRB 4ICHA 1IDZA 5L3DA 3GFJA 2DCEA 4O5VA 2WV1A 4AIJA 1ZGJA 4MXMA 3KZ9A 3JRCA 1G8XA 3ASOH 2LLKA 1YOVB 3QOPA 1KZHA 2YR2A 4A3GJ 3LSTA 1WJCA 3DTIA 5EF6A 3HXLA 5J1YA 1IUFA 3WGGA 1ZLJA 3H35A 3CTAA 1TTYA 3J7ZI 4XN3A 3W2AA 2GAUA 2QWTA 1BOAA 1IZ1A 2PG4A 1FOXA 3SWHA 4AD9A 1I39A 4E7KA 2CW8A 1LVAA 1VQ9I 4UB8C 2W53A 4XSZF 1YITI 1IV6A 1ETQA 2EZIA 3ZMUA 3S2WA 3DPJA 4E6KG 4IX7A 5F1JA 2Y75A 3IKVA 3CCJI 2H1KA 1AKHB 1WZ2A 1TWGJ 1FEXA 4AIHA 3HIMA 2HQRA 1XPXA 3VW0A 3HE0A 4G6DA 4U0YA 1QHHD 2XGDA 3RKXA 3H1CA 1G6NA 3RTRA 5GAEJ 1J59A 2EFNA 2G7UA 3T8TA 4W97A 2QQ8A 3GF2A 1T8IA 3OYNA 2GFNA 2A5WA 2YU9J 2P8TA 5LEJA 4OIQF 4UV9A 1T08B 2KLOA 2H94A 2B1EA 3NAUA 2HYFA 1HC8A 2NP3A 1GV5A 4JX5A 3N05A 2FOKA 5GTHC 1ACIA 4LG3A 1SFEA 3FM3A 4YG2F 4EEFG 2FOWA 3QODA 4HLYA 5HVQC 1MW7A 1G59A 5H20A 2ZB9A 1UAAA 1O3SA 3BP8A 4IRIA 4BQAA 1MBEA 5IOYA 2RAEA 4CYCB 2KDZA 4GYIA 2H27A 1D1AA 3K2AA 3S8PA 1RIOH 2DQRA 4BHPA 4EATA 2DA4A 2EIKH 2IGNA 4XRSG 3S1RJ 2K9LA 1VQ5I 3EQLF 4E70A 1E2XA 2VODA 2K9NA 3ZMDA 3I71A 2ZCWA 2HFHA 1R71A 1ETYA 1R00A 1F5TA 2N8GA 3TP0A 3G4SI 1OYWA 3I4PA 1BN5A 3ZQCA 3G73A 2E1OA 5F64A 5D8LB 4O3MA 5CXIA 3IH4A 2I10A 3FX3A 3CDHA 1N75A 5EEGA 1U9OA 2OC6A 3MKLA 4A3MJ 2C6YA 4LB5A 3MKYB 2FQ3A 4LK1F 4Q47A 4CH7A 2GM4A 5KNLA 3I56I 2R5YB 1Z3YA 5J4VA 4EGZA 2FF4A 3MD2A 1U5TC 2EV6A 3FF5A 1G3TA 2O5RA 4JBAA 3VB2A 3SDBA 3F21A 1NTCA 1FT9A 3BJOA 2IS2A 4C2MJ 5L3BA 2UXUA 2R7OA 2DDAA 5C4YA 5LHGA 2VKVA 1TC3C 1BR2A 2X6WA 1Y39A 1S6LA 5FB2A 1TW3A 4CCMA 4N4OB 4UV8A 1ERDA 3RIRA 2OAZA 2ZXIA 2HS5A 4IHTA 1ZN2A 2LY9A 2FJ1A 2Y31A 1GLNA 4MFDA 2VASA 1HKTA 1LVKA 2WUIA 4UUVA 5HNHA 5HAWA 3REOA 3I3LA 3VIBA 3LMMA 2M5WA 2FD5A 4N9HA 4WXDA 2XIGA 1JT6A 4NB5A 2W1OA 2DFFA 3AG1H 3KLOA 4X6AJ 1OLTA 3CP8A 3CLOA 1NK3P 2ZKZA 3CUQC 4ZZDA 4PJNA 3RPUA 4FTHA 3F8NA 1W36C 1QVUA 1ETWA 4HRIA 3EDPA 4JX4A 3LWJA 4HW0A 1X4PA 1WGXA 1ZARA 5FD6A 2JWTA 2ZMEC 3T8RA 4I99C 4XM3A 2A6TA 1K78A 1S5LC 1CF7B 5F6FA 4QTRA 2IJLA 3EUPA 1O57A 3HOVJ 3K10A 1TBXA 2E19A 2JK3A 2EFQA 5E17F 4AIKA 3HB9A 3W2VA 2OQGA 4DYRA 2F07A 1F9NA 2PQ8A 5DUKA 4II3A 1XCVA 1LDJA 3HOYJ 3ULQB 3G71I 1EH6A 3GW2A 3FXLA 3VEPA 4IO9F 3GZ6A 3Q3SA 5F27A 3FMQA 2Y0SA 3GLLA 2LTPA 4CCJA 3H0GJ 3NARA 5FD5A 2X6XA 3I58A 1AWCA 2O6GE 1FYKA 1W36D 1STZA 2H8WA 3DFGA 3LOCA 4U0WA 2B9SA 4OIOF 1SGMA 3ABKH 3ABMH 3K69A 4Q48A 1SD6A 2JVHA 1FTZA 3S3NA 3HRTA 4J19A 3ZQLA 3FK7A 1Q1HA 3F22A 5E3OA 2OI8A 2L7ZA 3QPTA 3DKXA 5J4YA 4YELA 5TGTA 2L7KA 2CQQA 3CJTB 1U5TB 5GP9A 2K4JA 3FDYA 2DOEA 3M9AA 3GYHX 4EGYA 1BIBA 2M1BA 3F9KA 2RN7A 2K5CA 2R7RA 4GCVA 1YIJI 1MJBA 2VBYA 3EGQA 4XOPA 1BI2A 4RM2A 1QZYA 3OS1A 2CWEA 4BJ6C 3VW1A 3ZRGA 1WRJA 4KIFA 3QU3A 2QWWA 2V1UA 1IW7F 1ETXA 4IVNA 3V7SA 3ZQFA 4RDUA 3COAC 3MAJA 4CZCA 2IGKA 3GX4X 2FQ4A 3GBGA 4ZDPA 2E2HJ 5JHFA 2FU4A 1UHSA 3CUQB 4M6VA 1KU9A 2DT5A 5FLVA 4I98B 1RI7A 4HZFA 4N0BA 1Z05A 3LSHA 4XBFA 4Y52J 5DTDA 4XL9A 2BEOA 3A01A 4BXFA 3SZGA 4IKFA 4L9JA 1J7KA 3BPXA 2HKUA 1KGSA 3HG9A 4R79A 2ZMEB 1LE8B 3ZPLA 1OCZH 3UKGA 4Q5SF 1TLHB 1DP3A 2LVSA 4XN0A 3K4LA 4ACIA 5LGNA 5H6QA 2VQGA 4RGUA 4ENMA 1IV8A 3OYKA 2ELHA 2XGCA 1REPC 2HZDA 4CO8A 1MBJA 3HKZN 1R6RA 4C3HJ 1JT0A 3O6BB 4CCLA 4IRGA 1GXQA 3GTGJ 1UI6A 4IRVA 4XLNF 3NI7A 1YIOA 5J3LA 1OCCH 3OYAA 2ZCNA 3KP3A 2LOOA 1I5ZA 1Z7UA 3I59A 4EJTA 2FNAA 3VSKA 2FUG2 5IY5H 4IZZA 1F1ZA 2P7VB 2G9WA 3V8KA 3Q0VA 3E0JB 3SZTA 2RC4A 4YIFA 2DA1A 3O2PE 3GTQJ 3G7RA 4NHJA 2XRLA 2OA4A 4UB6C 3S32A 2XAGA 5IYBJ 1ZHFA 3AL0B 2Q0OA 2XASA 4E7ZA 3Q5FA 3KNWA 3MZHA 3HL2A 1ENHA 2NVTJ 5BMZA 3T5XA 1D5YA 1PUEE 1HBXG 1YW8A 4WK8F 2QTQA 2OCEA 1UELB 4M3BA 2EZLA 2IP2A 2GA1A 4LLLA 4FISA 4YFKF 5DDGA 1O3QA 1KQ8A 2LK2A 3OOPA 3F0CA 1HW1A 2ECCA 3GTOJ 5CYVA 1JHHA 5HLHA 4XLAA 2A68F 5FFXA 3A0BC 3COLA 2M0CA 5DAJA 2ID3A 1IC8A 2RNJA 3HJEA 1MSFC 5FJ8J 2DYSH 4UVBA 3F6OA 4Y4RA 3L2UA 1FPQA 2JPCA 4X0GA 4V19K 3LQRA 2LNBA 3LAPA 1GDTA 1SANA 2VPRA 2FSWA 1MKMA 2K86A 1DDNA 2E1NA 1JHFA 1KQ0A 3OYJA 2YVXA 2R7ZJ 5DCFA 3K1NA 3MKWB 2LY1A 1JGGA 5GAHJ 2D2WA 3S1MJ 4A3LJ 1LDKB 4E4HA 5TRDA 2EV5A 3IP4B 3KZIC 4BH9A 2V1XA 4HYEA 2RDPA 2PJPA 4LGWA 4CA0A 3AQSA 5FKNA 3QYFA 4E7HA 3VWBA 1A04A 2E60A 4EJWA 3BLYA 4I76A 2ZC2A 4ZYAA 2KRHA 3NWTA 4DBRA 5M5XJ 2XUBA 1E3OC 3R0AA 3BHQA 4AVPA 4HX7A 3G56A 3GEUA 2GLOA 1B4AA 3MZ8A 4BJTA 5K7ZA 3F23A 2QBYB 3IRRA 2YUSA 1O3TA 3P9KA 2ISZA 1D8JA 3F8FA 2H6CA 5D6EA 2WAEA 3F8CA 2ZBKA 2JSPA 4CYDA 4MIMA 1ORKA 1HKSA 1FZPB 2FJI1 2DJNA 3BT9A 3K2ZA 3ON2A 3D5RC 2Q2EA 2R7TA 2XGEA 1G3SA 1YI2I 3CRJA 3IAS2 1TZLA 5IT9K 3AG3H 4RBOA 1DP7P 3O60A 1OISA 5E3LA 3V78A 3CWRA 4PSXA 2PZ9A 2GXBA 3H3UA 2VT2A 3M1EA 4P1WA 2TRTA 1VQLI 4RB0A 3IAM2 4KFCA 4ZYHA 3MKZA 1T95A 2BY3A 4JK1X 1LJ9A 4G7HF 4M72A 4YIRX 4DGWB 3HBLA 2GWRA 3HM5A 2O7OA 4A0YA 1T56A 1X58A 4RM3A 2MYSA 3PPBA 3IRQA 3S5RA 1HSTA 4ME9A 3DKYA 2ZFWA 2VIXA 3KYDB 1TNSA 3BNIA 3BR0A 4HSTA 4CHUA 3G3ZA 4M3GA 3M07A 2M0MA 3BJAA 3TO7A 2E34A 3CZ6A 3TGNA 4B8XA 3H3ZA 3FXOA 3B81A 1G3YA 3PL8A 2IGOA 4A3DJ 4EMSA 4DVYP 1OR7A 3ESWB 4D7MA 1LUJB 4B3AA 4J00A 3FRQA 5ERIA 1TT5B 1J75A 2XVCA 3C7JA 4UDSA 1K78B 4MTEA 4B3XA 4CGRA 1Z91A 5K5QA 3L9FA 3HRSA 1WJFA 5EEHA 1BI1A 2M4GA 2DK8A 3H5NA 1PJRA 1TQIA 2CH0A 2R7QA 2MW8A 3DEEA 1Z0XA 4LFUA 4TV7A 3ZQIA 4OMYA 2OTJI 5LLQA 5AIQA 2D5VA 4Y17A 3C3WA 2X6OA 2HXIA 1Z7LA 4EJOA 2JA7J 1MJAA 2R93J 3S15J 4GGGA 1MMDA 2K7LA 5DUIA 1JKOC 3FXMA 5E3NA 3NS4A 2UV1A 5FLXK 1V54H 4AM3A 4B09A 2WY8Q 5F08A 2DG8A 3M8JA 2X6YA 1FOKA 1WPKA 4I09A 2E5ZA 2XSJC 1HA8A 1AOYA 2HWVA 3MWMA 2VC0A 2X48A 3K4MA 3OYBA
chains in the Genus database with same CATH topology
5HBUA 3AQTA 1AKHA 2YU9J 2LFBA 1OFCX 4BY7J 4XRMA 3P9TA 2CJJA 3NAUA 2NP3A 2IBDA 1ZTRA 1GV5A 4JX5A 1UG2A 1AU7A 3RZOJ 5M5YJ 1H8AC 2QF7A 1LFUP 3MN2A 2QIBA 3LJLA 3PASA 3VOXA 4PXIA 1RPWA 3FISA 2DN0A 3CDLA 4EEFG 4IHVA 1TWFJ 1XG1A 3FIWA 1H88C 1YRNA 1K83J 3SJMA 4A3FJ 2REKA 5M5WJ 1JUPA 4BBSJ 5FKKA 3M3YJ 2ZB9A 2G0EA 1MBEA 5IOYA 2RAEA 3PM1A 4CYCB 2KDZA 3VOKA 1FIAA 3K2AA 2IU5A 2VUMJ 3MNLA 2DA4A 3HGYA 4XRSG 5IYDJ 3S1RJ 4HKUA 3QBMA 2CQXA 3VVZA 1PUFA 4A69C 2K9NA 1X2MA 3HEFA 1FIPA 3HTAA 2CUEA 2DTZA 1RESA 1APLC 1U9NA 1ETYA 3BTJA 2N8GA 4CYCA 3W6VA 3TP0A 3ZQCA 2E1OA 1IDYA 4V2FA 5CXIA 3IH4A 1ETOA 2I10A 1F36A 4QSHA 1U9OA 4HNVA 1GT0C 3LHQA 3MKLA 4A3MJ 5EFYA 4DZPA 9ANTA 3VVXA 5K7HA 3GTJJ 4ABZA 3CMYA 2GM4A 2R5YB 1JTYA 4C3JJ 4V2GA 4FE4A 1WH5A 2W48A 1MBGA 3JREA 5HSZA 1NTCA 4NN1A 2QCOA 4C2MJ 2UXUA 2DMNA 3GZIA 1VI0A 3A01B 5C4YA 2VKVA 4UUSA 4I6ZA 2UXHA 1TC3C 2ELKA 3DEWA 1I6HJ 2R5YA 1W0TA 1JKPC 3JSJA 2ZOYA 2RASA 2OF7A 3BR3A 4MFEA 1UI5A 3LNQA 2YVHA 1Z77A 2LY9A 1T33A 2FJ1A 2Y31A 4W1UA 1CQTA 4MFDA 2FBQA 3Q0UA 4X1EA 3A02A 2WUIA 1FJLA 5HAWA 3VIBA 3HGGA 1GVDA 5GPCA 2G3BA 2FD5A 1QRYA 4MO7A 3SDGA 1GV2A 1POGA 1JT6A 1ZR2A 2JA6J 3BR1A 2M34A 4X6AJ 3GEUA 4M3FA 1NK3P 3JR9A 4A93J 3O8GA 3OSGA 2DMPA 4AF5A 2ECBA 2LR8A 5FGLA 4FTHA 3BG9A 1QVUA 1ETWA 2ME6A 2JJ7A 2O9LA 2VI6A 2DA2A 2L0KA 4JX4A 3LWJA 1Y1VJ 1WGXA 2DA7A 2Y9ZA 5H9TA 5D1RA 1JTXA 1MBHA 2JWTA 3OSFA 3ANPA 3NRGA 2JA8J 2K9QA 3A03A 2L7FP 2WGBA 4QTRA 2XB5A 3O8HA 2JMWA 2AO9A 3EUPA 2E2IJ 3HOVJ 1K61A 4Y7NJ 3ZOBA 3B6CA 2E19A 1B8IA 3PO2J 2JK3A 3ON4A 3HB9A 4DYRA 2F07A 2CUFA 3FK6A 3PO3J 1TWAJ 3DCFA 3HOYJ 2L7MP 2B63J 3Q3SA 3LSJA 5F27A 3F1BA 2NVQJ 4JP0A 3VPRA 1U8BA 5IOZA 2LTPA 5EG0B 1WI3A 2ZCMA 5E3MA 3H0GJ 3NARA 3IUVA 2GBYA 2NVXJ 2O8KA 5EDNA 1RKWA 3BR2A 3LOCA 3RZDJ 1SGMA 3ZQGA 4A3EJ 3GTMJ 1JUMA 4JX6A 3S17J 1FTZA 1HOMA 1HLVA 1IG7A 5EGOB 1EF4A 1MBFA 4J19A 2GUHA 3ZQLA 1JKQC 3G1LA 3FK7A 3T6NA 1JKRC 1S7EA 2OI8A 5E3OA 5IYCJ 2L7ZA 1WCMJ 3FKIJ 2MGQA 1B72B 1IGNA 4A3BJ 3I4NJ 3VUQA 2CQQA 4GCLA 1JUSA 3OIOA 1I3QJ 3ANGA 5GP9A 2R5ZB 4D5FA 1P7IA 2EH3A 5EGOA 1BJZA 5C3EJ 3BRUA 2MG4A 1VF9A 1IRZA 2CRGA 3BJBA 3V6GA 4BKXA 4FCYA 2VKEA 4L5EA 1GUUA 2K40A 5FKOA 3NNRA 3BTIA 2NOGA 2NS8A 1FTTA 2G7LA 2R5ZA 1P7JA 2EZKA 3EGQA 4AC0A 2DA3A 2LD5A 4KWAA 1RR7A 3S2DJ 3VW1A 2HYTA 4XRSA 1BA5A 3RH2A 2M8GX 4B4CA 4GFBA 4AUXA 3BQZA 3HTHA 1ETXA 4DYQA 4RDUA 3ZQFA 4JKZA 3LSPA 2LKXA 1W0UA 2FQ4A 5C44J 3GBGA 4S0HB 5AQCA 2E2HJ 3S16J 1MBKA 1UHSA 4M6VA 4AYBN 5M3FJ 1NK2P 5FLVA 2K9SA 1DU6A 3IH3A 1XC5A 2DMQA 4DZJA 2HOAA 4Y52J 5DTDA 4MLOA 3BG5A 4NDLA 2EZHA 4DW6A 3WHCA 1ZQ3P 3A01A 1RETA 2XDNA 3KKDA 2HKUA 4BBRJ 1LE8B 3BQYA 4XIDA 3CCYA 3UKGA 5J1RA 1HDDC 1G2HA 1QPIA 3HTIA 1ETKA 2LVSA 4A3CJ 4ACIA 2P81A 4IHWA 2R0QC 2HOSA 2XGCA 1MBJA 3HKZN 4A3IJ 4C3HJ 1XS9A 1JT0A 3I4MJ 2QKOA 2ZCXA 3RD3A 5EYRA 4XK4A 3GTGJ 1UI6A 3NI7A 5J3LA 2ZCNA 2PMZN 3CJDA 3BTLA 3Q0WA 3GTKJ 2IEKA 3RKQA 2G7GA 3G1OA 3TW7A 2XPVA 2DMUA 5K7FA 4IHXA 5FMPA 3Q0VA 3HOUJ 1X2NA 2DA1A 3GTQJ 1A5JA 3G7RA 3MVPA 2XRLA 1LFBA 1VNDA 4GCTA 5IYBJ 4GCKA 3LSRA 2MSYA 3QKXA 3KNWA 1DU0A 3SFIA 1ITYA 1MNMC 1ENHA 2NVTJ 3WHBA 1D5YA 5F04A 3BR5A 2QTQA 4LOCA 4XICA 3VP5A 3D1NI 4M3BA 2EZLA 1UMQA 4FISA 2LK2A 2Y2ZA 1JJ8C 2HQ5A 3F0CA 2ECCA 2HI3A 5EZHA 1RKTA 4QIWN 3GTOJ 2DA6A 3S2HJ 2O7TA 2M0CA 3COLA 2ID3A 1IC8A 5C4XJ 5DAJA 2UXPA 5IP9J 2YVEA 5GPAA 4GFLA 1JJ6C 1MSFC 5FJ8J 1QVTA 2Y0SN 3L1PA 4L62A 3TEDA 1GDTA 2HDDA 1SANA 4MK6A 2VPRA 2X9DA 3NXCA 3BG3A 3TW6A 1ZKGA 1HCRA 3E7QA 2OPTA 4FE7A 3BR6A 3BTCA 5EG0A 5FKLA 4JYKA 3JRDA 2WAQN 3QQAA 2R7ZJ 1JGGA 2M9HA 1YRNB 4B1RA 2OERA 3ZQHA 1BL0A 2ME0A 3S1MJ 4A3LJ 2M2EA 4D5CA 2UXOA 1MH3A 3S1NJ 3H3VK 3B6AA 2NX4A 3AQSA 2NS7A 2Q24A 5FKNA 1VFCA 3S1QJ 4BXXJ 5JLXA 1PUFB 1ZGWA 2DMTA 4I76A 1I50J 2Y30A 5IPAA 5M5XJ 4C3IJ 1E3OC 3S14J 1OCPA 1HF0A 2UXIA 3BHQA 2DA5A 4IHYA 3K7AJ 1B72A 1H89C 3HDDA 3HOWJ 3JRAA 2GLOA 1OCTC 2D6YA 5K7ZA 3G56A 5C4JJ 1SFOJ 3KKCA 5K58A 2CU7A 2YUSA 2RHAA 3TP3A 1OJLA 2AHQA 3LSGA 2WB1N 2H8RA 2XSDC 2GENA 2QOPA 4YZEA 4MIMA 5FKMA 1ORKA 2DJNA 1HDPA 2NP5A 5CW8A 3BT9A 4M3DA 3IV5A 2EBIA 3ON2A 5EEAA 3NPIA 2XGEA 2ZOZA 1BW5A 3CRJA 1BW6A 4RBOA 3O60A 5E3LA 3BCGA 3V78A 5D18A 2PBXA 3CWRA 4AC6A 5F0HA 2DG7A 2PZ9A 4UUSB 4DYCA 2TRTA 1O4XA 5F0FA 3GTLJ 5CXGA 1MSEC 4JNNA 4JL3A 2V57A 5JLWA 3HBLA 2FX0A 3C07A 3HM5A 2O7OA 3JRIA 1T56A 2COBA 3JRFA 1X58A 3M4OJ 2IAIA 3OOUA 3E7LA 5HODA 3PPBA 3S5RA 4ME9A 4GFKA 2HOTA 4UUTA 3JRGA 4IEJA 4A3JJ 5M3MJ 3BNIA 2G7SA 3BR0A 1WH7A 4M3EA 3IH2A 1LE8A 4M3GA 1Y1WJ 2XPUA 5IP6A 2LP0A 3B81A 2YS9A 3GTPJ 5D19A 4G12A 1Q1VA 4A3DJ 5EZGA 3HOZJ 2JN6A 2TCTA 3CQZJ 4ICHA 4D7MA 4B3AA 1IDZA 1IJWC 3FRQA 3C2BA 2R92J 2WV1A 5FLMJ 1F43A 4MXMA 2XPWA 3KZ9A 3JRCA 5BNGA 2LLKA 1MH4A 1ETVA 4A3GJ 4UDSA 4CGRA 5EF6A 5J1YA 1IUFA 5F0CA 2E2JJ 3JRBA 1AHDP 3RQIA 1R9TJ 4BY1J 2HYJA 1B8IB 3G1MA 3ZQIA 2MW8A 5IP7J 1Z0XA 3HOXJ 3QPSA 2QWTA 1ZR4A 3VW2A 2D5VA 2L9RA 2X6OA 3HTJA 2HXIA 2JA7J 5J1UA 3VVYA 2W53A 2R93J 3S15J 1IV6A 1ETQA 2KT0A 2EZIA 1JKOC 5E3NA 3DPJA 5DS9A 2Y9YA 4A3KJ 2XB0X 2NVYJ 3QPLA 5F1JA 3HIMA 2H1KA 1AKHB 4D7NA 1TWGJ 3JRHA 2EQRA 1U78A 1FEXA 3VW0A 3HE0A 5F08A 2DG8A 2XGDA 1WPKA 1TWCJ 2HXOA 2ID6A 4W97A 2JA5J 1A6IA 1TWHJ 5FHPA 2X48A 4NELA 2GFNA 1ZK8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HBU A;  3AQT A;  1AKH A;  2YU9 J;  2LFB A;  1OFC X;  4BY7 J;  4XRM A;  3P9T A;  2CJJ A;  3NAU A;  2NP3 A;  2IBD A;  1ZTR A;  1GV5 A;  4JX5 A;  1UG2 A;  1AU7 A;  3RZO J;  5M5Y J;  1H8A C;  2QF7 A;  1LFU P;  3MN2 A;  2QIB A;  3LJL A;  3PAS A;  3VOX A;  4PXI A;  1RPW A;  3FIS A;  2DN0 A;  3CDL A;  4EEF G;  4IHV A;  1TWF J;  1XG1 A;  3FIW A;  1H88 C;  1YRN A;  1K83 J;  3SJM A;  4A3F J;  2REK A;  5M5W J;  1JUP A;  4BBS J;  5FKK A;  3M3Y J;  2ZB9 A;  2G0E A;  1MBE A;  5IOY A;  2RAE A;  3PM1 A;  4CYC B;  2KDZ A;  3VOK A;  1FIA A;  3K2A A;  2IU5 A;  2VUM J;  3MNL A;  2DA4 A;  3HGY A;  4XRS G;  5IYD J;  3S1R J;  4HKU A;  3QBM A;  2CQX A;  3VVZ A;  1PUF A;  4A69 C;  2K9N A;  1X2M A;  3HEF A;  1FIP A;  3HTA A;  2CUE A;  2DTZ A;  1RES A;  1APL C;  1U9N A;  1ETY A;  3BTJ A;  2N8G A;  4CYC A;  3W6V A;  3TP0 A;  3ZQC A;  2E1O A;  1IDY A;  4V2F A;  5CXI A;  3IH4 A;  1ETO A;  2I10 A;  1F36 A;  4QSH A;  1U9O A;  4HNV A;  1GT0 C;  3LHQ A;  3MKL A;  4A3M J;  5EFY A;  4DZP A;  9ANT A;  3VVX A;  5K7H A;  3GTJ J;  4ABZ A;  3CMY A;  2GM4 A;  2R5Y B;  1JTY A;  4C3J J;  4V2G A;  4FE4 A;  1WH5 A;  2W48 A;  1MBG A;  3JRE A;  5HSZ A;  1NTC A;  4NN1 A;  2QCO A;  4C2M J;  2UXU A;  2DMN A;  3GZI A;  1VI0 A;  3A01 B;  5C4Y A;  2VKV A;  4UUS A;  4I6Z A;  2UXH A;  1TC3 C;  2ELK A;  3DEW A;  1I6H J;  2R5Y A;  1W0T A;  1JKP C;  3JSJ A;  2ZOY A;  2RAS A;  2OF7 A;  3BR3 A;  4MFE A;  1UI5 A;  3LNQ A;  2YVH A;  1Z77 A;  2LY9 A;  1T33 A;  2FJ1 A;  2Y31 A;  4W1U A;  1CQT A;  4MFD A;  2FBQ A;  3Q0U A;  4X1E A;  3A02 A;  2WUI A;  1FJL A;  5HAW A;  3VIB A;  3HGG A;  1GVD A;  5GPC A;  2G3B A;  2FD5 A;  1QRY A;  4MO7 A;  3SDG A;  1GV2 A;  1POG A;  1JT6 A;  1ZR2 A;  2JA6 J;  3BR1 A;  2M34 A;  4X6A J;  3GEU A;  4M3F A;  1NK3 P;  3JR9 A;  4A93 J;  3O8G A;  3OSG A;  2DMP A;  4AF5 A;  2ECB A;  2LR8 A;  5FGL A;  4FTH A;  3BG9 A;  1QVU A;  1ETW A;  2ME6 A;  2JJ7 A;  2O9L A;  2VI6 A;  2DA2 A;  2L0K A;  4JX4 A;  3LWJ A;  1Y1V J;  1WGX A;  2DA7 A;  2Y9Z A;  5H9T A;  5D1R A;  1JTX A;  1MBH A;  2JWT A;  3OSF A;  3ANP A;  3NRG A;  2JA8 J;  2K9Q A;  3A03 A;  2L7F P;  2WGB A;  4QTR A;  2XB5 A;  3O8H A;  2JMW A;  2AO9 A;  3EUP A;  2E2I J;  3HOV J;  1K61 A;  4Y7N J;  3ZOB A;  3B6C A;  2E19 A;  1B8I A;  3PO2 J;  2JK3 A;  3ON4 A;  3HB9 A;  4DYR A;  2F07 A;  2CUF A;  3FK6 A;  3PO3 J;  1TWA J;  3DCF A;  3HOY J;  2L7M P;  2B63 J;  3Q3S A;  3LSJ A;  5F27 A;  3F1B A;  2NVQ J;  4JP0 A;  3VPR A;  1U8B A;  5IOZ A;  2LTP A;  5EG0 B;  1WI3 A;  2ZCM A;  5E3M A;  3H0G J;  3NAR A;  3IUV A;  2GBY A;  2NVX J;  2O8K A;  5EDN A;  1RKW A;  3BR2 A;  3LOC A;  3RZD J;  1SGM A;  3ZQG A;  4A3E J;  3GTM J;  1JUM A;  4JX6 A;  3S17 J;  1FTZ A;  1HOM A;  1HLV A;  1IG7 A;  5EGO B;  1EF4 A;  1MBF A;  4J19 A;  2GUH A;  3ZQL A;  1JKQ C;  3G1L A;  3FK7 A;  3T6N A;  1JKR C;  1S7E A;  2OI8 A;  5E3O A;  5IYC J;  2L7Z A;  1WCM J;  3FKI J;  2MGQ A;  1B72 B;  1IGN A;  4A3B J;  3I4N J;  3VUQ A;  2CQQ A;  4GCL A;  1JUS A;  3OIO A;  1I3Q J;  3ANG A;  5GP9 A;  2R5Z B;  4D5F A;  1P7I A;  2EH3 A;  5EGO A;  1BJZ A;  5C3E J;  3BRU A;  2MG4 A;  1VF9 A;  1IRZ A;  2CRG A;  3BJB A;  3V6G A;  4BKX A;  4FCY A;  2VKE A;  4L5E A;  1GUU A;  2K40 A;  5FKO A;  3NNR A;  3BTI A;  2NOG A;  2NS8 A;  1FTT A;  2G7L A;  2R5Z A;  1P7J A;  2EZK A;  3EGQ A;  4AC0 A;  2DA3 A;  2LD5 A;  4KWA A;  1RR7 A;  3S2D J;  3VW1 A;  2HYT A;  4XRS A;  1BA5 A;  3RH2 A;  2M8G X;  4B4C A;  4GFB A;  4AUX A;  3BQZ A;  3HTH A;  1ETX A;  4DYQ A;  4RDU A;  3ZQF A;  4JKZ A;  3LSP A;  2LKX A;  1W0U A;  2FQ4 A;  5C44 J;  3GBG A;  4S0H B;  5AQC A;  2E2H J;  3S16 J;  1MBK A;  1UHS A;  4M6V A;  4AYB N;  5M3F J;  1NK2 P;  5FLV A;  2K9S A;  1DU6 A;  3IH3 A;  1XC5 A;  2DMQ A;  4DZJ A;  2HOA A;  4Y52 J;  5DTD A;  4MLO A;  3BG5 A;  4NDL A;  2EZH A;  4DW6 A;  3WHC A;  1ZQ3 P;  3A01 A;  1RET A;  2XDN A;  3KKD A;  2HKU A;  4BBR J;  1LE8 B;  3BQY A;  4XID A;  3CCY A;  3UKG A;  5J1R A;  1HDD C;  1G2H A;  1QPI A;  3HTI A;  1ETK A;  2LVS A;  4A3C J;  4ACI A;  2P81 A;  4IHW A;  2R0Q C;  2HOS A;  2XGC A;  1MBJ A;  3HKZ N;  4A3I J;  4C3H J;  1XS9 A;  1JT0 A;  3I4M J;  2QKO A;  2ZCX A;  3RD3 A;  5EYR A;  4XK4 A;  3GTG J;  1UI6 A;  3NI7 A;  5J3L A;  2ZCN A;  2PMZ N;  3CJD A;  3BTL A;  3Q0W A;  3GTK J;  2IEK A;  3RKQ A;  2G7G A;  3G1O A;  3TW7 A;  2XPV A;  2DMU A;  5K7F A;  4IHX A;  5FMP A;  3Q0V A;  3HOU J;  1X2N A;  2DA1 A;  3GTQ J;  1A5J A;  3G7R A;  3MVP A;  2XRL A;  1LFB A;  1VND A;  4GCT A;  5IYB J;  4GCK A;  3LSR A;  2MSY A;  3QKX A;  3KNW A;  1DU0 A;  3SFI A;  1ITY A;  1MNM C;  1ENH A;  2NVT J;  3WHB A;  1D5Y A;  5F04 A;  3BR5 A;  2QTQ A;  4LOC A;  4XIC A;  3VP5 A;  3D1N I;  4M3B A;  2EZL A;  1UMQ A;  4FIS A;  2LK2 A;  2Y2Z A;  1JJ8 C;  2HQ5 A;  3F0C A;  2ECC A;  2HI3 A;  5EZH A;  1RKT A;  4QIW N;  3GTO J;  2DA6 A;  3S2H J;  2O7T A;  2M0C A;  3COL A;  2ID3 A;  1IC8 A;  5C4X J;  5DAJ A;  2UXP A;  5IP9 J;  2YVE A;  5GPA A;  4GFL A;  1JJ6 C;  1MSF C;  5FJ8 J;  1QVT A;  2Y0S N;  3L1P A;  4L62 A;  3TED A;  1GDT A;  2HDD A;  1SAN A;  4MK6 A;  2VPR A;  2X9D A;  3NXC A;  3BG3 A;  3TW6 A;  1ZKG A;  1HCR A;  3E7Q A;  2OPT A;  4FE7 A;  3BR6 A;  3BTC A;  5EG0 A;  5FKL A;  4JYK A;  3JRD A;  2WAQ N;  3QQA A;  2R7Z J;  1JGG A;  2M9H A;  1YRN B;  4B1R A;  2OER A;  3ZQH A;  1BL0 A;  2ME0 A;  3S1M J;  4A3L J;  2M2E A;  4D5C A;  2UXO A;  1MH3 A;  3S1N J;  3H3V K;  3B6A A;  2NX4 A;  3AQS A;  2NS7 A;  2Q24 A;  5FKN A;  1VFC A;  3S1Q J;  4BXX J;  5JLX A;  1PUF B;  1ZGW A;  2DMT A;  4I76 A;  1I50 J;  2Y30 A;  5IPA A;  5M5X J;  4C3I J;  1E3O C;  3S14 J;  1OCP A;  1HF0 A;  2UXI A;  3BHQ A;  2DA5 A;  4IHY A;  3K7A J;  1B72 A;  1H89 C;  3HDD A;  3HOW J;  3JRA A;  2GLO A;  1OCT C;  2D6Y A;  5K7Z A;  3G56 A;  5C4J J;  1SFO J;  3KKC A;  5K58 A;  2CU7 A;  2YUS A;  2RHA A;  3TP3 A;  1OJL A;  2AHQ A;  3LSG A;  2WB1 N;  2H8R A;  2XSD C;  2GEN A;  2QOP A;  4YZE A;  4MIM A;  5FKM A;  1ORK A;  2DJN A;  1HDP A;  2NP5 A;  5CW8 A;  3BT9 A;  4M3D A;  3IV5 A;  2EBI A;  3ON2 A;  5EEA A;  3NPI A;  2XGE A;  2ZOZ A;  1BW5 A;  3CRJ A;  1BW6 A;  4RBO A;  3O60 A;  5E3L A;  3BCG A;  3V78 A;  5D18 A;  2PBX A;  3CWR A;  4AC6 A;  5F0H A;  2DG7 A;  2PZ9 A;  4UUS B;  4DYC A;  2TRT A;  1O4X A;  5F0F A;  3GTL J;  5CXG A;  1MSE C;  4JNN A;  4JL3 A;  2V57 A;  5JLW A;  3HBL A;  2FX0 A;  3C07 A;  3HM5 A;  2O7O A;  3JRI A;  1T56 A;  2COB A;  3JRF A;  1X58 A;  3M4O J;  2IAI A;  3OOU A;  3E7L A;  5HOD A;  3PPB A;  3S5R A;  4ME9 A;  4GFK A;  2HOT A;  4UUT A;  3JRG A;  4IEJ A;  4A3J J;  5M3M J;  3BNI A;  2G7S A;  3BR0 A;  1WH7 A;  4M3E A;  3IH2 A;  1LE8 A;  4M3G A;  1Y1W J;  2XPU A;  5IP6 A;  2LP0 A;  3B81 A;  2YS9 A;  3GTP J;  5D19 A;  4G12 A;  1Q1V A;  4A3D J;  5EZG A;  3HOZ J;  2JN6 A;  2TCT A;  3CQZ J;  4ICH A;  4D7M A;  4B3A A;  1IDZ A;  1IJW C;  3FRQ A;  3C2B A;  2R92 J;  2WV1 A;  5FLM J;  1F43 A;  4MXM A;  2XPW A;  3KZ9 A;  3JRC A;  5BNG A;  2LLK A;  1MH4 A;  1ETV A;  4A3G J;  4UDS A;  4CGR A;  5EF6 A;  5J1Y A;  1IUF A;  5F0C A;  2E2J J;  3JRB A;  1AHD P;  3RQI A;  1R9T J;  4BY1 J;  2HYJ A;  1B8I B;  3G1M A;  3ZQI A;  2MW8 A;  5IP7 J;  1Z0X A;  3HOX J;  3QPS A;  2QWT A;  1ZR4 A;  3VW2 A;  2D5V A;  2L9R A;  2X6O A;  3HTJ A;  2HXI A;  2JA7 J;  5J1U A;  3VVY A;  2W53 A;  2R93 J;  3S15 J;  1IV6 A;  1ETQ A;  2KT0 A;  2EZI A;  1JKO C;  5E3N A;  3DPJ A;  5DS9 A;  2Y9Y A;  4A3K J;  2XB0 X;  2NVY J;  3QPL A;  5F1J A;  3HIM A;  2H1K A;  1AKH B;  4D7N A;  1TWG J;  3JRH A;  2EQR A;  1U78 A;  1FEX A;  3VW0 A;  3HE0 A;  5F08 A;  2DG8 A;  2XGD A;  1WPK A;  1TWC J;  2HXO A;  2ID6 A;  4W97 A;  2JA5 J;  1A6I A;  1TWH J;  5FHP A;  2X48 A;  4NEL A;  2GFN A;  1ZK8 A; 
#chains in the Genus database with same CATH topology
 3LA7 A;  5D6F A;  1R23 A;  2KIU A;  5HBU A;  5ICE A;  2ZXW H;  4I02 A;  4M9Z A;  4XRM A;  2CS3 A;  3BG7 A;  2CJJ A;  1UG2 A;  1AU7 A;  3LFK A;  2M8E A;  3HUG A;  1H8A C;  2ZY9 A;  2DXI A;  1E3H A;  1LFU P;  2QIB A;  3GXO A;  1SMY F;  3PAS A;  1XGO A;  3AFH A;  1RPW A;  3FIS A;  2XDV A;  5HDN A;  3CCV I;  3CC2 I;  2J5O A;  2BXY A;  4FET A;  2HKO A;  4ZYG A;  4BQN A;  5M5W J;  1JUP A;  5FKK A;  2M30 A;  2G0E A;  4KMU X;  2Y0M A;  2MH2 A;  3J7A O;  1SC7 A;  2KHM A;  4WCG A;  3ERE D;  3S3M A;  2EIN H;  1GHC A;  2IU5 A;  1D3Y A;  5IYD J;  1HW5 A;  2G7H A;  6PAX A;  3QBM A;  2CQX A;  4A69 C;  5J6X A;  2NXN B;  2XGX A;  2IS1 A;  4H4K C;  4M74 A;  3WU1 B;  3HTA A;  2E71 A;  1APL C;  1OYY A;  2PFV A;  1F36 A;  2FA5 A;  2WAD A;  4YII A;  5J47 A;  3TMO A;  2ZJP F;  5EFY A;  4DZP A;  9ANT A;  4ABZ A;  1S72 I;  3K4B A;  2HEO A;  2CFO A;  5FGM A;  3L2R A;  4V2G A;  1IXC A;  2AQF A;  2DYR H;  2Z9O A;  3ZN1 A;  3LFU A;  2WY7 Q;  2XF7 A;  4AYB A;  2QCO A;  2ZFU A;  4M71 A;  1FSH A;  3A01 B;  4YFN F;  4I6Z A;  3RKY A;  3CJN A;  2VJI A;  1W0T A;  3A1Y A;  4ENN A;  3C2G A;  3L09 A;  2VXZ A;  3ZCO A;  3J80 Z;  1MND A;  2M7B A;  3VDX A;  2RAS A;  3S93 A;  3ECO A;  2OF7 A;  3BR3 A;  4L18 B;  4K2E A;  3OYM A;  1YW7 A;  3LNQ A;  3GFL A;  3PNV A;  4N4N B;  3CCE I;  2CGP A;  1MIJ A;  4A5N A;  1ZRE A;  2HVS A;  1ONV A;  5ILV A;  3M1C A;  3F8B A;  3HGG A;  4MEY F;  5HDG A;  2OU2 A;  3WGH A;  1R5G A;  4BAC A;  4MO7 A;  2P5V A;  2DOD A;  3D5S C;  2VBX A;  3I59 B;  1ZR2 A;  2JA6 J;  2M34 A;  3IKT A;  1D0X A;  3K4K A;  3T1B A;  2PMZ A;  2IA1 A;  5TJJ A;  3JR9 A;  3DEU A;  5ILS A;  3RSN A;  3CCQ I;  4XKB A;  2ECB A;  4PSW A;  1K7A A;  5FGL A;  4AF5 A;  1XX5 A;  4OMZ A;  2ME6 A;  3A0H C;  3SZP A;  3BC8 A;  1CGP A;  1Y1V J;  2QQB A;  2R7W A;  3KFW X;  1JTX A;  1MBH A;  1W7P A;  2X4H A;  2ZO4 A;  2Z33 A;  3C1D A;  3NRG A;  5CVR A;  2W4S A;  2L7F P;  3V8J A;  4UNO A;  2XB5 A;  3FXK A;  3O8H A;  2YPR A;  4FAS D;  1PP7 U;  3OYD A;  1K61 A;  3VFZ A;  3ZOB A;  1BC8 C;  3B6C A;  1F4K A;  2IXS A;  3E6M A;  3E6D A;  4XOT A;  3OYC A;  3HPG A;  3HPH A;  1N78 A;  3H0D A;  1YX5 A;  2ZNY A;  4C2T A;  2F4I A;  1O7L A;  2H6B A;  3E97 A;  4ASN A;  2NVQ J;  3MMY B;  5IOZ A;  2QEX I;  1WI3 A;  2ZCM A;  5ICF A;  1Y6I A;  4HF2 A;  4U88 A;  3IUV A;  2GBY A;  2QM3 A;  4HEA 2;  5CQG A;  5EDN A;  5DD4 A;  5JR3 A;  1FBQ A;  3K9T A;  3NWS A;  4G6Q A;  3F6V A;  5FLX Z;  1T38 A;  4E7I A;  2ICW G;  2W25 A;  4JX6 A;  1KU3 A;  4LG0 B;  1XN7 A;  2E7W A;  4Y15 A;  2YX7 A;  5ILU A;  1HLV A;  4HV6 A;  3H36 A;  3ZP5 A;  2GUH A;  4HDU A;  2QSH X;  5TIS C;  1H0M A;  1D8K A;  1HSJ A;  3T6N A;  1S7E A;  2K4B A;  2NVU B;  3PUF A;  3VUQ A;  4GCL A;  1LFP A;  3I4N J;  3RJP A;  2CUZ A;  1JUS A;  2EB7 A;  4XON A;  2EV0 A;  4D5F A;  3CCM I;  2BY2 A;  1XDS A;  3LQQ A;  5EGO A;  3TBI A;  3V6G A;  1DUX C;  2F2E A;  2LF7 A;  2Z1D A;  2L01 A;  3BZ6 A;  2CV0 A;  3RDI A;  3K4C A;  4B47 A;  1FP1 D;  4ZTF A;  3BTI A;  1YS6 A;  3L00 A;  2NS8 A;  1RRJ A;  3PNY A;  1VTN C;  2P6S A;  2R5Z A;  4DOZ A;  3RPQ A;  4XQF A;  2Q2E B;  4HAM A;  2R3S A;  2XRN A;  2DA3 A;  2EFP A;  3ABT A;  3BWG A;  4MTD A;  3WTZ A;  4BE0 A;  4KWA A;  3J7Y J;  5CLS A;  3K1P A;  4MQ9 F;  4GRI A;  4HBL A;  1WVR A;  2M8G X;  2KIF A;  4GFB A;  3HTH A;  4JKZ A;  2DFE A;  2A3S A;  2HZT A;  1RC9 A;  2AQE A;  1FMW A;  1LDD A;  2L2O A;  3OMY A;  3S16 J;  2A6H F;  4NQW A;  4RGR A;  2K9S A;  1YS7 A;  1DU6 A;  1YO5 C;  2V4J C;  4DZJ A;  2GQQ A;  1P4X A;  1JI8 A;  1Z6T A;  1IN6 A;  4UXN A;  1BR1 A;  3BG5 A;  2D1H A;  2KQR A;  4NDL A;  2EZH A;  4XOR A;  4DW6 A;  1ZQ3 P;  4RAF A;  3MCZ A;  1SFX A;  2V1N A;  1RET A;  3UR3 C;  4L0Z B;  3UNG C;  4MHG A;  4G7O F;  2MD5 A;  1L0O C;  3M8F A;  1YHQ I;  2X0L A;  3CCY A;  3ZXS A;  4ANJ A;  2HYG D;  2V79 A;  3IL2 A;  1T98 A;  1D1B A;  1DPR A;  1ETK A;  1W4M A;  3CO6 C;  2RGV A;  1SD5 A;  4I0B A;  2R0Q C;  3WGI A;  2LRD A;  3I4M J;  2ZCX A;  2M45 A;  4ON0 A;  4IQJ A;  3RD3 A;  1FYM A;  4XK4 A;  2VJ5 A;  4U7D A;  4KT6 A;  5EJC A;  3H5R A;  3L2V A;  3BTL A;  4OAY A;  2HDW A;  3VYS B;  1EJ9 A;  3RKQ A;  2G7G A;  1MMN A;  4PGG A;  3H9J A;  1Z6R A;  3BDD A;  4GXO A;  2Q1Z B;  1E3P A;  2DMU A;  3ML6 A;  4Z6Y A;  3V8L A;  3VSL A;  4IHX A;  4XKW A;  2R7S A;  3KP2 A;  1UJ8 A;  2CQK A;  1LNW A;  4HKU A;  1D5V A;  2BVL A;  3WTU C;  1VND A;  4YFX F;  4GCT A;  2MSY A;  1X19 A;  1EA3 A;  4F55 A;  1MNM C;  3HYI A;  4L9V A;  3BR5 A;  4EM0 B;  3R60 A;  4XIC A;  5CVJ A;  5DCM A;  2JSC A;  2PFB A;  1UMQ A;  4IJA A;  1TNT A;  2DOF A;  1WWX A;  4EJV A;  1S3J A;  3BCA A;  2Y2Z A;  1JJ8 C;  2HQ5 A;  1RKT A;  4QIW N;  2IA2 A;  3B73 A;  3MFK A;  3S2H J;  2X51 A;  4HG2 A;  4ESJ A;  2O7T A;  5C4X J;  4C2M A;  1QPM A;  2UXP A;  2CW0 F;  3BZC A;  5IP9 J;  2YVE A;  1JJ6 C;  1QA6 A;  2IW5 A;  3AL0 C;  2E5N A;  3L1P A;  4BQQ A;  2WAQ A;  2OZU A;  5HS9 A;  2F6C A;  3TED A;  2R7X A;  2QLZ A;  4MK6 A;  1JE8 A;  2GIZ A;  2X9D A;  3HUG B;  3BG3 A;  1OQY A;  3FMR A;  1Y8R B;  3TW6 A;  1DQU A;  1QQI A;  5D5V B;  5EG0 A;  3QYE A;  5J40 A;  4G94 A;  1T0F A;  3QQA A;  4WF2 A;  1XB4 A;  1YJ9 I;  3DQV C;  2GA2 A;  3TO6 A;  2OER A;  2ME0 A;  4IOA F;  3GZ5 A;  2E35 A;  2XAQ A;  1Z21 A;  1HXD A;  2X1D A;  1R22 A;  2UXO A;  3OYH A;  5HLI A;  2CFX A;  1VZ0 A;  5L3F A;  5FRO A;  2E7X A;  5L3C A;  4BXX J;  2ZJR F;  3PFI A;  3HTU A;  1ZGW A;  2DMT A;  2F5V A;  3OYE A;  4KN4 X;  5E1Z B;  1VQ6 I;  2K3P A;  3CF5 F;  5IPA A;  1SMT A;  2NNN A;  3S14 J;  1OCP A;  3W3C A;  1RUO A;  2DA5 A;  5L3E A;  5FRM A;  1B72 A;  3HOW J;  1R49 A;  3HDD A;  1OCT C;  2JUC A;  3FXU A;  3TP3 A;  1OJL A;  2WB1 N;  2H8R A;  2JQ7 A;  3AKZ A;  3KP6 A;  5LEK A;  4WX9 A;  2VB6 A;  3U2R A;  2NNY A;  1O3R A;  2A61 A;  3I64 A;  4L0Y B;  3R6S A;  1HDP A;  1FLI A;  5CW8 A;  2EBI A;  2FML A;  5EEA A;  2W57 A;  4KMF A;  2H09 A;  2ZOZ A;  3E6C C;  1BW5 A;  2GXG A;  1SVM A;  2KPM A;  1R58 A;  3FWE A;  1XGM A;  5DV5 A;  5F0H A;  3CUO A;  1QU3 A;  1SVL A;  2VE9 A;  4AU7 A;  3K70 C;  2QQ9 A;  1MSE C;  4JNN A;  3P5J A;  3LSM A;  3N97 A;  1UHM A;  3C07 A;  3JRI A;  2COB A;  3JRF A;  4XLE A;  1LEA A;  2XKP A;  1AA7 A;  2PN6 A;  1QZZ A;  1SD4 A;  2VL8 A;  4GFK A;  1LEB A;  3GFM A;  4ZYD A;  1EH8 A;  4IXA A;  4UUT A;  4IEJ A;  3KP7 A;  4HA8 A;  3FM5 A;  1A36 A;  1YYV A;  2XC7 A;  1V55 H;  1X3W B;  4RAG A;  1ODD A;  2L4M A;  3IH2 A;  1UB9 A;  2DLL A;  2XV4 S;  3GO5 A;  3K4N A;  4LIT A;  3DLL F;  2OD5 A;  3JSP A;  5E18 F;  1A35 A;  3GTP J;  4G12 A;  2P5K A;  1Q1V A;  5EZG A;  2JN6 A;  2TCT A;  3K0L A;  3FXR A;  2PX9 A;  3CO7 C;  4YRV A;  2R92 J;  3H9G A;  4RAY A;  1W7P B;  2IVM A;  4S04 A;  4KJZ A;  3WTV C;  1PYV A;  2AS5 F;  4OIP F;  3OYI A;  5BNG A;  1SFK A;  2R7F A;  1MH4 A;  1ETV A;  3CP2 A;  3HIF A;  3PSF A;  3O3K A;  3ELK A;  4C9Y A;  3DXJ F;  2E2J J;  3JRB A;  1AHD P;  3IC7 A;  4D9J A;  3RQI A;  3BJ6 A;  3KP4 A;  2HYJ A;  3G1M A;  5IP7 J;  3MZY A;  1J2X A;  1ZR4 A;  4I2O A;  3KEO A;  4ZJZ A;  4XLP F;  3HTJ A;  5J8C A;  5J1U A;  2X85 A;  4CCK A;  2KIM A;  5DS9 A;  2Y9Y A;  3FZV A;  4A3K J;  2XB0 X;  2NVY J;  3QPL A;  4A12 A;  2VON A;  4D7N A;  3JRH A;  4II2 A;  2UWM A;  3H92 A;  1IN5 A;  1UCR A;  1YE9 A;  3V4G A;  1XSV A;  4OIR F;  4HDV A;  3PJR A;  2HXO A;  1V3F A;  2DT7 B;  2ID6 A;  4RB1 A;  2BW3 A;  4BAY A;  1A6I A;  2JA5 J;  1K6O A;  3DU5 A;  1ZK8 A;  3A2K A;  1AKH A;  2LFB A;  5A2Q K;  3W6J B;  3WTS C;  1IUY A;  1R7J A;  4BY7 J;  4J01 A;  2B7E A;  3IWZ A;  2IBD A;  1ZTR A;  1I1G A;  2XAF A;  5CVI A;  3RZO J;  5M5Y J;  5HLT A;  2KFD A;  3LL7 A;  5JI6 A;  3LJL A;  2W7N A;  1FP2 A;  2XAJ A;  2DN0 A;  2CV1 A;  2PEX A;  3FIW A;  1YRN A;  3SJM A;  4A3F J;  5LGU A;  2VXD A;  4BBS J;  1K6Y A;  1X1D A;  2LMD A;  5BOX A;  3RPU D;  3TOA A;  2LRE A;  3C2H A;  3RI4 A;  1BJA A;  2BOL A;  2BV6 A;  4LK0 F;  3RKW A;  2VUM J;  2GZW A;  3CC4 I;  3MNL A;  3HGY A;  3VVZ A;  3EYY A;  1PUF A;  1XGN A;  1R36 A;  4NBQ A;  1MDM A;  1X2M A;  3HEF A;  1FIP A;  2KJB A;  3SFZ A;  1ZYR F;  2VOO A;  2K85 A;  3I55 I;  2CUE A;  1VQ7 I;  2DTZ A;  2ESN A;  2NYX A;  2HU9 A;  1OPC A;  4CYC A;  3W6V A;  1XCB A;  4HX8 A;  5KHD A;  3J80 K;  3ZGK A;  4QSH A;  4PFO A;  1OCO H;  1XMK A;  3DF8 A;  1K4T A;  3CD6 I;  5IT3 A;  1GT0 C;  4LD5 A;  4MQV A;  2AXT C;  3GME A;  5K5O A;  4CSW A;  1ZRC A;  2FMY A;  2EIL H;  1P4W A;  1I1S A;  2QQA A;  2EWN A;  5K7H A;  3GTJ J;  4Z2Y A;  1JTY A;  2IGM A;  2HVQ A;  2VE8 A;  5FO5 A;  4D1Q A;  4FE4 A;  2DDB A;  5K1Y A;  3KP5 A;  5DYM A;  2F4O B;  5HSZ A;  4NN1 A;  3U1K A;  1FC3 A;  2Q8K A;  1VI0 A;  3GZI A;  3FXJ A;  4DQ2 A;  2ELK A;  2MAB A;  3DEW A;  1HQC A;  1I6H J;  2R5Y A;  2DO7 A;  5E8I A;  1YX3 A;  3F3X A;  4F52 A;  4IQ4 A;  3OY9 A;  2WC2 A;  1X1A A;  2ZOY A;  3T0Y A;  4MFE A;  3RQ4 A;  1UI5 A;  5D4S A;  3EUK L;  4IF4 A;  2YVH A;  2MH9 A;  4XLF A;  4CZZ A;  1T33 A;  4W1U A;  3QYB A;  1CQT A;  2LC2 A;  3ZQ7 A;  2EIJ H;  3Q0U A;  2FBQ A;  3A02 A;  1Y8Q B;  3TO9 A;  2EPF A;  3HKZ A;  2VKH A;  1RR8 C;  5GPC A;  2KMU A;  2G3B A;  2DFH A;  3X2Q H;  4Q4Z F;  2BE5 F;  4L5J A;  3SEQ A;  3JAM Z;  1NH3 A;  3BR1 A;  4S05 A;  1ZG3 A;  3O8G A;  3OSG A;  2DMP A;  1BI0 A;  4QPO A;  3P7N A;  2ZXJ A;  1VQ4 I;  3DPT A;  2GXA A;  2JJ7 A;  2WBM A;  3CLQ A;  2VI6 A;  2M7A A;  4ESF A;  3HSE A;  3I53 A;  2DA7 A;  3H5A A;  2Y9Z A;  2QVO A;  3QWL A;  4Y3O A;  4ENJ A;  4F93 B;  2JA8 J;  2K9Q A;  1HW2 A;  1QGP A;  2KZV A;  4QPQ A;  2WGB A;  1LPQ A;  2JMW A;  5DCM B;  2E2I J;  2FEZ A;  4Y7N J;  4B43 A;  2A69 F;  1B8I A;  3WTW C;  3PO2 J;  2JPB A;  1E0E A;  3RYR A;  1CF7 A;  4XMY A;  2CUF A;  3VTI A;  3DCF A;  3DTE A;  2XKO A;  3DP7 A;  4PCQ A;  2B63 J;  5GTI C;  2XF6 A;  3LSJ A;  3F1B A;  1I27 A;  1WI9 A;  2QSG X;  1A6Q A;  4JP0 A;  3VPR A;  1U8B A;  1G4D A;  2A2F X;  1EH7 A;  2OV7 A;  3PQK A;  5EG0 B;  4HV5 A;  2CO5 A;  5E3M A;  1FNN A;  3CDI A;  3LA2 A;  2NVX J;  1R4N B;  5HS7 A;  3ZN0 A;  1XMX A;  4EVI A;  5D4R A;  4U9N A;  4RS8 A;  2FBH A;  3BR2 A;  2HQA A;  4BHC A;  4RB3 C;  3RZD J;  1R1U A;  3OL4 A;  3ROU A;  5J8F A;  3GTM J;  1KU2 A;  2P4W A;  4UY8 I;  1HOM A;  2RQP A;  4ZC3 A;  1IG7 A;  2STT A;  1BOB A;  1FY7 A;  1MBF A;  2WTE A;  1G3W A;  5LRS A;  1NG6 A;  1WJ5 A;  4XR6 A;  2RQQ A;  2L54 A;  3RCO A;  3BY6 A;  3FKI J;  4H0E A;  1B72 B;  4MNU A;  3GWZ A;  4LB6 B;  4G7Z F;  5A2Q Z;  3OIO A;  1I3Q J;  3ANG A;  4HF0 A;  1Y0N A;  2MG4 A;  1VF9 A;  4BNC A;  2W85 A;  3NRV A;  4BKX A;  2W00 A;  3G2B A;  4L5E A;  3ECH A;  4WIB A;  2LBF A;  3NNR A;  5KAF C;  3I9V 2;  5D5U B;  4WXC A;  2FRH A;  2LYC A;  2G7L A;  2L4A A;  3KPH A;  2HQN A;  3K4J A;  3ERM A;  5ED4 A;  2OJE D;  4BL0 B;  3U9G A;  3OYF A;  3WE3 A;  2V6E A;  1TQP A;  2LSO A;  1W1W E;  1MJ9 A;  3PQJ A;  3S2D J;  2FXA A;  4RMN A;  2F5E A;  4ZH4 F;  3ZR8 X;  4XRS A;  1BA5 A;  3PNT A;  4P55 A;  3RH2 A;  4B4C A;  4XLH A;  4DYQ A;  4E7S A;  2R7D A;  5B3S H;  3LSP A;  2VLA A;  2COM A;  5HNF A;  1V4R A;  5AQC A;  4S0H B;  3DPL C;  1J0R A;  1V5E A;  2MLK A;  1MBK A;  3HTS B;  1O7F A;  4PFP A;  3HHH A;  1NK2 P;  4L9N A;  1XC5 A;  2DTR A;  1EV7 A;  3WE2 A;  2R4G A;  3PSI A;  1Z1D A;  3KKD A;  1SEU A;  1P2F A;  4EV0 A;  3BQY A;  2KZG A;  4KDP A;  3TL4 X;  4BEH A;  5J1R A;  5B1B H;  1G2H A;  2HPM A;  3HTI A;  2E36 A;  2P81 A;  2F5F A;  5H6R A;  2Y48 A;  2DK5 A;  3E5U A;  1Y0U A;  2HDC A;  3K1M A;  2O3F A;  4A3I J;  4NC6 A;  1XS9 A;  3KX2 A;  2QKO A;  2ZME A;  5B66 C;  2L5Q A;  3OS0 A;  4B48 A;  4CCN A;  1IN4 A;  4RLF A;  1SAX A;  3CJD A;  2MC4 A;  1TW2 A;  4KN7 X;  3GTK J;  3N4M A;  1OKR A;  1XTA A;  3ABL H;  3DBL B;  5B5E C;  1FOY A;  3TW7 A;  2XPV A;  3WTX C;  5LGT A;  1SVO A;  4E7L A;  5K7F A;  2A5Y B;  1KON A;  5KAI C;  2DBB A;  1X1C A;  2L9V A;  2IS6 A;  5FMP A;  5JVG F;  1N77 A;  3HOU J;  1X2N A;  2V26 A;  3MVP A;  5BPD A;  3I0T A;  1LFB A;  3VYR B;  2WV0 A;  1WJB A;  2Z16 A;  4R8H A;  3KYL A;  1OR7 C;  3LSR A;  1IN7 A;  4CCO A;  1R1V A;  1DU0 A;  3SFI A;  2JTV A;  3SHF A;  3HHG A;  4DIQ A;  4GO1 A;  4BQO A;  3VP5 A;  3D1N I;  1B59 A;  3BOQ A;  4O6J A;  2VBZ A;  2ZNZ A;  3TQN A;  5EZH A;  2HI3 A;  4U7B A;  2BW3 B;  4DNC A;  3ZMZ A;  3FXQ A;  2PJR A;  5DM6 F;  2HOE A;  4AWX B;  4GFL A;  5E8G A;  5JVT A;  1QVT A;  1W5S A;  4ZTJ A;  2Y0S N;  5B1A H;  3DU6 A;  4HPQ A;  3PIO F;  2HDD A;  4QLC U;  1HCR A;  1ZKG A;  3Q9V A;  3E7Q A;  1J09 A;  1XMA A;  5FKL A;  4JYK A;  4LMY A;  1QZE A;  2WAQ N;  4KIS A;  2M3A A;  1JXS A;  2M9H A;  2D1V A;  2X1E A;  3ZMV A;  1YRN B;  4B1R A;  2KP6 A;  1VQK I;  3ZQH A;  1ZG5 A;  1BL0 A;  1SAU A;  2P5L C;  3CES A;  2M4K A;  2M2E A;  2Z2S B;  4D5C A;  3LWF A;  2DT6 A;  4FX0 A;  3S1N J;  4IPA A;  1ON1 A;  2F4M B;  2I8D A;  3L2C A;  5GAD J;  3ISP A;  4UVC A;  2NS7 A;  2YX4 A;  3JW4 A;  1VFC A;  1VQO I;  1PUF B;  5ICC A;  1MDM B;  4U0V A;  3HZJ A;  2HGC A;  4G9Y A;  1HF0 A;  2UXI A;  4PGH A;  2VBW A;  2V6C A;  3TOB A;  3JRA A;  1YG2 A;  3KZY A;  4JQF A;  3KLN A;  2CU7 A;  4IL6 C;  4Y33 A;  2LY2 A;  2MC3 A;  1YW9 A;  3ZMS A;  1MMG A;  1WFX A;  3WTT C;  4HNU A;  1BIA A;  2GEN A;  2QOP A;  4CGZ A;  4EJU A;  5HS8 A;  5DD8 A;  1GVJ A;  5BQT A;  5FKM A;  1YQA A;  5CJ9 A;  4IOC F;  5D5W B;  1YTY A;  2GOM A;  4M73 A;  1ZRF A;  2NRA C;  2QBY A;  4M3D A;  3CMM A;  2CMP A;  1IN8 A;  3NPI A;  4NNJ A;  1V5G A;  2VC1 A;  1ZAO A;  2OQR A;  3WTY C;  4KIB A;  2EFO A;  3W6K B;  4HLX A;  1L3L A;  2PBX A;  4ITV A;  4AC6 A;  2M87 A;  2DG7 A;  3L7W A;  2O8X A;  1B9M A;  2H1L A;  1D0Y A;  3B02 A;  1S29 A;  2O03 A;  5F0F A;  3GTL J;  5CXG A;  2BYV E;  4JL3 A;  2V57 A;  4ZYE A;  5LHI A;  3GEZ A;  1B1B A;  2XAU A;  3F72 A;  3MEX A;  5H2F C;  2BBY A;  2IAI A;  2VJJ A;  3E7L A;  5LRR A;  2AXL A;  1YLF A;  1OYI A;  5GAG J;  2IS4 A;  1VQN I;  1IXR C;  3JRG A;  3RYP A;  4I01 A;  2UZK A;  3EET A;  5L3G A;  1WH7 A;  4M3E A;  4BUP A;  1Y1W J;  2O0Y A;  2MBF A;  4KYW A;  5IP6 A;  1XSD A;  2GIV A;  2YS9 A;  1MNE A;  1J5Y A;  4UHT A;  3HOZ J;  2DFI A;  3CQZ J;  3DTK A;  4OIN F;  2BHY A;  3P9I A;  4OD5 A;  1WJD A;  1IJW C;  2F5D A;  1FOW A;  3G6E I;  3C2B A;  1V5F A;  5JHU A;  3VOD A;  2TDX A;  5FLM J;  2XPW A;  1F43 A;  2IA0 A;  4QWQ A;  5E79 C;  4JOM A;  3V42 A;  2FNP A;  2CQN A;  3OS2 A;  5F0C A;  1LQ1 A;  3CC7 I;  2KIQ A;  3SYT A;  4HQM A;  2YSR A;  3MQ0 A;  5AON A;  3HSR A;  4A2U A;  5KVR A;  1B9N A;  2ZJQ F;  1R9T J;  4BY1 J;  1B8I B;  4OD4 A;  3VYU B;  2J5P A;  4BDY A;  3HOX J;  3QPS A;  2L3D A;  4A5M A;  1SD7 A;  5HOO A;  2RV8 A;  3VW2 A;  2L9R A;  3AG2 H;  2ADU A;  2ELJ A;  1UHW A;  1T39 A;  3EUA A;  3CCU I;  3U1D A;  3VVY A;  2DW4 A;  2A6E F;  3V7R A;  2KT0 A;  3BZK A;  4RGX A;  1USS A;  1YFH A;  1XSX A;  2KL4 A;  1MD0 A;  3C18 A;  1U78 A;  2EQR A;  1ZGA A;  4L9T A;  1X1B A;  3SQN A;  4P96 A;  4RAZ A;  2WAF A;  3FBN B;  1WHU A;  1TWC J;  3KZZ A;  4NEL A;  2R7V A;  2MA3 A;  5FHP A;  1TWH J;  4ZZL A;  2CV2 A;  1ZRD A;  4PJL A;  2DU9 A;  4EM1 A;  1FMV A;  4KT5 C;  1P9Q C;  4LIV A;  4BHB A;  4DBQ A;  2STW A;  3AQT A;  5K5R A;  1A31 A;  1OFC X;  3P9T A;  1IAW A;  4KNY A;  3IUO A;  2B3W A;  4F91 B;  2Z3Y A;  2JA2 A;  3KE2 A;  2QF7 A;  3M7G A;  3VOX A;  3MN2 A;  4PXI A;  3CDL A;  3S3O A;  4IHV A;  1DGR M;  1TWF J;  2CYY A;  1XG1 A;  1H88 C;  1K83 J;  4GYG A;  2REK A;  4HOB A;  3OR2 C;  3M3Y J;  2PMH A;  1HKQ A;  2KRC A;  2XRO A;  4KA4 A;  1FBU A;  3PM1 A;  2DPU A;  3VOK A;  4ENK A;  1FIA A;  1W5C C;  1FX7 A;  2KDO A;  5BS6 A;  2LBF B;  2I5U A;  1XDU A;  1W7P D;  3SXY A;  4KUM A;  2HKX A;  2EK5 A;  2EJR A;  2QUF A;  4OOI A;  1SFU A;  1RES A;  1U9N A;  3BTJ A;  4HSR A;  4U9L A;  3WU0 A;  2P6T A;  4BDZ A;  2DOA A;  1EKE A;  3E5Q A;  2BXZ A;  4V2F A;  1IDY A;  1ETO A;  2VN2 A;  2D45 A;  4CXF A;  4HNV A;  2CSO A;  3L2W A;  1U3E M;  3LHQ A;  3WG7 H;  3FBI B;  3LSI A;  4BYY A;  2JT1 A;  1MZB A;  2ZSI B;  3VVX A;  2QGU A;  3CMY A;  4I7H A;  3DWL E;  1Z67 A;  3JAM K;  2ISY A;  4U87 A;  4C3J J;  2WA0 A;  1YJW I;  1WH5 A;  2W48 A;  1MBG A;  1BI3 A;  3FHZ A;  2P7C B;  3JRE A;  3HOS A;  1VQ8 I;  1MMS A;  2DMN A;  3KEQ A;  4LLG F;  2QEN A;  3A4C A;  2HPI A;  4UUS A;  2UXH A;  3WG9 A;  1X3U A;  1UG0 A;  4BEH B;  1JKP C;  4GDF A;  2JRM A;  3JSJ A;  1IRX A;  3R4K A;  1KA8 A;  1I3A A;  1WQ2 A;  4XSX F;  5LHH A;  1Z77 A;  3QRF F;  4FHT A;  4X1E A;  1J9I A;  3D0S A;  3VYT B;  1FJL A;  1GVD A;  2K3F A;  2A07 F;  1QRY A;  3SDG A;  1GV2 A;  2LKP A;  1POG A;  2QKM B;  2BY1 A;  1R4M B;  2BGC A;  2KJC A;  4UVA A;  5BPI A;  2E1M C;  4LJZ F;  1NHA A;  4M3F A;  1S7A A;  5CPR B;  4A93 J;  3D5L A;  1YJN I;  5LBQ A;  3E1S A;  2LR8 A;  4AID A;  1QBJ A;  3BG9 A;  2W82 A;  2V9K A;  1RZ4 A;  2LF8 A;  3E6B A;  2O9L A;  2DA2 A;  1N25 A;  3K70 D;  2L0K A;  5CVU A;  2W84 A;  2PBI A;  1PDN C;  5CVV A;  5H9T A;  3OIQ A;  3BRO A;  2IPQ X;  3WOD F;  5D1R A;  3OSF A;  1ZLK A;  2F48 A;  3ANP A;  3ZQQ A;  3PUB A;  3A03 A;  5AIP A;  3Q9S A;  1KU7 A;  2B0L A;  2AO9 A;  2K9M A;  1MMA A;  4F7Z A;  1TL8 A;  3DBH B;  4E7J A;  2ZXH A;  3ON4 A;  2JRT A;  4A6D A;  2PJR B;  4KIG A;  4B44 A;  1H9T A;  4C2U A;  1R5H A;  3J7A Y;  3FK6 A;  3PO3 J;  1VQP I;  1TWA J;  3CCR I;  3KYC B;  3R61 A;  2L7M P;  2QZ8 A;  3JTH A;  4G6T B;  4P5O A;  1IO2 A;  4M9S A;  5KCM A;  2JZY A;  3EYI A;  2MLG A;  1M1E B;  5DM7 F;  3CJQ B;  1Z9C A;  1ULY A;  1U0J A;  4BS9 A;  2O8K A;  5CKT A;  1GXP A;  4XNF A;  1RKW A;  4WWC A;  1U8R A;  3I5U A;  3ZQG A;  2NOJ B;  5KK1 A;  4A3E J;  3TKY A;  3WU2 C;  1JUM A;  3JTG A;  2K02 A;  3S17 J;  1U6G A;  3CME I;  3GVA A;  3GZN B;  3QU6 A;  5EGO B;  1EF4 A;  2YU3 A;  1JGS A;  2DJI A;  2P0W A;  5LD2 C;  1JKQ C;  3G1L A;  1I6X A;  3U21 A;  4KIC A;  4XRF A;  3VOE A;  1D0Z A;  1JKR C;  5IYC J;  3V7C A;  1WCM J;  4NC7 A;  2MGQ A;  4YEJ A;  1IGN A;  2PLY A;  4A3B J;  1T0F C;  3LSK A;  4LG0 A;  4PJJ A;  4FT8 A;  2R5Z B;  1P7I A;  2EH3 A;  4KIT B;  5D5X B;  1BJZ A;  4RB2 C;  3NEU A;  5CQE A;  3OV8 A;  5C3E J;  3JCU C;  3QOE A;  3BRU A;  3BJB A;  1IRZ A;  1FSE A;  2CRG A;  3GLX A;  1XGS A;  3PFY A;  3LA3 A;  4FCY A;  4A0X A;  1ON2 A;  2VKE A;  5FKO A;  1GUU A;  2K40 A;  2WB1 A;  2IRF G;  1DGW Y;  2JVG A;  3I54 A;  3QP6 A;  3KEY A;  2V9P A;  2NOG A;  3P9C A;  3TDU C;  1FTT A;  3QPH A;  1WJA A;  1P7J A;  2EIM H;  2EZK A;  2OZ6 A;  4XKV A;  2KIS A;  1TT0 A;  4AC0 A;  2LD5 A;  4HX4 A;  1RR7 A;  3DBR B;  1T2K A;  4EQQ A;  4NQW B;  5FRN A;  2HYT A;  1RNL A;  4BGD A;  2DPD A;  3BPV A;  3L2Q A;  3EUH A;  2A05 A;  3J81 K;  3TDZ C;  4N9I A;  3BQZ A;  4AUX A;  2BHZ A;  3CCS I;  2VJ4 A;  4IHS A;  3ONQ A;  4HNT A;  4BE2 A;  2LKX A;  1W0U A;  2V9V A;  2E1M B;  3CF2 A;  5C44 J;  1W5T A;  1E17 A;  3OYG A;  4R1H A;  1Y56 A;  2BZT A;  1S8N A;  4AYB N;  5M3F J;  5FFZ A;  3IHU A;  3KET A;  3IH3 A;  4BJ5 C;  2DMQ A;  2HOA A;  2NAZ A;  1ZG1 A;  3FMS A;  4MLO A;  3WHC A;  2XDN A;  3M8E A;  4BBR J;  2PI0 A;  2OUM A;  4XID A;  1HDD C;  1QPI A;  4A3C J;  2XAH A;  1K79 A;  4PK4 A;  1S9H A;  2OBP A;  5LFA A;  4IHW A;  1QNT A;  2HOS A;  4Y13 A;  1IRG A;  3LAJ A;  3HSF A;  4A6E A;  4CIC A;  2EFW A;  1K4S A;  2KRF A;  2RNG A;  1LB2 A;  1WSU A;  3K6G A;  5EYR A;  4BE1 A;  2V1D A;  3ABU A;  1UZC A;  3SEZ A;  4M9X A;  3HOT A;  2PMZ N;  3HRU A;  3Q0W A;  2IEK A;  4XKC A;  1C0W A;  2W24 A;  3G1O A;  2ACJ A;  3BG6 A;  2IT0 A;  2FE3 A;  4IRH A;  3K8P C;  4OU0 A;  2ZSH B;  1P6R A;  4ZDO A;  1X3Z B;  1KYW A;  2MFZ A;  3W2W A;  3NQO A;  2UXX A;  1X4O A;  2RRE A;  2LKS A;  1A5J A;  4PZJ A;  3OWT A;  4D0P A;  3DV8 A;  2RVC A;  3AG4 H;  1FYL A;  2V7F A;  2QKL B;  4GCK A;  1Z3X A;  4M6X A;  1QO0 D;  1WJE A;  3QKX A;  1P92 A;  1ITY A;  3EPZ A;  3H9Q A;  1P4A A;  1S7O A;  3WHB A;  2GOX B;  4G8X A;  5F04 A;  4LOC A;  2CG4 A;  2Z5U A;  2VT3 A;  3GUD A;  3CCL I;  4F3Q A;  1PP8 F;  4RLQ A;  4PJM A;  2DI3 A;  2E1C A;  1UFM A;  1H9G A;  2DA6 A;  2HR3 A;  2JUG A;  2PMU A;  1OMI A;  2VPL A;  3QP5 A;  1IXS B;  2UUZ A;  3QAH A;  4WXH A;  5GPA A;  5DEQ A;  1FWZ A;  2UXN A;  4PDK A;  2VQH A;  4L62 A;  2LG4 A;  2FBI A;  2X1C A;  2HTS A;  2HVR A;  3NXC A;  1IF1 A;  1BC7 C;  1BR4 A;  2EA4 A;  2LH9 A;  2OPT A;  3BR6 A;  3BTC A;  3E5X A;  4FE7 A;  3JRD A;  1ZH5 A;  1PVE A;  3IWF A;  4DJA A;  1RUN A;  2L9S A;  4ETS A;  3GFI A;  5F1R A;  1FBS A;  3DKW A;  2XF5 A;  3JSO A;  4C30 A;  2RKH A;  3KIO A;  2BVM A;  1T6S A;  4MGR A;  1MH3 A;  2ZJ2 A;  2CQ7 A;  3FHN A;  2ETH A;  4OWR B;  3OYL A;  1KYZ A;  3B6A A;  1NG7 A;  3H3V K;  3HRM A;  2NX4 A;  2VOP A;  2Q24 A;  2XHK A;  4AVZ A;  3OL3 A;  3S1Q J;  5JLX A;  4BXU A;  2NS0 A;  4NUB A;  5JFR A;  4PJ0 C;  2QYO A;  1B6A A;  4OAZ A;  1TP4 A;  1I50 J;  1X1P A;  1BBY A;  2Y30 A;  4A0Z A;  3ZMT A;  4LLN A;  4C3I J;  3E3V A;  2VQC A;  2LDU A;  4IHY A;  3K7A J;  4RGS A;  4BU2 A;  1H89 C;  2D6Y A;  5K58 A;  1IRF A;  2Y69 H;  3FKJ A;  1U5T A;  4LIU A;  5C4J J;  1SFO J;  3KKC A;  1BM9 A;  1MGT A;  2RHA A;  2AHQ A;  3LSG A;  5E1W A;  2BY0 A;  2XSD C;  1OCR H;  5HDK A;  4YZE A;  2QA4 I;  2FBK A;  1LKX A;  4MEX F;  2VQL A;  3ASN H;  2Z99 A;  3F8M A;  3GCM A;  4ESB A;  4P9U A;  2OCC H;  1D1C A;  2NP5 A;  4EM2 A;  2L9N A;  3AAF A;  3IV5 A;  4HF1 A;  4I0A A;  4ZDL A;  3R0J A;  2DQL A;  1BW6 A;  2VKD A;  2HNH A;  2R7U A;  2K27 A;  3OR1 C;  4FQG A;  2ESH A;  1DPU A;  1ZEL A;  1WKM A;  3BCG A;  5E1X A;  5E20 A;  5D18 A;  2O61 A;  1VQM I;  3DPU A;  4UUS B;  4DYC A;  1O4X A;  4CUG A;  1KQ9 A;  4HQE A;  5JLW A;  5ICG A;  3HC7 A;  2FX0 A;  4XLC A;  2CUJ A;  4CDG A;  5HLG A;  2WWY A;  3CUQ A;  1UST A;  3M4O J;  1U2W A;  4M6Y A;  3OOU A;  5HOD A;  2HTJ A;  2QSF X;  4NC8 A;  1XD7 A;  1TQM A;  2HOT A;  4PUS A;  4P9F A;  4A3J J;  1R5I D;  5M3M J;  1R1T A;  3EUH C;  2DAO A;  2EA2 A;  3DLA A;  3J81 Z;  2G7S A;  4FX4 A;  3PIP F;  1LE8 A;  4L5I A;  4F92 B;  3CMA I;  2F5C A;  2XPU A;  5IT9 Z;  3OIP A;  3KCC A;  2CW7 A;  2LP0 A;  2L02 A;  4RA2 A;  5D19 A;  2MD0 A;  5D8K B;  2OTL I;  2KKO A;  1QHG A;  3BCB A;  3CJR B;  4ICH A;  1IDZ A;  5L3D A;  3GFJ A;  2DCE A;  4O5V A;  2WV1 A;  4AIJ A;  1ZGJ A;  4MXM A;  3KZ9 A;  3JRC A;  1G8X A;  3ASO H;  2LLK A;  1YOV B;  3QOP A;  1KZH A;  2YR2 A;  4A3G J;  3LST A;  1WJC A;  3DTI A;  5EF6 A;  3HXL A;  5J1Y A;  1IUF A;  3WGG A;  1ZLJ A;  3H35 A;  3CTA A;  1TTY A;  3J7Z I;  4XN3 A;  3W2A A;  2GAU A;  2QWT A;  1BOA A;  1IZ1 A;  2PG4 A;  1FOX A;  3SWH A;  4AD9 A;  1I39 A;  4E7K A;  2CW8 A;  1LVA A;  1VQ9 I;  4UB8 C;  2W53 A;  4XSZ F;  1YIT I;  1IV6 A;  1ETQ A;  2EZI A;  3ZMU A;  3S2W A;  3DPJ A;  4E6K G;  4IX7 A;  5F1J A;  2Y75 A;  3IKV A;  3CCJ I;  2H1K A;  1AKH B;  1WZ2 A;  1TWG J;  1FEX A;  4AIH A;  3HIM A;  2HQR A;  1XPX A;  3VW0 A;  3HE0 A;  4G6D A;  4U0Y A;  1QHH D;  2XGD A;  3RKX A;  3H1C A;  1G6N A;  3RTR A;  5GAE J;  1J59 A;  2EFN A;  2G7U A;  3T8T A;  4W97 A;  2QQ8 A;  3GF2 A;  1T8I A;  3OYN A;  2GFN A;  2A5W A;  2YU9 J;  2P8T A;  5LEJ A;  4OIQ F;  4UV9 A;  1T08 B;  2KLO A;  2H94 A;  2B1E A;  3NAU A;  2HYF A;  1HC8 A;  2NP3 A;  1GV5 A;  4JX5 A;  3N05 A;  2FOK A;  5GTH C;  1ACI A;  4LG3 A;  1SFE A;  3FM3 A;  4YG2 F;  4EEF G;  2FOW A;  3QOD A;  4HLY A;  5HVQ C;  1MW7 A;  1G59 A;  5H20 A;  2ZB9 A;  1UAA A;  1O3S A;  3BP8 A;  4IRI A;  4BQA A;  1MBE A;  5IOY A;  2RAE A;  4CYC B;  2KDZ A;  4GYI A;  2H27 A;  1D1A A;  3K2A A;  3S8P A;  1RIO H;  2DQR A;  4BHP A;  4EAT A;  2DA4 A;  2EIK H;  2IGN A;  4XRS G;  3S1R J;  2K9L A;  1VQ5 I;  3EQL F;  4E70 A;  1E2X A;  2VOD A;  2K9N A;  3ZMD A;  3I71 A;  2ZCW A;  2HFH A;  1R71 A;  1ETY A;  1R00 A;  1F5T A;  2N8G A;  3TP0 A;  3G4S I;  1OYW A;  3I4P A;  1BN5 A;  3ZQC A;  3G73 A;  2E1O A;  5F64 A;  5D8L B;  4O3M A;  5CXI A;  3IH4 A;  2I10 A;  3FX3 A;  3CDH A;  1N75 A;  5EEG A;  1U9O A;  2OC6 A;  3MKL A;  4A3M J;  2C6Y A;  4LB5 A;  3MKY B;  2FQ3 A;  4LK1 F;  4Q47 A;  4CH7 A;  2GM4 A;  5KNL A;  3I56 I;  2R5Y B;  1Z3Y A;  5J4V A;  4EGZ A;  2FF4 A;  3MD2 A;  1U5T C;  2EV6 A;  3FF5 A;  1G3T A;  2O5R A;  4JBA A;  3VB2 A;  3SDB A;  3F21 A;  1NTC A;  1FT9 A;  3BJO A;  2IS2 A;  4C2M J;  5L3B A;  2UXU A;  2R7O A;  2DDA A;  5C4Y A;  5LHG A;  2VKV A;  1TC3 C;  1BR2 A;  2X6W A;  1Y39 A;  1S6L A;  5FB2 A;  1TW3 A;  4CCM A;  4N4O B;  4UV8 A;  1ERD A;  3RIR A;  2OAZ A;  2ZXI A;  2HS5 A;  4IHT A;  1ZN2 A;  2LY9 A;  2FJ1 A;  2Y31 A;  1GLN A;  4MFD A;  2VAS A;  1HKT A;  1LVK A;  2WUI A;  4UUV A;  5HNH A;  5HAW A;  3REO A;  3I3L A;  3VIB A;  3LMM A;  2M5W A;  2FD5 A;  4N9H A;  4WXD A;  2XIG A;  1JT6 A;  4NB5 A;  2W1O A;  2DFF A;  3AG1 H;  3KLO A;  4X6A J;  1OLT A;  3CP8 A;  3CLO A;  1NK3 P;  2ZKZ A;  3CUQ C;  4ZZD A;  4PJN A;  3RPU A;  4FTH A;  3F8N A;  1W36 C;  1QVU A;  1ETW A;  4HRI A;  3EDP A;  4JX4 A;  3LWJ A;  4HW0 A;  1X4P A;  1WGX A;  1ZAR A;  5FD6 A;  2JWT A;  2ZME C;  3T8R A;  4I99 C;  4XM3 A;  2A6T A;  1K78 A;  1S5L C;  1CF7 B;  5F6F A;  4QTR A;  2IJL A;  3EUP A;  1O57 A;  3HOV J;  3K10 A;  1TBX A;  2E19 A;  2JK3 A;  2EFQ A;  5E17 F;  4AIK A;  3HB9 A;  3W2V A;  2OQG A;  4DYR A;  2F07 A;  1F9N A;  2PQ8 A;  5DUK A;  4II3 A;  1XCV A;  1LDJ A;  3HOY J;  3ULQ B;  3G71 I;  1EH6 A;  3GW2 A;  3FXL A;  3VEP A;  4IO9 F;  3GZ6 A;  3Q3S A;  5F27 A;  3FMQ A;  2Y0S A;  3GLL A;  2LTP A;  4CCJ A;  3H0G J;  3NAR A;  5FD5 A;  2X6X A;  3I58 A;  1AWC A;  2O6G E;  1FYK A;  1W36 D;  1STZ A;  2H8W A;  3DFG A;  3LOC A;  4U0W A;  2B9S A;  4OIO F;  1SGM A;  3ABK H;  3ABM H;  3K69 A;  4Q48 A;  1SD6 A;  2JVH A;  1FTZ A;  3S3N A;  3HRT A;  4J19 A;  3ZQL A;  3FK7 A;  1Q1H A;  3F22 A;  5E3O A;  2OI8 A;  2L7Z A;  3QPT A;  3DKX A;  5J4Y A;  4YEL A;  5TGT A;  2L7K A;  2CQQ A;  3CJT B;  1U5T B;  5GP9 A;  2K4J A;  3FDY A;  2DOE A;  3M9A A;  3GYH X;  4EGY A;  1BIB A;  2M1B A;  3F9K A;  2RN7 A;  2K5C A;  2R7R A;  4GCV A;  1YIJ I;  1MJB A;  2VBY A;  3EGQ A;  4XOP A;  1BI2 A;  4RM2 A;  1QZY A;  3OS1 A;  2CWE A;  4BJ6 C;  3VW1 A;  3ZRG A;  1WRJ A;  4KIF A;  3QU3 A;  2QWW A;  2V1U A;  1IW7 F;  1ETX A;  4IVN A;  3V7S A;  3ZQF A;  4RDU A;  3COA C;  3MAJ A;  4CZC A;  2IGK A;  3GX4 X;  2FQ4 A;  3GBG A;  4ZDP A;  2E2H J;  5JHF A;  2FU4 A;  1UHS A;  3CUQ B;  4M6V A;  1KU9 A;  2DT5 A;  5FLV A;  4I98 B;  1RI7 A;  4HZF A;  4N0B A;  1Z05 A;  3LSH A;  4XBF A;  4Y52 J;  5DTD A;  4XL9 A;  2BEO A;  3A01 A;  4BXF A;  3SZG A;  4IKF A;  4L9J A;  1J7K A;  3BPX A;  2HKU A;  1KGS A;  3HG9 A;  4R79 A;  2ZME B;  1LE8 B;  3ZPL A;  1OCZ H;  3UKG A;  4Q5S F;  1TLH B;  1DP3 A;  2LVS A;  4XN0 A;  3K4L A;  4ACI A;  5LGN A;  5H6Q A;  2VQG A;  4RGU A;  4ENM A;  1IV8 A;  3OYK A;  2ELH A;  2XGC A;  1REP C;  2HZD A;  4CO8 A;  1MBJ A;  3HKZ N;  1R6R A;  4C3H J;  1JT0 A;  3O6B B;  4CCL A;  4IRG A;  1GXQ A;  3GTG J;  1UI6 A;  4IRV A;  4XLN F;  3NI7 A;  1YIO A;  5J3L A;  1OCC H;  3OYA A;  2ZCN A;  3KP3 A;  2LOO A;  1I5Z A;  1Z7U A;  3I59 A;  4EJT A;  2FNA A;  3VSK A;  2FUG 2;  5IY5 H;  4IZZ A;  1F1Z A;  2P7V B;  2G9W A;  3V8K A;  3Q0V A;  3E0J B;  3SZT A;  2RC4 A;  4YIF A;  2DA1 A;  3O2P E;  3GTQ J;  3G7R A;  4NHJ A;  2XRL A;  2OA4 A;  4UB6 C;  3S32 A;  2XAG A;  5IYB J;  1ZHF A;  3AL0 B;  2Q0O A;  2XAS A;  4E7Z A;  3Q5F A;  3KNW A;  3MZH A;  3HL2 A;  1ENH A;  2NVT J;  5BMZ A;  3T5X A;  1D5Y A;  1PUE E;  1HBX G;  1YW8 A;  4WK8 F;  2QTQ A;  2OCE A;  1UEL B;  4M3B A;  2EZL A;  2IP2 A;  2GA1 A;  4LLL A;  4FIS A;  4YFK F;  5DDG A;  1O3Q A;  1KQ8 A;  2LK2 A;  3OOP A;  3F0C A;  1HW1 A;  2ECC A;  3GTO J;  5CYV A;  1JHH A;  5HLH A;  4XLA A;  2A68 F;  5FFX A;  3A0B C;  3COL A;  2M0C A;  5DAJ A;  2ID3 A;  1IC8 A;  2RNJ A;  3HJE A;  1MSF C;  5FJ8 J;  2DYS H;  4UVB A;  3F6O A;  4Y4R A;  3L2U A;  1FPQ A;  2JPC A;  4X0G A;  4V19 K;  3LQR A;  2LNB A;  3LAP A;  1GDT A;  1SAN A;  2VPR A;  2FSW A;  1MKM A;  2K86 A;  1DDN A;  2E1N A;  1JHF A;  1KQ0 A;  3OYJ A;  2YVX A;  2R7Z J;  5DCF A;  3K1N A;  3MKW B;  2LY1 A;  1JGG A;  5GAH J;  2D2W A;  3S1M J;  4A3L J;  1LDK B;  4E4H A;  5TRD A;  2EV5 A;  3IP4 B;  3KZI C;  4BH9 A;  2V1X A;  4HYE A;  2RDP A;  2PJP A;  4LGW A;  4CA0 A;  3AQS A;  5FKN A;  3QYF A;  4E7H A;  3VWB A;  1A04 A;  2E60 A;  4EJW A;  3BLY A;  4I76 A;  2ZC2 A;  4ZYA A;  2KRH A;  3NWT A;  4DBR A;  5M5X J;  2XUB A;  1E3O C;  3R0A A;  3BHQ A;  4AVP A;  4HX7 A;  3G56 A;  3GEU A;  2GLO A;  1B4A A;  3MZ8 A;  4BJT A;  5K7Z A;  3F23 A;  2QBY B;  3IRR A;  2YUS A;  1O3T A;  3P9K A;  2ISZ A;  1D8J A;  3F8F A;  2H6C A;  5D6E A;  2WAE A;  3F8C A;  2ZBK A;  2JSP A;  4CYD A;  4MIM A;  1ORK A;  1HKS A;  1FZP B;  2FJI 1;  2DJN A;  3BT9 A;  3K2Z A;  3ON2 A;  3D5R C;  2Q2E A;  2R7T A;  2XGE A;  1G3S A;  1YI2 I;  3CRJ A;  3IAS 2;  1TZL A;  5IT9 K;  3AG3 H;  4RBO A;  1DP7 P;  3O60 A;  1OIS A;  5E3L A;  3V78 A;  3CWR A;  4PSX A;  2PZ9 A;  2GXB A;  3H3U A;  2VT2 A;  3M1E A;  4P1W A;  2TRT A;  1VQL I;  4RB0 A;  3IAM 2;  4KFC A;  4ZYH A;  3MKZ A;  1T95 A;  2BY3 A;  4JK1 X;  1LJ9 A;  4G7H F;  4M72 A;  4YIR X;  4DGW B;  3HBL A;  2GWR A;  3HM5 A;  2O7O A;  4A0Y A;  1T56 A;  1X58 A;  4RM3 A;  2MYS A;  3PPB A;  3IRQ A;  3S5R A;  1HST A;  4ME9 A;  3DKY A;  2ZFW A;  2VIX A;  3KYD B;  1TNS A;  3BNI A;  3BR0 A;  4HST A;  4CHU A;  3G3Z A;  4M3G A;  3M07 A;  2M0M A;  3BJA A;  3TO7 A;  2E34 A;  3CZ6 A;  3TGN A;  4B8X A;  3H3Z A;  3FXO A;  3B81 A;  1G3Y A;  3PL8 A;  2IGO A;  4A3D J;  4EMS A;  4DVY P;  1OR7 A;  3ESW B;  4D7M A;  1LUJ B;  4B3A A;  4J00 A;  3FRQ A;  5ERI A;  1TT5 B;  1J75 A;  2XVC A;  3C7J A;  4UDS A;  1K78 B;  4MTE A;  4B3X A;  4CGR A;  1Z91 A;  5K5Q A;  3L9F A;  3HRS A;  1WJF A;  5EEH A;  1BI1 A;  2M4G A;  2DK8 A;  3H5N A;  1PJR A;  1TQI A;  2CH0 A;  2R7Q A;  2MW8 A;  3DEE A;  1Z0X A;  4LFU A;  4TV7 A;  3ZQI A;  4OMY A;  2OTJ I;  5LLQ A;  5AIQ A;  2D5V A;  4Y17 A;  3C3W A;  2X6O A;  2HXI A;  1Z7L A;  4EJO A;  2JA7 J;  1MJA A;  2R93 J;  3S15 J;  4GGG A;  1MMD A;  2K7L A;  5DUI A;  1JKO C;  3FXM A;  5E3N A;  3NS4 A;  2UV1 A;  5FLX K;  1V54 H;  4AM3 A;  4B09 A;  2WY8 Q;  5F08 A;  2DG8 A;  3M8J A;  2X6Y A;  1FOK A;  1WPK A;  4I09 A;  2E5Z A;  2XSJ C;  1HA8 A;  1AOY A;  2HWV A;  3MWM A;  2VC0 A;  2X48 A;  3K4M A;  3OYB A; 
#chains in the Genus database with same CATH homology
 5HBU A;  3AQT A;  1AKH A;  2YU9 J;  2LFB A;  1OFC X;  4BY7 J;  4XRM A;  3P9T A;  2CJJ A;  3NAU A;  2NP3 A;  2IBD A;  1ZTR A;  1GV5 A;  4JX5 A;  1UG2 A;  1AU7 A;  3RZO J;  5M5Y J;  1H8A C;  2QF7 A;  1LFU P;  3MN2 A;  2QIB A;  3LJL A;  3PAS A;  3VOX A;  4PXI A;  1RPW A;  3FIS A;  2DN0 A;  3CDL A;  4EEF G;  4IHV A;  1TWF J;  1XG1 A;  3FIW A;  1H88 C;  1YRN A;  1K83 J;  3SJM A;  4A3F J;  2REK A;  5M5W J;  1JUP A;  4BBS J;  5FKK A;  3M3Y J;  2ZB9 A;  2G0E A;  1MBE A;  5IOY A;  2RAE A;  3PM1 A;  4CYC B;  2KDZ A;  3VOK A;  1FIA A;  3K2A A;  2IU5 A;  2VUM J;  3MNL A;  2DA4 A;  3HGY A;  4XRS G;  5IYD J;  3S1R J;  4HKU A;  3QBM A;  2CQX A;  3VVZ A;  1PUF A;  4A69 C;  2K9N A;  1X2M A;  3HEF A;  1FIP A;  3HTA A;  2CUE A;  2DTZ A;  1RES A;  1APL C;  1U9N A;  1ETY A;  3BTJ A;  2N8G A;  4CYC A;  3W6V A;  3TP0 A;  3ZQC A;  2E1O A;  1IDY A;  4V2F A;  5CXI A;  3IH4 A;  1ETO A;  2I10 A;  1F36 A;  4QSH A;  1U9O A;  4HNV A;  1GT0 C;  3LHQ A;  3MKL A;  4A3M J;  5EFY A;  4DZP A;  9ANT A;  3VVX A;  5K7H A;  3GTJ J;  4ABZ A;  3CMY A;  2GM4 A;  2R5Y B;  1JTY A;  4C3J J;  4V2G A;  4FE4 A;  1WH5 A;  2W48 A;  1MBG A;  3JRE A;  5HSZ A;  1NTC A;  4NN1 A;  2QCO A;  4C2M J;  2UXU A;  2DMN A;  3GZI A;  1VI0 A;  3A01 B;  5C4Y A;  2VKV A;  4UUS A;  4I6Z A;  2UXH A;  1TC3 C;  2ELK A;  3DEW A;  1I6H J;  2R5Y A;  1W0T A;  1JKP C;  3JSJ A;  2ZOY A;  2RAS A;  2OF7 A;  3BR3 A;  4MFE A;  1UI5 A;  3LNQ A;  2YVH A;  1Z77 A;  2LY9 A;  1T33 A;  2FJ1 A;  2Y31 A;  4W1U A;  1CQT A;  4MFD A;  2FBQ A;  3Q0U A;  4X1E A;  3A02 A;  2WUI A;  1FJL A;  5HAW A;  3VIB A;  3HGG A;  1GVD A;  5GPC A;  2G3B A;  2FD5 A;  1QRY A;  4MO7 A;  3SDG A;  1GV2 A;  1POG A;  1JT6 A;  1ZR2 A;  2JA6 J;  3BR1 A;  2M34 A;  4X6A J;  3GEU A;  4M3F A;  1NK3 P;  3JR9 A;  4A93 J;  3O8G A;  3OSG A;  2DMP A;  4AF5 A;  2ECB A;  2LR8 A;  5FGL A;  4FTH A;  3BG9 A;  1QVU A;  1ETW A;  2ME6 A;  2JJ7 A;  2O9L A;  2VI6 A;  2DA2 A;  2L0K A;  4JX4 A;  3LWJ A;  1Y1V J;  1WGX A;  2DA7 A;  2Y9Z A;  5H9T A;  5D1R A;  1JTX A;  1MBH A;  2JWT A;  3OSF A;  3ANP A;  3NRG A;  2JA8 J;  2K9Q A;  3A03 A;  2L7F P;  2WGB A;  4QTR A;  2XB5 A;  3O8H A;  2JMW A;  2AO9 A;  3EUP A;  2E2I J;  3HOV J;  1K61 A;  4Y7N J;  3ZOB A;  3B6C A;  2E19 A;  1B8I A;  3PO2 J;  2JK3 A;  3ON4 A;  3HB9 A;  4DYR A;  2F07 A;  2CUF A;  3FK6 A;  3PO3 J;  1TWA J;  3DCF A;  3HOY J;  2L7M P;  2B63 J;  3Q3S A;  3LSJ A;  5F27 A;  3F1B A;  2NVQ J;  4JP0 A;  3VPR A;  1U8B A;  5IOZ A;  2LTP A;  5EG0 B;  1WI3 A;  2ZCM A;  5E3M A;  3H0G J;  3NAR A;  3IUV A;  2GBY A;  2NVX J;  2O8K A;  5EDN A;  1RKW A;  3BR2 A;  3LOC A;  3RZD J;  1SGM A;  3ZQG A;  4A3E J;  3GTM J;  1JUM A;  4JX6 A;  3S17 J;  1FTZ A;  1HOM A;  1HLV A;  1IG7 A;  5EGO B;  1EF4 A;  1MBF A;  4J19 A;  2GUH A;  3ZQL A;  1JKQ C;  3G1L A;  3FK7 A;  3T6N A;  1JKR C;  1S7E A;  2OI8 A;  5E3O A;  5IYC J;  2L7Z A;  1WCM J;  3FKI J;  2MGQ A;  1B72 B;  1IGN A;  4A3B J;  3I4N J;  3VUQ A;  2CQQ A;  4GCL A;  1JUS A;  3OIO A;  1I3Q J;  3ANG A;  5GP9 A;  2R5Z B;  4D5F A;  1P7I A;  2EH3 A;  5EGO A;  1BJZ A;  5C3E J;  3BRU A;  2MG4 A;  1VF9 A;  1IRZ A;  2CRG A;  3BJB A;  3V6G A;  4BKX A;  4FCY A;  2VKE A;  4L5E A;  1GUU A;  2K40 A;  5FKO A;  3NNR A;  3BTI A;  2NOG A;  2NS8 A;  1FTT A;  2G7L A;  2R5Z A;  1P7J A;  2EZK A;  3EGQ A;  4AC0 A;  2DA3 A;  2LD5 A;  4KWA A;  1RR7 A;  3S2D J;  3VW1 A;  2HYT A;  4XRS A;  1BA5 A;  3RH2 A;  2M8G X;  4B4C A;  4GFB A;  4AUX A;  3BQZ A;  3HTH A;  1ETX A;  4DYQ A;  4RDU A;  3ZQF A;  4JKZ A;  3LSP A;  2LKX A;  1W0U A;  2FQ4 A;  5C44 J;  3GBG A;  4S0H B;  5AQC A;  2E2H J;  3S16 J;  1MBK A;  1UHS A;  4M6V A;  4AYB N;  5M3F J;  1NK2 P;  5FLV A;  2K9S A;  1DU6 A;  3IH3 A;  1XC5 A;  2DMQ A;  4DZJ A;  2HOA A;  4Y52 J;  5DTD A;  4MLO A;  3BG5 A;  4NDL A;  2EZH A;  4DW6 A;  3WHC A;  1ZQ3 P;  3A01 A;  1RET A;  2XDN A;  3KKD A;  2HKU A;  4BBR J;  1LE8 B;  3BQY A;  4XID A;  3CCY A;  3UKG A;  5J1R A;  1HDD C;  1G2H A;  1QPI A;  3HTI A;  1ETK A;  2LVS A;  4A3C J;  4ACI A;  2P81 A;  4IHW A;  2R0Q C;  2HOS A;  2XGC A;  1MBJ A;  3HKZ N;  4A3I J;  4C3H J;  1XS9 A;  1JT0 A;  3I4M J;  2QKO A;  2ZCX A;  3RD3 A;  5EYR A;  4XK4 A;  3GTG J;  1UI6 A;  3NI7 A;  5J3L A;  2ZCN A;  2PMZ N;  3CJD A;  3BTL A;  3Q0W A;  3GTK J;  2IEK A;  3RKQ A;  2G7G A;  3G1O A;  3TW7 A;  2XPV A;  2DMU A;  5K7F A;  4IHX A;  5FMP A;  3Q0V A;  3HOU J;  1X2N A;  2DA1 A;  3GTQ J;  1A5J A;  3G7R A;  3MVP A;  2XRL A;  1LFB A;  1VND A;  4GCT A;  5IYB J;  4GCK A;  3LSR A;  2MSY A;  3QKX A;  3KNW A;  1DU0 A;  3SFI A;  1ITY A;  1MNM C;  1ENH A;  2NVT J;  3WHB A;  1D5Y A;  5F04 A;  3BR5 A;  2QTQ A;  4LOC A;  4XIC A;  3VP5 A;  3D1N I;  4M3B A;  2EZL A;  1UMQ A;  4FIS A;  2LK2 A;  2Y2Z A;  1JJ8 C;  2HQ5 A;  3F0C A;  2ECC A;  2HI3 A;  5EZH A;  1RKT A;  4QIW N;  3GTO J;  2DA6 A;  3S2H J;  2O7T A;  2M0C A;  3COL A;  2ID3 A;  1IC8 A;  5C4X J;  5DAJ A;  2UXP A;  5IP9 J;  2YVE A;  5GPA A;  4GFL A;  1JJ6 C;  1MSF C;  5FJ8 J;  1QVT A;  2Y0S N;  3L1P A;  4L62 A;  3TED A;  1GDT A;  2HDD A;  1SAN A;  4MK6 A;  2VPR A;  2X9D A;  3NXC A;  3BG3 A;  3TW6 A;  1ZKG A;  1HCR A;  3E7Q A;  2OPT A;  4FE7 A;  3BR6 A;  3BTC A;  5EG0 A;  5FKL A;  4JYK A;  3JRD A;  2WAQ N;  3QQA A;  2R7Z J;  1JGG A;  2M9H A;  1YRN B;  4B1R A;  2OER A;  3ZQH A;  1BL0 A;  2ME0 A;  3S1M J;  4A3L J;  2M2E A;  4D5C A;  2UXO A;  1MH3 A;  3S1N J;  3H3V K;  3B6A A;  2NX4 A;  3AQS A;  2NS7 A;  2Q24 A;  5FKN A;  1VFC A;  3S1Q J;  4BXX J;  5JLX A;  1PUF B;  1ZGW A;  2DMT A;  4I76 A;  1I50 J;  2Y30 A;  5IPA A;  5M5X J;  4C3I J;  1E3O C;  3S14 J;  1OCP A;  1HF0 A;  2UXI A;  3BHQ A;  2DA5 A;  4IHY A;  3K7A J;  1B72 A;  1H89 C;  3HDD A;  3HOW J;  3JRA A;  2GLO A;  1OCT C;  2D6Y A;  5K7Z A;  3G56 A;  5C4J J;  1SFO J;  3KKC A;  5K58 A;  2CU7 A;  2YUS A;  2RHA A;  3TP3 A;  1OJL A;  2AHQ A;  3LSG A;  2WB1 N;  2H8R A;  2XSD C;  2GEN A;  2QOP A;  4YZE A;  4MIM A;  5FKM A;  1ORK A;  2DJN A;  1HDP A;  2NP5 A;  5CW8 A;  3BT9 A;  4M3D A;  3IV5 A;  2EBI A;  3ON2 A;  5EEA A;  3NPI A;  2XGE A;  2ZOZ A;  1BW5 A;  3CRJ A;  1BW6 A;  4RBO A;  3O60 A;  5E3L A;  3BCG A;  3V78 A;  5D18 A;  2PBX A;  3CWR A;  4AC6 A;  5F0H A;  2DG7 A;  2PZ9 A;  4UUS B;  4DYC A;  2TRT A;  1O4X A;  5F0F A;  3GTL J;  5CXG A;  1MSE C;  4JNN A;  4JL3 A;  2V57 A;  5JLW A;  3HBL A;  2FX0 A;  3C07 A;  3HM5 A;  2O7O A;  3JRI A;  1T56 A;  2COB A;  3JRF A;  1X58 A;  3M4O J;  2IAI A;  3OOU A;  3E7L A;  5HOD A;  3PPB A;  3S5R A;  4ME9 A;  4GFK A;  2HOT A;  4UUT A;  3JRG A;  4IEJ A;  4A3J J;  5M3M J;  3BNI A;  2G7S A;  3BR0 A;  1WH7 A;  4M3E A;  3IH2 A;  1LE8 A;  4M3G A;  1Y1W J;  2XPU A;  5IP6 A;  2LP0 A;  3B81 A;  2YS9 A;  3GTP J;  5D19 A;  4G12 A;  1Q1V A;  4A3D J;  5EZG A;  3HOZ J;  2JN6 A;  2TCT A;  3CQZ J;  4ICH A;  4D7M A;  4B3A A;  1IDZ A;  1IJW C;  3FRQ A;  3C2B A;  2R92 J;  2WV1 A;  5FLM J;  1F43 A;  4MXM A;  2XPW A;  3KZ9 A;  3JRC A;  5BNG A;  2LLK A;  1MH4 A;  1ETV A;  4A3G J;  4UDS A;  4CGR A;  5EF6 A;  5J1Y A;  1IUF A;  5F0C A;  2E2J J;  3JRB A;  1AHD P;  3RQI A;  1R9T J;  4BY1 J;  2HYJ A;  1B8I B;  3G1M A;  3ZQI A;  2MW8 A;  5IP7 J;  1Z0X A;  3HOX J;  3QPS A;  2QWT A;  1ZR4 A;  3VW2 A;  2D5V A;  2L9R A;  2X6O A;  3HTJ A;  2HXI A;  2JA7 J;  5J1U A;  3VVY A;  2W53 A;  2R93 J;  3S15 J;  1IV6 A;  1ETQ A;  2KT0 A;  2EZI A;  1JKO C;  5E3N A;  3DPJ A;  5DS9 A;  2Y9Y A;  4A3K J;  2XB0 X;  2NVY J;  3QPL A;  5F1J A;  3HIM A;  2H1K A;  1AKH B;  4D7N A;  1TWG J;  3JRH A;  2EQR A;  1U78 A;  1FEX A;  3VW0 A;  3HE0 A;  5F08 A;  2DG8 A;  2XGD A;  1WPK A;  1TWC J;  2HXO A;  2ID6 A;  4W97 A;  2JA5 J;  1A6I A;  1TWH J;  5FHP A;  2X48 A;  4NEL A;  2GFN A;  1ZK8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...