3BT9A

Crystal structure of qacr(e57q) bound to dequalinium
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIQESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title QacR-cation recognition is mediated by a redundancy of residues capable of charge neutralization
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator qacR
total genus 78
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2007-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3bt9A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3bt9A02
3JRFA 1IUFA 1QVTA 4DYQA 2R5ZA 3UKGA 1LE8A 3NAUA 1ETOA 4KWAA 3RH2A 3DEWA 3B81A 1HF0A 3CQZJ 3JREA 4AUXA 5K58A 4GCKA 2ZOYA 2WAQN 1IGNA 5EZHA 1VNDA 1ZK8A 4FISA 4NDLA 1RETA 3LSRA 2L7MP 2WUIA 1FEXA 3QPLA 2XGDA 3BR6A 3HOVJ 2QTQA 5H9TA 4GCLA 3BNIA 2NS8A 3NARA 3V78A 1FIAA 4XRMA 1IDZA 4JKZA 5EG0A 1WGXA 3HOXJ 5K7ZA 4I76A 2VI6A 2ME0A 2R5YB 2KDZA 2DG7A 1ETXA 3PASA 3BTLA 3GTLJ 2Y30A 2Y31A 1T56A 1BJZA 5JLWA 3VVZA 5FLMJ 4JX4A 2K40A 2DJNA 4XICA 4RBOA 4M3FA 4BBSJ 2M9HA 1FTTA 2ZCXA 1ETQA 3PPBA 3C2BA 1IG7A 2TCTA 1SFOJ 4MFDA 1VFCA 3GTQJ 1ITYA 4M6VA 5FGLA 1MBKA 1P7IA 4D5CA 2DTZA 5HBUA 5HODA 4AC0A 1X58A 2VPRA 1H89C 2I10A 5IP6A 3BCGA 2G7SA 3O8GA 3S15J 1RKTA 5EGOA 5J1RA 2R0QC 4DZJA 2CUEA 3CMYA 3S1MJ 1XS9A 3EGQA 4MFEA 2LP0A 1U9OA 3G1LA 2R5YA 4PXIA 5EZGA 3I4NJ 5IP9J 5M5WJ 1ZKGA 5EF6A 3ON2A 3LSJA 3AQSA 1F36A 1FTZA 3HTAA 3HOYJ 1AKHA 3FRQA 3GTGJ 2CU7A 2QOPA 1MH3A 4UUSB 4X6AJ 5D1RA 4XRSG 2LD5A 2CUFA 2ECBA 3C07A 3JR9A 1A6IA 2HOSA 2NP3A 3HTIA 5EFYA 3SDGA 5HSZA 3K2AA 4D7NA 3DPJA 4JNNA 4QTRA 4UUSA 2R5ZB 1I6HJ 5C4JJ 4IHXA 2D5VA 3GTKJ 1JKPC 1YRNA 4A93J 1UI5A 2F07A 3VP5A 1JKQC 3GTOJ 3OOUA 4X1EA 5FJ8J 5IPAA 5F27A 2O9LA 5IP7J 3PO2J 3Q0VA 2D6YA 2G0EA 4GFBA 3ZQLA 2DA4A 2DA2A 2JA6J 3CDLA 3VIBA 2Y9ZA 2GM4A 3EUPA 2K9SA 3GTJJ 2HDDA 1IDYA 3RKQA 3V6GA 4GCTA 2O7TA 3Q3SA 5J3LA 3MVPA 4A3CJ 2L0KA 4AC6A 1GDTA 2NVYJ 2LVSA 1MBEA 1Y1VJ 3IV5A 2VUMJ 2Q24A 4MLOA 4A3FJ 2RHAA 2G3BA 3JRGA 4MK6A 1IV6A 4S0HB 2W53A 1B72A 3TP0A 3OSFA 2NVQJ 3BTIA 2ZCNA 2GUHA 1POGA 1MBJA 2XGEA 3NXCA 3S5RA 3BR0A 2DG8A 1WPKA 1Z77A 3BG3A 2H1KA 4W1UA 3G1OA 5EGOB 3A01A 1QRYA 2LLKA 1Y1WJ 2E2IJ 1NK3P 5IOZA 1U78A 3W6VA 2Y9YA 2N8GA 2KT0A 1PUFB 1VI0A 3FKIJ 2IEKA 3I4MJ 3LOCA 1JJ8C 2QWTA 3A02A 2LFBA 3NI7A 4ICHA 3PO3J 1ZR2A 5AQCA 4GFLA 3TEDA 5EEAA 1LFUP 5FMPA 3FK7A 2XDNA 3KZ9A 5K7FA 2LR8A 2GENA 3GBGA 3KNWA 3E7LA 3GEUA 2LK2A 2MSYA 3QKXA 4W97A 1JTXA 5J1YA 2UXOA 1OCTC 2R7ZJ 5FKKA 3HTJA 3IH3A 3TP3A 2NS7A 4EEFG 3VOKA 2L9RA 3LWJA 4MXMA 1ENHA 1U9NA 4ACIA 2LKXA 2QKOA 2QF7A 4XRSA 3BT9A 3SJMA 4IHWA 1TC3C 1TWAJ 2HOAA 3BTJA 1JUPA 2JK3A 4BY7J 4ME9A 2X48A 3O60A 1R9TJ 4A3LJ 3T6NA 1ETYA 4QIWN 3S17J 4IEJA 2JJ7A 2PZ9A 2V57A 4C3HJ 4FTHA 4V2GA 2XB0X 4CYCB 3ZQCA 1ZQ3P 1Z0XA 5GPCA 2WB1N 5F04A 2M34A 5JLXA 2ME6A 1AU7A 5EG0B 1A5JA 4ABZA 3BQYA 3S14J 2K9NA 1UG2A 3JRAA 3TW6A 1JTYA 3MN2A 2XPWA 4B1RA 1QVUA 2YVEA 4QSHA 2W48A 3RQIA 2GBYA 4UUTA 4FCYA 5M5YJ 1U8BA 3JRIA 4HKUA 3LNQA 2WGBA 3HTHA 5BNGA 3RZOJ 4BBRJ 2EQRA 4XIDA 2CRGA 2MGQA 4A3JJ 2TRTA 5F0FA 3VW0A 1BA5A 3ON4A 1UHSA 2AO9A 3BQZA 4A69C 3B6CA 1H88C 5GPAA 2RAEA 5IYDJ 3S1RJ 2XGCA 2H8RA 5C3EJ 3G1MA 1W0UA 1TWGJ 4YZEA 5C4XJ 3PM1A 3HB9A 4M3DA 3MKLA 3JRDA 2DA6A 4C3IJ 2DA1A 3Q0UA 3H3VK 1X2MA 4G12A 2UXPA 4JX6A 4C2MJ 4Y7NJ 2E19A 1APLC 5DAJA 5E3NA 3JRCA 1IRZA 3JSJA 3BHQA 3ANPA 2DMPA 3HEFA 1HDDC 1WCMJ 3TW7A 3OSGA 1JKOC 2UXUA 5HAWA 1JGGA 4FE4A 4IHYA 2ZB9A 3KKCA 2R92J 5IYCJ 3A03A 3WHBA 2JA7J 5CXIA 3D1NI 2ELKA 2M2EA 4BKXA 2WV1A 2OERA 1MBGA 4LOCA 5C44J 3NRGA 5DTDA 1AHDP 3H0GJ 3LHQA 2REKA 3CWRA 2O7OA 1OJLA 1FJLA 2UXHA 1Q1VA 1OFCX 3S2HJ 4DYRA 1BL0A 2GFNA 3M4OJ 1FIPA 4A3GJ 2OI8A 5E3OA 5M3FJ 5J1UA 3MNLA 4NELA 1MBFA 1UMQA 3E7QA 4JL3A 3HKZN 3BR3A 4L62A 1JT0A 2E1OA 1RR7A 4JYKA 4M3EA 2OF7A 1S7EA 1IJWC 5D19A 4AF5A 1TWFJ 4A3DJ 2MG4A 3M3YJ 3ZQGA 1YRNB 4A3KJ 1NTCA 3BR5A 1JUMA 3P9TA 2NP5A 2HQ5A 1UI6A 4BXXJ 3VW1A 3S2DJ 1RPWA 2COBA 2R93J 3ZQIA 2ZOZA 1JJ6C 2JMWA 3KKDA 2HI3A 5FKOA 3L1PA 5C4YA 9ANTA 1G2HA 2EZIA 3HOWJ 5FKMA 4A3IJ 1LFBA 2XB5A 1JT6A 1F43A 3O8HA 5K7HA 3VPRA 1GT0C 1RKWA 1ZR4A 3FIWA 1ETKA 1HLVA 5EYRA 1EF4A 3ZOBA 2JWTA 1IC8A 1ETWA 5M5XJ 2L7FP 4JP0A 3LSGA 1OCPA 4DW6A 1E3OC 3F1BA 4FE7A 4AYBN 3HE0A 3HOZJ 1SGMA 2X9DA 2HKUA 2ID6A 5EDNA 2HXOA 2RASA 3NNRA 3JRHA 3BG9A 4XK4A 1SANA 2YUSA 2G7GA 3LJLA 5CW8A 1GV2A 2MW8A 1GVDA 5F1JA 4A3EJ 1MSEC 4M3GA 1HOMA 4J19A 3AQTA 3GTPJ 4B3AA 1JUSA 3BJBA 3BG5A 2G7LA 5FHPA 5GP9A 4M3BA 1I50J 3CJDA 3BR1A 1I3QJ 4BY1J 2B63J 2DMTA 5IOYA 5D18A 1XG1A 2HYTA 1NK2P 2XPVA 3SFIA 4CGRA 1O4XA 2DN0A 1TWHJ 4Y52J 2XSDC 1X2NA 3S16J 2O8KA 3RZDJ 1HCRA 1BW5A 3B6AA 2HYJA 4V2FA 2IBDA 2LY9A 3QQAA 2DMUA 3WHCA 2YVHA 2HXIA 4L5EA 1B72B 4NN1A 4D5FA 2EH3A 2X6OA 2AHQA 2E2JJ 1HDPA 2YU9J 2QCOA 1BW6A 5FKLA 5M3MJ 2M8GX 3NPIA 4UDSA 4MO7A 1P7JA 5F0HA 4IHVA 3A01B 3HOUJ 3HIMA 3ZQHA 1K61A 2ECCA 3IH4A 1AKHB 2PBXA 1WI3A 2DMQA 1JKRC 3JRBA 2L7ZA 2VKEA 1PUFA 3GTMJ 2FJ1A 2EZHA 1ORKA 5E3LA 1QPIA 2Y2ZA 1MSFC 1ZTRA 2NOGA 3FISA 2FBQA 1XC5A 3VUQA 2LTPA 1T33A 3COLA 2IU5A 2NVXJ 4GFKA 2JA8J 2UXIA 3VVYA 4RDUA 4A3BJ 5F0CA 2XRLA 1ETVA 1DU0A 3HGGA 3QBMA 1GUUA 1ZGWA 2JN6A 3CRJA 3VOXA 1VF9A 3FK6A 2FD5A 2FX0A 3DCFA 3Q0WA 3OIOA 1CQTA 2CJJA 3ANGA 3CCYA 1B8IB 4JX5A 5E3MA 1W0TA 1WH5A 2JA5J 5FLVA 2DA3A 2NX4A 3QPSA 3RD3A 3VVXA 3HDDA 3BRUA 2PMZN 2QIBA 2VKVA 1B8IA 3LSPA 2ZCMA 2P81A 1TWCJ 3VW2A 1GV5A 4DYCA 4HNVA 4DZPA 2YS9A 1K83J 1DU6A 1MBHA 3IUVA 2EZKA 2GLOA 3HM5A 1MNMC 1LE8B 2HOTA 2EBIA 5FKNA 1MH4A 2OPTA 3BR2A 3K7AJ 4I6ZA 2CQQA 1H8AC 3GZIA 5F08A 5IYBJ 4C3JJ 3F0CA 5CXGA 2NVTJ 5DS9A 3ZQFA 2K9QA 1WH7A 2IAIA 4D7MA 4A3MJ 2E2HJ 2ID3A 2XPUA 3G56A 3BTCA 2EZLA 2FQ4A 1D5YA 4MIMA 2DMNA 3S1NJ 3HBLA 3IH2A 4CYCA 2DA7A 2CQXA 2M0CA 3S1QJ 3G7RA 1RESA 2Y0SN 2DA5A 4B4CA 3HGYA
chains in the Genus database with same CATH superfamily
3JRFA 2Z99A 1LJ9A 4QWQA 5E1XA 2LRDA 1QVTA 2OC6A 4DYQA 3UKGA 1LE8A 3LWFA 3NAUA 1ETOA 4GDFA 1WSUA 4KWAA 3F8FA 2QENA 3LSTA 3FMQA 3DPLC 3CUOA 2ZOYA 1ZN2A 3UNGC 3R0JA 3HRUA 2JQ7A 3CJRB 2JPCA 3BLYA 2A3SA 4XMYA 4GCLA 3BJOA 3NARA 1IN4A 3LSKA 2M1BA 5EG0A 2EJRA 4I76A 1ZG5A 3TMOA 4WIBA 2R5YB 1IN6A 1HBXG 2W4SA 4BJ6C 4E7LA 2FE3A 3VVZA 3F3XA 3FXKA 4JX4A 4XLAA 1R6RA 1QU3A 2CFOA 2M9HA 3OYDA 3WG7H 2TCTA 2HVQA 4LITA 3J7AY 5FGLA 4M9SA 2R7RA 5CKTA 2DTZA 2L7KA 2LC2A 1U5TA 2DOEA 4CCNA 5K5OA 2KQRA 3BCAA 1PP7U 5IP6A 1XCBA 1W5TA 5CQGA 2PFBA 5EGOA 3HYIA 5J1RA 1OCRH 2L5QA 1SFUA 1XS9A 4B44A 1W5CC 2LP0A 3S32A 3G1LA 3LAJA 2ICWG 2KISA 3FXLA 1KYZA 4HDUA 5IP9J 1R36A 1ZKGA 1U2WA 1HSJA 3LSJA 5EF6A 5M5WJ 1AKHA 2Z9OA 1G3YA 2V9VA 3I64A 4HPQA 4MQ9F 5CPRB 3LA2A 3S2WA 3KETA 2HPMA 3ZMTA 3VWBA 4BJ5C 2NP3A 1Y8QB 4IF4A 3MKZA 3KYDB 1ZRCA 2PJRB 4JNNA 1VQ5I 1VQ9I 2W24A 4G9YA 2FNPA 2MLKA 4B8XA 1VQKI 4X1EA 3ZN0A 2EB7A 5F27A 1KA8A 5IP7J 3KLNA 4GFBA 3ZQLA 1REPC 4HRIA 2WY7Q 2VXZA 1GLNA 3VIBA 2HDDA 1HKTA 3V6GA 1ZYRF 4WXHA 3Q3SA 5J3LA 2L0KA 3E1SA 2KL4A 2Y0MA 1GDTA 1JI8A 1J7KA 4A0YA 1DPUA 5HDKA 4A3FJ 2RHAA 2GXBA 2G3BA 3JW4A 2ZFUA 3FZVA 3M07A 4PSXA 1SVMA 2BGCA 2PN6A 1B72A 3N05A 2NVQJ 2CUZA 3IRRA 2L3DA 1POGA 3NXCA 1X3ZB 2DG8A 2KIUA 1Z77A 1UZCA 1XGMA 4ZH4F 2H1KA 5DD4A 5EGOB 2Q0OA 3MQ0A 2E2IJ 1NK3P 3G73A 4KFCA 1XGNA 1VI0A 3W6JB 2PFVA 1R5ID 2NVUB 1SAXA 4XOTA 3I58A 1Z05A 4PGGA 2VBYA 5J47A 2E35A 4BQOA 3MD2A 3PO3J 1KGSA 1WJAA 2KP6A 5FMPA 2BZTA 4XOPA 2P5KA 1MGTA 1XX5A 2VQHA 3OYNA 2LR8A 4DOZA 3KNWA 1ZELA 3M8FA 5FROA 3AL0C 4NQWB 3GEUA 2M30A 5CLSA 2XKPA 2V6CA 4W97A 2XASA 5L3BA 4HX7A 3HRSA 5ICCA 4KT6A 2BY0A 2Y69H 5FKKA 1YW8A 4XM3A 2DYRH 4EEFG 4PGHA 1R71A 1U9NA 1FSEA 4U7DA 3JTHA 4E4HA 1LEBA 2QF7A 2KMUA 1QA6A 2VBZA 1T6SA 2P5VA 2DAOA 3BT9A 1F1ZA 3RPUA 3TO6A 4DBRA 3I0TA 3H9JA 4II3A 3BTJA 4KISA 2H8WA 2WAFA 3D0SA 2WC2A 4E7JA 3O60A 4A3LJ 3KP6A 4IJAA 1TL8A 1WJEA 4XLHA 3J7ZI 4R79A 4XONA 4LLGF 1ETYA 3PUBA 3T6NA 2JSCA 4BE0A 4IEJA 2JJ7A 2V57A 2P7VB 4FTHA 3OYKA 4XSXF 1FNNA 1ZQ3P 2WB1N 3OYCA 3E6BA 2M34A 3DV8A 2ME6A 1X3WB 4ESBA 2RQPA 4D9JA 1XSVA 4M71A 2K9NA 1UG2A 3JRAA 2Z3YA 3MN2A 5IT9Z 4BHCA 3H5NA 2ZSIB 4QSHA 2KKOA 2F5CA 1ZRFA 3JRIA 1YG2A 3PQJA 2WGBA 2VQGA 3H92A 3ABMH 1QPMA 2TRTA 3DFGA 2Z33A 3OL4A 2JRMA 3ON4A 1UHSA 3VW0A 2AO9A 1VQ8I 5TJJA 4A69C 4L0YB 3OS1A 1W7PB 3SEQA 2GWRA 1Z9CA 3IL2A 3G1MA 4KICA 2E7XA 5C4XJ 3PM1A 3HB9A 1KU3A 1R49A 3ABKH 1ON1A 2LY2A 4ZZDA 1S7AA 4C2MJ 4Z2YA 1FBUA 2E19A 2MA3A 1XMXA 4M9ZA 2EFPA 1XMAA 3MAJA 4N4OB 1IRZA 1E17A 3HEFA 1FOKA 2PI0A 2GOMA 3TW7A 5DM6F 5HAWA 2JTVA 3GMEA 4Y4RA 4LLNA 1UCRA 2O8XA 1RRJA 3ZPLA 1WJCA 1XSDA 3A03A 3WHBA 2JA7J 5CXIA 1SD5A 2HKOA 3D1NI 2ELKA 3AG1H 3I5UA 2NAZA 3K4MA 5C44J 2BOLA 2ZFWA 3H0GJ 4B48A 2V4JC 2DPDA 3S2HJ 4KNYA 4OU0A 2E36A 3S93A 4EGZA 3MEXA 4BNCA 1S6LA 3E6CC 1BC8C 5E1ZB 3S3MA 2J5OA 3WTTC 3MNLA 2CWEA 1LUJB 1MBFA 3P5JA 4O3MA 3E7QA 4JL3A 5E1WA 4KN4X 2ESNA 1JT0A 2KLOA 2E1OA 1RR7A 4N0BA 4M3EA 3OS2A 2OF7A 5A2QZ 4LK1F 2Y48A 2E5NA 2VE8A 4HV6A 3P9TA 2NP5A 1OCOH 1N78A 3OYIA 5H20A 2R7DA 3SWHA 3BZCA 3IKVA 4KIBA 3BOQA 5HVQC 3OV8A 5E17F 2LKPA 5ICFA 2VBXA 4ZC3A 4BGDA 1MMNA 2F2EA 1G2HA 3OMYA 2ISYA 2IPQX 2L54A 2R7FA 5FKMA 2LBFB 2XB5A 4EATA 3OYEA 1ZG1A 3O8HA 5K7HA 1SFKA 1VQOI 1Y0NA 1ETKA 1MZBA 1EF4A 3ZOBA 4RGUA 2JWTA 4LD5A 2KRHA 4ASNA 1Y39A 3FXRA 2VL8A 3GO5A 4PK4A 4MGRA 3F1BA 4FE7A 1YE9A 4IL6C 3ABTA 4XKVA 4XLFA 4AYBN 1TW3A 2ID6A 3LSHA 5EDNA 4LFUA 3I55I 3HKZA 1R58A 2YPRA 5CW8A 4ESJA 3KEOA 2XUBA 3T1BA 4MEYF 5CQEA 1F4KA 4J19A 3AQTA 4ENJA 1DGRM 5HLGA 2G7LA 3HSFA 3NRVA 5FHPA 4EGYA 3BR1A 1I3QJ 2KIFA 5FO5A 4BY1J 1VQ6I 2H27A 4ETSA 3L2VA 5IOYA 5D18A 1W7PD 1XG1A 2KZVA 4P9FA 2IGMA 1TW2A 2KRCA 1SD4A 4Y52J 1X2NA 1IF1A 3RZDJ 1A31A 3H9QA 3MZ8A 4FQGA 3M1EA 3OWTA 1BW5A 2GZWA 3BG7A 5GTIC 2IBDA 1G3TA 3QQAA 3TBIA 1DUXC 2D2WA 3WHCA 3T8TA 5LGNA 2HXIA 2QSHX 2VODA 2KIMA 2ZJPF 4LG3A 2LF7A 4UVBA 2ACJA 3CO6C 3IWZA 4OMZA 2IA2A 4CZCA 3HOUJ 2M7AA 2FRHA 4KITB 3L00A 3IH4A 2EK5A 3PUFA 2UV1A 3JRBA 2W25A 2L7ZA 4BYYA 1ZLJA 2FJ1A 4R8HA 1ORKA 3K70C 5E3LA 3PFYA 4QLCU 1Y8RB 1D5VA 1WZ2A 2K27A 3VUQA 3EUHC 2LTPA 3BJAA 2HWVA 3ZMZA 1UELB 2NVXJ 2UXIA 3D5SC 3VVYA 4DIQA 2XRLA 3QBMA 1LB2A 5LEJA 3P9KA 2LNBA 4HAMA 4HYEA 3FK6A 3DCFA 3M7GA 5K5QA 3OIOA 3C3WA 3AG3H 1ZREA 3H5RA 1IXSB 1FMVA 1N75A 2FSWA 3ZN1A 1HW2A 1FT9A 1N25A 1B8IB 4GXOA 4XL9A 1W0TA 1WH5A 3P9CA 2JA5J 3V8KA 4I0BA 3GW2A 3VYTB 2CUJA 4B47A 2FBKA 2PMZN 3FF5A 3QWLA 4BS9A 3CF5F 3LSPA 2DPUA 3HG9A 5ILUA 1GV5A 1MMGA 4DYCA 3OYGA 2O61A 3K10A 2OZ6A 3TL4X 2V9PA 2ZCWA 1DU6A 1BBYA 3IUVA 5LHIA 3C2GA 3DLLF 3I9V2 3R6SA 2WB1A 2HOTA 2E1NA 2EBIA 2VBWA 4XQFA 2OPTA 3K7AJ 3K70D 3W6KB 1X1CA 5F08A 3OOPA 4C3JJ 2IS4A 5CXGA 4CCKA 2QVOA 1X4PA 1Z6TA 3FBIB 5DS9A 1WH7A 4UV9A 4AIHA 4D7MA 4F3QA 5LRSA 1RUNA 4F91B 3KYLA 2HDCA 2ID3A 1YQAA 5JVGF 1J09A 2CS3A 2L9NA 2CQNA 4LG0A 1FYLA 2QQAA 2DU9A 2A6HF 3RPQA 3S1NJ 2CQXA 2EV5A 2M0CA 3FHNA 1RESA 2EPFA 2W1OA 3BCBA 2OJED 4ZDPA 4S04A 1BOAA 3KLOA 4EJWA 4HOBA 3HUGB 5EFYA 5HLHA 1HKSA 1U6GA 3DQVC 3G6EI 3DEWA 5DD8A 1YITI 4BHPA 1P4XA 4BH9A 4ESFA 5HS8A 3JREA 3U1KA 4AUXA 2R7OA 3PNVA 2WAQN 1NG7A 2L7MP 3BR6A 5H9TA 4OMYA 2GXGA 3V78A 4XRMA 1J9IA 4JKZA 2GIZA 3HTUA 3QOEA 2VI6A 3CUQA 4BU2A 5BPDA 4OAYA 2ME0A 2RGVA 3PASA 3H3ZA 3L7WA 3OIPA 5FLMJ 1PDNC 4OIQF 2K40A 2DJNA 2ADUA 4AYBA 4XICA 1HA8A 4M3FA 1RNLA 4BBSJ 2H6BA 3KEQA 2ZJQF 1SVOA 5KAIC 3QOPA 1IG7A 4M6VA 2QEXI 2F5DA 2V1DA 5K5RA 1H9TA 1VQ4I 1ZARA 4AC0A 1BI0A 5HDGA 2VPRA 1H89C 1OYIA 3BCGA 3S15J 2EIMH 1RKTA 1EJ9A 2L9VA 1K4SA 1MJBA 2CUEA 1G8XA 3EGQA 3HOTA 2X6YA 2R5YA 1LQ1A 5EZGA 4BHBA 4CZZA 2UUZA 4PXIA 4U9LA 1V5EA 3I4NJ 2PMHA 3QAHA 2CMPA 3ZQ7A 2CU7A 1E3PA 2QOPA 3BPVA 3VDXA 4F52A 4I99C 4UUSB 4X6AJ 5IT9K 4OIOF 1EV7A 4HNUA 1MIJA 2CUFA 1BC7C 1E0EA 3OIQA 4RB1A 3S3NA 1TNSA 1LEAA 3I54A 1KZHA 3SDGA 4MTEA 4D7NA 3TOBA 2E1CA 3P7NA 2M4GA 3EPZA 3HIFA 2HQAA 3CC4I 4A93J 2F07A 3GTOJ 4HNTA 2WBMA 3RKYA 2NYXA 2G0EA 4M6XA 4IHTA 5H6RA 2YX7A 3QPTA 2V9KA 3DTKA 2WADA 2DFHA 1AOYA 2IRFG 1XGSA 2K9SA 2HNHA 3Q5FA 3RKQA 2VT3A 1X1DA 2Z5UA 1VZ0A 2WA0A 5B1BH 3F23A 3DTEA 3MVPA 1A04A 3CESA 2NVYJ 2OQRA 3IUOA 1S29A 3IP4B 4KIGA 2VUMJ 3GYHX 4IPAA 1MKMA 3WE2A 3RKWA 1EH7A 2Q24A 2DQRA 2JUCA 2V7FA 4LGWA 3JRGA 1PYVA 3QU3A 3GFIA 3OYAA 4S0HB 2DDBA 1AWCA 1XDSA 2WY8Q 3KZZA 1RUOA 3L2CA 3BTIA 2RV8A 2GUHA 2ZCNA 2XGEA 3NS4A 1FPQA 2DJIA 1P4WA 2K86A 4L5JA 4ON0A 2K3FA 1X1BA 1Z1DA 5BMZA 3V4GA 5LGTA 3MKYB 4XN3A 1WFXA 2A69F 3CUQC 3KX2A 1U78A 4AIJA 3W6VA 2DK5A 2N8GA 4A5NA 4A6DA 1R4NB 1KQ9A 2ISZA 2VQCA 2KDOA 2X51A 1I6XA 2QWTA 3EUKL 1X3UA 2OQGA 3R60A 4RB0A 2LFBA 3BC8A 3KP5A 3OYHA 2VE9A 3CCQI 1T38A 1ZR2A 1LDKB 1FOXA 2VB6A 3CZ6A 3TEDA 1UHWA 1TQMA 2XDNA 2DXIA 3DLAA 3K9TA 1BIBA 2XAUA 4M74A 4EM2A 1ZRDA 3GBGA 5JVTA 3OS0A 1YIOA 2MSYA 4PDKA 4EM1A 1JTXA 4BE1A 1BI3A 3FM3A 2BHZA 3H5AA 5L3CA 2DFEA 4E7HA 2R7ZJ 3HTJA 1P9QC 2ZY9A 4EJVA 1W36C 2MC3A 1U5TC 2NS7A 1S5LC 2HTSA 2BY3A 4MXMA 3WTWC 2OCEA 4ZYGA 3MZHA 1B1BA 2A68F 4G6QA 3PIPF 2HOAA 3I59A 3TDZC 4B43A 5DCFA 4RGRA 4BY7J 1VQMI 1R9TJ 2ZXWH 4XKWA 1ULYA 4C30A 3S17J 2BV6A 4NHJA 2M0MA 5DV5A 2EV0A 3E6DA 1J5YA 1B4AA 2BEOA 3LMMA 4V2GA 2XB0X 3ZQCA 3E5XA 1Z0XA 4ZDLA 2PMZA 5GPCA 5JLXA 5D5WB 2HYGD 1WJFA 1T98A 2STTA 2IGOA 2CW0F 5EG0B 4ABZA 3BQYA 4Q4ZF 1D1CA 1JTYA 2XPWA 4B1RA 2W48A 3RQIA 2VN2A 2GBYA 4UUTA 5D4SA 4FCYA 2BY2A 1BN5A 4BUPA 1U8BA 4NB5A 3HTHA 4HKUA 5BNGA 4BBRJ 4B09A 4YRVA 3ECOA 4XIDA 3FMSA 1X19A 4F7ZA 2B1EA 2VASA 4L5IA 1BA5A 1BI1A 3F8CA 1Z6RA 2E7WA 3ZMVA 5IYDJ 2XGCA 3DPTA 4FETA 2H8RA 3EYIA 3SDBA 4YZEA 4ZYDA 5HS9A 1QZEA 1WJ5A 2HKXA 3F72A 4HF1A 3Q0UA 2DQLA 2VQLA 2UXPA 1BR1A 2QZ8A 2XAFA 4O5VA 4EV0A 1MJ9A 1OYWA 1APLC 5E3NA 3JRCA 3JSJA 4ANJA 3ZR8X 1V4RA 1YHQI 1HDDC 2XF5A 1IAWA 2PMUA 1JGGA 2F6CA 4IHYA 2XRNA 4L9NA 2ZC2A 2ZB9A 3FBNB 2K4JA 2NXNB 2VIXA 2MH9A 4XLEA 2J5PA 2OERA 1WJBA 4LOCA 4A12A 2RDPA 5DTDA 3F6OA 1FWZA 1Q1VA 2M3AA 1QHGA 3M8JA 4EQQA 2V26A 5GADJ 1T39A 2GFNA 3CCSI 1R7JA 2MLGA 2R7VA 3EDPA 2ZXHA 2OI8A 5E3OA 2R3SA 4IX7A 2FJI1 1EA3A 3DU5A 4NELA 2VONA 2JA2A 3J81Z 3KP7A 4L62A 3IC7A 2W7NA 2LH9A 4JYKA 1FOYA 2WV0A 3ML6A 1GVJA 2X4HA 1WVRA 2MG4A 3M3YJ 2R7TA 2MD0A 2HPIA 5FRMA 2QQ8A 3KE2A 1A36A 3Q9VA 4IOAF 1JGSA 3K8PC 1XB4A 5ERIA 4LB6B 4UVCA 4DQ2A 2OTJI 1RPWA 2IVMA 2FNAA 1U0JA 3G3ZA 4XR6A 1TZLA 3KKDA 2HI3A 3WE3A 4WWCA 5J6XA 3R0AA 2DW4A 2JT1A 2D45A 3AAFA 3AG2H 4L9VA 4A3IJ 2DTRA 2ZNYA 1R23A 1F43A 3VPRA 1G3WA 3I4PA 1FBQA 2X1EA 3CO7C 5EYRA 4BQAA 3J7AO 4XLPF 2CYYA 4L9JA 1S7OA 2L7FP 1FSHA 2ZKZA 1E3OC 3HOZJ 1SGMA 2IW5A 2X9DA 1FP1D 3FX3A 1RR8C 2RASA 5J4YA 4G7ZF 1YJWI 4P5OA 4XK4A 3WGHA 2AXTC 1WQ2A 2G7UA 5J8FA 2PBIA 2BXZA 5F1JA 2B7EA 3IAS2 4CCMA 4M3GA 1HOMA 4B3AA 5GP9A 3U9GA 4BEHA 1I50J 4F93B 3PIOF 2FU4A 1W36D 5D5VB 2OAZA 3WTUC 2B63J 1LDDA 3KCCA 3A0BC 4ZTFA 2HYTA 1NK2P 3MKWB 3ISPA 2CW7A 2LF8A 2DN0A 4GO1A 2CQKA 2FF4A 1OCCH 2PG4A 2V1XA 2EA2A 1HXDA 1YS6A 3HZJA 1R4MB 3ZGKA 3PSFA 1SFEA 3B6AA 5CYVA 4Q5SF 2HYJA 2YX4A 2ZJRF 1GHCA 2LY9A 5L3DA 2XHKA 3HPGA 4G8XA 4L5EA 3H9GA 3F8NA 4HZFA 3SQNA 4A0ZA 2X6OA 1OYYA 3RTRA 2A6TA 3HHHA 1FC3A 2BYVE 1STZA 5K1YA 2A2FX 3NPIA 1P7JA 4RAYA 5F0HA 3A01B 4IHVA 3HIMA 5DM7F 5EEGA 1LPQA 2K7LA 2HFHA 4WF2A 4YEJA 2COMA 2PBXA 2XAJA 1IZ1A 4HV5A 1D8KA 1PUFA 3GTMJ 3V8JA 1QO0D 4IQJA 1QBJA 2Y2ZA 1P92A 2NOGA 1J59A 2FBQA 4PCQA 2KFDA 1I1GA 2HDWA 4YIIA 1HW1A 2NOJB 4GFKA 2JA8J 4RDUA 5FB2A 1ETVA 2OZUA 3GCMA 2X1DA 3LQQA 3M1CA 4II2A 5L3FA 2CG4A 2JN6A 1W7PA 4HG2A 3VOXA 4NBQA 4PJJA 3FXOA 1O7LA 3ZCOA 1CQTA 1JE8A 2LOOA 1IUYA 4P1WA 1LFPA 4IRGA 2BVMA 4XKBA 1VQNI 2Z2SB 1VQPI 5EEHA 3G71I 4I01A 4OAZA 2AS5F 2VXDA 1BOBA 2EFNA 4PFOA 4JX5A 3SZPA 1OISA 5E3MA 3PNYA 4EM0B 4BJTA 3L09A 1YIJI 3RD3A 2AQEA 3F9KA 5CVIA 5JHUA 4U0VA 3N4MA 5CVJA 2VKVA 3V7CA 1KQ8A 3GF2A 3VW2A 1IW7F 4CYDA 4HNVA 2BHYA 2ZXIA 1A35A 5F6FA 2NNYA 1BI2A 4PFPA 2B3WA 3TKYA 3BR2A 3HOSA 2CV0A 3WTSC 5HLIA 5IYBJ 4EJOA 2K9MA 4KN7X 2M87A 3SYTA 3KPHA 4JOMA 1K6YA 4N9IA 1Q1HA 5JR3A 1FMWA 2H6CA 3EUAA 3WTZA 1T0FC 4F55A 2FMYA 2VC0A 3LL7A 3HSRA 2RQQA 1YS7A 4A6EA 3D5LA 1QNTA 4EJUA 5D8KB 3HBLA 4PSWA 4CYCA 1XSXA 5LEKA 2DA7A 3LAPA 3S1QJ 3G7RA 1LDJA 2Y0SN 4B4CA 3HGYA 3LHQA 3VP5A 1NG6A 3V42A 2DLLA 1IO2A 3OYLA 1DDNA 2F5VA 4RLQA 2VJ5A 1HSTA 2LYCA 1NHAA 1ZK8A 4NDLA 1RETA 2WUIA 1FEXA 2XGDA 3AKZA 4J00A 2STWA 5JFRA 5HOOA 3W2AA 3IHUA 3TDUC 4ZZLA 2QTQA 2ZXJA 3NEUA 3BNIA 2NS8A 2EINH 3V7SA 1FIAA 2IGNA 5K7ZA 1KQ0A 2FA5A 2O3FA 3KZIC 4XBFA 2PQ8A 3U1DA 2ZBKA 3ZRGA 2DG7A 3K4CA 1ETXA 3OL3A 3CJTB 3BTLA 3VODA 2X6WA 3QRFF 1OKRA 4U0WA 4HLYA 3IAM2 2Y31A 1T56A 1BJZA 5KHDA 3MFKA 2R7UA 2EILH 2FOWA 3OYJA 1S8NA 3HUGA 1TQIA 1UAAA 4JQFA 3C2BA 3E5UA 1SFOJ 1VFCA 3GTQJ 4L9TA 4G6TB 1P7IA 3TOAA 4D5CA 3CLQA 2W84A 3MZYA 5E18F 5HBUA 5HODA 1ZLKA 2RKHA 2VKHA 4YIFA 1X58A 2NS0A 2DDAA 3PSIA 2G7SA 3O8GA 2ZMEA 2H1LA 3F21A 2RN7A 2R0QC 2RC4A 3JTGA 3CMYA 5E79C 3S1MJ 3ROUA 4MEXF 4FX4A 1MNEA 1U9OA 3RKXA 5CJ9A 2IJLA 1MNDA 2MFZA 3JAMZ 3ON2A 4Q48A 3ULQB 1F36A 3BZKA 4DJAA 5LFAA 4RB3C 3HTAA 3HOYJ 3WTXC 4BDZA 2MBFA 3GTGJ 1MH3A 3FMRA 2K9LA 4GGGA 5E8GA 5HLTA 3M8EA 4Q47A 3BROA 5FLXZ 3HSEA 2ECBA 1Z91A 4IOCF 1A6IA 2HOSA 3HTIA 2OCCH 3ABUA 3LQRA 3VFZA 3RI4A 3K2AA 4CCOA 3DPJA 3UR3C 3GFJA 3CCMI 1DP3A 3GZ5A 4IHXA 3GTKJ 4ZDOA 3SZGA 3OOUA 5FJ8J 5IPAA 2B9SA 3RCOA 4ZYHA 3OYFA 2M5WA 2E5ZA 2OU2A 2DA4A 2DA2A 4G6DA 2JA6J 3K0LA 3E97A 4LK0F 4P55A 2Z1DA 4GCTA 1IDYA 2K85A 1V5GA 3V7RA 3LA3A 1S72I 1V3FA 4YFNF 4GYIA 4OIRF 2GA1A 3GXOA 4NUBA 2LVSA 1MBEA 1Y1VJ 4AC6A 4KYWA 1YI2I 1SFXA 4R1HA 5GAGJ 4MK6A 1IV6A 4OIPF 4M9XA 2W53A 3QYEA 3TP0A 3OSFA 3FM5A 3ZMUA 1WHUA 4MNUA 3LFUA 3S5RA 5LD2C 1WPKA 3L9FA 2R7XA 3BG3A 4W1UA 4O6JA 3A01A 4ZTJA 1ODDA 1QRYA 1W1WE 2XAHA 4P9UA 3REOA 2KT0A 1PUFB 4LJZF 1MMSA 3FKIJ 2IS1A 2DCEA 1IXCA 1JHHA 1HC8A 3I4MJ 3LOCA 5AONA 1JJ8C 4KUMA 3CTAA 2F4OB 4MHGA 5AQCA 5IT3A 4GFLA 5LHGA 1D0XA 2XGXA 1TNTA 5EEAA 3CLOA 4UNOA 3FK7A 3DXJF 3KZ9A 2DODA 3I3LA 2O5RA 3ASOH 4KDPA 3CF2A 1TP4A 3PL8A 1USTA 2H09A 3E7LA 3ABLH 2LK2A 2QKLB 3QKXA 4U7BA 3COAC 2UXOA 2Q2EB 4U88A 1OCTC 3CC7I 4KA4A 2E1MB 3TP3A 4LG0B 3KP4A 3SXYA 4NQWA 3LWJA 2L9SA 1ENHA 1SD6A 3DEUA 3K2ZA 5LLQA 4ACIA 2LKXA 3T5XA 1VQLI 2V6EA 1SMYF 1T95A 2QKOA 1B6AA 1P4AA 5FFXA 1ERDA 1D0ZA 2PJPA 3SJMA 4HF0A 4XKCA 2DT5A 3DKYA 4FT8A 4ENNA 1YO5C 4ME9A 4CCJA 4IO9F 5KCMA 3K1PA 3CMAI 6PAXA 2ZMEC 4GRIA 2RNJA 1XCVA 1E2XA 1VTNC 2PZ9A 1KYWA 1Y6IA 2YR2A 5E20A 3VOEA 3DKWA 1BR4A 3CMMA 4CYCB 4M72A 1U8RA 5F04A 2K3PA 2HOEA 3RYPA 3O6BB 2P6SA 2H94A 4HBLA 4QPOA 3CMEI 3S14J 1OPCA 4BQNA 3F8MA 3VSKA 1QVUA 1WWXA 2A6EF 2X6XA 3K6GA 1R1VA 4KMUX 5M5YJ 4UB6C 3LNQA 2NNNA 3J80Z 2EQRA 2KJBA 4CSWA 2CRGA 2MGQA 3K1MA 4A3JJ 5F0FA 4PJLA 4HX4A 3BQZA 2V1UA 3CDIA 4BXFA 5GPAA 3HPHA 3S1RJ 2W85A 3WTVC 1W0UA 1SC7A 4M3DA 2X0LA 1TT5B 4C3IJ 1MD0A 1CF7A 2E60A 1X2MA 4IRIA 4JX6A 4IRVA 4A5MA 4Y7NJ 4UUVA 1IN7A 5CVVA 4A2UA 3AL0B 4RLFA 1X1AA 2EWNA 2HEOA 3BDDA 3ANPA 3BHQA 2DMPA 1SMTA 3OSGA 1JKOC 3KFWX 2WWYA 4K2EA 5AIQA 1ONVA 3SZTA 3KKCA 5IYCJ 1YX5A 2A61A 3WGGA 1Z3XA 3HC7A 1IRFA 1YLFA 3ONQA 2KIQA 5TGTA 3L2UA 4BKXA 3TO7A 2WV1A 2BBYA 2BW3B 2JSPA 1F5TA 3N97A 1KONA 3CWRA 2O7OA 3E3VA 1OJLA 2R7QA 1JKRC 3BPXA 1G4DA 2UXHA 2I8DA 3KZYA 4HW0A 2QBYA 4DYRA 1TLHB 5DCMA 3LSIA 4ENKA 4A3GJ 4KMFA 5FD5A 5J1UA 4KJZA 5BS6A 4YIRX 4Y3OA 2P7CB 1N77A 2GA2A 2YVXA 2LMDA 3ZP5A 1QHHD 1UMQA 1EKEA 2ZMEB 3HKZN 5IY5H 4L0ZB 1T08B 1USSA 5JI6A 1S7EA 2O0YA 5D5XB 1IJWC 5D19A 1TWFJ 2HZDA 2DOFA 4AF5A 2EV6A 2R7SA 1NTCA 5E8IA 3BR5A 1JUMA 2FOKA 4D0PA 2HQ5A 3R4KA 1YFHA 2IS2A 1UI6A 4NC7A 3VW1A 3S2DJ 3MCZA 3NQOA 1D8JA 5AIPA 3C2HA 2COBA 2L02A 2IA0A 3BJ6A 1Z3YA 2ZOZA 1JJ6C 3AFHA 5CVUA 2DOAA 4KT5C 4AD9A 3L1PA 1P6RA 1XD7A 5C4YA 1B59A 2MD5A 3K4LA 1MDMB 4CH7A 9ANTA 3HOWJ 1R5HA 1FP2A 1U3EM 1XTAA 3QYBA 2XSJC 2XVCA 1JT6A 3CP8A 4JBAA 3W2VA 3JSOA 1WI9A 1RKWA 2XF7A 1ZR4A 3FIWA 3DKXA 4AIDA 5ICGA 1IC8A 4F92B 1OLTA 1ETWA 5HNFA 1I1SA 4PUSA 3LSGA 1OCPA 4DW6A 5FLXK 1FLIA 4E70A 4IQ4A 4LIVA 5FRNA 2HQRA 4YG2F 1SEUA 4XLCA 1B9MA 1Z7UA 3BG9A 3MMYB 1I5ZA 1SANA 2BW3A 4I7HA 2YUSA 5BQTA 5LGUA 2G7GA 1GV2A 2MW8A 3KYCB 4Y33A 3CJQB 5KNLA 2X85A 1XGOA 3I59B 1JUSA 3KP2A 2QYOA 3BG5A 1O57A 4CICA 4BE2A 4FASD 3CJDA 2RVCA 3OY9A 1B9NA 2HYFA 2DMTA 1G6NA 4I09A 4N4NB 1R5GA 3SFIA 4IXAA 3CCEI 3I56I 3S16J 3IKTA 1C0WA 5HNHA 4FHTA 4M6YA 1H9GA 2DMUA 2YVHA 2Z16A 2ETHA 2V79A 3GFLA 3PJRA 4D5FA 2EH3A 3DBRB 2L2OA 2AHQA 2DT6A 2E2JJ 2VOPA 4EVIA 4ZJZA 1BW6A 1NH3A 5FKLA 5F1RA 2IGKA 2HGCA 3ECHA 4TV7A 4MO7A 5HDNA 4E7ZA 1MMAA 3ZQHA 3J7YJ 3TQNA 1UB9A 3CCRI 1K61A 2ECCA 1AKHB 1YYVA 1IN8A 5D6FA 2TDXA 2VKEA 3WU1B 3S8PA 4CHUA 2EZHA 2L4MA 2RNGA 2B0LA 2P0WA 3FISA 2HS5A 1XC5A 5H6QA 3ERED 4D1QA 1X4OA 2IU5A 4UHTA 1FX7A 3PFIA 3CCUI 4A3BJ 5CVRA 2F4IA 3VYUB 1DU0A 3HGGA 4HLXA 1GUUA 1ZGWA 3CRJA 4CUGA 4AWXB 3BWGA 2VC1A 5GTHC 3H36A 2XF6A 2FD5A 2LDUA 1BJAA 3Q0WA 4HDVA 4M73A 2GAUA 2CJJA 4HQMA 3ANGA 2F48A 4RA2A 2AQFA 4S05A 1RC9A 5KAFC 2P5LC 3QODA 5FLVA 2NX4A 2E34A 3QYFA 3EQLF 2MH2A 2QA4I 3GWZA 1R1TA 2ZJ2A 2QIBA 1EH6A 1B8IA 4HSTA 4C2UA 4BDYA 2P81A 4UY8I 3W3CA 4EMSA 3CCJI 4DZPA 2G9WA 2ELJA 2YS9A 1K83J 4UXNA 2HR3A 5D5UB 1MBHA 2GLOA 1LE8B 2KRFA 1MH4A 5FKNA 4I6ZA 2UZKA 1FZPB 2C6YA 1S9HA 4CO8A 1IN5A 5B3SH 3GZIA 2LKSA 5DEQA 3F0CA 1UG0A 3P9IA 1OCZH 4C2MA 4NNJA 1Y0UA 2GIVA 1PVEA 3C7JA 1P2FA 3E6MA 4U9NA 4IZZA 1YJ9I 4XRFA 3CD6I 3G56A 2EZLA 3CCVI 3PNTA 3VSLA 2EIJH 2HTJA 1U5TB 5GAEJ 2P4WA 2OTLI 1FYMA 3IH2A 4G7OF 3T0YA 2QBYB 2HQNA 2DA5A 2MYSA 3I53A 2WTEA 3NWSA 5TRDA 1IUFA 4N9HA 4OD4A 2CO5A 2R5ZA 3LFKA 3RH2A 3B81A 1HF0A 3CQZJ 1K78A 5K58A 2FBIA 4GCKA 1IGNA 4I02A 5EZHA 1VNDA 4PJMA 4FISA 4CA0A 3LSRA 1IRGA 5L3EA 4GYGA 3QPLA 4MQVA 4XORA 4PZJA 4WXDA 2R4GA 3HOVJ 3PQKA 5D8LB 1O3RA 4BAYA 5DCMB 1IDZA 1WGXA 3ELKA 3FDYA 3HOXJ 1JHFA 2EA4A 3T8RA 1K7AA 2KDZA 1L0OC 5FGMA 1Z7LA 3L2RA 3GTLJ 3H3UA 5KVRA 4OOIA 2UXNA 4BEHB 3J81K 2Y30A 1A6QA 1BR2A 3H35A 3K4NA 5HS7A 5ILSA 2FBHA 5JLWA 3V8LA 1D1AA 3O2PE 3WGIA 4RBOA 4Y17A 2DK8A 2ZCXA 1FTTA 1KU2A 1ETQA 3PPBA 3FXMA 1MMDA 1RZ4A 2L01A 4MFDA 1IV8A 1ITYA 2W82A 1MBKA 2LREA 2QQ9A 5B66C 3JCUC 2UWMA 1TTYA 2DO7A 2R7WA 2XKOA 2Y0SA 2I10A 3K4KA 4C9YA 3F22A 4CXFA 2XROA 2CW8A 4DZJA 3GZ6A 3A1YA 2DI3A 4MFEA 4Y15A 5LRRA 4WK8F 1GXQA 4I0AA 3DF8A 3K4JA 2OBPA 3AQSA 2E1MC 2F5FA 1FTZA 1QZZA 4ZYAA 2F4MB 3FRQA 2BY1A 4E6KG 4XRSG 5D1RA 2IXSA 2LD5A 3GX4X 2QLZA 1OR7A 2MC4A 1K6OA 3SEZA 3JR9A 3C07A 5HSZA 1LVKA 1QQIA 1XN7A 2ZSHB 4QTRA 4UUSA 2R5ZB 1ACIA 1I6HJ 2OUMA 1ZHFA 2XAGA 5C4JJ 3IRQA 2D5VA 1JKPC 4YFKF 1YRNA 1UI5A 2E71A 1XPXA 1JKQC 4OWRB 1UHMA 3RIRA 3DU6A 2VT2A 2O9LA 2CGPA 2ELHA 3PO2J 3Q0VA 2D6YA 1HW5A 4AIKA 5KK1A 3FXUA 2VJIA 3CDLA 4RM2A 2O03A 2OV7A 2Y9ZA 2GM4A 4I2OA 3NWTA 3GTJJ 3EUPA 4Y13A 2O7TA 3GLXA 4CGZA 4A3CJ 1R1UA 1G59A 2Q1ZB 3IV5A 2JVGA 4MTDA 2BVLA 2QM3A 3TGNA 3ZMSA 4MLOA 3Q9SA 4P96A 2IS6A 4HEA2 1BM9A 1R00A 4UVAA 3F8BA 2IA1A 2K4BA 2GQQA 1PP8F 3TO9A 1MBJA 2M7BA 3BR0A 1D1BA 3CCLI 3QU6A 2PX9A 3RPUD 1PUEE 1E3HA 4E7IA 2LBFA 3G1OA 5LHHA 3VYRB 2LLKA 2ZO4A 5DUKA 3HL2A 1Y1WJ 4LIUA 5IOZA 4ITVA 3ZQQA 2Y9YA 1BIAA 4UB8C 3HJEA 1LNWA 1JXSA 2WAQA 3GFMA 2IEKA 4YFXF 3NI7A 1M1EB 3A02A 1D0YA 4ICHA 2A05A 4AVZA 1LFUP 5ILVA 2CV2A 2M8EA 4G7HF 3FHZA 3QPHA 4H0EA 2F5EA 5K7FA 2GENA 3LA7A 2O6GE 3U21A 4HQEA 2IP2A 1T8IA 2XDVA 2CFXA 1W5SA 3B73A 5J1YA 4FX0A 1HKQA 1WJDA 2QQBA 1UFMA 3C18A 3GEZA 2P8TA 3IH3A 3B02A 3VOKA 2CSOA 2L9RA 2UXXA 1KU9A 2IT0A 3DPUA 1RIOH 3DTIA 3VEPA 4XRSA 1FY7A 4IHWA 1TC3C 4V19K 1TWAJ 1FBSA 4CDGA 1YOVB 1JUPA 4I98B 4IKFA 2JK3A 2JPBA 2X48A 3GUDA 1WRJA 3ERMA 3M9AA 2A5YB 4C2TA 2XV4S 4QIWN 3X2QH 5D6EA 2BXYA 2X1CA 4U87A 1ZAOA 2D1HA 2GOXB 4C3HJ 2BE5F 5J8CA 2QKMB 4WCGA 2HVRA 4ZYEA 4KIFA 1FOWA 1KU7A 3E5QA 1QGPA 1AU7A 5DYMA 1A5JA 3FKJA 3KIOA 3QP5A 1TQPA 3EUHA 3TW6A 4G94A 2YVEA 1H0MA 1F9NA 3CJNA 2W57A 1K78B 3RZOJ 3FWEA 1HQCA 2YSRA 3VTIA 5DDGA 5BPIA 4DBQA 2VLAA 3B6CA 1WKMA 2RAEA 1H88C 2OD5A 3OR1C 3JSPA 5C3EJ 1TWGJ 4RAZA 2FMLA 3HHGA 3MKLA 3JRDA 2DA6A 3L2WA 1T0FA 3BG6A 2DA1A 2DFIA 2VKDA 3H3VK 3DBLB 4XLNF 4G12A 2XAQA 2ESHA 3D5RC 3KP3A 5FFZA 3JAMK 5D4RA 1PJRA 5DAJA 2P6TA 1LKXA 4RM3A 4QPQA 1O7FA 2CV1A 3GLLA 2KZGA 1IXRC 1WCMJ 2UXUA 4GCVA 1DPRA 3LSMA 4PJNA 4FE4A 3DWLE 4AM3A 2FUG2 4CCLA 2DFFA 2KPMA 2EIKH 1AA7A 4HA8A 2R92J 1TBXA 1I39A 4BXUA 1S3JA 4XNFA 4EJTA 2M2EA 3AG4H 2XC7A 1MBGA 4RB2C 1O3SA 4RMNA 5LBQA 3NRGA 1ZGAA 2W00A 4UV8A 1AHDP 4L18B 2REKA 3BP8A 1MW7A 3G4SI 3HXLA 1K79A 3GVAA 1X1PA 1Y56A 3BY6A 1OFCX 3RJPA 3VYSB 1FJLA 4XN0A 5JHFA 1OR7C 2CH0A 5ICEA 1BL0A 1FIPA 3M4OJ 3A2KA 5M3FJ 2AXLA 1FYKA 2Q8KA 1T2KA 1I27A 4RS8A 3ASNH 2FEZA 1I3AA 3BR3A 4WXCA 3OR2C 1CGPA 2LG4A 1O3QA 4A3DJ 3ZQGA 1CF7B 1YRNB 5FD6A 4A3KJ 4YELA 5B1AH 4XSZF 3FXJA 1DP7P 4BXXJ 3SHFA 2XIGA 1Z21A 2R93J 1XDUA 3MWMA 3ZQIA 5GAHJ 2KJCA 2JMWA 5FKOA 3RSNA 1J0RA 1ZG3A 4HSRA 4DVYP 4RAFA 2GXAA 2G7HA 2EZIA 1L3LA 2OA4A 5F64A 1LFBA 1GT0C 1EH8A 4PJ0C 4WX9A 1HLVA 1R22A 5M5XJ 4JP0A 2DYSH 1IRXA 3HE0A 2HU9A 2HKUA 4LLLA 1Z67A 4IRHA 2PJRA 2QSFX 2QWWA 2HXOA 2WAEA 4H4KC 4IVNA 3NNRA 1YW9A 3JRHA 1SVLA 2VJJA 3WG9A 1MJAA 3LJLA 1GVDA 3OYMA 3U2RA 3CUQB 4A3EJ 1MSEC 2NRAC 3GTPJ 3BJBA 2EFQA 5BOXA 2QSGX 3DBHB 4M3BA 3ESWB 4E7KA 1V5FA 2Q2EA 4LMYA 2V1NA 2ZNZA 1TT0A 3S3OA 3K1NA 1RI7A 1J75A 3SFZA 3VB2A 5ED4A 3IWFA 2XPVA 4U0YA 4CGRA 1O4XA 2RREA 1TWHJ 2XSDC 2O8KA 4X0GA 3QP6A 5EJCA 1HCRA 1ZGJA 4V2FA 1MDMA 3R61A 2A5WA 2L4AA 1YX3A 1B72B 4NN1A 4BACA 3CP2A 1VQ7I 1HDPA 1YW7A 4JK1X 3CDHA 3RDIA 2YU9J 2QCOA 2VJ4A 1SAUA 5M3MJ 3O3KA 5TISC 2M8GX 1ZH5A 4UDSA 4HX8A 3ZXSA 3ZMDA 5J40A 2JVHA 1WI3A 3HRMA 2DMQA 2QGUA 3A0HC 3BZ6A 3EYYA 4DNCA 1QZYA 4RGSA 5DUIA 3H0DA 4OINF 2D1VA 2M4KA 4B3XA 2FQ3A 2K5CA 1QPIA 1MSFC 1ZTRA 2YU3A 1XMKA 3HRTA 2JUGA 1T33A 5B5EC 4RGXA 4LB5A 3COLA 1W4MA 1D3YA 3FXQA 3RYRA 1YJNI 5F0CA 2M45A 3WU0A 2CQ7A 3KEYA 3DEEA 3K69A 4BQQA 1VF9A 1G3SA 2FX0A 3DP7A 3WODF 4NC8A 3GZNB 5H2FC 2HVSA 4NC6A 3CCYA 3H1CA 2PLYA 4RAGA 2HZTA 1OQYA 4HF2A 5A2QK 5L3GA 1GXPA 2DA3A 4OD5A 3QPSA 3C1DA 2LY1A 3VVXA 4Z6YA 3L2QA 3HDDA 3BRUA 1J2XA 4J01A 1LVAA 5J4VA 2MABA 3CC2I 4BL0B 2K02A 2ZCMA 2EFWA 2VOOA 2KHMA 1TWCJ 2VPLA 3HTSB 2Y75A 1OMIA 3WTYC 2DBBA 4DGWB 4AU7A 1V54H 1DQUA 3F6VA 1V55H 1YTYA 2A07F 2EZKA 3G2BA 2LSOA 3I71A 1DGWY 3HM5A 1MNMC 2DT7B 1O3TA 3E0JB 2CQQA 2JZYA 1H8AC 1K4TA 3A4CA 2NVTJ 1UJ8A 2I5UA 3ZQFA 2K9QA 3EETA 2IAIA 2EFOA 4A3MJ 2E2HJ 2XPUA 3BTCA 2FQ4A 4E7SA 3J80K 1D5YA 2JRTA 4MIMA 2DMNA 3WU2C 4IHSA 3W2WA 2QUFA 1SD7A 4ENMA 3K4BA 2FXAA 2PEXA 4A0XA 3OYBA 1ON2A 3RQ4A 4AVPA
chains in the Genus database with same CATH topology
3JRFA 1IUFA 1QVTA 4DYQA 2R5ZA 3UKGA 1LE8A 3NAUA 1ETOA 4KWAA 3RH2A 3DEWA 3B81A 1HF0A 3CQZJ 3JREA 4AUXA 5K58A 4GCKA 2ZOYA 2WAQN 1IGNA 5EZHA 1VNDA 1ZK8A 4FISA 4NDLA 1RETA 3LSRA 2L7MP 2WUIA 1FEXA 3QPLA 2XGDA 3BR6A 3HOVJ 2QTQA 5H9TA 4GCLA 3BNIA 2NS8A 3NARA 3V78A 1FIAA 4XRMA 1IDZA 4JKZA 5EG0A 1WGXA 3HOXJ 5K7ZA 4I76A 2VI6A 2ME0A 2R5YB 2KDZA 2DG7A 1ETXA 3PASA 3BTLA 3GTLJ 2Y30A 2Y31A 1T56A 1BJZA 5JLWA 3VVZA 5FLMJ 4JX4A 2K40A 2DJNA 4XICA 4RBOA 4M3FA 4BBSJ 2M9HA 1FTTA 2ZCXA 1ETQA 3PPBA 3C2BA 1IG7A 2TCTA 1SFOJ 4MFDA 1VFCA 3GTQJ 1ITYA 4M6VA 5FGLA 1MBKA 1P7IA 4D5CA 2DTZA 5HBUA 5HODA 4AC0A 1X58A 2VPRA 1H89C 2I10A 5IP6A 3BCGA 2G7SA 3O8GA 3S15J 1RKTA 5EGOA 5J1RA 2R0QC 4DZJA 2CUEA 3CMYA 3S1MJ 1XS9A 3EGQA 4MFEA 2LP0A 1U9OA 3G1LA 2R5YA 4PXIA 5EZGA 3I4NJ 5IP9J 5M5WJ 1ZKGA 5EF6A 3ON2A 3LSJA 3AQSA 1F36A 1FTZA 3HTAA 3HOYJ 1AKHA 3FRQA 3GTGJ 2CU7A 2QOPA 1MH3A 4UUSB 4X6AJ 5D1RA 4XRSG 2LD5A 2CUFA 2ECBA 3C07A 3JR9A 1A6IA 2HOSA 2NP3A 3HTIA 5EFYA 3SDGA 5HSZA 3K2AA 4D7NA 3DPJA 4JNNA 4QTRA 4UUSA 2R5ZB 1I6HJ 5C4JJ 4IHXA 2D5VA 3GTKJ 1JKPC 1YRNA 4A93J 1UI5A 2F07A 3VP5A 1JKQC 3GTOJ 3OOUA 4X1EA 5FJ8J 5IPAA 5F27A 2O9LA 5IP7J 3PO2J 3Q0VA 2D6YA 2G0EA 4GFBA 3ZQLA 2DA4A 2DA2A 2JA6J 3CDLA 3VIBA 2Y9ZA 2GM4A 3EUPA 2K9SA 3GTJJ 2HDDA 1IDYA 3RKQA 3V6GA 4GCTA 2O7TA 3Q3SA 5J3LA 3MVPA 4A3CJ 2L0KA 4AC6A 1GDTA 2NVYJ 2LVSA 1MBEA 1Y1VJ 3IV5A 2VUMJ 2Q24A 4MLOA 4A3FJ 2RHAA 2G3BA 3JRGA 4MK6A 1IV6A 4S0HB 2W53A 1B72A 3TP0A 3OSFA 2NVQJ 3BTIA 2ZCNA 2GUHA 1POGA 1MBJA 2XGEA 3NXCA 3S5RA 3BR0A 2DG8A 1WPKA 1Z77A 3BG3A 2H1KA 4W1UA 3G1OA 5EGOB 3A01A 1QRYA 2LLKA 1Y1WJ 2E2IJ 1NK3P 5IOZA 1U78A 3W6VA 2Y9YA 2N8GA 2KT0A 1PUFB 1VI0A 3FKIJ 2IEKA 3I4MJ 3LOCA 1JJ8C 2QWTA 3A02A 2LFBA 3NI7A 4ICHA 3PO3J 1ZR2A 5AQCA 4GFLA 3TEDA 5EEAA 1LFUP 5FMPA 3FK7A 2XDNA 3KZ9A 5K7FA 2LR8A 2GENA 3GBGA 3KNWA 3E7LA 3GEUA 2LK2A 2MSYA 3QKXA 4W97A 1JTXA 5J1YA 2UXOA 1OCTC 2R7ZJ 5FKKA 3HTJA 3IH3A 3TP3A 2NS7A 4EEFG 3VOKA 2L9RA 3LWJA 4MXMA 1ENHA 1U9NA 4ACIA 2LKXA 2QKOA 2QF7A 4XRSA 3BT9A 3SJMA 4IHWA 1TC3C 1TWAJ 2HOAA 3BTJA 1JUPA 2JK3A 4BY7J 4ME9A 2X48A 3O60A 1R9TJ 4A3LJ 3T6NA 1ETYA 4QIWN 3S17J 4IEJA 2JJ7A 2PZ9A 2V57A 4C3HJ 4FTHA 4V2GA 2XB0X 4CYCB 3ZQCA 1ZQ3P 1Z0XA 5GPCA 2WB1N 5F04A 2M34A 5JLXA 2ME6A 1AU7A 5EG0B 1A5JA 4ABZA 3BQYA 3S14J 2K9NA 1UG2A 3JRAA 3TW6A 1JTYA 3MN2A 2XPWA 4B1RA 1QVUA 2YVEA 4QSHA 2W48A 3RQIA 2GBYA 4UUTA 4FCYA 5M5YJ 1U8BA 3JRIA 4HKUA 3LNQA 2WGBA 3HTHA 5BNGA 3RZOJ 4BBRJ 2EQRA 4XIDA 2CRGA 2MGQA 4A3JJ 2TRTA 5F0FA 3VW0A 1BA5A 3ON4A 1UHSA 2AO9A 3BQZA 4A69C 3B6CA 1H88C 5GPAA 2RAEA 5IYDJ 3S1RJ 2XGCA 2H8RA 5C3EJ 3G1MA 1W0UA 1TWGJ 4YZEA 5C4XJ 3PM1A 3HB9A 4M3DA 3MKLA 3JRDA 2DA6A 4C3IJ 2DA1A 3Q0UA 3H3VK 1X2MA 4G12A 2UXPA 4JX6A 4C2MJ 4Y7NJ 2E19A 1APLC 5DAJA 5E3NA 3JRCA 1IRZA 3JSJA 3BHQA 3ANPA 2DMPA 3HEFA 1HDDC 1WCMJ 3TW7A 3OSGA 1JKOC 2UXUA 5HAWA 1JGGA 4FE4A 4IHYA 2ZB9A 3KKCA 2R92J 5IYCJ 3A03A 3WHBA 2JA7J 5CXIA 3D1NI 2ELKA 2M2EA 4BKXA 2WV1A 2OERA 1MBGA 4LOCA 5C44J 3NRGA 5DTDA 1AHDP 3H0GJ 3LHQA 2REKA 3CWRA 2O7OA 1OJLA 1FJLA 2UXHA 1Q1VA 1OFCX 3S2HJ 4DYRA 1BL0A 2GFNA 3M4OJ 1FIPA 4A3GJ 2OI8A 5E3OA 5M3FJ 5J1UA 3MNLA 4NELA 1MBFA 1UMQA 3E7QA 4JL3A 3HKZN 3BR3A 4L62A 1JT0A 2E1OA 1RR7A 4JYKA 4M3EA 2OF7A 1S7EA 1IJWC 5D19A 4AF5A 1TWFJ 4A3DJ 2MG4A 3M3YJ 3ZQGA 1YRNB 4A3KJ 1NTCA 3BR5A 1JUMA 3P9TA 2NP5A 2HQ5A 1UI6A 4BXXJ 3VW1A 3S2DJ 1RPWA 2COBA 2R93J 3ZQIA 2ZOZA 1JJ6C 2JMWA 3KKDA 2HI3A 5FKOA 3L1PA 5C4YA 9ANTA 1G2HA 2EZIA 3HOWJ 5FKMA 4A3IJ 1LFBA 2XB5A 1JT6A 1F43A 3O8HA 5K7HA 3VPRA 1GT0C 1RKWA 1ZR4A 3FIWA 1ETKA 1HLVA 5EYRA 1EF4A 3ZOBA 2JWTA 1IC8A 1ETWA 5M5XJ 2L7FP 4JP0A 3LSGA 1OCPA 4DW6A 1E3OC 3F1BA 4FE7A 4AYBN 3HE0A 3HOZJ 1SGMA 2X9DA 2HKUA 2ID6A 5EDNA 2HXOA 2RASA 3NNRA 3JRHA 3BG9A 4XK4A 1SANA 2YUSA 2G7GA 3LJLA 5CW8A 1GV2A 2MW8A 1GVDA 5F1JA 4A3EJ 1MSEC 4M3GA 1HOMA 4J19A 3AQTA 3GTPJ 4B3AA 1JUSA 3BJBA 3BG5A 2G7LA 5FHPA 5GP9A 4M3BA 1I50J 3CJDA 3BR1A 1I3QJ 4BY1J 2B63J 2DMTA 5IOYA 5D18A 1XG1A 2HYTA 1NK2P 2XPVA 3SFIA 4CGRA 1O4XA 2DN0A 1TWHJ 4Y52J 2XSDC 1X2NA 3S16J 2O8KA 3RZDJ 1HCRA 1BW5A 3B6AA 2HYJA 4V2FA 2IBDA 2LY9A 3QQAA 2DMUA 3WHCA 2YVHA 2HXIA 4L5EA 1B72B 4NN1A 4D5FA 2EH3A 2X6OA 2AHQA 2E2JJ 1HDPA 2YU9J 2QCOA 1BW6A 5FKLA 5M3MJ 2M8GX 3NPIA 4UDSA 4MO7A 1P7JA 5F0HA 4IHVA 3A01B 3HOUJ 3HIMA 3ZQHA 1K61A 2ECCA 3IH4A 1AKHB 2PBXA 1WI3A 2DMQA 1JKRC 3JRBA 2L7ZA 2VKEA 1PUFA 3GTMJ 2FJ1A 2EZHA 1ORKA 5E3LA 1QPIA 2Y2ZA 1MSFC 1ZTRA 2NOGA 3FISA 2FBQA 1XC5A 3VUQA 2LTPA 1T33A 3COLA 2IU5A 2NVXJ 4GFKA 2JA8J 2UXIA 3VVYA 4RDUA 4A3BJ 5F0CA 2XRLA 1ETVA 1DU0A 3HGGA 3QBMA 1GUUA 1ZGWA 2JN6A 3CRJA 3VOXA 1VF9A 3FK6A 2FD5A 2FX0A 3DCFA 3Q0WA 3OIOA 1CQTA 2CJJA 3ANGA 3CCYA 1B8IB 4JX5A 5E3MA 1W0TA 1WH5A 2JA5J 5FLVA 2DA3A 2NX4A 3QPSA 3RD3A 3VVXA 3HDDA 3BRUA 2PMZN 2QIBA 2VKVA 1B8IA 3LSPA 2ZCMA 2P81A 1TWCJ 3VW2A 1GV5A 4DYCA 4HNVA 4DZPA 2YS9A 1K83J 1DU6A 1MBHA 3IUVA 2EZKA 2GLOA 3HM5A 1MNMC 1LE8B 2HOTA 2EBIA 5FKNA 1MH4A 2OPTA 3BR2A 3K7AJ 4I6ZA 2CQQA 1H8AC 3GZIA 5F08A 5IYBJ 4C3JJ 3F0CA 5CXGA 2NVTJ 5DS9A 3ZQFA 2K9QA 1WH7A 2IAIA 4D7MA 4A3MJ 2E2HJ 2ID3A 2XPUA 3G56A 3BTCA 2EZLA 2FQ4A 1D5YA 4MIMA 2DMNA 3S1NJ 3HBLA 3IH2A 4CYCA 2DA7A 2CQXA 2M0CA 3S1QJ 3G7RA 1RESA 2Y0SN 2DA5A 4B4CA 3HGYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JRF A;  1IUF A;  1QVT A;  4DYQ A;  2R5Z A;  3UKG A;  1LE8 A;  3NAU A;  1ETO A;  4KWA A;  3RH2 A;  3DEW A;  3B81 A;  1HF0 A;  3CQZ J;  3JRE A;  4AUX A;  5K58 A;  4GCK A;  2ZOY A;  2WAQ N;  1IGN A;  5EZH A;  1VND A;  1ZK8 A;  4FIS A;  4NDL A;  1RET A;  3LSR A;  2L7M P;  2WUI A;  1FEX A;  3QPL A;  2XGD A;  3BR6 A;  3HOV J;  2QTQ A;  5H9T A;  4GCL A;  3BNI A;  2NS8 A;  3NAR A;  3V78 A;  1FIA A;  4XRM A;  1IDZ A;  4JKZ A;  5EG0 A;  1WGX A;  3HOX J;  5K7Z A;  4I76 A;  2VI6 A;  2ME0 A;  2R5Y B;  2KDZ A;  2DG7 A;  1ETX A;  3PAS A;  3BTL A;  3GTL J;  2Y30 A;  2Y31 A;  1T56 A;  1BJZ A;  5JLW A;  3VVZ A;  5FLM J;  4JX4 A;  2K40 A;  2DJN A;  4XIC A;  4RBO A;  4M3F A;  4BBS J;  2M9H A;  1FTT A;  2ZCX A;  1ETQ A;  3PPB A;  3C2B A;  1IG7 A;  2TCT A;  1SFO J;  4MFD A;  1VFC A;  3GTQ J;  1ITY A;  4M6V A;  5FGL A;  1MBK A;  1P7I A;  4D5C A;  2DTZ A;  5HBU A;  5HOD A;  4AC0 A;  1X58 A;  2VPR A;  1H89 C;  2I10 A;  5IP6 A;  3BCG A;  2G7S A;  3O8G A;  3S15 J;  1RKT A;  5EGO A;  5J1R A;  2R0Q C;  4DZJ A;  2CUE A;  3CMY A;  3S1M J;  1XS9 A;  3EGQ A;  4MFE A;  2LP0 A;  1U9O A;  3G1L A;  2R5Y A;  4PXI A;  5EZG A;  3I4N J;  5IP9 J;  5M5W J;  1ZKG A;  5EF6 A;  3ON2 A;  3LSJ A;  3AQS A;  1F36 A;  1FTZ A;  3HTA A;  3HOY J;  1AKH A;  3FRQ A;  3GTG J;  2CU7 A;  2QOP A;  1MH3 A;  4UUS B;  4X6A J;  5D1R A;  4XRS G;  2LD5 A;  2CUF A;  2ECB A;  3C07 A;  3JR9 A;  1A6I A;  2HOS A;  2NP3 A;  3HTI A;  5EFY A;  3SDG A;  5HSZ A;  3K2A A;  4D7N A;  3DPJ A;  4JNN A;  4QTR A;  4UUS A;  2R5Z B;  1I6H J;  5C4J J;  4IHX A;  2D5V A;  3GTK J;  1JKP C;  1YRN A;  4A93 J;  1UI5 A;  2F07 A;  3VP5 A;  1JKQ C;  3GTO J;  3OOU A;  4X1E A;  5FJ8 J;  5IPA A;  5F27 A;  2O9L A;  5IP7 J;  3PO2 J;  3Q0V A;  2D6Y A;  2G0E A;  4GFB A;  3ZQL A;  2DA4 A;  2DA2 A;  2JA6 J;  3CDL A;  3VIB A;  2Y9Z A;  2GM4 A;  3EUP A;  2K9S A;  3GTJ J;  2HDD A;  1IDY A;  3RKQ A;  3V6G A;  4GCT A;  2O7T A;  3Q3S A;  5J3L A;  3MVP A;  4A3C J;  2L0K A;  4AC6 A;  1GDT A;  2NVY J;  2LVS A;  1MBE A;  1Y1V J;  3IV5 A;  2VUM J;  2Q24 A;  4MLO A;  4A3F J;  2RHA A;  2G3B A;  3JRG A;  4MK6 A;  1IV6 A;  4S0H B;  2W53 A;  1B72 A;  3TP0 A;  3OSF A;  2NVQ J;  3BTI A;  2ZCN A;  2GUH A;  1POG A;  1MBJ A;  2XGE A;  3NXC A;  3S5R A;  3BR0 A;  2DG8 A;  1WPK A;  1Z77 A;  3BG3 A;  2H1K A;  4W1U A;  3G1O A;  5EGO B;  3A01 A;  1QRY A;  2LLK A;  1Y1W J;  2E2I J;  1NK3 P;  5IOZ A;  1U78 A;  3W6V A;  2Y9Y A;  2N8G A;  2KT0 A;  1PUF B;  1VI0 A;  3FKI J;  2IEK A;  3I4M J;  3LOC A;  1JJ8 C;  2QWT A;  3A02 A;  2LFB A;  3NI7 A;  4ICH A;  3PO3 J;  1ZR2 A;  5AQC A;  4GFL A;  3TED A;  5EEA A;  1LFU P;  5FMP A;  3FK7 A;  2XDN A;  3KZ9 A;  5K7F A;  2LR8 A;  2GEN A;  3GBG A;  3KNW A;  3E7L A;  3GEU A;  2LK2 A;  2MSY A;  3QKX A;  4W97 A;  1JTX A;  5J1Y A;  2UXO A;  1OCT C;  2R7Z J;  5FKK A;  3HTJ A;  3IH3 A;  3TP3 A;  2NS7 A;  4EEF G;  3VOK A;  2L9R A;  3LWJ A;  4MXM A;  1ENH A;  1U9N A;  4ACI A;  2LKX A;  2QKO A;  2QF7 A;  4XRS A;  3BT9 A;  3SJM A;  4IHW A;  1TC3 C;  1TWA J;  2HOA A;  3BTJ A;  1JUP A;  2JK3 A;  4BY7 J;  4ME9 A;  2X48 A;  3O60 A;  1R9T J;  4A3L J;  3T6N A;  1ETY A;  4QIW N;  3S17 J;  4IEJ A;  2JJ7 A;  2PZ9 A;  2V57 A;  4C3H J;  4FTH A;  4V2G A;  2XB0 X;  4CYC B;  3ZQC A;  1ZQ3 P;  1Z0X A;  5GPC A;  2WB1 N;  5F04 A;  2M34 A;  5JLX A;  2ME6 A;  1AU7 A;  5EG0 B;  1A5J A;  4ABZ A;  3BQY A;  3S14 J;  2K9N A;  1UG2 A;  3JRA A;  3TW6 A;  1JTY A;  3MN2 A;  2XPW A;  4B1R A;  1QVU A;  2YVE A;  4QSH A;  2W48 A;  3RQI A;  2GBY A;  4UUT A;  4FCY A;  5M5Y J;  1U8B A;  3JRI A;  4HKU A;  3LNQ A;  2WGB A;  3HTH A;  5BNG A;  3RZO J;  4BBR J;  2EQR A;  4XID A;  2CRG A;  2MGQ A;  4A3J J;  2TRT A;  5F0F A;  3VW0 A;  1BA5 A;  3ON4 A;  1UHS A;  2AO9 A;  3BQZ A;  4A69 C;  3B6C A;  1H88 C;  5GPA A;  2RAE A;  5IYD J;  3S1R J;  2XGC A;  2H8R A;  5C3E J;  3G1M A;  1W0U A;  1TWG J;  4YZE A;  5C4X J;  3PM1 A;  3HB9 A;  4M3D A;  3MKL A;  3JRD A;  2DA6 A;  4C3I J;  2DA1 A;  3Q0U A;  3H3V K;  1X2M A;  4G12 A;  2UXP A;  4JX6 A;  4C2M J;  4Y7N J;  2E19 A;  1APL C;  5DAJ A;  5E3N A;  3JRC A;  1IRZ A;  3JSJ A;  3BHQ A;  3ANP A;  2DMP A;  3HEF A;  1HDD C;  1WCM J;  3TW7 A;  3OSG A;  1JKO C;  2UXU A;  5HAW A;  1JGG A;  4FE4 A;  4IHY A;  2ZB9 A;  3KKC A;  2R92 J;  5IYC J;  3A03 A;  3WHB A;  2JA7 J;  5CXI A;  3D1N I;  2ELK A;  2M2E A;  4BKX A;  2WV1 A;  2OER A;  1MBG A;  4LOC A;  5C44 J;  3NRG A;  5DTD A;  1AHD P;  3H0G J;  3LHQ A;  2REK A;  3CWR A;  2O7O A;  1OJL A;  1FJL A;  2UXH A;  1Q1V A;  1OFC X;  3S2H J;  4DYR A;  1BL0 A;  2GFN A;  3M4O J;  1FIP A;  4A3G J;  2OI8 A;  5E3O A;  5M3F J;  5J1U A;  3MNL A;  4NEL A;  1MBF A;  1UMQ A;  3E7Q A;  4JL3 A;  3HKZ N;  3BR3 A;  4L62 A;  1JT0 A;  2E1O A;  1RR7 A;  4JYK A;  4M3E A;  2OF7 A;  1S7E A;  1IJW C;  5D19 A;  4AF5 A;  1TWF J;  4A3D J;  2MG4 A;  3M3Y J;  3ZQG A;  1YRN B;  4A3K J;  1NTC A;  3BR5 A;  1JUM A;  3P9T A;  2NP5 A;  2HQ5 A;  1UI6 A;  4BXX J;  3VW1 A;  3S2D J;  1RPW A;  2COB A;  2R93 J;  3ZQI A;  2ZOZ A;  1JJ6 C;  2JMW A;  3KKD A;  2HI3 A;  5FKO A;  3L1P A;  5C4Y A;  9ANT A;  1G2H A;  2EZI A;  3HOW J;  5FKM A;  4A3I J;  1LFB A;  2XB5 A;  1JT6 A;  1F43 A;  3O8H A;  5K7H A;  3VPR A;  1GT0 C;  1RKW A;  1ZR4 A;  3FIW A;  1ETK A;  1HLV A;  5EYR A;  1EF4 A;  3ZOB A;  2JWT A;  1IC8 A;  1ETW A;  5M5X J;  2L7F P;  4JP0 A;  3LSG A;  1OCP A;  4DW6 A;  1E3O C;  3F1B A;  4FE7 A;  4AYB N;  3HE0 A;  3HOZ J;  1SGM A;  2X9D A;  2HKU A;  2ID6 A;  5EDN A;  2HXO A;  2RAS A;  3NNR A;  3JRH A;  3BG9 A;  4XK4 A;  1SAN A;  2YUS A;  2G7G A;  3LJL A;  5CW8 A;  1GV2 A;  2MW8 A;  1GVD A;  5F1J A;  4A3E J;  1MSE C;  4M3G A;  1HOM A;  4J19 A;  3AQT A;  3GTP J;  4B3A A;  1JUS A;  3BJB A;  3BG5 A;  2G7L A;  5FHP A;  5GP9 A;  4M3B A;  1I50 J;  3CJD A;  3BR1 A;  1I3Q J;  4BY1 J;  2B63 J;  2DMT A;  5IOY A;  5D18 A;  1XG1 A;  2HYT A;  1NK2 P;  2XPV A;  3SFI A;  4CGR A;  1O4X A;  2DN0 A;  1TWH J;  4Y52 J;  2XSD C;  1X2N A;  3S16 J;  2O8K A;  3RZD J;  1HCR A;  1BW5 A;  3B6A A;  2HYJ A;  4V2F A;  2IBD A;  2LY9 A;  3QQA A;  2DMU A;  3WHC A;  2YVH A;  2HXI A;  4L5E A;  1B72 B;  4NN1 A;  4D5F A;  2EH3 A;  2X6O A;  2AHQ A;  2E2J J;  1HDP A;  2YU9 J;  2QCO A;  1BW6 A;  5FKL A;  5M3M J;  2M8G X;  3NPI A;  4UDS A;  4MO7 A;  1P7J A;  5F0H A;  4IHV A;  3A01 B;  3HOU J;  3HIM A;  3ZQH A;  1K61 A;  2ECC A;  3IH4 A;  1AKH B;  2PBX A;  1WI3 A;  2DMQ A;  1JKR C;  3JRB A;  2L7Z A;  2VKE A;  1PUF A;  3GTM J;  2FJ1 A;  2EZH A;  1ORK A;  5E3L A;  1QPI A;  2Y2Z A;  1MSF C;  1ZTR A;  2NOG A;  3FIS A;  2FBQ A;  1XC5 A;  3VUQ A;  2LTP A;  1T33 A;  3COL A;  2IU5 A;  2NVX J;  4GFK A;  2JA8 J;  2UXI A;  3VVY A;  4RDU A;  4A3B J;  5F0C A;  2XRL A;  1ETV A;  1DU0 A;  3HGG A;  3QBM A;  1GUU A;  1ZGW A;  2JN6 A;  3CRJ A;  3VOX A;  1VF9 A;  3FK6 A;  2FD5 A;  2FX0 A;  3DCF A;  3Q0W A;  3OIO A;  1CQT A;  2CJJ A;  3ANG A;  3CCY A;  1B8I B;  4JX5 A;  5E3M A;  1W0T A;  1WH5 A;  2JA5 J;  5FLV A;  2DA3 A;  2NX4 A;  3QPS A;  3RD3 A;  3VVX A;  3HDD A;  3BRU A;  2PMZ N;  2QIB A;  2VKV A;  1B8I A;  3LSP A;  2ZCM A;  2P81 A;  1TWC J;  3VW2 A;  1GV5 A;  4DYC A;  4HNV A;  4DZP A;  2YS9 A;  1K83 J;  1DU6 A;  1MBH A;  3IUV A;  2EZK A;  2GLO A;  3HM5 A;  1MNM C;  1LE8 B;  2HOT A;  2EBI A;  5FKN A;  1MH4 A;  2OPT A;  3BR2 A;  3K7A J;  4I6Z A;  2CQQ A;  1H8A C;  3GZI A;  5F08 A;  5IYB J;  4C3J J;  3F0C A;  5CXG A;  2NVT J;  5DS9 A;  3ZQF A;  2K9Q A;  1WH7 A;  2IAI A;  4D7M A;  4A3M J;  2E2H J;  2ID3 A;  2XPU A;  3G56 A;  3BTC A;  2EZL A;  2FQ4 A;  1D5Y A;  4MIM A;  2DMN A;  3S1N J;  3HBL A;  3IH2 A;  4CYC A;  2DA7 A;  2CQX A;  2M0C A;  3S1Q J;  3G7R A;  1RES A;  2Y0S N;  2DA5 A;  4B4C A;  3HGY A; 
#chains in the Genus database with same CATH topology
 3JRF A;  2Z99 A;  1LJ9 A;  4QWQ A;  5E1X A;  2LRD A;  1QVT A;  2OC6 A;  4DYQ A;  3UKG A;  1LE8 A;  3LWF A;  3NAU A;  1ETO A;  4GDF A;  1WSU A;  4KWA A;  3F8F A;  2QEN A;  3LST A;  3FMQ A;  3DPL C;  3CUO A;  2ZOY A;  1ZN2 A;  3UNG C;  3R0J A;  3HRU A;  2JQ7 A;  3CJR B;  2JPC A;  3BLY A;  2A3S A;  4XMY A;  4GCL A;  3BJO A;  3NAR A;  1IN4 A;  3LSK A;  2M1B A;  5EG0 A;  2EJR A;  4I76 A;  1ZG5 A;  3TMO A;  4WIB A;  2R5Y B;  1IN6 A;  1HBX G;  2W4S A;  4BJ6 C;  4E7L A;  2FE3 A;  3VVZ A;  3F3X A;  3FXK A;  4JX4 A;  4XLA A;  1R6R A;  1QU3 A;  2CFO A;  2M9H A;  3OYD A;  3WG7 H;  2TCT A;  2HVQ A;  4LIT A;  3J7A Y;  5FGL A;  4M9S A;  2R7R A;  5CKT A;  2DTZ A;  2L7K A;  2LC2 A;  1U5T A;  2DOE A;  4CCN A;  5K5O A;  2KQR A;  3BCA A;  1PP7 U;  5IP6 A;  1XCB A;  1W5T A;  5CQG A;  2PFB A;  5EGO A;  3HYI A;  5J1R A;  1OCR H;  2L5Q A;  1SFU A;  1XS9 A;  4B44 A;  1W5C C;  2LP0 A;  3S32 A;  3G1L A;  3LAJ A;  2ICW G;  2KIS A;  3FXL A;  1KYZ A;  4HDU A;  5IP9 J;  1R36 A;  1ZKG A;  1U2W A;  1HSJ A;  3LSJ A;  5EF6 A;  5M5W J;  1AKH A;  2Z9O A;  1G3Y A;  2V9V A;  3I64 A;  4HPQ A;  4MQ9 F;  5CPR B;  3LA2 A;  3S2W A;  3KET A;  2HPM A;  3ZMT A;  3VWB A;  4BJ5 C;  2NP3 A;  1Y8Q B;  4IF4 A;  3MKZ A;  3KYD B;  1ZRC A;  2PJR B;  4JNN A;  1VQ5 I;  1VQ9 I;  2W24 A;  4G9Y A;  2FNP A;  2MLK A;  4B8X A;  1VQK I;  4X1E A;  3ZN0 A;  2EB7 A;  5F27 A;  1KA8 A;  5IP7 J;  3KLN A;  4GFB A;  3ZQL A;  1REP C;  4HRI A;  2WY7 Q;  2VXZ A;  1GLN A;  3VIB A;  2HDD A;  1HKT A;  3V6G A;  1ZYR F;  4WXH A;  3Q3S A;  5J3L A;  2L0K A;  3E1S A;  2KL4 A;  2Y0M A;  1GDT A;  1JI8 A;  1J7K A;  4A0Y A;  1DPU A;  5HDK A;  4A3F J;  2RHA A;  2GXB A;  2G3B A;  3JW4 A;  2ZFU A;  3FZV A;  3M07 A;  4PSX A;  1SVM A;  2BGC A;  2PN6 A;  1B72 A;  3N05 A;  2NVQ J;  2CUZ A;  3IRR A;  2L3D A;  1POG A;  3NXC A;  1X3Z B;  2DG8 A;  2KIU A;  1Z77 A;  1UZC A;  1XGM A;  4ZH4 F;  2H1K A;  5DD4 A;  5EGO B;  2Q0O A;  3MQ0 A;  2E2I J;  1NK3 P;  3G73 A;  4KFC A;  1XGN A;  1VI0 A;  3W6J B;  2PFV A;  1R5I D;  2NVU B;  1SAX A;  4XOT A;  3I58 A;  1Z05 A;  4PGG A;  2VBY A;  5J47 A;  2E35 A;  4BQO A;  3MD2 A;  3PO3 J;  1KGS A;  1WJA A;  2KP6 A;  5FMP A;  2BZT A;  4XOP A;  2P5K A;  1MGT A;  1XX5 A;  2VQH A;  3OYN A;  2LR8 A;  4DOZ A;  3KNW A;  1ZEL A;  3M8F A;  5FRO A;  3AL0 C;  4NQW B;  3GEU A;  2M30 A;  5CLS A;  2XKP A;  2V6C A;  4W97 A;  2XAS A;  5L3B A;  4HX7 A;  3HRS A;  5ICC A;  4KT6 A;  2BY0 A;  2Y69 H;  5FKK A;  1YW8 A;  4XM3 A;  2DYR H;  4EEF G;  4PGH A;  1R71 A;  1U9N A;  1FSE A;  4U7D A;  3JTH A;  4E4H A;  1LEB A;  2QF7 A;  2KMU A;  1QA6 A;  2VBZ A;  1T6S A;  2P5V A;  2DAO A;  3BT9 A;  1F1Z A;  3RPU A;  3TO6 A;  4DBR A;  3I0T A;  3H9J A;  4II3 A;  3BTJ A;  4KIS A;  2H8W A;  2WAF A;  3D0S A;  2WC2 A;  4E7J A;  3O60 A;  4A3L J;  3KP6 A;  4IJA A;  1TL8 A;  1WJE A;  4XLH A;  3J7Z I;  4R79 A;  4XON A;  4LLG F;  1ETY A;  3PUB A;  3T6N A;  2JSC A;  4BE0 A;  4IEJ A;  2JJ7 A;  2V57 A;  2P7V B;  4FTH A;  3OYK A;  4XSX F;  1FNN A;  1ZQ3 P;  2WB1 N;  3OYC A;  3E6B A;  2M34 A;  3DV8 A;  2ME6 A;  1X3W B;  4ESB A;  2RQP A;  4D9J A;  1XSV A;  4M71 A;  2K9N A;  1UG2 A;  3JRA A;  2Z3Y A;  3MN2 A;  5IT9 Z;  4BHC A;  3H5N A;  2ZSI B;  4QSH A;  2KKO A;  2F5C A;  1ZRF A;  3JRI A;  1YG2 A;  3PQJ A;  2WGB A;  2VQG A;  3H92 A;  3ABM H;  1QPM A;  2TRT A;  3DFG A;  2Z33 A;  3OL4 A;  2JRM A;  3ON4 A;  1UHS A;  3VW0 A;  2AO9 A;  1VQ8 I;  5TJJ A;  4A69 C;  4L0Y B;  3OS1 A;  1W7P B;  3SEQ A;  2GWR A;  1Z9C A;  3IL2 A;  3G1M A;  4KIC A;  2E7X A;  5C4X J;  3PM1 A;  3HB9 A;  1KU3 A;  1R49 A;  3ABK H;  1ON1 A;  2LY2 A;  4ZZD A;  1S7A A;  4C2M J;  4Z2Y A;  1FBU A;  2E19 A;  2MA3 A;  1XMX A;  4M9Z A;  2EFP A;  1XMA A;  3MAJ A;  4N4O B;  1IRZ A;  1E17 A;  3HEF A;  1FOK A;  2PI0 A;  2GOM A;  3TW7 A;  5DM6 F;  5HAW A;  2JTV A;  3GME A;  4Y4R A;  4LLN A;  1UCR A;  2O8X A;  1RRJ A;  3ZPL A;  1WJC A;  1XSD A;  3A03 A;  3WHB A;  2JA7 J;  5CXI A;  1SD5 A;  2HKO A;  3D1N I;  2ELK A;  3AG1 H;  3I5U A;  2NAZ A;  3K4M A;  5C44 J;  2BOL A;  2ZFW A;  3H0G J;  4B48 A;  2V4J C;  2DPD A;  3S2H J;  4KNY A;  4OU0 A;  2E36 A;  3S93 A;  4EGZ A;  3MEX A;  4BNC A;  1S6L A;  3E6C C;  1BC8 C;  5E1Z B;  3S3M A;  2J5O A;  3WTT C;  3MNL A;  2CWE A;  1LUJ B;  1MBF A;  3P5J A;  4O3M A;  3E7Q A;  4JL3 A;  5E1W A;  4KN4 X;  2ESN A;  1JT0 A;  2KLO A;  2E1O A;  1RR7 A;  4N0B A;  4M3E A;  3OS2 A;  2OF7 A;  5A2Q Z;  4LK1 F;  2Y48 A;  2E5N A;  2VE8 A;  4HV6 A;  3P9T A;  2NP5 A;  1OCO H;  1N78 A;  3OYI A;  5H20 A;  2R7D A;  3SWH A;  3BZC A;  3IKV A;  4KIB A;  3BOQ A;  5HVQ C;  3OV8 A;  5E17 F;  2LKP A;  5ICF A;  2VBX A;  4ZC3 A;  4BGD A;  1MMN A;  2F2E A;  1G2H A;  3OMY A;  2ISY A;  2IPQ X;  2L54 A;  2R7F A;  5FKM A;  2LBF B;  2XB5 A;  4EAT A;  3OYE A;  1ZG1 A;  3O8H A;  5K7H A;  1SFK A;  1VQO I;  1Y0N A;  1ETK A;  1MZB A;  1EF4 A;  3ZOB A;  4RGU A;  2JWT A;  4LD5 A;  2KRH A;  4ASN A;  1Y39 A;  3FXR A;  2VL8 A;  3GO5 A;  4PK4 A;  4MGR A;  3F1B A;  4FE7 A;  1YE9 A;  4IL6 C;  3ABT A;  4XKV A;  4XLF A;  4AYB N;  1TW3 A;  2ID6 A;  3LSH A;  5EDN A;  4LFU A;  3I55 I;  3HKZ A;  1R58 A;  2YPR A;  5CW8 A;  4ESJ A;  3KEO A;  2XUB A;  3T1B A;  4MEY F;  5CQE A;  1F4K A;  4J19 A;  3AQT A;  4ENJ A;  1DGR M;  5HLG A;  2G7L A;  3HSF A;  3NRV A;  5FHP A;  4EGY A;  3BR1 A;  1I3Q J;  2KIF A;  5FO5 A;  4BY1 J;  1VQ6 I;  2H27 A;  4ETS A;  3L2V A;  5IOY A;  5D18 A;  1W7P D;  1XG1 A;  2KZV A;  4P9F A;  2IGM A;  1TW2 A;  2KRC A;  1SD4 A;  4Y52 J;  1X2N A;  1IF1 A;  3RZD J;  1A31 A;  3H9Q A;  3MZ8 A;  4FQG A;  3M1E A;  3OWT A;  1BW5 A;  2GZW A;  3BG7 A;  5GTI C;  2IBD A;  1G3T A;  3QQA A;  3TBI A;  1DUX C;  2D2W A;  3WHC A;  3T8T A;  5LGN A;  2HXI A;  2QSH X;  2VOD A;  2KIM A;  2ZJP F;  4LG3 A;  2LF7 A;  4UVB A;  2ACJ A;  3CO6 C;  3IWZ A;  4OMZ A;  2IA2 A;  4CZC A;  3HOU J;  2M7A A;  2FRH A;  4KIT B;  3L00 A;  3IH4 A;  2EK5 A;  3PUF A;  2UV1 A;  3JRB A;  2W25 A;  2L7Z A;  4BYY A;  1ZLJ A;  2FJ1 A;  4R8H A;  1ORK A;  3K70 C;  5E3L A;  3PFY A;  4QLC U;  1Y8R B;  1D5V A;  1WZ2 A;  2K27 A;  3VUQ A;  3EUH C;  2LTP A;  3BJA A;  2HWV A;  3ZMZ A;  1UEL B;  2NVX J;  2UXI A;  3D5S C;  3VVY A;  4DIQ A;  2XRL A;  3QBM A;  1LB2 A;  5LEJ A;  3P9K A;  2LNB A;  4HAM A;  4HYE A;  3FK6 A;  3DCF A;  3M7G A;  5K5Q A;  3OIO A;  3C3W A;  3AG3 H;  1ZRE A;  3H5R A;  1IXS B;  1FMV A;  1N75 A;  2FSW A;  3ZN1 A;  1HW2 A;  1FT9 A;  1N25 A;  1B8I B;  4GXO A;  4XL9 A;  1W0T A;  1WH5 A;  3P9C A;  2JA5 J;  3V8K A;  4I0B A;  3GW2 A;  3VYT B;  2CUJ A;  4B47 A;  2FBK A;  2PMZ N;  3FF5 A;  3QWL A;  4BS9 A;  3CF5 F;  3LSP A;  2DPU A;  3HG9 A;  5ILU A;  1GV5 A;  1MMG A;  4DYC A;  3OYG A;  2O61 A;  3K10 A;  2OZ6 A;  3TL4 X;  2V9P A;  2ZCW A;  1DU6 A;  1BBY A;  3IUV A;  5LHI A;  3C2G A;  3DLL F;  3I9V 2;  3R6S A;  2WB1 A;  2HOT A;  2E1N A;  2EBI A;  2VBW A;  4XQF A;  2OPT A;  3K7A J;  3K70 D;  3W6K B;  1X1C A;  5F08 A;  3OOP A;  4C3J J;  2IS4 A;  5CXG A;  4CCK A;  2QVO A;  1X4P A;  1Z6T A;  3FBI B;  5DS9 A;  1WH7 A;  4UV9 A;  4AIH A;  4D7M A;  4F3Q A;  5LRS A;  1RUN A;  4F91 B;  3KYL A;  2HDC A;  2ID3 A;  1YQA A;  5JVG F;  1J09 A;  2CS3 A;  2L9N A;  2CQN A;  4LG0 A;  1FYL A;  2QQA A;  2DU9 A;  2A6H F;  3RPQ A;  3S1N J;  2CQX A;  2EV5 A;  2M0C A;  3FHN A;  1RES A;  2EPF A;  2W1O A;  3BCB A;  2OJE D;  4ZDP A;  4S04 A;  1BOA A;  3KLO A;  4EJW A;  4HOB A;  3HUG B;  5EFY A;  5HLH A;  1HKS A;  1U6G A;  3DQV C;  3G6E I;  3DEW A;  5DD8 A;  1YIT I;  4BHP A;  1P4X A;  4BH9 A;  4ESF A;  5HS8 A;  3JRE A;  3U1K A;  4AUX A;  2R7O A;  3PNV A;  2WAQ N;  1NG7 A;  2L7M P;  3BR6 A;  5H9T A;  4OMY A;  2GXG A;  3V78 A;  4XRM A;  1J9I A;  4JKZ A;  2GIZ A;  3HTU A;  3QOE A;  2VI6 A;  3CUQ A;  4BU2 A;  5BPD A;  4OAY A;  2ME0 A;  2RGV A;  3PAS A;  3H3Z A;  3L7W A;  3OIP A;  5FLM J;  1PDN C;  4OIQ F;  2K40 A;  2DJN A;  2ADU A;  4AYB A;  4XIC A;  1HA8 A;  4M3F A;  1RNL A;  4BBS J;  2H6B A;  3KEQ A;  2ZJQ F;  1SVO A;  5KAI C;  3QOP A;  1IG7 A;  4M6V A;  2QEX I;  2F5D A;  2V1D A;  5K5R A;  1H9T A;  1VQ4 I;  1ZAR A;  4AC0 A;  1BI0 A;  5HDG A;  2VPR A;  1H89 C;  1OYI A;  3BCG A;  3S15 J;  2EIM H;  1RKT A;  1EJ9 A;  2L9V A;  1K4S A;  1MJB A;  2CUE A;  1G8X A;  3EGQ A;  3HOT A;  2X6Y A;  2R5Y A;  1LQ1 A;  5EZG A;  4BHB A;  4CZZ A;  2UUZ A;  4PXI A;  4U9L A;  1V5E A;  3I4N J;  2PMH A;  3QAH A;  2CMP A;  3ZQ7 A;  2CU7 A;  1E3P A;  2QOP A;  3BPV A;  3VDX A;  4F52 A;  4I99 C;  4UUS B;  4X6A J;  5IT9 K;  4OIO F;  1EV7 A;  4HNU A;  1MIJ A;  2CUF A;  1BC7 C;  1E0E A;  3OIQ A;  4RB1 A;  3S3N A;  1TNS A;  1LEA A;  3I54 A;  1KZH A;  3SDG A;  4MTE A;  4D7N A;  3TOB A;  2E1C A;  3P7N A;  2M4G A;  3EPZ A;  3HIF A;  2HQA A;  3CC4 I;  4A93 J;  2F07 A;  3GTO J;  4HNT A;  2WBM A;  3RKY A;  2NYX A;  2G0E A;  4M6X A;  4IHT A;  5H6R A;  2YX7 A;  3QPT A;  2V9K A;  3DTK A;  2WAD A;  2DFH A;  1AOY A;  2IRF G;  1XGS A;  2K9S A;  2HNH A;  3Q5F A;  3RKQ A;  2VT3 A;  1X1D A;  2Z5U A;  1VZ0 A;  2WA0 A;  5B1B H;  3F23 A;  3DTE A;  3MVP A;  1A04 A;  3CES A;  2NVY J;  2OQR A;  3IUO A;  1S29 A;  3IP4 B;  4KIG A;  2VUM J;  3GYH X;  4IPA A;  1MKM A;  3WE2 A;  3RKW A;  1EH7 A;  2Q24 A;  2DQR A;  2JUC A;  2V7F A;  4LGW A;  3JRG A;  1PYV A;  3QU3 A;  3GFI A;  3OYA A;  4S0H B;  2DDB A;  1AWC A;  1XDS A;  2WY8 Q;  3KZZ A;  1RUO A;  3L2C A;  3BTI A;  2RV8 A;  2GUH A;  2ZCN A;  2XGE A;  3NS4 A;  1FPQ A;  2DJI A;  1P4W A;  2K86 A;  4L5J A;  4ON0 A;  2K3F A;  1X1B A;  1Z1D A;  5BMZ A;  3V4G A;  5LGT A;  3MKY B;  4XN3 A;  1WFX A;  2A69 F;  3CUQ C;  3KX2 A;  1U78 A;  4AIJ A;  3W6V A;  2DK5 A;  2N8G A;  4A5N A;  4A6D A;  1R4N B;  1KQ9 A;  2ISZ A;  2VQC A;  2KDO A;  2X51 A;  1I6X A;  2QWT A;  3EUK L;  1X3U A;  2OQG A;  3R60 A;  4RB0 A;  2LFB A;  3BC8 A;  3KP5 A;  3OYH A;  2VE9 A;  3CCQ I;  1T38 A;  1ZR2 A;  1LDK B;  1FOX A;  2VB6 A;  3CZ6 A;  3TED A;  1UHW A;  1TQM A;  2XDN A;  2DXI A;  3DLA A;  3K9T A;  1BIB A;  2XAU A;  4M74 A;  4EM2 A;  1ZRD A;  3GBG A;  5JVT A;  3OS0 A;  1YIO A;  2MSY A;  4PDK A;  4EM1 A;  1JTX A;  4BE1 A;  1BI3 A;  3FM3 A;  2BHZ A;  3H5A A;  5L3C A;  2DFE A;  4E7H A;  2R7Z J;  3HTJ A;  1P9Q C;  2ZY9 A;  4EJV A;  1W36 C;  2MC3 A;  1U5T C;  2NS7 A;  1S5L C;  2HTS A;  2BY3 A;  4MXM A;  3WTW C;  2OCE A;  4ZYG A;  3MZH A;  1B1B A;  2A68 F;  4G6Q A;  3PIP F;  2HOA A;  3I59 A;  3TDZ C;  4B43 A;  5DCF A;  4RGR A;  4BY7 J;  1VQM I;  1R9T J;  2ZXW H;  4XKW A;  1ULY A;  4C30 A;  3S17 J;  2BV6 A;  4NHJ A;  2M0M A;  5DV5 A;  2EV0 A;  3E6D A;  1J5Y A;  1B4A A;  2BEO A;  3LMM A;  4V2G A;  2XB0 X;  3ZQC A;  3E5X A;  1Z0X A;  4ZDL A;  2PMZ A;  5GPC A;  5JLX A;  5D5W B;  2HYG D;  1WJF A;  1T98 A;  2STT A;  2IGO A;  2CW0 F;  5EG0 B;  4ABZ A;  3BQY A;  4Q4Z F;  1D1C A;  1JTY A;  2XPW A;  4B1R A;  2W48 A;  3RQI A;  2VN2 A;  2GBY A;  4UUT A;  5D4S A;  4FCY A;  2BY2 A;  1BN5 A;  4BUP A;  1U8B A;  4NB5 A;  3HTH A;  4HKU A;  5BNG A;  4BBR J;  4B09 A;  4YRV A;  3ECO A;  4XID A;  3FMS A;  1X19 A;  4F7Z A;  2B1E A;  2VAS A;  4L5I A;  1BA5 A;  1BI1 A;  3F8C A;  1Z6R A;  2E7W A;  3ZMV A;  5IYD J;  2XGC A;  3DPT A;  4FET A;  2H8R A;  3EYI A;  3SDB A;  4YZE A;  4ZYD A;  5HS9 A;  1QZE A;  1WJ5 A;  2HKX A;  3F72 A;  4HF1 A;  3Q0U A;  2DQL A;  2VQL A;  2UXP A;  1BR1 A;  2QZ8 A;  2XAF A;  4O5V A;  4EV0 A;  1MJ9 A;  1OYW A;  1APL C;  5E3N A;  3JRC A;  3JSJ A;  4ANJ A;  3ZR8 X;  1V4R A;  1YHQ I;  1HDD C;  2XF5 A;  1IAW A;  2PMU A;  1JGG A;  2F6C A;  4IHY A;  2XRN A;  4L9N A;  2ZC2 A;  2ZB9 A;  3FBN B;  2K4J A;  2NXN B;  2VIX A;  2MH9 A;  4XLE A;  2J5P A;  2OER A;  1WJB A;  4LOC A;  4A12 A;  2RDP A;  5DTD A;  3F6O A;  1FWZ A;  1Q1V A;  2M3A A;  1QHG A;  3M8J A;  4EQQ A;  2V26 A;  5GAD J;  1T39 A;  2GFN A;  3CCS I;  1R7J A;  2MLG A;  2R7V A;  3EDP A;  2ZXH A;  2OI8 A;  5E3O A;  2R3S A;  4IX7 A;  2FJI 1;  1EA3 A;  3DU5 A;  4NEL A;  2VON A;  2JA2 A;  3J81 Z;  3KP7 A;  4L62 A;  3IC7 A;  2W7N A;  2LH9 A;  4JYK A;  1FOY A;  2WV0 A;  3ML6 A;  1GVJ A;  2X4H A;  1WVR A;  2MG4 A;  3M3Y J;  2R7T A;  2MD0 A;  2HPI A;  5FRM A;  2QQ8 A;  3KE2 A;  1A36 A;  3Q9V A;  4IOA F;  1JGS A;  3K8P C;  1XB4 A;  5ERI A;  4LB6 B;  4UVC A;  4DQ2 A;  2OTJ I;  1RPW A;  2IVM A;  2FNA A;  1U0J A;  3G3Z A;  4XR6 A;  1TZL A;  3KKD A;  2HI3 A;  3WE3 A;  4WWC A;  5J6X A;  3R0A A;  2DW4 A;  2JT1 A;  2D45 A;  3AAF A;  3AG2 H;  4L9V A;  4A3I J;  2DTR A;  2ZNY A;  1R23 A;  1F43 A;  3VPR A;  1G3W A;  3I4P A;  1FBQ A;  2X1E A;  3CO7 C;  5EYR A;  4BQA A;  3J7A O;  4XLP F;  2CYY A;  4L9J A;  1S7O A;  2L7F P;  1FSH A;  2ZKZ A;  1E3O C;  3HOZ J;  1SGM A;  2IW5 A;  2X9D A;  1FP1 D;  3FX3 A;  1RR8 C;  2RAS A;  5J4Y A;  4G7Z F;  1YJW I;  4P5O A;  4XK4 A;  3WGH A;  2AXT C;  1WQ2 A;  2G7U A;  5J8F A;  2PBI A;  2BXZ A;  5F1J A;  2B7E A;  3IAS 2;  4CCM A;  4M3G A;  1HOM A;  4B3A A;  5GP9 A;  3U9G A;  4BEH A;  1I50 J;  4F93 B;  3PIO F;  2FU4 A;  1W36 D;  5D5V B;  2OAZ A;  3WTU C;  2B63 J;  1LDD A;  3KCC A;  3A0B C;  4ZTF A;  2HYT A;  1NK2 P;  3MKW B;  3ISP A;  2CW7 A;  2LF8 A;  2DN0 A;  4GO1 A;  2CQK A;  2FF4 A;  1OCC H;  2PG4 A;  2V1X A;  2EA2 A;  1HXD A;  1YS6 A;  3HZJ A;  1R4M B;  3ZGK A;  3PSF A;  1SFE A;  3B6A A;  5CYV A;  4Q5S F;  2HYJ A;  2YX4 A;  2ZJR F;  1GHC A;  2LY9 A;  5L3D A;  2XHK A;  3HPG A;  4G8X A;  4L5E A;  3H9G A;  3F8N A;  4HZF A;  3SQN A;  4A0Z A;  2X6O A;  1OYY A;  3RTR A;  2A6T A;  3HHH A;  1FC3 A;  2BYV E;  1STZ A;  5K1Y A;  2A2F X;  3NPI A;  1P7J A;  4RAY A;  5F0H A;  3A01 B;  4IHV A;  3HIM A;  5DM7 F;  5EEG A;  1LPQ A;  2K7L A;  2HFH A;  4WF2 A;  4YEJ A;  2COM A;  2PBX A;  2XAJ A;  1IZ1 A;  4HV5 A;  1D8K A;  1PUF A;  3GTM J;  3V8J A;  1QO0 D;  4IQJ A;  1QBJ A;  2Y2Z A;  1P92 A;  2NOG A;  1J59 A;  2FBQ A;  4PCQ A;  2KFD A;  1I1G A;  2HDW A;  4YII A;  1HW1 A;  2NOJ B;  4GFK A;  2JA8 J;  4RDU A;  5FB2 A;  1ETV A;  2OZU A;  3GCM A;  2X1D A;  3LQQ A;  3M1C A;  4II2 A;  5L3F A;  2CG4 A;  2JN6 A;  1W7P A;  4HG2 A;  3VOX A;  4NBQ A;  4PJJ A;  3FXO A;  1O7L A;  3ZCO A;  1CQT A;  1JE8 A;  2LOO A;  1IUY A;  4P1W A;  1LFP A;  4IRG A;  2BVM A;  4XKB A;  1VQN I;  2Z2S B;  1VQP I;  5EEH A;  3G71 I;  4I01 A;  4OAZ A;  2AS5 F;  2VXD A;  1BOB A;  2EFN A;  4PFO A;  4JX5 A;  3SZP A;  1OIS A;  5E3M A;  3PNY A;  4EM0 B;  4BJT A;  3L09 A;  1YIJ I;  3RD3 A;  2AQE A;  3F9K A;  5CVI A;  5JHU A;  4U0V A;  3N4M A;  5CVJ A;  2VKV A;  3V7C A;  1KQ8 A;  3GF2 A;  3VW2 A;  1IW7 F;  4CYD A;  4HNV A;  2BHY A;  2ZXI A;  1A35 A;  5F6F A;  2NNY A;  1BI2 A;  4PFP A;  2B3W A;  3TKY A;  3BR2 A;  3HOS A;  2CV0 A;  3WTS C;  5HLI A;  5IYB J;  4EJO A;  2K9M A;  4KN7 X;  2M87 A;  3SYT A;  3KPH A;  4JOM A;  1K6Y A;  4N9I A;  1Q1H A;  5JR3 A;  1FMW A;  2H6C A;  3EUA A;  3WTZ A;  1T0F C;  4F55 A;  2FMY A;  2VC0 A;  3LL7 A;  3HSR A;  2RQQ A;  1YS7 A;  4A6E A;  3D5L A;  1QNT A;  4EJU A;  5D8K B;  3HBL A;  4PSW A;  4CYC A;  1XSX A;  5LEK A;  2DA7 A;  3LAP A;  3S1Q J;  3G7R A;  1LDJ A;  2Y0S N;  4B4C A;  3HGY A;  3LHQ A;  3VP5 A;  1NG6 A;  3V42 A;  2DLL A;  1IO2 A;  3OYL A;  1DDN A;  2F5V A;  4RLQ A;  2VJ5 A;  1HST A;  2LYC A;  1NHA A;  1ZK8 A;  4NDL A;  1RET A;  2WUI A;  1FEX A;  2XGD A;  3AKZ A;  4J00 A;  2STW A;  5JFR A;  5HOO A;  3W2A A;  3IHU A;  3TDU C;  4ZZL A;  2QTQ A;  2ZXJ A;  3NEU A;  3BNI A;  2NS8 A;  2EIN H;  3V7S A;  1FIA A;  2IGN A;  5K7Z A;  1KQ0 A;  2FA5 A;  2O3F A;  3KZI C;  4XBF A;  2PQ8 A;  3U1D A;  2ZBK A;  3ZRG A;  2DG7 A;  3K4C A;  1ETX A;  3OL3 A;  3CJT B;  3BTL A;  3VOD A;  2X6W A;  3QRF F;  1OKR A;  4U0W A;  4HLY A;  3IAM 2;  2Y31 A;  1T56 A;  1BJZ A;  5KHD A;  3MFK A;  2R7U A;  2EIL H;  2FOW A;  3OYJ A;  1S8N A;  3HUG A;  1TQI A;  1UAA A;  4JQF A;  3C2B A;  3E5U A;  1SFO J;  1VFC A;  3GTQ J;  4L9T A;  4G6T B;  1P7I A;  3TOA A;  4D5C A;  3CLQ A;  2W84 A;  3MZY A;  5E18 F;  5HBU A;  5HOD A;  1ZLK A;  2RKH A;  2VKH A;  4YIF A;  1X58 A;  2NS0 A;  2DDA A;  3PSI A;  2G7S A;  3O8G A;  2ZME A;  2H1L A;  3F21 A;  2RN7 A;  2R0Q C;  2RC4 A;  3JTG A;  3CMY A;  5E79 C;  3S1M J;  3ROU A;  4MEX F;  4FX4 A;  1MNE A;  1U9O A;  3RKX A;  5CJ9 A;  2IJL A;  1MND A;  2MFZ A;  3JAM Z;  3ON2 A;  4Q48 A;  3ULQ B;  1F36 A;  3BZK A;  4DJA A;  5LFA A;  4RB3 C;  3HTA A;  3HOY J;  3WTX C;  4BDZ A;  2MBF A;  3GTG J;  1MH3 A;  3FMR A;  2K9L A;  4GGG A;  5E8G A;  5HLT A;  3M8E A;  4Q47 A;  3BRO A;  5FLX Z;  3HSE A;  2ECB A;  1Z91 A;  4IOC F;  1A6I A;  2HOS A;  3HTI A;  2OCC H;  3ABU A;  3LQR A;  3VFZ A;  3RI4 A;  3K2A A;  4CCO A;  3DPJ A;  3UR3 C;  3GFJ A;  3CCM I;  1DP3 A;  3GZ5 A;  4IHX A;  3GTK J;  4ZDO A;  3SZG A;  3OOU A;  5FJ8 J;  5IPA A;  2B9S A;  3RCO A;  4ZYH A;  3OYF A;  2M5W A;  2E5Z A;  2OU2 A;  2DA4 A;  2DA2 A;  4G6D A;  2JA6 J;  3K0L A;  3E97 A;  4LK0 F;  4P55 A;  2Z1D A;  4GCT A;  1IDY A;  2K85 A;  1V5G A;  3V7R A;  3LA3 A;  1S72 I;  1V3F A;  4YFN F;  4GYI A;  4OIR F;  2GA1 A;  3GXO A;  4NUB A;  2LVS A;  1MBE A;  1Y1V J;  4AC6 A;  4KYW A;  1YI2 I;  1SFX A;  4R1H A;  5GAG J;  4MK6 A;  1IV6 A;  4OIP F;  4M9X A;  2W53 A;  3QYE A;  3TP0 A;  3OSF A;  3FM5 A;  3ZMU A;  1WHU A;  4MNU A;  3LFU A;  3S5R A;  5LD2 C;  1WPK A;  3L9F A;  2R7X A;  3BG3 A;  4W1U A;  4O6J A;  3A01 A;  4ZTJ A;  1ODD A;  1QRY A;  1W1W E;  2XAH A;  4P9U A;  3REO A;  2KT0 A;  1PUF B;  4LJZ F;  1MMS A;  3FKI J;  2IS1 A;  2DCE A;  1IXC A;  1JHH A;  1HC8 A;  3I4M J;  3LOC A;  5AON A;  1JJ8 C;  4KUM A;  3CTA A;  2F4O B;  4MHG A;  5AQC A;  5IT3 A;  4GFL A;  5LHG A;  1D0X A;  2XGX A;  1TNT A;  5EEA A;  3CLO A;  4UNO A;  3FK7 A;  3DXJ F;  3KZ9 A;  2DOD A;  3I3L A;  2O5R A;  3ASO H;  4KDP A;  3CF2 A;  1TP4 A;  3PL8 A;  1UST A;  2H09 A;  3E7L A;  3ABL H;  2LK2 A;  2QKL B;  3QKX A;  4U7B A;  3COA C;  2UXO A;  2Q2E B;  4U88 A;  1OCT C;  3CC7 I;  4KA4 A;  2E1M B;  3TP3 A;  4LG0 B;  3KP4 A;  3SXY A;  4NQW A;  3LWJ A;  2L9S A;  1ENH A;  1SD6 A;  3DEU A;  3K2Z A;  5LLQ A;  4ACI A;  2LKX A;  3T5X A;  1VQL I;  2V6E A;  1SMY F;  1T95 A;  2QKO A;  1B6A A;  1P4A A;  5FFX A;  1ERD A;  1D0Z A;  2PJP A;  3SJM A;  4HF0 A;  4XKC A;  2DT5 A;  3DKY A;  4FT8 A;  4ENN A;  1YO5 C;  4ME9 A;  4CCJ A;  4IO9 F;  5KCM A;  3K1P A;  3CMA I;  6PAX A;  2ZME C;  4GRI A;  2RNJ A;  1XCV A;  1E2X A;  1VTN C;  2PZ9 A;  1KYW A;  1Y6I A;  2YR2 A;  5E20 A;  3VOE A;  3DKW A;  1BR4 A;  3CMM A;  4CYC B;  4M72 A;  1U8R A;  5F04 A;  2K3P A;  2HOE A;  3RYP A;  3O6B B;  2P6S A;  2H94 A;  4HBL A;  4QPO A;  3CME I;  3S14 J;  1OPC A;  4BQN A;  3F8M A;  3VSK A;  1QVU A;  1WWX A;  2A6E F;  2X6X A;  3K6G A;  1R1V A;  4KMU X;  5M5Y J;  4UB6 C;  3LNQ A;  2NNN A;  3J80 Z;  2EQR A;  2KJB A;  4CSW A;  2CRG A;  2MGQ A;  3K1M A;  4A3J J;  5F0F A;  4PJL A;  4HX4 A;  3BQZ A;  2V1U A;  3CDI A;  4BXF A;  5GPA A;  3HPH A;  3S1R J;  2W85 A;  3WTV C;  1W0U A;  1SC7 A;  4M3D A;  2X0L A;  1TT5 B;  4C3I J;  1MD0 A;  1CF7 A;  2E60 A;  1X2M A;  4IRI A;  4JX6 A;  4IRV A;  4A5M A;  4Y7N J;  4UUV A;  1IN7 A;  5CVV A;  4A2U A;  3AL0 B;  4RLF A;  1X1A A;  2EWN A;  2HEO A;  3BDD A;  3ANP A;  3BHQ A;  2DMP A;  1SMT A;  3OSG A;  1JKO C;  3KFW X;  2WWY A;  4K2E A;  5AIQ A;  1ONV A;  3SZT A;  3KKC A;  5IYC J;  1YX5 A;  2A61 A;  3WGG A;  1Z3X A;  3HC7 A;  1IRF A;  1YLF A;  3ONQ A;  2KIQ A;  5TGT A;  3L2U A;  4BKX A;  3TO7 A;  2WV1 A;  2BBY A;  2BW3 B;  2JSP A;  1F5T A;  3N97 A;  1KON A;  3CWR A;  2O7O A;  3E3V A;  1OJL A;  2R7Q A;  1JKR C;  3BPX A;  1G4D A;  2UXH A;  2I8D A;  3KZY A;  4HW0 A;  2QBY A;  4DYR A;  1TLH B;  5DCM A;  3LSI A;  4ENK A;  4A3G J;  4KMF A;  5FD5 A;  5J1U A;  4KJZ A;  5BS6 A;  4YIR X;  4Y3O A;  2P7C B;  1N77 A;  2GA2 A;  2YVX A;  2LMD A;  3ZP5 A;  1QHH D;  1UMQ A;  1EKE A;  2ZME B;  3HKZ N;  5IY5 H;  4L0Z B;  1T08 B;  1USS A;  5JI6 A;  1S7E A;  2O0Y A;  5D5X B;  1IJW C;  5D19 A;  1TWF J;  2HZD A;  2DOF A;  4AF5 A;  2EV6 A;  2R7S A;  1NTC A;  5E8I A;  3BR5 A;  1JUM A;  2FOK A;  4D0P A;  2HQ5 A;  3R4K A;  1YFH A;  2IS2 A;  1UI6 A;  4NC7 A;  3VW1 A;  3S2D J;  3MCZ A;  3NQO A;  1D8J A;  5AIP A;  3C2H A;  2COB A;  2L02 A;  2IA0 A;  3BJ6 A;  1Z3Y A;  2ZOZ A;  1JJ6 C;  3AFH A;  5CVU A;  2DOA A;  4KT5 C;  4AD9 A;  3L1P A;  1P6R A;  1XD7 A;  5C4Y A;  1B59 A;  2MD5 A;  3K4L A;  1MDM B;  4CH7 A;  9ANT A;  3HOW J;  1R5H A;  1FP2 A;  1U3E M;  1XTA A;  3QYB A;  2XSJ C;  2XVC A;  1JT6 A;  3CP8 A;  4JBA A;  3W2V A;  3JSO A;  1WI9 A;  1RKW A;  2XF7 A;  1ZR4 A;  3FIW A;  3DKX A;  4AID A;  5ICG A;  1IC8 A;  4F92 B;  1OLT A;  1ETW A;  5HNF A;  1I1S A;  4PUS A;  3LSG A;  1OCP A;  4DW6 A;  5FLX K;  1FLI A;  4E70 A;  4IQ4 A;  4LIV A;  5FRN A;  2HQR A;  4YG2 F;  1SEU A;  4XLC A;  1B9M A;  1Z7U A;  3BG9 A;  3MMY B;  1I5Z A;  1SAN A;  2BW3 A;  4I7H A;  2YUS A;  5BQT A;  5LGU A;  2G7G A;  1GV2 A;  2MW8 A;  3KYC B;  4Y33 A;  3CJQ B;  5KNL A;  2X85 A;  1XGO A;  3I59 B;  1JUS A;  3KP2 A;  2QYO A;  3BG5 A;  1O57 A;  4CIC A;  4BE2 A;  4FAS D;  3CJD A;  2RVC A;  3OY9 A;  1B9N A;  2HYF A;  2DMT A;  1G6N A;  4I09 A;  4N4N B;  1R5G A;  3SFI A;  4IXA A;  3CCE I;  3I56 I;  3S16 J;  3IKT A;  1C0W A;  5HNH A;  4FHT A;  4M6Y A;  1H9G A;  2DMU A;  2YVH A;  2Z16 A;  2ETH A;  2V79 A;  3GFL A;  3PJR A;  4D5F A;  2EH3 A;  3DBR B;  2L2O A;  2AHQ A;  2DT6 A;  2E2J J;  2VOP A;  4EVI A;  4ZJZ A;  1BW6 A;  1NH3 A;  5FKL A;  5F1R A;  2IGK A;  2HGC A;  3ECH A;  4TV7 A;  4MO7 A;  5HDN A;  4E7Z A;  1MMA A;  3ZQH A;  3J7Y J;  3TQN A;  1UB9 A;  3CCR I;  1K61 A;  2ECC A;  1AKH B;  1YYV A;  1IN8 A;  5D6F A;  2TDX A;  2VKE A;  3WU1 B;  3S8P A;  4CHU A;  2EZH A;  2L4M A;  2RNG A;  2B0L A;  2P0W A;  3FIS A;  2HS5 A;  1XC5 A;  5H6Q A;  3ERE D;  4D1Q A;  1X4O A;  2IU5 A;  4UHT A;  1FX7 A;  3PFI A;  3CCU I;  4A3B J;  5CVR A;  2F4I A;  3VYU B;  1DU0 A;  3HGG A;  4HLX A;  1GUU A;  1ZGW A;  3CRJ A;  4CUG A;  4AWX B;  3BWG A;  2VC1 A;  5GTH C;  3H36 A;  2XF6 A;  2FD5 A;  2LDU A;  1BJA A;  3Q0W A;  4HDV A;  4M73 A;  2GAU A;  2CJJ A;  4HQM A;  3ANG A;  2F48 A;  4RA2 A;  2AQF A;  4S05 A;  1RC9 A;  5KAF C;  2P5L C;  3QOD A;  5FLV A;  2NX4 A;  2E34 A;  3QYF A;  3EQL F;  2MH2 A;  2QA4 I;  3GWZ A;  1R1T A;  2ZJ2 A;  2QIB A;  1EH6 A;  1B8I A;  4HST A;  4C2U A;  4BDY A;  2P81 A;  4UY8 I;  3W3C A;  4EMS A;  3CCJ I;  4DZP A;  2G9W A;  2ELJ A;  2YS9 A;  1K83 J;  4UXN A;  2HR3 A;  5D5U B;  1MBH A;  2GLO A;  1LE8 B;  2KRF A;  1MH4 A;  5FKN A;  4I6Z A;  2UZK A;  1FZP B;  2C6Y A;  1S9H A;  4CO8 A;  1IN5 A;  5B3S H;  3GZI A;  2LKS A;  5DEQ A;  3F0C A;  1UG0 A;  3P9I A;  1OCZ H;  4C2M A;  4NNJ A;  1Y0U A;  2GIV A;  1PVE A;  3C7J A;  1P2F A;  3E6M A;  4U9N A;  4IZZ A;  1YJ9 I;  4XRF A;  3CD6 I;  3G56 A;  2EZL A;  3CCV I;  3PNT A;  3VSL A;  2EIJ H;  2HTJ A;  1U5T B;  5GAE J;  2P4W A;  2OTL I;  1FYM A;  3IH2 A;  4G7O F;  3T0Y A;  2QBY B;  2HQN A;  2DA5 A;  2MYS A;  3I53 A;  2WTE A;  3NWS A;  5TRD A;  1IUF A;  4N9H A;  4OD4 A;  2CO5 A;  2R5Z A;  3LFK A;  3RH2 A;  3B81 A;  1HF0 A;  3CQZ J;  1K78 A;  5K58 A;  2FBI A;  4GCK A;  1IGN A;  4I02 A;  5EZH A;  1VND A;  4PJM A;  4FIS A;  4CA0 A;  3LSR A;  1IRG A;  5L3E A;  4GYG A;  3QPL A;  4MQV A;  4XOR A;  4PZJ A;  4WXD A;  2R4G A;  3HOV J;  3PQK A;  5D8L B;  1O3R A;  4BAY A;  5DCM B;  1IDZ A;  1WGX A;  3ELK A;  3FDY A;  3HOX J;  1JHF A;  2EA4 A;  3T8R A;  1K7A A;  2KDZ A;  1L0O C;  5FGM A;  1Z7L A;  3L2R A;  3GTL J;  3H3U A;  5KVR A;  4OOI A;  2UXN A;  4BEH B;  3J81 K;  2Y30 A;  1A6Q A;  1BR2 A;  3H35 A;  3K4N A;  5HS7 A;  5ILS A;  2FBH A;  5JLW A;  3V8L A;  1D1A A;  3O2P E;  3WGI A;  4RBO A;  4Y17 A;  2DK8 A;  2ZCX A;  1FTT A;  1KU2 A;  1ETQ A;  3PPB A;  3FXM A;  1MMD A;  1RZ4 A;  2L01 A;  4MFD A;  1IV8 A;  1ITY A;  2W82 A;  1MBK A;  2LRE A;  2QQ9 A;  5B66 C;  3JCU C;  2UWM A;  1TTY A;  2DO7 A;  2R7W A;  2XKO A;  2Y0S A;  2I10 A;  3K4K A;  4C9Y A;  3F22 A;  4CXF A;  2XRO A;  2CW8 A;  4DZJ A;  3GZ6 A;  3A1Y A;  2DI3 A;  4MFE A;  4Y15 A;  5LRR A;  4WK8 F;  1GXQ A;  4I0A A;  3DF8 A;  3K4J A;  2OBP A;  3AQS A;  2E1M C;  2F5F A;  1FTZ A;  1QZZ A;  4ZYA A;  2F4M B;  3FRQ A;  2BY1 A;  4E6K G;  4XRS G;  5D1R A;  2IXS A;  2LD5 A;  3GX4 X;  2QLZ A;  1OR7 A;  2MC4 A;  1K6O A;  3SEZ A;  3JR9 A;  3C07 A;  5HSZ A;  1LVK A;  1QQI A;  1XN7 A;  2ZSH B;  4QTR A;  4UUS A;  2R5Z B;  1ACI A;  1I6H J;  2OUM A;  1ZHF A;  2XAG A;  5C4J J;  3IRQ A;  2D5V A;  1JKP C;  4YFK F;  1YRN A;  1UI5 A;  2E71 A;  1XPX A;  1JKQ C;  4OWR B;  1UHM A;  3RIR A;  3DU6 A;  2VT2 A;  2O9L A;  2CGP A;  2ELH A;  3PO2 J;  3Q0V A;  2D6Y A;  1HW5 A;  4AIK A;  5KK1 A;  3FXU A;  2VJI A;  3CDL A;  4RM2 A;  2O03 A;  2OV7 A;  2Y9Z A;  2GM4 A;  4I2O A;  3NWT A;  3GTJ J;  3EUP A;  4Y13 A;  2O7T A;  3GLX A;  4CGZ A;  4A3C J;  1R1U A;  1G59 A;  2Q1Z B;  3IV5 A;  2JVG A;  4MTD A;  2BVL A;  2QM3 A;  3TGN A;  3ZMS A;  4MLO A;  3Q9S A;  4P96 A;  2IS6 A;  4HEA 2;  1BM9 A;  1R00 A;  4UVA A;  3F8B A;  2IA1 A;  2K4B A;  2GQQ A;  1PP8 F;  3TO9 A;  1MBJ A;  2M7B A;  3BR0 A;  1D1B A;  3CCL I;  3QU6 A;  2PX9 A;  3RPU D;  1PUE E;  1E3H A;  4E7I A;  2LBF A;  3G1O A;  5LHH A;  3VYR B;  2LLK A;  2ZO4 A;  5DUK A;  3HL2 A;  1Y1W J;  4LIU A;  5IOZ A;  4ITV A;  3ZQQ A;  2Y9Y A;  1BIA A;  4UB8 C;  3HJE A;  1LNW A;  1JXS A;  2WAQ A;  3GFM A;  2IEK A;  4YFX F;  3NI7 A;  1M1E B;  3A02 A;  1D0Y A;  4ICH A;  2A05 A;  4AVZ A;  1LFU P;  5ILV A;  2CV2 A;  2M8E A;  4G7H F;  3FHZ A;  3QPH A;  4H0E A;  2F5E A;  5K7F A;  2GEN A;  3LA7 A;  2O6G E;  3U21 A;  4HQE A;  2IP2 A;  1T8I A;  2XDV A;  2CFX A;  1W5S A;  3B73 A;  5J1Y A;  4FX0 A;  1HKQ A;  1WJD A;  2QQB A;  1UFM A;  3C18 A;  3GEZ A;  2P8T A;  3IH3 A;  3B02 A;  3VOK A;  2CSO A;  2L9R A;  2UXX A;  1KU9 A;  2IT0 A;  3DPU A;  1RIO H;  3DTI A;  3VEP A;  4XRS A;  1FY7 A;  4IHW A;  1TC3 C;  4V19 K;  1TWA J;  1FBS A;  4CDG A;  1YOV B;  1JUP A;  4I98 B;  4IKF A;  2JK3 A;  2JPB A;  2X48 A;  3GUD A;  1WRJ A;  3ERM A;  3M9A A;  2A5Y B;  4C2T A;  2XV4 S;  4QIW N;  3X2Q H;  5D6E A;  2BXY A;  2X1C A;  4U87 A;  1ZAO A;  2D1H A;  2GOX B;  4C3H J;  2BE5 F;  5J8C A;  2QKM B;  4WCG A;  2HVR A;  4ZYE A;  4KIF A;  1FOW A;  1KU7 A;  3E5Q A;  1QGP A;  1AU7 A;  5DYM A;  1A5J A;  3FKJ A;  3KIO A;  3QP5 A;  1TQP A;  3EUH A;  3TW6 A;  4G94 A;  2YVE A;  1H0M A;  1F9N A;  3CJN A;  2W57 A;  1K78 B;  3RZO J;  3FWE A;  1HQC A;  2YSR A;  3VTI A;  5DDG A;  5BPI A;  4DBQ A;  2VLA A;  3B6C A;  1WKM A;  2RAE A;  1H88 C;  2OD5 A;  3OR1 C;  3JSP A;  5C3E J;  1TWG J;  4RAZ A;  2FML A;  3HHG A;  3MKL A;  3JRD A;  2DA6 A;  3L2W A;  1T0F A;  3BG6 A;  2DA1 A;  2DFI A;  2VKD A;  3H3V K;  3DBL B;  4XLN F;  4G12 A;  2XAQ A;  2ESH A;  3D5R C;  3KP3 A;  5FFZ A;  3JAM K;  5D4R A;  1PJR A;  5DAJ A;  2P6T A;  1LKX A;  4RM3 A;  4QPQ A;  1O7F A;  2CV1 A;  3GLL A;  2KZG A;  1IXR C;  1WCM J;  2UXU A;  4GCV A;  1DPR A;  3LSM A;  4PJN A;  4FE4 A;  3DWL E;  4AM3 A;  2FUG 2;  4CCL A;  2DFF A;  2KPM A;  2EIK H;  1AA7 A;  4HA8 A;  2R92 J;  1TBX A;  1I39 A;  4BXU A;  1S3J A;  4XNF A;  4EJT A;  2M2E A;  3AG4 H;  2XC7 A;  1MBG A;  4RB2 C;  1O3S A;  4RMN A;  5LBQ A;  3NRG A;  1ZGA A;  2W00 A;  4UV8 A;  1AHD P;  4L18 B;  2REK A;  3BP8 A;  1MW7 A;  3G4S I;  3HXL A;  1K79 A;  3GVA A;  1X1P A;  1Y56 A;  3BY6 A;  1OFC X;  3RJP A;  3VYS B;  1FJL A;  4XN0 A;  5JHF A;  1OR7 C;  2CH0 A;  5ICE A;  1BL0 A;  1FIP A;  3M4O J;  3A2K A;  5M3F J;  2AXL A;  1FYK A;  2Q8K A;  1T2K A;  1I27 A;  4RS8 A;  3ASN H;  2FEZ A;  1I3A A;  3BR3 A;  4WXC A;  3OR2 C;  1CGP A;  2LG4 A;  1O3Q A;  4A3D J;  3ZQG A;  1CF7 B;  1YRN B;  5FD6 A;  4A3K J;  4YEL A;  5B1A H;  4XSZ F;  3FXJ A;  1DP7 P;  4BXX J;  3SHF A;  2XIG A;  1Z21 A;  2R93 J;  1XDU A;  3MWM A;  3ZQI A;  5GAH J;  2KJC A;  2JMW A;  5FKO A;  3RSN A;  1J0R A;  1ZG3 A;  4HSR A;  4DVY P;  4RAF A;  2GXA A;  2G7H A;  2EZI A;  1L3L A;  2OA4 A;  5F64 A;  1LFB A;  1GT0 C;  1EH8 A;  4PJ0 C;  4WX9 A;  1HLV A;  1R22 A;  5M5X J;  4JP0 A;  2DYS H;  1IRX A;  3HE0 A;  2HU9 A;  2HKU A;  4LLL A;  1Z67 A;  4IRH A;  2PJR A;  2QSF X;  2QWW A;  2HXO A;  2WAE A;  4H4K C;  4IVN A;  3NNR A;  1YW9 A;  3JRH A;  1SVL A;  2VJJ A;  3WG9 A;  1MJA A;  3LJL A;  1GVD A;  3OYM A;  3U2R A;  3CUQ B;  4A3E J;  1MSE C;  2NRA C;  3GTP J;  3BJB A;  2EFQ A;  5BOX A;  2QSG X;  3DBH B;  4M3B A;  3ESW B;  4E7K A;  1V5F A;  2Q2E A;  4LMY A;  2V1N A;  2ZNZ A;  1TT0 A;  3S3O A;  3K1N A;  1RI7 A;  1J75 A;  3SFZ A;  3VB2 A;  5ED4 A;  3IWF A;  2XPV A;  4U0Y A;  4CGR A;  1O4X A;  2RRE A;  1TWH J;  2XSD C;  2O8K A;  4X0G A;  3QP6 A;  5EJC A;  1HCR A;  1ZGJ A;  4V2F A;  1MDM A;  3R61 A;  2A5W A;  2L4A A;  1YX3 A;  1B72 B;  4NN1 A;  4BAC A;  3CP2 A;  1VQ7 I;  1HDP A;  1YW7 A;  4JK1 X;  3CDH A;  3RDI A;  2YU9 J;  2QCO A;  2VJ4 A;  1SAU A;  5M3M J;  3O3K A;  5TIS C;  2M8G X;  1ZH5 A;  4UDS A;  4HX8 A;  3ZXS A;  3ZMD A;  5J40 A;  2JVH A;  1WI3 A;  3HRM A;  2DMQ A;  2QGU A;  3A0H C;  3BZ6 A;  3EYY A;  4DNC A;  1QZY A;  4RGS A;  5DUI A;  3H0D A;  4OIN F;  2D1V A;  2M4K A;  4B3X A;  2FQ3 A;  2K5C A;  1QPI A;  1MSF C;  1ZTR A;  2YU3 A;  1XMK A;  3HRT A;  2JUG A;  1T33 A;  5B5E C;  4RGX A;  4LB5 A;  3COL A;  1W4M A;  1D3Y A;  3FXQ A;  3RYR A;  1YJN I;  5F0C A;  2M45 A;  3WU0 A;  2CQ7 A;  3KEY A;  3DEE A;  3K69 A;  4BQQ A;  1VF9 A;  1G3S A;  2FX0 A;  3DP7 A;  3WOD F;  4NC8 A;  3GZN B;  5H2F C;  2HVS A;  4NC6 A;  3CCY A;  3H1C A;  2PLY A;  4RAG A;  2HZT A;  1OQY A;  4HF2 A;  5A2Q K;  5L3G A;  1GXP A;  2DA3 A;  4OD5 A;  3QPS A;  3C1D A;  2LY1 A;  3VVX A;  4Z6Y A;  3L2Q A;  3HDD A;  3BRU A;  1J2X A;  4J01 A;  1LVA A;  5J4V A;  2MAB A;  3CC2 I;  4BL0 B;  2K02 A;  2ZCM A;  2EFW A;  2VOO A;  2KHM A;  1TWC J;  2VPL A;  3HTS B;  2Y75 A;  1OMI A;  3WTY C;  2DBB A;  4DGW B;  4AU7 A;  1V54 H;  1DQU A;  3F6V A;  1V55 H;  1YTY A;  2A07 F;  2EZK A;  3G2B A;  2LSO A;  3I71 A;  1DGW Y;  3HM5 A;  1MNM C;  2DT7 B;  1O3T A;  3E0J B;  2CQQ A;  2JZY A;  1H8A C;  1K4T A;  3A4C A;  2NVT J;  1UJ8 A;  2I5U A;  3ZQF A;  2K9Q A;  3EET A;  2IAI A;  2EFO A;  4A3M J;  2E2H J;  2XPU A;  3BTC A;  2FQ4 A;  4E7S A;  3J80 K;  1D5Y A;  2JRT A;  4MIM A;  2DMN A;  3WU2 C;  4IHS A;  3W2W A;  2QUF A;  1SD7 A;  4ENM A;  3K4B A;  2FXA A;  2PEX A;  4A0X A;  3OYB A;  1ON2 A;  3RQ4 A;  4AVP A; 
#chains in the Genus database with same CATH homology
 3JRF A;  1IUF A;  1QVT A;  4DYQ A;  2R5Z A;  3UKG A;  1LE8 A;  3NAU A;  1ETO A;  4KWA A;  3RH2 A;  3DEW A;  3B81 A;  1HF0 A;  3CQZ J;  3JRE A;  4AUX A;  5K58 A;  4GCK A;  2ZOY A;  2WAQ N;  1IGN A;  5EZH A;  1VND A;  1ZK8 A;  4FIS A;  4NDL A;  1RET A;  3LSR A;  2L7M P;  2WUI A;  1FEX A;  3QPL A;  2XGD A;  3BR6 A;  3HOV J;  2QTQ A;  5H9T A;  4GCL A;  3BNI A;  2NS8 A;  3NAR A;  3V78 A;  1FIA A;  4XRM A;  1IDZ A;  4JKZ A;  5EG0 A;  1WGX A;  3HOX J;  5K7Z A;  4I76 A;  2VI6 A;  2ME0 A;  2R5Y B;  2KDZ A;  2DG7 A;  1ETX A;  3PAS A;  3BTL A;  3GTL J;  2Y30 A;  2Y31 A;  1T56 A;  1BJZ A;  5JLW A;  3VVZ A;  5FLM J;  4JX4 A;  2K40 A;  2DJN A;  4XIC A;  4RBO A;  4M3F A;  4BBS J;  2M9H A;  1FTT A;  2ZCX A;  1ETQ A;  3PPB A;  3C2B A;  1IG7 A;  2TCT A;  1SFO J;  4MFD A;  1VFC A;  3GTQ J;  1ITY A;  4M6V A;  5FGL A;  1MBK A;  1P7I A;  4D5C A;  2DTZ A;  5HBU A;  5HOD A;  4AC0 A;  1X58 A;  2VPR A;  1H89 C;  2I10 A;  5IP6 A;  3BCG A;  2G7S A;  3O8G A;  3S15 J;  1RKT A;  5EGO A;  5J1R A;  2R0Q C;  4DZJ A;  2CUE A;  3CMY A;  3S1M J;  1XS9 A;  3EGQ A;  4MFE A;  2LP0 A;  1U9O A;  3G1L A;  2R5Y A;  4PXI A;  5EZG A;  3I4N J;  5IP9 J;  5M5W J;  1ZKG A;  5EF6 A;  3ON2 A;  3LSJ A;  3AQS A;  1F36 A;  1FTZ A;  3HTA A;  3HOY J;  1AKH A;  3FRQ A;  3GTG J;  2CU7 A;  2QOP A;  1MH3 A;  4UUS B;  4X6A J;  5D1R A;  4XRS G;  2LD5 A;  2CUF A;  2ECB A;  3C07 A;  3JR9 A;  1A6I A;  2HOS A;  2NP3 A;  3HTI A;  5EFY A;  3SDG A;  5HSZ A;  3K2A A;  4D7N A;  3DPJ A;  4JNN A;  4QTR A;  4UUS A;  2R5Z B;  1I6H J;  5C4J J;  4IHX A;  2D5V A;  3GTK J;  1JKP C;  1YRN A;  4A93 J;  1UI5 A;  2F07 A;  3VP5 A;  1JKQ C;  3GTO J;  3OOU A;  4X1E A;  5FJ8 J;  5IPA A;  5F27 A;  2O9L A;  5IP7 J;  3PO2 J;  3Q0V A;  2D6Y A;  2G0E A;  4GFB A;  3ZQL A;  2DA4 A;  2DA2 A;  2JA6 J;  3CDL A;  3VIB A;  2Y9Z A;  2GM4 A;  3EUP A;  2K9S A;  3GTJ J;  2HDD A;  1IDY A;  3RKQ A;  3V6G A;  4GCT A;  2O7T A;  3Q3S A;  5J3L A;  3MVP A;  4A3C J;  2L0K A;  4AC6 A;  1GDT A;  2NVY J;  2LVS A;  1MBE A;  1Y1V J;  3IV5 A;  2VUM J;  2Q24 A;  4MLO A;  4A3F J;  2RHA A;  2G3B A;  3JRG A;  4MK6 A;  1IV6 A;  4S0H B;  2W53 A;  1B72 A;  3TP0 A;  3OSF A;  2NVQ J;  3BTI A;  2ZCN A;  2GUH A;  1POG A;  1MBJ A;  2XGE A;  3NXC A;  3S5R A;  3BR0 A;  2DG8 A;  1WPK A;  1Z77 A;  3BG3 A;  2H1K A;  4W1U A;  3G1O A;  5EGO B;  3A01 A;  1QRY A;  2LLK A;  1Y1W J;  2E2I J;  1NK3 P;  5IOZ A;  1U78 A;  3W6V A;  2Y9Y A;  2N8G A;  2KT0 A;  1PUF B;  1VI0 A;  3FKI J;  2IEK A;  3I4M J;  3LOC A;  1JJ8 C;  2QWT A;  3A02 A;  2LFB A;  3NI7 A;  4ICH A;  3PO3 J;  1ZR2 A;  5AQC A;  4GFL A;  3TED A;  5EEA A;  1LFU P;  5FMP A;  3FK7 A;  2XDN A;  3KZ9 A;  5K7F A;  2LR8 A;  2GEN A;  3GBG A;  3KNW A;  3E7L A;  3GEU A;  2LK2 A;  2MSY A;  3QKX A;  4W97 A;  1JTX A;  5J1Y A;  2UXO A;  1OCT C;  2R7Z J;  5FKK A;  3HTJ A;  3IH3 A;  3TP3 A;  2NS7 A;  4EEF G;  3VOK A;  2L9R A;  3LWJ A;  4MXM A;  1ENH A;  1U9N A;  4ACI A;  2LKX A;  2QKO A;  2QF7 A;  4XRS A;  3BT9 A;  3SJM A;  4IHW A;  1TC3 C;  1TWA J;  2HOA A;  3BTJ A;  1JUP A;  2JK3 A;  4BY7 J;  4ME9 A;  2X48 A;  3O60 A;  1R9T J;  4A3L J;  3T6N A;  1ETY A;  4QIW N;  3S17 J;  4IEJ A;  2JJ7 A;  2PZ9 A;  2V57 A;  4C3H J;  4FTH A;  4V2G A;  2XB0 X;  4CYC B;  3ZQC A;  1ZQ3 P;  1Z0X A;  5GPC A;  2WB1 N;  5F04 A;  2M34 A;  5JLX A;  2ME6 A;  1AU7 A;  5EG0 B;  1A5J A;  4ABZ A;  3BQY A;  3S14 J;  2K9N A;  1UG2 A;  3JRA A;  3TW6 A;  1JTY A;  3MN2 A;  2XPW A;  4B1R A;  1QVU A;  2YVE A;  4QSH A;  2W48 A;  3RQI A;  2GBY A;  4UUT A;  4FCY A;  5M5Y J;  1U8B A;  3JRI A;  4HKU A;  3LNQ A;  2WGB A;  3HTH A;  5BNG A;  3RZO J;  4BBR J;  2EQR A;  4XID A;  2CRG A;  2MGQ A;  4A3J J;  2TRT A;  5F0F A;  3VW0 A;  1BA5 A;  3ON4 A;  1UHS A;  2AO9 A;  3BQZ A;  4A69 C;  3B6C A;  1H88 C;  5GPA A;  2RAE A;  5IYD J;  3S1R J;  2XGC A;  2H8R A;  5C3E J;  3G1M A;  1W0U A;  1TWG J;  4YZE A;  5C4X J;  3PM1 A;  3HB9 A;  4M3D A;  3MKL A;  3JRD A;  2DA6 A;  4C3I J;  2DA1 A;  3Q0U A;  3H3V K;  1X2M A;  4G12 A;  2UXP A;  4JX6 A;  4C2M J;  4Y7N J;  2E19 A;  1APL C;  5DAJ A;  5E3N A;  3JRC A;  1IRZ A;  3JSJ A;  3BHQ A;  3ANP A;  2DMP A;  3HEF A;  1HDD C;  1WCM J;  3TW7 A;  3OSG A;  1JKO C;  2UXU A;  5HAW A;  1JGG A;  4FE4 A;  4IHY A;  2ZB9 A;  3KKC A;  2R92 J;  5IYC J;  3A03 A;  3WHB A;  2JA7 J;  5CXI A;  3D1N I;  2ELK A;  2M2E A;  4BKX A;  2WV1 A;  2OER A;  1MBG A;  4LOC A;  5C44 J;  3NRG A;  5DTD A;  1AHD P;  3H0G J;  3LHQ A;  2REK A;  3CWR A;  2O7O A;  1OJL A;  1FJL A;  2UXH A;  1Q1V A;  1OFC X;  3S2H J;  4DYR A;  1BL0 A;  2GFN A;  3M4O J;  1FIP A;  4A3G J;  2OI8 A;  5E3O A;  5M3F J;  5J1U A;  3MNL A;  4NEL A;  1MBF A;  1UMQ A;  3E7Q A;  4JL3 A;  3HKZ N;  3BR3 A;  4L62 A;  1JT0 A;  2E1O A;  1RR7 A;  4JYK A;  4M3E A;  2OF7 A;  1S7E A;  1IJW C;  5D19 A;  4AF5 A;  1TWF J;  4A3D J;  2MG4 A;  3M3Y J;  3ZQG A;  1YRN B;  4A3K J;  1NTC A;  3BR5 A;  1JUM A;  3P9T A;  2NP5 A;  2HQ5 A;  1UI6 A;  4BXX J;  3VW1 A;  3S2D J;  1RPW A;  2COB A;  2R93 J;  3ZQI A;  2ZOZ A;  1JJ6 C;  2JMW A;  3KKD A;  2HI3 A;  5FKO A;  3L1P A;  5C4Y A;  9ANT A;  1G2H A;  2EZI A;  3HOW J;  5FKM A;  4A3I J;  1LFB A;  2XB5 A;  1JT6 A;  1F43 A;  3O8H A;  5K7H A;  3VPR A;  1GT0 C;  1RKW A;  1ZR4 A;  3FIW A;  1ETK A;  1HLV A;  5EYR A;  1EF4 A;  3ZOB A;  2JWT A;  1IC8 A;  1ETW A;  5M5X J;  2L7F P;  4JP0 A;  3LSG A;  1OCP A;  4DW6 A;  1E3O C;  3F1B A;  4FE7 A;  4AYB N;  3HE0 A;  3HOZ J;  1SGM A;  2X9D A;  2HKU A;  2ID6 A;  5EDN A;  2HXO A;  2RAS A;  3NNR A;  3JRH A;  3BG9 A;  4XK4 A;  1SAN A;  2YUS A;  2G7G A;  3LJL A;  5CW8 A;  1GV2 A;  2MW8 A;  1GVD A;  5F1J A;  4A3E J;  1MSE C;  4M3G A;  1HOM A;  4J19 A;  3AQT A;  3GTP J;  4B3A A;  1JUS A;  3BJB A;  3BG5 A;  2G7L A;  5FHP A;  5GP9 A;  4M3B A;  1I50 J;  3CJD A;  3BR1 A;  1I3Q J;  4BY1 J;  2B63 J;  2DMT A;  5IOY A;  5D18 A;  1XG1 A;  2HYT A;  1NK2 P;  2XPV A;  3SFI A;  4CGR A;  1O4X A;  2DN0 A;  1TWH J;  4Y52 J;  2XSD C;  1X2N A;  3S16 J;  2O8K A;  3RZD J;  1HCR A;  1BW5 A;  3B6A A;  2HYJ A;  4V2F A;  2IBD A;  2LY9 A;  3QQA A;  2DMU A;  3WHC A;  2YVH A;  2HXI A;  4L5E A;  1B72 B;  4NN1 A;  4D5F A;  2EH3 A;  2X6O A;  2AHQ A;  2E2J J;  1HDP A;  2YU9 J;  2QCO A;  1BW6 A;  5FKL A;  5M3M J;  2M8G X;  3NPI A;  4UDS A;  4MO7 A;  1P7J A;  5F0H A;  4IHV A;  3A01 B;  3HOU J;  3HIM A;  3ZQH A;  1K61 A;  2ECC A;  3IH4 A;  1AKH B;  2PBX A;  1WI3 A;  2DMQ A;  1JKR C;  3JRB A;  2L7Z A;  2VKE A;  1PUF A;  3GTM J;  2FJ1 A;  2EZH A;  1ORK A;  5E3L A;  1QPI A;  2Y2Z A;  1MSF C;  1ZTR A;  2NOG A;  3FIS A;  2FBQ A;  1XC5 A;  3VUQ A;  2LTP A;  1T33 A;  3COL A;  2IU5 A;  2NVX J;  4GFK A;  2JA8 J;  2UXI A;  3VVY A;  4RDU A;  4A3B J;  5F0C A;  2XRL A;  1ETV A;  1DU0 A;  3HGG A;  3QBM A;  1GUU A;  1ZGW A;  2JN6 A;  3CRJ A;  3VOX A;  1VF9 A;  3FK6 A;  2FD5 A;  2FX0 A;  3DCF A;  3Q0W A;  3OIO A;  1CQT A;  2CJJ A;  3ANG A;  3CCY A;  1B8I B;  4JX5 A;  5E3M A;  1W0T A;  1WH5 A;  2JA5 J;  5FLV A;  2DA3 A;  2NX4 A;  3QPS A;  3RD3 A;  3VVX A;  3HDD A;  3BRU A;  2PMZ N;  2QIB A;  2VKV A;  1B8I A;  3LSP A;  2ZCM A;  2P81 A;  1TWC J;  3VW2 A;  1GV5 A;  4DYC A;  4HNV A;  4DZP A;  2YS9 A;  1K83 J;  1DU6 A;  1MBH A;  3IUV A;  2EZK A;  2GLO A;  3HM5 A;  1MNM C;  1LE8 B;  2HOT A;  2EBI A;  5FKN A;  1MH4 A;  2OPT A;  3BR2 A;  3K7A J;  4I6Z A;  2CQQ A;  1H8A C;  3GZI A;  5F08 A;  5IYB J;  4C3J J;  3F0C A;  5CXG A;  2NVT J;  5DS9 A;  3ZQF A;  2K9Q A;  1WH7 A;  2IAI A;  4D7M A;  4A3M J;  2E2H J;  2ID3 A;  2XPU A;  3G56 A;  3BTC A;  2EZL A;  2FQ4 A;  1D5Y A;  4MIM A;  2DMN A;  3S1N J;  3HBL A;  3IH2 A;  4CYC A;  2DA7 A;  2CQX A;  2M0C A;  3S1Q J;  3G7R A;  1RES A;  2Y0S N;  2DA5 A;  4B4C A;  3HGY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...