3BT9A

Crystal structure of qacr(e57q) bound to dequalinium
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIQESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator qacR
publication title QacR-cation recognition is mediated by a redundancy of residues capable of charge neutralization
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 78
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2007-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3bt9A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3bt9A02
1H88C 2UXUA 2EZKA 1FJLA 2ID3A 2ELKA 5E3MA 4YZEA 3BNIA 3P9TA 2V57A 2EQRA 1ETKA 3AQSA 3MVPA 2WAQN 1B8IB 1CQTA 1RPWA 3BR5A 3HTHA 4XRMA 5M5XJ 3JRCA 3G1MA 4DW6A 2OPTA 4FCYA 3Q0WA 1I50J 4GCTA 3GTKJ 4W1UA 4JKZA 3QPSA 4CYCB 3S14J 4FTHA 3S2DJ 2NX4A 2LKXA 2CJJA 3LSRA 3CRJA 4B4CA 2MGQA 1MSEC 5CXGA 5K58A 5IYBJ 2EH3A 2MG4A 2G3BA 1JKPC 4GFKA 4W97A 3ON2A 2JA8J 3KNWA 5GPAA 3ANGA 3QKXA 4RBOA 3FRQA 1AU7A 1LFBA 2LK2A 3F0CA 1OCPA 2JA5J 2G0EA 3VOXA 1FTZA 3GTJJ 4GFBA 2FBQA 4D5CA 1HLVA 3HTJA 2XB5A 3PM1A 4MXMA 2NVXJ 5IOZA 3L1PA 3GTQJ 2WUIA 3K7AJ 2HI3A 3G1OA 1LE8A 5H9TA 5D18A 1OCTC 2G7GA 2HOAA 2DMPA 3W6VA 3KZ9A 2R92J 3TP3A 5K7FA 1LFUP 1R9TJ 4HKUA 1DU0A 2GUHA 1MBKA 2AO9A 4MFDA 4M3DA 3Q0UA 4AUXA 3GTMJ 3TW7A 4L5EA 1GV5A 1T56A 4EEFG 3IH4A 3S1MJ 3DPJA 3AQTA 1ORKA 2IBDA 3OOUA 1H8AC 2XSDC 3Q0VA 1BW6A 2F07A 2FX0A 4UUSA 2GLOA 3S1QJ 3NNRA 5EGOB 2Q24A 1UMQA 4BY7J 3VP5A 3BTCA 4DZPA 4ABZA 5EZHA 5J1YA 2WB1N 5IYCJ 2R5YB 3HE0A 3VIBA 3PASA 2REKA 3IH3A 5J1UA 2TRTA 5F0CA 3VUQA 1JTXA 5C4XJ 4D7NA 2EZHA 3BR3A 2YVEA 4XRSA 2ZCMA 1K83J 2N8GA 3KKDA 3V6GA 1MBFA 1JUMA 4GFLA 3B81A 1ZGWA 3RD3A 5C4JJ 4UUTA 3LWJA 1RKTA 2Y2ZA 5K7ZA 3RKQA 3LSPA 3G56A 5FKKA 2EZIA 5K7HA 2XPUA 3WHCA 5FGLA 2LLKA 4A93J 5JLXA 4IHWA 4QTRA 1APLC 4A3LJ 1FIAA 2IU5A 4B1RA 2COBA 5M3MJ 4S0HB 1MBJA 4PXIA 5EF6A 1XS9A 1IGNA 3GTPJ 3HTAA 5DTDA 3CQZJ 3RZOJ 2HXOA 2LFBA 2W48A 2PMZN 4JX6A 3JRFA 1ETYA 2R0QC 1ZKGA 2VI6A 1AHDP 1Z77A 2NS8A 1MBGA 1WCMJ 4IHVA 3HOYJ 1ITYA 1W0UA 3LNQA 4XIDA 5BNGA 1QPIA 1HDPA 3HGGA 1U9OA 5E3LA 1OFCX 4NELA 2JK3A 3C07A 1JJ8C 2D6YA 1F43A 4UDSA 4HNVA 3ZOBA 3Q3SA 3HDDA 2R5ZB 4LOCA 2CUFA 3FK7A 3DCFA 1ZQ3P 3RH2A 3QBMA 4DZJA 1P7JA 4DYCA 4D7MA 4ME9A 2R7ZJ 5E3NA 3JR9A 2CUEA 3LJLA 2EBIA 2GENA 2NS7A 2JA6J 1ETWA 2VUMJ 2QTQA 2XGDA 3EUPA 2L7MP 2UXPA 5D19A 3HM5A 3HOZJ 2DMTA 1TWHJ 2KT0A 3H3VK 2OERA 5F0FA 1U9NA 1LE8B 3BHQA 2L0KA 3IV5A 2IEKA 3LSGA 1YRNA 3E7QA 4Y52J 4A3CJ 2QWTA 3QQAA 2HOTA 1DU6A 2DMUA 5M3FJ 4AC0A 5CXIA 5JLWA 2QKOA 4IEJA 4C3JJ 1ZR4A 1E3OC 5IP9J 2E2JJ 3FK6A 1UI6A 3K2AA 3BR1A 1BL0A 4XRSG 1Y1VJ 1NK2P 4A69C 1NTCA 4KWAA 4A3JJ 3OSFA 1VFCA 3BQYA 5FLMJ 1IJWC 3DEWA 1ETQA 4UUSB 2UXOA 2E1OA 3I4MJ 2HKUA 1VF9A 5DS9A 1WH5A 1FIPA 2XB0X 4M3EA 1HOMA 2ECCA 1IDYA 1VI0A 2M9HA 1I6HJ 3T6NA 2TCTA 5GPCA 1IG7A 2HYTA 4A3EJ 2CQXA 1UG2A 4DYQA 2RAEA 1TC3C 3S1RJ 2UXIA 4J19A 1ZR2A 1MBEA 1OJLA 4V2GA 3BG9A 1SFOJ 3NPIA 4JYKA 1ETOA 3ZQLA 4MIMA 2ZOZA 4M3GA 9ANTA 4CYCA 4MK6A 5FJ8J 3S17J 2G7SA 2HXIA 5F27A 3JRAA 4V2FA 3BG3A 1Z0XA 1XC5A 2NVTJ 5IP7J 1UHSA 3NXCA 2VKVA 3E7LA 3LOCA 2XPVA 3HTIA 4XK4A 3HOWJ 5C3EJ 2YU9J 3BCGA 3SFIA 3VW2A 3BT9A 2CRGA 3ZQHA 2K9QA 5FHPA 3A01A 4A3GJ 2OI8A 3GTOJ 2DA7A 4JNNA 2CQQA 1JKOC 1SANA 2DA2A 5EZGA 3F1BA 2ME6A 3BR6A 1NK3P 1VNDA 3PO3J 5EFYA 3CDLA 3B6CA 3COLA 1WI3A 1ZTRA 1BJZA 5J1RA 1W0TA 3S15J 5IPAA 5EG0B 1X2NA 1JT6A 4XICA 1GDTA 2L9RA 2X6OA 1ENHA 3S16J 3SDGA 3NARA 2H8RA 3MNLA 2DJNA 2EZLA 2DG8A 3BJBA 3HOVJ 2VKEA 4A3KJ 1AKHA 2JN6A 2ZB9A 1U78A 4QIWN 2HDDA 1PUFA 5EGOA 5FKMA 3H0GJ 3IH2A 3M3YJ 4L62A 2ZOYA 2LY9A 2XGEA 2Y9ZA 2AHQA 1Q1VA 2R5YA 2LP0A 2R93J 4I6ZA 5HSZA 4M6VA 1QRYA 2M8GX 3BR0A 1JKQC 2QIBA 5EDNA 2E2HJ 1IDZA 1UI5A 2DA5A 3CMYA 3CWRA 4CGRA 3VVXA 5HBUA 5E3OA 1JTYA 1JUPA 3NRGA 3ZQFA 3NI7A 1FTTA 2DA1A 1Y1WJ 2HQ5A 3JSJA 4MFEA 1HF0A 5F0HA 3GTLJ 1TWCJ 5J3LA 1JKRC 1EF4A 2VPRA 2DMNA 2X48A 3HB9A 5F04A 3VPRA 1XG1A 1TWGJ 2FQ4A 2HYJA 3A03A 3CCYA 3TW6A 5EEAA 4FISA 3S1NJ 2NOGA 3A02A 4I76A 5F1JA 3GTGJ 5M5WJ 4JP0A 1I3QJ 2FD5A 2I10A 3GBGA 4A3DJ 3JRBA 1B72A 3HKZN 1MNMC 3ZQGA 5DAJA 3TEDA 2GBYA 2W53A 1GUUA 1MH3A 4IHXA 1RR7A 2O8KA 2XGCA 2Y9YA 4X1EA 3VW0A 2UXHA 3O60A 5C4YA 4C2MJ 1X58A 5IOYA 3NAUA 1T33A 2O7TA 1JUSA 3SJMA 2Y30A 3RZDJ 3JRGA 4ACIA 5FKLA 3VW1A 1K61A 4ICHA 2M2EA 4RDUA 3HOUJ 3RQIA 4G12A 1MBHA 1JJ6C 5AQCA 1QVUA 1IV6A 3OIOA 3VVZA 2NVQJ 3ANPA 3C2BA 2OF7A 1FEXA 1SGMA 3LHQA 1TWFJ 2GFNA 2E2IJ 2K9SA 2O9LA 2M0CA 5GP9A 3O8HA 2R5ZA 1RETA 2QCOA 1D5YA 3FIWA 5C44J 1B8IA 3PO2J 1POGA 5EYRA 1U8BA 3BTJA 4DYRA 3HIMA 1WGXA 1TWAJ 3GZIA 3A01B 4BXXJ 1GVDA 2YUSA 3TP0A 1WPKA 4FE4A 5F08A 1RESA 1HDDC 2FJ1A 5FKNA 4JX4A 2ME0A 2ZCXA 3GEUA 3VVYA 4FE7A 4A3FJ 3BR2A 2YVHA 2LR8A 2MW8A 4C3HJ 3HEFA 3BTIA 3QPLA 2XPWA 2B63J 4GCKA 2D5VA 2NP5A 4MO7A 2JWTA 4A3MJ 1P7IA 3JRHA 3O8GA 2PZ9A 4BKXA 4M3BA 4NDLA 2DA6A 1ZK8A 2M34A 2DTZA 2DG7A 2ECBA 1MSFC 3KKCA 3S2HJ 1HCRA 4BBRJ 2DA4A 1S7EA 2ZCNA 1WH7A 5FMPA 1AKHB 3ON4A 2GM4A 2P81A 3MN2A 4IHYA 2JA7J 4AC6A 1PUFB 4BBSJ 4JX5A 1H89C 2NVYJ 3JRIA 3G7RA 2WGBA 4X6AJ 2DMQA 1ETXA 2YS9A 4D5FA 1MH4A 3EGQA 2HOSA 3CJDA 4M3FA 3BRUA 2LTPA 3PPBA 2QF7A 2DN0A 2X9DA 2NP3A 2QOPA 4AF5A 5HAWA 1JT0A 2Y0SN 4C3IJ 2K40A 4AYBN 2PBXA 4JL3A 3G1LA 1X2MA 2RASA 3HBLA 1RKWA 2Y31A 2LVSA 3B6AA 2XRLA 5FKOA 3ZQIA 1BA5A 3S5RA 3V78A 4GCLA 3JREA 1BW5A 3JRDA 1JGGA 1F36A 5M5YJ 1A6IA 4QSHA 1IC8A 2ID6A 2L7ZA 5IYDJ 2G7LA 1IUFA 1QVTA 2DA3A 2XDNA 3BQZA 1IRZA 3VOKA 2KDZA 2RHAA 1ETVA 2E19A 3OSGA 3LSJA 1B72B 3HGYA 5CW8A 1YRNB 2JJ7A 3HOXJ 3IUVA 2JMWA 4NN1A 1GV2A 3M4OJ 2CU7A 2L7FP 4MLOA 3BG5A 4A3IJ 1O4XA 3D1NI 3FISA 5FLVA 2WV1A 3I4NJ 1GT0C 2K9NA 4B3AA 5HODA 2IAIA 5IP6A 4A3BJ 3WHBA 1G2HA 2MSYA 2LD5A 4BY1J 3UKGA 3BTLA 5EG0A 3FKIJ 4Y7NJ 1A5JA 3ZQCA 2O7OA 2H1KA 5D1RA 3MKLA
chains in the Genus database with same CATH superfamily
2BE5F 2GXBA 3RPUA 2OBPA 2ELKA 2ZXHA 3JAMK 3J7ZI 3IKTA 3AQSA 3MVPA 3VTIA 2R7SA 2A6EF 5GADJ 3FMRA 1RPWA 1LEBA 4C30A 1KYWA 2AXLA 3DTKA 3FHNA 3PUBA 3QPTA 3BG7A 2R7UA 3T5XA 3CUQA 4ANJA 2VPLA 3PIOF 4W1UA 5KK1A 3IUOA 4QPOA 1IF1A 2EINH 4I2OA 4AIJA 1SMYF 1LDJA 1XCBA 4FTHA 3EUHA 3S2DJ 2Z99A 3CJRB 2LKXA 1IN8A 5K58A 3KCCA 1UHMA 2W1OA 5IYBJ 4KA4A 1P9QC 2CW8A 4PJ0C 2JA8J 5GPAA 5HNHA 3OY9A 3DQVC 4RAZA 1ZRFA 2ZJRF 2LREA 4G94A 2Z5UA 3F0CA 4L9TA 2WY8Q 1FTZA 3GTJJ 3ZRGA 2NNYA 4D5CA 3GLXA 3V8LA 1HLVA 3HTJA 3E6MA 2W84A 3CCRI 1TQIA 1YS7A 4XKBA 2KZGA 5CVUA 3K4KA 5H9TA 3FXJA 4QPQA 1OCTC 1Y56A 2ADUA 4BEHB 3S3NA 2V1NA 1FMVA 3DFGA 3I5UA 4E6KG 2GUHA 1MBKA 3R60A 1QNTA 2AO9A 2D1VA 4GXOA 2XGXA 1OMIA 3W2WA 4CCOA 1G3TA 2PJRB 1ORKA 3AQTA 2IBDA 2BGCA 1H8AC 4N9HA 3GZ6A 3WE3A 1B9MA 2BHYA 1H9GA 1UAAA 2F07A 4LIVA 3S1QJ 4XN3A 4Y3OA 4BY7J 2HWVA 2QQBA 4KUMA 2E1MC 5EZHA 3E0JB 2R5YB 2JQ7A 3BWGA 3DV8A 4BE2A 3IH3A 3SWHA 4NC8A 4NB5A 3OYDA 5FFZA 4J00A 1KU9A 1VQ8I 3BR3A 2YVEA 4XRSA 2ZCMA 3OV8A 1K83J 3V6GA 2PJPA 3HOTA 1MBFA 1JUMA 2XV4S 1R58A 1Z1DA 5J4YA 3OS1A 3CCVI 2Y2ZA 3G56A 2W25A 4OWRB 3IL2A 1I1GA 4HBLA 5FGLA 2LLKA 2L3DA 5BMZA 2PX9A 1PP7U 4A93J 3C3WA 4IHWA 5LLQA 1M1EB 5KNLA 1APLC 4PSWA 3X2QH 1EH7A 2DT5A 2EA2A 1GXPA 2KMUA 5M3MJ 4Q5SF 1G8XA 4WXDA 3WGHA 2PMHA 1OYWA 2JPCA 1QPMA 3GTPJ 3HTAA 2FRHA 2P5KA 4PGHA 2W57A 3CDHA 5BPDA 2GXAA 2P0WA 1AHDP 3H0DA 2B3WA 2DI3A 2NS8A 3CMEI 2FJI1 3JSPA 2Z1DA 4QLCU 3Q9VA 4HA8A 4XIDA 2DDBA 4KYWA 3HGGA 4NELA 1OFCX 4S05A 2CV0A 5F1RA 2XF5A 2ELJA 1TNTA 1DPRA 5FGMA 1JJ8C 2V26A 3FDYA 1F43A 3CCMI 1R49A 1R71A 2R5ZB 4LOCA 3P5JA 4PJMA 2R7WA 4GRIA 3RH2A 1SD6A 4ME9A 2ETHA 4D7MA 2IP2A 3JR9A 4NNJA 3MQ0A 3LJLA 3CC4I 3ELKA 1ETWA 2MYSA 5HS8A 2E7XA 3HOZJ 1K79A 3IRRA 1TWHJ 1AWCA 2KT0A 1U9NA 1LE8B 1SAUA 2L0KA 3IV5A 2H27A 2M8EA 3EPZA 4Y52J 2DMUA 1ZRCA 1UB9A 5GAHJ 2QKOA 2XAJA 1ZG1A 2VT2A 5IP9J 1UI6A 2W4SA 1DGRM 3BR1A 3K2AA 1K78B 2K9MA 4K2EA 5H2FC 2HVSA 3IWFA 2MD5A 4A69C 1R5HA 1NTCA 4KWAA 4A3JJ 3A0HC 3BQYA 5FLMJ 3EDPA 1IJWC 2MH9A 1QHGA 2ZXJA 1KU2A 4BAYA 4G7HF 2EV6A 2LG4A 1KONA 2IXSA 3JW4A 5HS9A 4A5MA 2F5CA 2M4KA 1OCCH 5KHDA 1ON2A 1W7PB 3VOEA 1WH5A 3F22A 3VYUB 5LFAA 1N25A 2HZDA 4B8XA 1HOMA 1IDYA 3K69A 5GPCA 3NQOA 4A3EJ 1BR4A 4DYQA 1XGOA 3FMSA 3IAS2 3E5QA 4M9ZA 3S1RJ 2UXIA 2BBYA 5B1AH 1SVOA 4PFOA 4M3GA 3U9GA 5AONA 9ANTA 2GOMA 3G6EI 1FOYA 4BE0A 1RIOH 2G7SA 2HXIA 2UZKA 1EV7A 1ZLKA 3JRAA 4V2FA 2KZVA 2EILH 1BI1A 1LQ1A 3NXCA 2FMYA 3TL4X 5GTHC 2XPVA 4IX7A 3R61A 3WTSC 3ULQB 1R7JA 2P7CB 4OIOF 2R7DA 3SFIA 3BT9A 3HYIA 2CRGA 3AL0B 2K9QA 4O3MA 5E8IA 2K3PA 4M9SA 3OR1C 4IXAA 3RYRA 3FKJA 2ZJQF 3LL7A 3H9JA 3SZPA 2CYYA 5LHIA 2OI8A 3F8BA 3NNRA 4OU0A 2TDXA 2Q2EA 4YEJA 1JKOC 5EZGA 2RQPA 2OCEA 2FNPA 2ME6A 3SFZA 3DBHB 5ICEA 2ZBKA 1VNDA 4LK0F 2Z3YA 2OA4A 4BH9A 1ZRDA 2HVQA 4NC7A 1BJZA 5J1RA 2HQRA 1JT6A 2CUZA 4G9YA 3PIPF 5DUKA 2RV8A 3MNLA 4CDGA 3DTEA 2VKEA 1VQMI 3MD2A 1R1UA 2XIGA 4RLQA 3LQRA 1U78A 1RNLA 1PUFA 5KAFC 2CV2A 5EGOA 4BQOA 3M8EA 2LY9A 3RSNA 2Y9ZA 3ABLH 2BVMA 4RM3A 2KKOA 2LP0A 3RKWA 1XCVA 3KLOA 4CYDA 5HSZA 2VKDA 1JKQC 2GIVA 2EIMH 2CQNA 3ISPA 3QWLA 4XBFA 5L3BA 3CWRA 3I3LA 3T1BA 1LVKA 3KP7A 1FTTA 1KQ9A 1FMWA 2M7AA 1E2XA 5D5XB 2HQ5A 4KN4X 3P9IA 4HAMA 3GTLJ 1MJ9A 1J59A 3O3KA 5B66C 2DMNA 5BOXA 2KFDA 2DFFA 3V4GA 4KT5C 4UY8I 2FQ4A 3BOQA 1W1WE 5F1JA 4IHSA 3GTGJ 5M5WJ 1MKMA 2I10A 2L2OA 3KP2A 4AIHA 2GBYA 3SZGA 4ZYGA 1X1AA 1RR7A 4RA2A 4WF2A 3O60A 4LG3A 1XX5A 2PN6A 3EUKL 3JRGA 2M3AA 3E1SA 1K61A 4HZFA 4ICHA 1WHUA 1R23A 2M2EA 2IW5A 3HOUJ 3RQIA 4G12A 1JJ6C 1IV6A 2KJCA 5ILSA 3RCOA 3K4LA 3FXMA 5DV5A 3LSTA 2K5CA 1DGWY 3LHQA 4CICA 2WBMA 2E1MB 3RPUD 4BGDA 1RETA 2V1DA 3WTWC 3U1DA 4U7DA 3O6BB 3E3VA 3GMEA 1Q1HA 4XLAA 1YG2A 1U8BA 1XSDA 1SFUA 3JCUC 1MNEA 2F6CA 4PFPA 3ABTA 1FY7A 1OR7C 2ZNYA 5DM6F 3WU2C 1IXCA 3TP0A 4RLFA 3OS0A 1UELB 1VQ5I 1VQLI 1WPKA 4FE4A 5JHUA 2FJ1A 2VC1A 3PNTA 2ZCXA 1IRFA 1P2FA 4FE7A 3F8MA 3BR2A 2YVHA 2LR8A 2ZXIA 3BTIA 2KPMA 4XM3A 1Y8RB 1X1PA 3O2PE 4MO7A 2Q0OA 4CUGA 4OIPF 1XSVA 2K85A 3T8TA 3AG2H 4BKXA 4H0EA 2XDVA 3A0BC 3J7AY 5EJCA 2EFQA 1ZK8A 4IVNA 2K86A 1WH7A 3CO6C 2KISA 3MN2A 4ZC3A 4IHYA 4MQ9F 4R79A 2OTJI 1TZLA 2HKXA 5L3DA 4II3A 2BEOA 2FXAA 3BZKA 3G73A 3H5NA 3HUGB 3JRIA 2L7KA 3CC2I 2EFNA 1OYYA 3EGQA 3DKWA 1G4DA 3V7RA 3BRUA 3CZ6A 1FOXA 2QOPA 2PJRA 2PBXA 4JL3A 3GUDA 1PYVA 4DGWB 1RKWA 3B6AA 2IA0A 5FKOA 4OINF 4GCLA 3K70D 1R1VA 2K7LA 1JGGA 4CHUA 2VQHA 1A6IA 4WX9A 3KP4A 4HX8A 3KP3A 4IPAA 3SEZA 1SFEA 2KIFA 2JT1A 5E8GA 2XDNA 1YLFA 4ESFA 5GAEJ 3JTGA 3CCJI 3RKYA 3VOKA 2HEOA 2RHAA 2O0YA 3OSGA 1ZARA 2HYGD 1OLTA 2QQ8A 3FXLA 1WWXA 4XKCA 5CW8A 3LFUA 4FHTA 4NN1A 4RB1A 1WZ2A 2OZUA 1XSXA 4C2MA 3M4OJ 1RC9A 4BJ6C 4CCMA 2BOLA 1MJAA 3FISA 5D4SA 3HXLA 3KYLA 2DBBA 2Q1ZB 1REPC 5GAGJ 1GT0C 4LG0B 3GWZA 1FOWA 1OKRA 1VZ0A 1EA3A 3I59B 4F92B 1G2HA 4HG2A 2LD5A 4Y7NJ 1A5JA 1IXSB 3ZQCA 3C1DA 1IUYA 3KYCB 4EGYA 3TKYA 4CA0A 1D0XA 3K1NA 2ID3A 4YZEA 2NS0A 3P9TA 3JAMZ 2EQRA 2F5VA 2ZCWA 3G3ZA 3VWBA 4OD5A 2LYCA 1YX5A 1B8IB 4PUSA 1O3QA 2V79A 3BR5A 2R7VA 1UFMA 3HSRA 1I27A 3MEXA 3K8PC 3SQNA 3M8JA 3GTKJ 4RGUA 2DYRH 2X6WA 3I55I 3UNGC 4GYGA 2E35A 1KYZA 3ABMH 1QGPA 3CRJA 5CXGA 1WJ5A 2GA1A 4KNYA 4YELA 2G3BA 4L9NA 4GFKA 3ON2A 3MFKA 5J47A 1R00A 3BY6A 2BXZA 3LAJA 5FRMA 4PDKA 2EPFA 2Z33A 1MDMB 1YI2I 1LFBA 4L9JA 1OCPA 2Y69H 3QOPA 4HSTA 5ICGA 2M87A 1S7OA 2XB5A 3RKXA 5FLXK 2M4GA 1KZHA 3ZQQA 3ZR8X 3KZZA 3K7AJ 2Q2EB 1LE8A 3KLNA 3FXRA 2LY1A 2V1XA 5D4RA 4XQFA 2DMPA 3KZ9A 1Z21A 5TRDA 1Y0UA 2BXYA 2R92J 3TP3A 1WI9A 3L2WA 1LFUP 1K78A 3KZYA 3NEUA 5A2QK 2ZO4A 3DLLF 1ZHFA 3GLLA 4MFDA 3M7GA 3CJQB 2RQQA 4L5EA 1Z05A 4EEFG 2CG4A 3IH4A 1MGTA 4AVPA 4MGRA 2A6TA 1KU7A 3DPJA 2VBYA 2XSDC 4IOCF 1T0FC 1Z3YA 1T0FA 2HPMA 3RYPA 1WQ2A 2FX0A 3M9AA 2GLOA 2EIKH 3B02A 5EGOB 4IKFA 4IQ4A 2F4IA 1CGPA 3VP5A 4I02A 4R1HA 1W7PA 1C0WA 1ZREA 2REKA 2LSOA 2VXZA 2Y48A 1T8IA 2B9SA 4KIFA 2TRTA 5F0CA 2X51A 2LRDA 4ETSA 1VQOI 5C4XJ 1EKEA 4ESJA 3TO7A 5HVQC 2UXXA 4EM0B 2WWYA 3TDZC 4I99C 2FU4A 1ZGWA 4E7ZA 2ICWG 5C4JJ 4BU2A 3ZN1A 4NHJA 5CQGA 4BHBA 1FWZA 2O8XA 2AQFA 1RKTA 1SAXA 1IO2A 5K7ZA 1SC7A 2W24A 5K7HA 2E60A 3WHCA 1A31A 4OD4A 4NQWB 2L9NA 2VC0A 4P1WA 4M73A 4UVBA 1A36A 3CC7I 2KIQA 4HV5A 2XAFA 4P9UA 1Y39A 3PSFA 5AIPA 4N0BA 3VDXA 3D0SA 2L54A 4B47A 3ZN0A 2YU3A 4S0HB 4PXIA 4BQAA 3OL4A 1XS9A 2DPUA 2HNHA 3GVAA 3WODF 1L0OC 5L3EA 2HXOA 6PAXA 1JI8A 1MNDA 3VODA 1RUNA 4JX6A 3JRFA 2R0QC 1ETYA 2ESNA 2PBIA 4I0BA 4UVAA 1MBGA 3COAC 4HF2A 3L2UA 1W0UA 3I58A 2F4OB 2Z16A 4GO1A 1USSA 2G7UA 3RPQA 4BJ5C 2G9WA 5D8LB 3P9CA 4HYEA 2ESHA 4UDSA 1N77A 2JRTA 4U9LA 1IN6A 4DYCA 1P4WA 5H6RA 4EQQA 5E3NA 1O3RA 2CUEA 2EBIA 3QOEA 4B44A 2GENA 4P96A 2MA3A 2R7OA 2W7NA 4NBQA 2L7MP 2UXPA 5D19A 2A6HF 1ZN2A 3BJAA 3E6DA 3HM5A 4DOZA 1CF7B 1TQPA 1JHHA 2OERA 2YVXA 3BHQA 5ERIA 1YIJI 3GZNB 4L5JA 1BOAA 1DU6A 5CXIA 4AC0A 1G3WA 3QP6A 4HDVA 4MHGA 4C3JJ 1ZR4A 2E71A 1N75A 3FK6A 3DWLE 1E3PA 3OIPA 2XF7A 3BJ6A 1NK2P 2J5PA 3W2VA 3C7JA 4HLXA 5FO5A 4D0PA 4FETA 4A12A 3BCBA 1VFCA 4OIQF 2M45A 2KDOA 1Y8QB 4HQMA 2F5FA 3BCAA 2JA2A 1WKMA 3CF5F 1RUOA 4ZDPA 4UUSB 3I56I 3I4MJ 4B09A 4BXFA 1J7KA 2OCCH 2HKUA 4U9NA 2JPBA 5DCMA 5KAIC 2LOOA 3VSKA 2I5UA 2LF8A 1FIPA 4RM2A 3I4PA 4TV7A 3VYRB 2F2EA 1I6HJ 2M9HA 3T6NA 2IA2A 2TCTA 4KICA 1IG7A 2HYTA 1O3TA 2RAEA 3ZMVA 2HGCA 4E4HA 1FPQA 1O7LA 4XLCA 4V2GA 3BG9A 4C9YA 3NPIA 4BE1A 4JYKA 3ZQLA 1TNSA 4CO8A 1BBYA 4YG2F 2LH9A 1UCRA 4MK6A 1BI2A 2VJJA 1YYVA 3L2VA 2HZTA 3U21A 2NVTJ 1LPQA 1YJWI 4BYYA 5ILVA 2JVHA 1QO0D 2VKVA 2EA4A 1FBSA 3E7LA 1R1TA 4XONA 4IOAF 3HTIA 2DFEA 1YIOA 4L0ZB 2YU9J 4X0GA 3K1MA 2CH0A 2HU9A 4LITA 3FM3A 3QODA 4DQ2A 2V7FA 5LRRA 3FBIB 2VONA 1GHCA 1O57A 2QM3A 3OL3A 3WTVC 3F1BA 2P8TA 2BY3A 5EFYA 3PO3J 1B9NA 1FYKA 3OR2C 1U2WA 3GFLA 3B6CA 1ZG5A 3COLA 3SYTA 1W0TA 3AAFA 1T2KA 5IPAA 3BDDA 4JBAA 4XICA 1GDTA 4LD5A 4UB8C 5J6XA 4M6XA 1FP1D 4WXCA 2JUGA 3DXJF 1WJFA 1ZG3A 2DG8A 2F5EA 2ZJPF 3OYMA 2H6CA 3L2CA 4IRVA 4QIWN 3K0LA 2ZXWH 3T8RA 4L62A 3H0GJ 3KP6A 3OOPA 3M3YJ 2PMZA 3WE2A 1KQ0A 2A3SA 2OAZA 5LRSA 2P5LC 3HUGA 2VBWA 1IRXA 2M30A 3K4JA 2H1LA 2CQ7A 2W00A 1QRYA 4WIBA 1WSUA 1D0YA 2K9LA 1S6LA 2V6CA 3LSIA 2P4WA 2XAUA 5DD4A 2HKOA 4F52A 4ZH4F 4JOMA 1JTYA 4EJTA 2KQRA 1H9TA 2Z9OA 2PEXA 1DQUA 5E1ZB 2VBZA 3M1CA 2V4JC 2E1NA 4MFEA 2MC4A 4AU7A 3QYFA 4LJZF 2L02A 2X4HA 2X48A 5F04A 3VPRA 4L18B 1J75A 1J9IA 3CCYA 3G71I 3TW6A 5EEAA 2K4BA 5ILUA 2QENA 4I76A 1JGSA 1LJ9A 2H8WA 4EM2A 3LA2A 4U7BA 3GBGA 3I9V2 4A3DJ 3JRBA 4HLYA 3RI4A 1MNMC 1MMAA 3ZQGA 5HLTA 3OYNA 5DAJA 2IGOA 1MH3A 3TDUC 2XGCA 4DNCA 4X1EA 2CW0F 5C4YA 4G8XA 5TISC 5IOYA 1T33A 2GAUA 2IS2A 3I71A 3RZDJ 2CQKA 2Y30A 4ACIA 4LG0A 4D1QA 4RDUA 3I59A 1SVMA 4EMSA 2EFPA 1MBHA 3CESA 3T0YA 5B3SH 4YFXF 3UR3C 2NVQJ 2E34A 2M7BA 4AM3A 3S8PA 1YX3A 2COMA 3C2BA 1FEXA 2PMUA 3TO6A 3ASOH 1X4PA 3K6GA 3W6KB 4WCGA 2E2IJ 2M0CA 3ASNH 3O8HA 3E97A 1OYIA 5L3GA 3HSFA 3FIWA 5C44J 1B8IA 2RVCA 3K9TA 2BVLA 2NAZA 4DYRA 3HIMA 2VKHA 3GZIA 1E0EA 4HNUA 4KT6A 4R8HA 4CCKA 4UV8A 3OYLA 2WAEA 1T08B 2YUSA 3L9FA 2XASA 3K4MA 1HDDC 4JX4A 2ME0A 3VVYA 2MFZA 4A3FJ 1MW7A 2MW8A 3LWFA 4BS9A 3HEFA 2CGPA 2XPWA 2FSWA 1IAWA 2VJ4A 1FT9A 2NP5A 2JWTA 2Q8KA 5BS6A 1IZ1A 4ASNA 2DODA 3S3OA 2M5WA 2PZ9A 4CGZA 1V5FA 2QBYB 4JQFA 4NDLA 1MDMA 2DTZA 4ZYAA 1T39A 3DBRB 1UZCA 3L09A 2NOJB 3PNYA 2GM4A 4EJOA 3W2AA 2JA7J 2XKOA 1FBUA 2VE9A 5KVRA 2R7TA 2EV0A 2LBFB 3CCLI 1MD0A 1T98A 3G7RA 2E7WA 1X3WB 2X1EA 1PP8F 4D5FA 1LKXA 3K4BA 3QYEA 4N4NB 1FOKA 2HOSA 4M3FA 2CSOA 4KFCA 2QF7A 4XRFA 2HPIA 3RIRA 4C3IJ 3ZMDA 2ELHA 4ZZLA 3G1LA 1BM9A 3ZQIA 3F6OA 2LVSA 4F7ZA 3R0AA 3S5RA 1BA5A 4XOPA 2BY0A 2HOEA 3P9KA 5M5YJ 4RGRA 2IJLA 4QSHA 2ID6A 4G6DA 5LBQA 5IYDJ 1IUFA 4UV9A 1HXDA 3BQZA 5CQEA 3CP2A 1JXSA 1TW3A 1YE9A 2KDZA 1ETVA 2E19A 3WU0A 3LSJA 4MTDA 3FZVA 1MMGA 3HGYA 1ULYA 3WGGA 1XMAA 4XLNF 4MLOA 3BG5A 3DLAA 2A05A 4MEYF 2YX7A 3BZCA 3D1NI 2VLAA 1LB2A 3P7NA 1D3YA 1O7FA 2A69F 2X6YA 2WV1A 3FXKA 2IAIA 3F8NA 4NQWA 2UUZA 4NC6A 2CWEA 3WHBA 5IP6A 3S3MA 3WTUC 3SHFA 4A3BJ 3E6BA 3NS4A 5EEGA 3TBIA 2O7OA 2ZSHB 3RDIA 3HE0A 4C2UA 2PFBA 2UXUA 4XNFA 3GEZA 1S9HA 2KRFA 1FJLA 4YIIA 5DCMB 5E3MA 3I53A 4F3QA 2V57A 3EYIA 1X1DA 2XC7A 3I64A 3QAHA 4RGXA 3VFZA 4ENNA 5TJJA 2FBKA 2VQGA 1NG7A 4L5IA 3VB2A 4XRMA 3JRCA 1RRJA 2M0MA 1XGMA 2IA1A 4M72A 4S04A 2HDCA 1MMSA 1I50J 1VQ7I 4GCTA 2O3FA 3S14J 1EH6A 3J7YJ 3E5XA 4U0YA 2IGMA 4MNUA 1HQCA 5FD6A 2CJJA 2IGKA 2NX4A 4B4CA 4G7ZF 1MSEC 2MG4A 2STWA 2KP6A 1VTNC 3KNWA 1NHAA 1EJ9A 3ANGA 1BIAA 3QKXA 4RBOA 3FRQA 5HDGA 1HKSA 2LK2A 4HPQA 2JA5J 3VSLA 4EJUA 4HV6A 3ZXSA 1OR7A 2E5ZA 4BQQA 1WJAA 1NH3A 2NVXJ 5IOZA 1CF7A 4PJNA 2EB7A 1FC3A 5BQTA 5FLXZ 1R5ID 3HL2A 2KRHA 2HOAA 3W6VA 4RS8A 5FRNA 5GTIC 3F9KA 3ECOA 5K7FA 2X1DA 1DU0A 4GGGA 4FQGA 5A2QZ 3GTMJ 3ZMTA 1WRJA 3Q0UA 4M3DA 3HTSB 3TW7A 1N78A 4AIKA 5D6EA 1ZGJA 1T56A 3S1MJ 2IVMA 3U1KA 4XKVA 3MAJA 3OOUA 1OCRH 2VQCA 3HJEA 3Q0VA 1BW6A 4EVIA 1QZZA 1MJBA 1XB4A 4HOBA 4UUSA 2DOAA 3KIOA 4XLEA 2QA4I 2Q24A 5HLGA 3PUFA 3BTCA 3N4MA 2A61A 1OCZH 4G7OF 5J1YA 2JVGA 5IYCJ 1TBXA 3VIBA 4PJJA 4KMFA 3OYCA 3MZYA 5J1UA 4M6YA 3H35A 4II2A 2ZNZA 3VUQA 1JTXA 4HNTA 2QGUA 4D7NA 2EZHA 3CMAI 4CZCA 4FT8A 2FOWA 2N8GA 4GFLA 2Z2SB 5JI6A 4ZYDA 2DK5A 3B81A 3RD3A 3HTUA 2ZMEC 4UUTA 2ZMEA 5HLHA 4C2TA 2VJIA 1A6QA 4HW0A 4KIGA 2DTRA 3LSPA 2GQQA 3KFWX 1F9NA 4XOTA 1TQMA 1Z6RA 5E18F 2O6GE 5CJ9A 3DPUA 4BJTA 3HIFA 2XRNA 3DKXA 3M1EA 1D1BA 3MZ8A 3HRUA 4A3LJ 4LIUA 2COBA 5IT9K 1TT5B 2RNJA 3GFIA 1Z67A 3ONQA 2LC2A 2LY2A 3KYDB 1IGNA 5DTDA 1F4KA 5DUIA 3RZOJ 2HQAA 2NYXA 2IGNA 3CJNA 5B1BH 2PMZN 3G2BA 1L3LA 3K4CA 1XPXA 1Z77A 1WCMJ 4OOIA 4IHVA 4XLPF 3K4NA 3H9GA 5DEQA 1ITYA 1MZBA 5TGTA 3WTTC 1W5CC 1ZELA 4ITVA 5BNGA 3LNQA 1HDPA 1E17A 4OMZA 1U9OA 3L00A 1QBJA 3ABKH 2JK3A 5DYMA 5E17F 1Y6IA 1I3AA 3Q3SA 3HDDA 4IRIA 3FK7A 3F8CA 3V42A 4HF0A 3HC7A 2MABA 2WAQA 1ZQ3P 3QBMA 3GFJA 4DZJA 1P7JA 2QQAA 3WTZA 3HG9A 4AWXB 1TL8A 3CLQA 3E6CC 2NS7A 5J4VA 2QTQA 1B59A 5HOOA 1IN4A 2L9SA 1FZPB 4XLFA 1WJCA 2DMTA 2V9PA 3R6SA 4ZZDA 3H3VK 3U2RA 5FB2A 4CXFA 2IEKA 3F3XA 3NWSA 5CVVA 2W82A 2QWTA 4Y17A 2HOTA 3PNVA 3J81K 5M3FJ 2B1EA 2D45A 2JRMA 1DP7P 1E3OC 2ZJ2A 1SD5A 2YX4A 1Z7LA 4DJAA 2FA5A 2IS1A 1LEAA 1BL0A 3H3ZA 1Y1VJ 3OYAA 2QSFX 3RTRA 2L4AA 1R22A 4KMUX 2MLKA 2W85A 2EJRA 4RB2C 1YW7A 3S2WA 2E36A 2JSPA 3M07A 2EIJH 1WFXA 4CCJA 1ETQA 2DQRA 3H9QA 1WJBA 1YW9A 1YHQI 2UXOA 2E1OA 1ON1A 3FMQA 1VF9A 2P7VB 2OD5A 2BHZA 4QWQA 2HYFA 1QA6A 1UG0A 2FEZA 2ZY9A 3DKYA 3S32A 4M3EA 4LGWA 3ESWB 1VI0A 2STTA 1K4SA 4LFUA 2CQXA 2RREA 4J19A 4P5OA 1FYLA 3FX3A 2L5QA 1ETOA 2V9VA 1V4RA 4RAFA 4CYCA 3QP5A 3H5AA 2P6SA 4I98B 3S17J 2MLGA 1PDNC 3DU5A 1B4AA 2MD0A 1Z0XA 3IKVA 3K1PA 2X85A 5D5VB 1X4OA 1G6NA 1UHSA 2WB1A 4UHTA 4HSRA 4YRVA 3LOCA 4Y15A 2VL8A 3HOWJ 3CCUI 1TLHB 4EM1A 3BCGA 1V54H 2B0LA 2ISYA 3VW2A 3MKWB 1TTYA 4M71A 2UV1A 3IWZA 4A3GJ 1YW8A 1F1ZA 3CD6I 2ZFUA 3GTOJ 2XF6A 1YQAA 1AOYA 2NRAC 3CCSI 2CQQA 4A6EA 1SANA 2DA2A 3HZJA 2CW7A 1UHWA 4ZJZA 1PVEA 2KL4A 3CDLA 4H4KC 3CMMA 3ECHA 1QU3A 1WI3A 1LDDA 1ZTRA 2BW3B 3S15J 2XAHA 3HPHA 4GYIA 3EETA 4F55A 1X2NA 3HRTA 2QBYA 2E1CA 2L9RA 2R7QA 2X6OA 3JTHA 3SDBA 2MBFA 3NARA 2H8RA 4ZDOA 4XSXF 3LSHA 2L01A 4A3KJ 3PFIA 4RB0A 2JN6A 4RAGA 3IH2A 5J40A 2XGEA 2LBFA 2X1CA 3H5RA 3TGNA 2PG4A 3J80K 4Q48A 4M6VA 2M8GX 4KITB 2E2HJ 1UI5A 1IN5A 1SD4A 2DA5A 3KPHA 3DF8A 3LFKA 3CMYA 3FF5A 5HBUA 1S5LC 1JUPA 2PQ8A 3NRGA 2AQEA 3ZQFA 1BI0A 3TQNA 2WA0A 1XTAA 2DA1A 1Y1WJ 3JSJA 2OJED 3ZGKA 2NVUB 1HF0A 1TWCJ 1YO5C 4XMYA 2BV6A 2CFOA 1ZH5A 2VPRA 5CVIA 3HB9A 3BZ6A 1P6RA 1TWGJ 2HYJA 4B43A 5HLIA 4FISA 3S1NJ 2FNAA 1WJDA 4Y4RA 5HDNA 2O5RA 4JP0A 1I3QJ 2F5DA 2FD5A 4PGGA 3MKYB 3PJRA 3AG4H 3OMYA 3HKZN 1ONVA 3ZMZA 2A5WA 2VJ5A 1XMXA 2DQLA 2OV7A 3OYJA 2W53A 3V8KA 4IHXA 5JHFA 2ACJA 5LGNA 4U88A 2DFHA 3VW0A 1OISA 1R5GA 2GXGA 4RGSA 1X58A 4C2MJ 3NAUA 4BACA 4XLHA 3VYSB 1VQNI 5FKLA 3IHUA 2FF4A 5LGUA 2K27A 3DPTA 3CUQC 1D8KA 4KN7X 4IZZA 2DFIA 1QVUA 1R36A 2R7XA 1K4TA 2X0LA 2KJBA 4N9IA 4LK1F 1OCOH 2RNGA 3EUHC 4Z6YA 1TWFJ 2R7FA 2GFNA 2B7EA 1KGSA 3BG6A 4IRGA 2O9LA 1HW2A 5GP9A 2MH2A 1BI3A 4U0WA 3KE2A 4IRHA 1MMNA 1D5YA 1POGA 1U0JA 2UXNA 4FASD 3R4KA 1TWAJ 4I7HA 2L4MA 1T95A 2V1UA 3A01B 2FOKA 3AFHA 2WAFA 1GVDA 5HDKA 2H6BA 3W3CA 4IF4A 2RC4A 3CTAA 1X19A 1D0ZA 3OYFA 2ZMEB 1USTA 5FKNA 2VE8A 2CV1A 1W5TA 4F93B 2HR3A 5DCFA 4A2UA 1BR1A 3EUAA 3QPLA 4EGZA 4B3XA 1WVRA 3JSOA 1K6OA 2LDUA 4A3MJ 3JRHA 3DTIA 1IXRC 3O8GA 3HRMA 2YR2A 3IAM2 2VBXA 2R4GA 4M3BA 3BROA 2WV0A 2M34A 2DG7A 2ECBA 3HRSA 2DYSH 1HCRA 1B6AA 3GXOA 2ZCNA 2YSRA 5JVGF 1AKHB 1FBQA 4YFNF 3ON4A 4JK1X 2P81A 4E7HA 3K70C 2MC3A 1Z6TA 4GCVA 1H89C 1T6SA 4YFKF 4XKWA 2H94A 4DBQA 1Y0NA 5L3CA 2NVYJ 2V6EA 2JZYA 2CO5A 2OUMA 2WGBA 4PCQA 3LMMA 1MH4A 1W36D 4Q47A 3IC7A 1G3SA 3PPBA 5ICCA 2X9DA 4LB6B 4AF5A 1JT0A 2Y0SN 4UNOA 2ZC2A 4ON0A 4AYBN 3GX4X 1SFXA 5B5EC 1D8JA 2VXDA 2RASA 2Y31A 2AXTC 3FXUA 3FXOA 2XRLA 1BW5A 2DLLA 3JRDA 2RGVA 2GOXB 1IC8A 2HTJA 3OS2A 2L7ZA 4KJZA 4CH7A 2XKPA 2D1HA 1D5VA 2VQLA 2EFOA 1B72B 2P6TA 2XVCA 1FX7A 3ROUA 3HOXJ 2JMWA 4XR6A 1VQPI 1BR2A 2E5NA 1YS6A 1EH8A 3KEYA 4A3IJ 1DDNA 1IV8A 5FLVA 2J5OA 1RZ4A 1HA8A 3MCZA 5HODA 3E5UA 3MZHA 1YFHA 2MSYA 4ESBA 4BY1J 4A0XA 3WGIA 5EG0A 2IPQX 2H1KA 5D1RA 4KISA 3CLOA 3MKLA 2A2FX 3VOXA 1H88C 3OIQA 5D5UB 2DXIA 3IP4B 5F64A 5LD2C 2EZKA 1IRGA 5H6QA 3DP7A 3BNIA 1HC8A 1ETKA 1V5GA 2WAQN 5FFXA 4OAZA 2XROA 2LKSA 1CQTA 4LB5A 1YJNI 1I5ZA 2Y75A 3GW2A 3HTHA 5M5XJ 3DBLB 4EJVA 3G1MA 4DW6A 2OPTA 3C2HA 4FCYA 4L0YB 1YTYA 5CYVA 3Q0WA 2KLOA 1QZYA 4EJWA 1BC8C 1FNNA 4N4OB 1TW2A 1FSEA 4XORA 5DDGA 4JKZA 3QPSA 4CYCB 3KEQA 1KQ8A 2QKLB 2R3SA 2G7HA 3HSEA 2IT0A 2OU2A 3C2GA 3LSRA 1JE8A 2MGQA 2JSCA 2DCEA 3CDIA 2EH3A 4AVZA 1JKPC 2BY2A 4W97A 1F5TA 4E7KA 3F23A 1LVAA 4CCLA 3OWTA 1AU7A 1J5YA 1STZA 2G0EA 4EATA 4GFBA 3EYYA 5J8CA 2FBQA 4XN0A 1SEUA 3KZIC 3PM1A 2M1BA 2PFVA 4MXMA 5IT3A 4HRIA 3S93A 3L1PA 3FWEA 3GTQJ 2UWMA 2WUIA 4DIQA 2HI3A 3G1OA 5D18A 2BZTA 3V7CA 1FSHA 2G7GA 3FXQA 4RAYA 1HSTA 2JTVA 1RI7A 2HDWA 1R9TJ 1HW1A 3CCQI 4HKUA 5JFRA 3ABUA 3CO7C 4AUXA 5D8KB 1BJAA 3H1CA 5ICFA 1GV5A 4IO9F 4IQJA 1Z9CA 2WY7Q 3KETA 2XUBA 3ZMSA 2FMLA 1UMQA 1E3HA 4U0VA 3LQQA 4DZPA 4ABZA 1A04A 2GA2A 2WB1N 3ZPLA 1A35A 1S29A 3PASA 5E1XA 3OYBA 4L9VA 2EWNA 1X1BA 2VIXA 2ZSIB 1DP3A 2DO7A 3LSMA 4J01A 2QQ9A 3B73A 4NUBA 4CSWA 2CFXA 2GIZA 3KKDA 2JUCA 3MWMA 3LAPA 1U5TB 5JVTA 3V8JA 2XHKA 2DT6A 2A5YB 3H36A 1PUEE 5CKTA 3AG1H 2LMDA 3LWJA 5E1WA 3N05A 1ZYRF 3RKQA 3TOAA 5FKKA 2EZIA 4HDUA 2XPUA 1W7PD 5K1YA 2DOEA 1K7AA 2KIUA 2O61A 5JLXA 4QTRA 3GF2A 2QSHX 1HKTA 3SZTA 4ZTJA 1FIAA 2IU5A 2F4MB 4B1RA 3ERED 5IT9Z 1MBJA 3LSKA 2QVOA 5EF6A 3SEQA 2EFWA 2X6XA 2KRCA 3BP8A 3CQZJ 3Q5FA 5DM7F 3D5SC 2LFBA 1G3YA 4ZDLA 3MKZA 2W48A 4OMYA 2OQRA 1ZKGA 2VI6A 4RB3C 1HSJA 1K6YA 2OQGA 1XGSA 4AD9A 3HOYJ 3CUQB 2BW3A 5LHGA 2RDPA 1QPIA 4IJAA 4Y33A 5E3LA 3L2RA 3HKZA 1P4XA 2XAGA 1XMKA 4MTEA 4KDPA 1VQ6I 3C07A 2D6YA 4E7JA 4YIFA 3ZOBA 4HNVA 1HBXG 2CUFA 3V7SA 3DCFA 3DEEA 3FM5A 3K2ZA 1V55H 2R7ZJ 3C18A 2A68F 2JA6J 3MMYB 2VUMJ 3F21A 2QUFA 2XGDA 3BPVA 4I0AA 5L3FA 3EUPA 1DUXC 4A0YA 2K3FA 2EV5A 5LEJA 2DDAA 4ZYHA 4G6TB 5F0FA 4AIDA 4CCNA 4BHPA 3LSGA 1YRNA 3WTXC 3E7QA 3REOA 4A3CJ 3QQAA 3QU3A 1PJRA 5JLWA 4IEJA 2F48A 3J81Z 1ZLJA 3PSIA 2VN2A 3ZMUA 2E2JJ 5LGTA 1XN7A 1G59A 4XRSG 1SVLA 5DD8A 2IS4A 1S7AA 3OSFA 1WJEA 2FBIA 1QZEA 3DEWA 1DPUA 1X3UA 2YPRA 3CJTB 4WXHA 3H92A 2XAQA 1U8RA 4HF1A 1D1CA 3KX2A 4G6QA 1UJ8A 3ERMA 3HHHA 3PQJA 5DS9A 3GYHX 4XSZF 1J09A 2ISZA 2XB0X 2HVRA 2ECCA 4A6DA 2LNBA 3D5LA 3WG7H 2BYVE 4UB6C 1UG2A 1LUJB 1RR8C 1TC3C 2IS6A 2O03A 1B1BA 1ZR2A 1MBEA 1OJLA 1GXQA 4ZTFA 1P4AA 1R4MB 1SFOJ 3M8FA 4I01A 4MIMA 2ZOZA 2QWWA 1J0RA 1Z7UA 3I0TA 5FJ8J 1ZGAA 4E7SA 3N97A 5F27A 3K10A 4O6JA 1I6XA 3BG3A 1ODDA 1XC5A 4FX0A 5IP7J 5FROA 5AIQA 3PFYA 2LKPA 1W36C 5D6FA 5LHHA 4XK4A 1XDSA 2KIMA 5C3EJ 4BDZA 2V9KA 3A1YA 4A5NA 1TT0A 3ZQHA 3HOSA 2R7RA 5FHPA 3A01A 3BPXA 5LEKA 1QQIA 1W4MA 2Y0SA 4AYBA 3FBNB 2DA7A 4OIRF 4E7LA 4JNNA 4B48A 5KCMA 2AS5F 3BR6A 1NK3P 4YIRX 2HS5A 2DAOA 4BEHA 1FP2A 2NXNB 2FBHA 1ACIA 5HS7A 1O3SA 3CUOA 1ERDA 5EG0B 2C6YA 3OYKA 3OYIA 1ENHA 1LFPA 3S16J 3F72A 3SDGA 5E20A 1U6GA 3DEUA 4I09A 2DJNA 1FLIA 2CMPA 2EZLA 1YITI 3BJBA 1BN5A 3HOVJ 5ED4A 5K5RA 1AKHA 2K4JA 5JR3A 3BC8A 3DPLC 2ZB9A 2HDDA 3GO5A 4BHCA 3HPGA 4PK4A 5H20A 1OQYA 5FKMA 2ZOYA 4FX4A 2VT3A 4F91B 2QSGX 2AHQA 1Q1VA 3WG9A 5CLSA 2R5YA 4MQVA 3RJPA 3F6VA 2I8DA 4CZZA 2R93J 4I6ZA 3KEOA 3J80Z 3BR0A 2QIBA 5EDNA 1D1AA 3IRQA 1IDZA 5F6FA 2EK5A 3HHGA 3WU1B 4CGRA 3VVXA 1LNWA 1P92A 5E3OA 5IY5H 4WWCA 1R6RA 3NI7A 2QZ8A 1MIJA 2ZKZA 1XGNA 1MMDA 2HFHA 3PL8A 1VQ9I 5F0HA 2QEXI 5J3LA 2LF7A 2FUG2 4GDFA 1JKRC 1EF4A 4DBRA 1XG1A 4LLNA 4XL9A 1U3EM 3A03A 3NRVA 4P55A 4HX7A 2NOGA 3A02A 2K02A 4OAYA 2DU9A 3ZP5A 2FE3A 4O5VA 3WTYC 2DPDA 2Y0MA 1B72A 1QHHD 1OPCA 1IN7A 1KU3A 2RKHA 3TEDA 5CVRA 1SD7A 1GUUA 1KA8A 2DJIA 2HTSA 3QRFF 1NG6A 2O8KA 2QKMB 2Y9YA 1LDKB 2UXHA 1VQ4I 1AA7A 2O7TA 1JUSA 3SJMA 4LLLA 1X3ZB 1SMTA 2FQ3A 3Q9SA 1ZAOA 2RN7A 3VW1A 1W5SA 5AQCA 3W6JB 5FD5A 4MEXF 3OIOA 2GZWA 3VVZA 3ANPA 2OF7A 1SGMA 2ZFWA 2DOFA 4BXUA 2K9SA 2P5VA 3GZ5A 2R5ZA 3QU6A 4LLGF 2OTLI 3KP5A 3TMOA 2QCOA 4D9JA 2WTEA 4V19K 3PO2J 5EYRA 3BTJA 3DU6A 5K5OA 4Z2YA 1WGXA 4HQEA 3CP8A 4IHTA 4PSXA 3OYHA 5D5WB 2BY1A 3TO9A 4BXXJ 4M9XA 4DVYP 4PJLA 1YOVB 2PLYA 1HW5A 2DK8A 5F08A 1RESA 1T38A 3ZQ7A 4Q4ZF 2VODA 3GFMA 3BJOA 3GEUA 1J2XA 5BPIA 4WK8F 4C3HJ 2B63J 4GCKA 2D5VA 3OYEA 3J7AO 1P7IA 1BOBA 1V5EA 1X1CA 3VYTB 2CUJA 2CS3A 2DA6A 3NWTA 3OYGA 1GLNA 1MSFC 3KKCA 2GWRA 4E7IA 3EQLF 3S2HJ 1JHFA 4BBRJ 1SFKA 1BIBA 2DA4A 2H09A 1S7EA 3A4CA 3LA7A 3LA3A 5CVJA 3ZCOA 4BDYA 5FMPA 4BUPA 2NNNA 2VB6A 3GCMA 2VOPA 4UVCA 4AC6A 2KHMA 1Z91A 1PUFB 2WC2A 4BBSJ 4JX5A 3AKZA 2OC6A 3QYBA 2VASA 3D5RC 4M74A 2XSJC 3G4SI 4RMNA 3A2KA 4UXNA 2IRFG 4PZJA 4X6AJ 4ZYEA 1GVJA 2DMQA 2WADA 3PQKA 1ETXA 2YS9A 1FYMA 1S3JA 4IL6C 3CJDA 4P9FA 4BL0B 4HX4A 2LTPA 2DN0A 2NP3A 5HAWA 2DT7B 4KIBA 3FHZA 2K40A 1S8NA 1I1SA 3CCEI 1X2MA 1Z3XA 3HBLA 3V78A 3RQ4A 3AG3H 3JREA 3F8FA 4HEA2 3CF2A 3ML6A 1F36A 4E70A 1V3FA 2G7LA 5HNFA 5E79C 1QVTA 4ENMA 2DA3A 2D2WA 1IRZA 5J8FA 2QYOA 3TOBA 3AL0C 4U87A 3R0JA 3L7WA 4BQNA 4EV0A 3BLYA 5K5QA 4BNCA 4A0ZA 2L9VA 3QPHA 1YRNB 1U5TC 2JJ7A 4LMYA 3IUVA 2QLZA 1U5TA 5CPRB 1GV2A 1TP4A 3L2QA 4UUVA 3SXYA 2CU7A 2L7FP 1XD7A 1I39A 4ENKA 1O4XA 2DW4A 1S72I 4ENJA 2HQNA 3I4NJ 1VQKI 2K9NA 3I54A 3VEPA 4B3AA 3H3UA 2A07F 4Y13A 2OZ6A 1IW7F 5EEHA 1R4NB 3UKGA 3BTLA 1HKQA 3FKIJ 2PI0A 2VOOA 1H0MA 1BC7C 1XDUA 1YJ9I
chains in the Genus database with same CATH topology
1H88C 2UXUA 2EZKA 1FJLA 2ID3A 2ELKA 5E3MA 4YZEA 3BNIA 3P9TA 2V57A 2EQRA 1ETKA 3AQSA 3MVPA 2WAQN 1B8IB 1CQTA 1RPWA 3BR5A 3HTHA 4XRMA 5M5XJ 3JRCA 3G1MA 4DW6A 2OPTA 4FCYA 3Q0WA 1I50J 4GCTA 3GTKJ 4W1UA 4JKZA 3QPSA 4CYCB 3S14J 4FTHA 3S2DJ 2NX4A 2LKXA 2CJJA 3LSRA 3CRJA 4B4CA 2MGQA 1MSEC 5CXGA 5K58A 5IYBJ 2EH3A 2MG4A 2G3BA 1JKPC 4GFKA 4W97A 3ON2A 2JA8J 3KNWA 5GPAA 3ANGA 3QKXA 4RBOA 3FRQA 1AU7A 1LFBA 2LK2A 3F0CA 1OCPA 2JA5J 2G0EA 3VOXA 1FTZA 3GTJJ 4GFBA 2FBQA 4D5CA 1HLVA 3HTJA 2XB5A 3PM1A 4MXMA 2NVXJ 5IOZA 3L1PA 3GTQJ 2WUIA 3K7AJ 2HI3A 3G1OA 1LE8A 5H9TA 5D18A 1OCTC 2G7GA 2HOAA 2DMPA 3W6VA 3KZ9A 2R92J 3TP3A 5K7FA 1LFUP 1R9TJ 4HKUA 1DU0A 2GUHA 1MBKA 2AO9A 4MFDA 4M3DA 3Q0UA 4AUXA 3GTMJ 3TW7A 4L5EA 1GV5A 1T56A 4EEFG 3IH4A 3S1MJ 3DPJA 3AQTA 1ORKA 2IBDA 3OOUA 1H8AC 2XSDC 3Q0VA 1BW6A 2F07A 2FX0A 4UUSA 2GLOA 3S1QJ 3NNRA 5EGOB 2Q24A 1UMQA 4BY7J 3VP5A 3BTCA 4DZPA 4ABZA 5EZHA 5J1YA 2WB1N 5IYCJ 2R5YB 3HE0A 3VIBA 3PASA 2REKA 3IH3A 5J1UA 2TRTA 5F0CA 3VUQA 1JTXA 5C4XJ 4D7NA 2EZHA 3BR3A 2YVEA 4XRSA 2ZCMA 1K83J 2N8GA 3KKDA 3V6GA 1MBFA 1JUMA 4GFLA 3B81A 1ZGWA 3RD3A 5C4JJ 4UUTA 3LWJA 1RKTA 2Y2ZA 5K7ZA 3RKQA 3LSPA 3G56A 5FKKA 2EZIA 5K7HA 2XPUA 3WHCA 5FGLA 2LLKA 4A93J 5JLXA 4IHWA 4QTRA 1APLC 4A3LJ 1FIAA 2IU5A 4B1RA 2COBA 5M3MJ 4S0HB 1MBJA 4PXIA 5EF6A 1XS9A 1IGNA 3GTPJ 3HTAA 5DTDA 3CQZJ 3RZOJ 2HXOA 2LFBA 2W48A 2PMZN 4JX6A 3JRFA 1ETYA 2R0QC 1ZKGA 2VI6A 1AHDP 1Z77A 2NS8A 1MBGA 1WCMJ 4IHVA 3HOYJ 1ITYA 1W0UA 3LNQA 4XIDA 5BNGA 1QPIA 1HDPA 3HGGA 1U9OA 5E3LA 1OFCX 4NELA 2JK3A 3C07A 1JJ8C 2D6YA 1F43A 4UDSA 4HNVA 3ZOBA 3Q3SA 3HDDA 2R5ZB 4LOCA 2CUFA 3FK7A 3DCFA 1ZQ3P 3RH2A 3QBMA 4DZJA 1P7JA 4DYCA 4D7MA 4ME9A 2R7ZJ 5E3NA 3JR9A 2CUEA 3LJLA 2EBIA 2GENA 2NS7A 2JA6J 1ETWA 2VUMJ 2QTQA 2XGDA 3EUPA 2L7MP 2UXPA 5D19A 3HM5A 3HOZJ 2DMTA 1TWHJ 2KT0A 3H3VK 2OERA 5F0FA 1U9NA 1LE8B 3BHQA 2L0KA 3IV5A 2IEKA 3LSGA 1YRNA 3E7QA 4Y52J 4A3CJ 2QWTA 3QQAA 2HOTA 1DU6A 2DMUA 5M3FJ 4AC0A 5CXIA 5JLWA 2QKOA 4IEJA 4C3JJ 1ZR4A 1E3OC 5IP9J 2E2JJ 3FK6A 1UI6A 3K2AA 3BR1A 1BL0A 4XRSG 1Y1VJ 1NK2P 4A69C 1NTCA 4KWAA 4A3JJ 3OSFA 1VFCA 3BQYA 5FLMJ 1IJWC 3DEWA 1ETQA 4UUSB 2UXOA 2E1OA 3I4MJ 2HKUA 1VF9A 5DS9A 1WH5A 1FIPA 2XB0X 4M3EA 1HOMA 2ECCA 1IDYA 1VI0A 2M9HA 1I6HJ 3T6NA 2TCTA 5GPCA 1IG7A 2HYTA 4A3EJ 2CQXA 1UG2A 4DYQA 2RAEA 1TC3C 3S1RJ 2UXIA 4J19A 1ZR2A 1MBEA 1OJLA 4V2GA 3BG9A 1SFOJ 3NPIA 4JYKA 1ETOA 3ZQLA 4MIMA 2ZOZA 4M3GA 9ANTA 4CYCA 4MK6A 5FJ8J 3S17J 2G7SA 2HXIA 5F27A 3JRAA 4V2FA 3BG3A 1Z0XA 1XC5A 2NVTJ 5IP7J 1UHSA 3NXCA 2VKVA 3E7LA 3LOCA 2XPVA 3HTIA 4XK4A 3HOWJ 5C3EJ 2YU9J 3BCGA 3SFIA 3VW2A 3BT9A 2CRGA 3ZQHA 2K9QA 5FHPA 3A01A 4A3GJ 2OI8A 3GTOJ 2DA7A 4JNNA 2CQQA 1JKOC 1SANA 2DA2A 5EZGA 3F1BA 2ME6A 3BR6A 1NK3P 1VNDA 3PO3J 5EFYA 3CDLA 3B6CA 3COLA 1WI3A 1ZTRA 1BJZA 5J1RA 1W0TA 3S15J 5IPAA 5EG0B 1X2NA 1JT6A 4XICA 1GDTA 2L9RA 2X6OA 1ENHA 3S16J 3SDGA 3NARA 2H8RA 3MNLA 2DJNA 2EZLA 2DG8A 3BJBA 3HOVJ 2VKEA 4A3KJ 1AKHA 2JN6A 2ZB9A 1U78A 4QIWN 2HDDA 1PUFA 5EGOA 5FKMA 3H0GJ 3IH2A 3M3YJ 4L62A 2ZOYA 2LY9A 2XGEA 2Y9ZA 2AHQA 1Q1VA 2R5YA 2LP0A 2R93J 4I6ZA 5HSZA 4M6VA 1QRYA 2M8GX 3BR0A 1JKQC 2QIBA 5EDNA 2E2HJ 1IDZA 1UI5A 2DA5A 3CMYA 3CWRA 4CGRA 3VVXA 5HBUA 5E3OA 1JTYA 1JUPA 3NRGA 3ZQFA 3NI7A 1FTTA 2DA1A 1Y1WJ 2HQ5A 3JSJA 4MFEA 1HF0A 5F0HA 3GTLJ 1TWCJ 5J3LA 1JKRC 1EF4A 2VPRA 2DMNA 2X48A 3HB9A 5F04A 3VPRA 1XG1A 1TWGJ 2FQ4A 2HYJA 3A03A 3CCYA 3TW6A 5EEAA 4FISA 3S1NJ 2NOGA 3A02A 4I76A 5F1JA 3GTGJ 5M5WJ 4JP0A 1I3QJ 2FD5A 2I10A 3GBGA 4A3DJ 3JRBA 1B72A 3HKZN 1MNMC 3ZQGA 5DAJA 3TEDA 2GBYA 2W53A 1GUUA 1MH3A 4IHXA 1RR7A 2O8KA 2XGCA 2Y9YA 4X1EA 3VW0A 2UXHA 3O60A 5C4YA 4C2MJ 1X58A 5IOYA 3NAUA 1T33A 2O7TA 1JUSA 3SJMA 2Y30A 3RZDJ 3JRGA 4ACIA 5FKLA 3VW1A 1K61A 4ICHA 2M2EA 4RDUA 3HOUJ 3RQIA 4G12A 1MBHA 1JJ6C 5AQCA 1QVUA 1IV6A 3OIOA 3VVZA 2NVQJ 3ANPA 3C2BA 2OF7A 1FEXA 1SGMA 3LHQA 1TWFJ 2GFNA 2E2IJ 2K9SA 2O9LA 2M0CA 5GP9A 3O8HA 2R5ZA 1RETA 2QCOA 1D5YA 3FIWA 5C44J 1B8IA 3PO2J 1POGA 5EYRA 1U8BA 3BTJA 4DYRA 3HIMA 1WGXA 1TWAJ 3GZIA 3A01B 4BXXJ 1GVDA 2YUSA 3TP0A 1WPKA 4FE4A 5F08A 1RESA 1HDDC 2FJ1A 5FKNA 4JX4A 2ME0A 2ZCXA 3GEUA 3VVYA 4FE7A 4A3FJ 3BR2A 2YVHA 2LR8A 2MW8A 4C3HJ 3HEFA 3BTIA 3QPLA 2XPWA 2B63J 4GCKA 2D5VA 2NP5A 4MO7A 2JWTA 4A3MJ 1P7IA 3JRHA 3O8GA 2PZ9A 4BKXA 4M3BA 4NDLA 2DA6A 1ZK8A 2M34A 2DTZA 2DG7A 2ECBA 1MSFC 3KKCA 3S2HJ 1HCRA 4BBRJ 2DA4A 1S7EA 2ZCNA 1WH7A 5FMPA 1AKHB 3ON4A 2GM4A 2P81A 3MN2A 4IHYA 2JA7J 4AC6A 1PUFB 4BBSJ 4JX5A 1H89C 2NVYJ 3JRIA 3G7RA 2WGBA 4X6AJ 2DMQA 1ETXA 2YS9A 4D5FA 1MH4A 3EGQA 2HOSA 3CJDA 4M3FA 3BRUA 2LTPA 3PPBA 2QF7A 2DN0A 2X9DA 2NP3A 2QOPA 4AF5A 5HAWA 1JT0A 2Y0SN 4C3IJ 2K40A 4AYBN 2PBXA 4JL3A 3G1LA 1X2MA 2RASA 3HBLA 1RKWA 2Y31A 2LVSA 3B6AA 2XRLA 5FKOA 3ZQIA 1BA5A 3S5RA 3V78A 4GCLA 3JREA 1BW5A 3JRDA 1JGGA 1F36A 5M5YJ 1A6IA 4QSHA 1IC8A 2ID6A 2L7ZA 5IYDJ 2G7LA 1IUFA 1QVTA 2DA3A 2XDNA 3BQZA 1IRZA 3VOKA 2KDZA 2RHAA 1ETVA 2E19A 3OSGA 3LSJA 1B72B 3HGYA 5CW8A 1YRNB 2JJ7A 3HOXJ 3IUVA 2JMWA 4NN1A 1GV2A 3M4OJ 2CU7A 2L7FP 4MLOA 3BG5A 4A3IJ 1O4XA 3D1NI 3FISA 5FLVA 2WV1A 3I4NJ 1GT0C 2K9NA 4B3AA 5HODA 2IAIA 5IP6A 4A3BJ 3WHBA 1G2HA 2MSYA 2LD5A 4BY1J 3UKGA 3BTLA 5EG0A 3FKIJ 4Y7NJ 1A5JA 3ZQCA 2O7OA 2H1KA 5D1RA 3MKLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H88 C;  2UXU A;  2EZK A;  1FJL A;  2ID3 A;  2ELK A;  5E3M A;  4YZE A;  3BNI A;  3P9T A;  2V57 A;  2EQR A;  1ETK A;  3AQS A;  3MVP A;  2WAQ N;  1B8I B;  1CQT A;  1RPW A;  3BR5 A;  3HTH A;  4XRM A;  5M5X J;  3JRC A;  3G1M A;  4DW6 A;  2OPT A;  4FCY A;  3Q0W A;  1I50 J;  4GCT A;  3GTK J;  4W1U A;  4JKZ A;  3QPS A;  4CYC B;  3S14 J;  4FTH A;  3S2D J;  2NX4 A;  2LKX A;  2CJJ A;  3LSR A;  3CRJ A;  4B4C A;  2MGQ A;  1MSE C;  5CXG A;  5K58 A;  5IYB J;  2EH3 A;  2MG4 A;  2G3B A;  1JKP C;  4GFK A;  4W97 A;  3ON2 A;  2JA8 J;  3KNW A;  5GPA A;  3ANG A;  3QKX A;  4RBO A;  3FRQ A;  1AU7 A;  1LFB A;  2LK2 A;  3F0C A;  1OCP A;  2JA5 J;  2G0E A;  3VOX A;  1FTZ A;  3GTJ J;  4GFB A;  2FBQ A;  4D5C A;  1HLV A;  3HTJ A;  2XB5 A;  3PM1 A;  4MXM A;  2NVX J;  5IOZ A;  3L1P A;  3GTQ J;  2WUI A;  3K7A J;  2HI3 A;  3G1O A;  1LE8 A;  5H9T A;  5D18 A;  1OCT C;  2G7G A;  2HOA A;  2DMP A;  3W6V A;  3KZ9 A;  2R92 J;  3TP3 A;  5K7F A;  1LFU P;  1R9T J;  4HKU A;  1DU0 A;  2GUH A;  1MBK A;  2AO9 A;  4MFD A;  4M3D A;  3Q0U A;  4AUX A;  3GTM J;  3TW7 A;  4L5E A;  1GV5 A;  1T56 A;  4EEF G;  3IH4 A;  3S1M J;  3DPJ A;  3AQT A;  1ORK A;  2IBD A;  3OOU A;  1H8A C;  2XSD C;  3Q0V A;  1BW6 A;  2F07 A;  2FX0 A;  4UUS A;  2GLO A;  3S1Q J;  3NNR A;  5EGO B;  2Q24 A;  1UMQ A;  4BY7 J;  3VP5 A;  3BTC A;  4DZP A;  4ABZ A;  5EZH A;  5J1Y A;  2WB1 N;  5IYC J;  2R5Y B;  3HE0 A;  3VIB A;  3PAS A;  2REK A;  3IH3 A;  5J1U A;  2TRT A;  5F0C A;  3VUQ A;  1JTX A;  5C4X J;  4D7N A;  2EZH A;  3BR3 A;  2YVE A;  4XRS A;  2ZCM A;  1K83 J;  2N8G A;  3KKD A;  3V6G A;  1MBF A;  1JUM A;  4GFL A;  3B81 A;  1ZGW A;  3RD3 A;  5C4J J;  4UUT A;  3LWJ A;  1RKT A;  2Y2Z A;  5K7Z A;  3RKQ A;  3LSP A;  3G56 A;  5FKK A;  2EZI A;  5K7H A;  2XPU A;  3WHC A;  5FGL A;  2LLK A;  4A93 J;  5JLX A;  4IHW A;  4QTR A;  1APL C;  4A3L J;  1FIA A;  2IU5 A;  4B1R A;  2COB A;  5M3M J;  4S0H B;  1MBJ A;  4PXI A;  5EF6 A;  1XS9 A;  1IGN A;  3GTP J;  3HTA A;  5DTD A;  3CQZ J;  3RZO J;  2HXO A;  2LFB A;  2W48 A;  2PMZ N;  4JX6 A;  3JRF A;  1ETY A;  2R0Q C;  1ZKG A;  2VI6 A;  1AHD P;  1Z77 A;  2NS8 A;  1MBG A;  1WCM J;  4IHV A;  3HOY J;  1ITY A;  1W0U A;  3LNQ A;  4XID A;  5BNG A;  1QPI A;  1HDP A;  3HGG A;  1U9O A;  5E3L A;  1OFC X;  4NEL A;  2JK3 A;  3C07 A;  1JJ8 C;  2D6Y A;  1F43 A;  4UDS A;  4HNV A;  3ZOB A;  3Q3S A;  3HDD A;  2R5Z B;  4LOC A;  2CUF A;  3FK7 A;  3DCF A;  1ZQ3 P;  3RH2 A;  3QBM A;  4DZJ A;  1P7J A;  4DYC A;  4D7M A;  4ME9 A;  2R7Z J;  5E3N A;  3JR9 A;  2CUE A;  3LJL A;  2EBI A;  2GEN A;  2NS7 A;  2JA6 J;  1ETW A;  2VUM J;  2QTQ A;  2XGD A;  3EUP A;  2L7M P;  2UXP A;  5D19 A;  3HM5 A;  3HOZ J;  2DMT A;  1TWH J;  2KT0 A;  3H3V K;  2OER A;  5F0F A;  1U9N A;  1LE8 B;  3BHQ A;  2L0K A;  3IV5 A;  2IEK A;  3LSG A;  1YRN A;  3E7Q A;  4Y52 J;  4A3C J;  2QWT A;  3QQA A;  2HOT A;  1DU6 A;  2DMU A;  5M3F J;  4AC0 A;  5CXI A;  5JLW A;  2QKO A;  4IEJ A;  4C3J J;  1ZR4 A;  1E3O C;  5IP9 J;  2E2J J;  3FK6 A;  1UI6 A;  3K2A A;  3BR1 A;  1BL0 A;  4XRS G;  1Y1V J;  1NK2 P;  4A69 C;  1NTC A;  4KWA A;  4A3J J;  3OSF A;  1VFC A;  3BQY A;  5FLM J;  1IJW C;  3DEW A;  1ETQ A;  4UUS B;  2UXO A;  2E1O A;  3I4M J;  2HKU A;  1VF9 A;  5DS9 A;  1WH5 A;  1FIP A;  2XB0 X;  4M3E A;  1HOM A;  2ECC A;  1IDY A;  1VI0 A;  2M9H A;  1I6H J;  3T6N A;  2TCT A;  5GPC A;  1IG7 A;  2HYT A;  4A3E J;  2CQX A;  1UG2 A;  4DYQ A;  2RAE A;  1TC3 C;  3S1R J;  2UXI A;  4J19 A;  1ZR2 A;  1MBE A;  1OJL A;  4V2G A;  3BG9 A;  1SFO J;  3NPI A;  4JYK A;  1ETO A;  3ZQL A;  4MIM A;  2ZOZ A;  4M3G A;  9ANT A;  4CYC A;  4MK6 A;  5FJ8 J;  3S17 J;  2G7S A;  2HXI A;  5F27 A;  3JRA A;  4V2F A;  3BG3 A;  1Z0X A;  1XC5 A;  2NVT J;  5IP7 J;  1UHS A;  3NXC A;  2VKV A;  3E7L A;  3LOC A;  2XPV A;  3HTI A;  4XK4 A;  3HOW J;  5C3E J;  2YU9 J;  3BCG A;  3SFI A;  3VW2 A;  3BT9 A;  2CRG A;  3ZQH A;  2K9Q A;  5FHP A;  3A01 A;  4A3G J;  2OI8 A;  3GTO J;  2DA7 A;  4JNN A;  2CQQ A;  1JKO C;  1SAN A;  2DA2 A;  5EZG A;  3F1B A;  2ME6 A;  3BR6 A;  1NK3 P;  1VND A;  3PO3 J;  5EFY A;  3CDL A;  3B6C A;  3COL A;  1WI3 A;  1ZTR A;  1BJZ A;  5J1R A;  1W0T A;  3S15 J;  5IPA A;  5EG0 B;  1X2N A;  1JT6 A;  4XIC A;  1GDT A;  2L9R A;  2X6O A;  1ENH A;  3S16 J;  3SDG A;  3NAR A;  2H8R A;  3MNL A;  2DJN A;  2EZL A;  2DG8 A;  3BJB A;  3HOV J;  2VKE A;  4A3K J;  1AKH A;  2JN6 A;  2ZB9 A;  1U78 A;  4QIW N;  2HDD A;  1PUF A;  5EGO A;  5FKM A;  3H0G J;  3IH2 A;  3M3Y J;  4L62 A;  2ZOY A;  2LY9 A;  2XGE A;  2Y9Z A;  2AHQ A;  1Q1V A;  2R5Y A;  2LP0 A;  2R93 J;  4I6Z A;  5HSZ A;  4M6V A;  1QRY A;  2M8G X;  3BR0 A;  1JKQ C;  2QIB A;  5EDN A;  2E2H J;  1IDZ A;  1UI5 A;  2DA5 A;  3CMY A;  3CWR A;  4CGR A;  3VVX A;  5HBU A;  5E3O A;  1JTY A;  1JUP A;  3NRG A;  3ZQF A;  3NI7 A;  1FTT A;  2DA1 A;  1Y1W J;  2HQ5 A;  3JSJ A;  4MFE A;  1HF0 A;  5F0H A;  3GTL J;  1TWC J;  5J3L A;  1JKR C;  1EF4 A;  2VPR A;  2DMN A;  2X48 A;  3HB9 A;  5F04 A;  3VPR A;  1XG1 A;  1TWG J;  2FQ4 A;  2HYJ A;  3A03 A;  3CCY A;  3TW6 A;  5EEA A;  4FIS A;  3S1N J;  2NOG A;  3A02 A;  4I76 A;  5F1J A;  3GTG J;  5M5W J;  4JP0 A;  1I3Q J;  2FD5 A;  2I10 A;  3GBG A;  4A3D J;  3JRB A;  1B72 A;  3HKZ N;  1MNM C;  3ZQG A;  5DAJ A;  3TED A;  2GBY A;  2W53 A;  1GUU A;  1MH3 A;  4IHX A;  1RR7 A;  2O8K A;  2XGC A;  2Y9Y A;  4X1E A;  3VW0 A;  2UXH A;  3O60 A;  5C4Y A;  4C2M J;  1X58 A;  5IOY A;  3NAU A;  1T33 A;  2O7T A;  1JUS A;  3SJM A;  2Y30 A;  3RZD J;  3JRG A;  4ACI A;  5FKL A;  3VW1 A;  1K61 A;  4ICH A;  2M2E A;  4RDU A;  3HOU J;  3RQI A;  4G12 A;  1MBH A;  1JJ6 C;  5AQC A;  1QVU A;  1IV6 A;  3OIO A;  3VVZ A;  2NVQ J;  3ANP A;  3C2B A;  2OF7 A;  1FEX A;  1SGM A;  3LHQ A;  1TWF J;  2GFN A;  2E2I J;  2K9S A;  2O9L A;  2M0C A;  5GP9 A;  3O8H A;  2R5Z A;  1RET A;  2QCO A;  1D5Y A;  3FIW A;  5C44 J;  1B8I A;  3PO2 J;  1POG A;  5EYR A;  1U8B A;  3BTJ A;  4DYR A;  3HIM A;  1WGX A;  1TWA J;  3GZI A;  3A01 B;  4BXX J;  1GVD A;  2YUS A;  3TP0 A;  1WPK A;  4FE4 A;  5F08 A;  1RES A;  1HDD C;  2FJ1 A;  5FKN A;  4JX4 A;  2ME0 A;  2ZCX A;  3GEU A;  3VVY A;  4FE7 A;  4A3F J;  3BR2 A;  2YVH A;  2LR8 A;  2MW8 A;  4C3H J;  3HEF A;  3BTI A;  3QPL A;  2XPW A;  2B63 J;  4GCK A;  2D5V A;  2NP5 A;  4MO7 A;  2JWT A;  4A3M J;  1P7I A;  3JRH A;  3O8G A;  2PZ9 A;  4BKX A;  4M3B A;  4NDL A;  2DA6 A;  1ZK8 A;  2M34 A;  2DTZ A;  2DG7 A;  2ECB A;  1MSF C;  3KKC A;  3S2H J;  1HCR A;  4BBR J;  2DA4 A;  1S7E A;  2ZCN A;  1WH7 A;  5FMP A;  1AKH B;  3ON4 A;  2GM4 A;  2P81 A;  3MN2 A;  4IHY A;  2JA7 J;  4AC6 A;  1PUF B;  4BBS J;  4JX5 A;  1H89 C;  2NVY J;  3JRI A;  3G7R A;  2WGB A;  4X6A J;  2DMQ A;  1ETX A;  2YS9 A;  4D5F A;  1MH4 A;  3EGQ A;  2HOS A;  3CJD A;  4M3F A;  3BRU A;  2LTP A;  3PPB A;  2QF7 A;  2DN0 A;  2X9D A;  2NP3 A;  2QOP A;  4AF5 A;  5HAW A;  1JT0 A;  2Y0S N;  4C3I J;  2K40 A;  4AYB N;  2PBX A;  4JL3 A;  3G1L A;  1X2M A;  2RAS A;  3HBL A;  1RKW A;  2Y31 A;  2LVS A;  3B6A A;  2XRL A;  5FKO A;  3ZQI A;  1BA5 A;  3S5R A;  3V78 A;  4GCL A;  3JRE A;  1BW5 A;  3JRD A;  1JGG A;  1F36 A;  5M5Y J;  1A6I A;  4QSH A;  1IC8 A;  2ID6 A;  2L7Z A;  5IYD J;  2G7L A;  1IUF A;  1QVT A;  2DA3 A;  2XDN A;  3BQZ A;  1IRZ A;  3VOK A;  2KDZ A;  2RHA A;  1ETV A;  2E19 A;  3OSG A;  3LSJ A;  1B72 B;  3HGY A;  5CW8 A;  1YRN B;  2JJ7 A;  3HOX J;  3IUV A;  2JMW A;  4NN1 A;  1GV2 A;  3M4O J;  2CU7 A;  2L7F P;  4MLO A;  3BG5 A;  4A3I J;  1O4X A;  3D1N I;  3FIS A;  5FLV A;  2WV1 A;  3I4N J;  1GT0 C;  2K9N A;  4B3A A;  5HOD A;  2IAI A;  5IP6 A;  4A3B J;  3WHB A;  1G2H A;  2MSY A;  2LD5 A;  4BY1 J;  3UKG A;  3BTL A;  5EG0 A;  3FKI J;  4Y7N J;  1A5J A;  3ZQC A;  2O7O A;  2H1K A;  5D1R A;  3MKL A; 
#chains in the Genus database with same CATH topology
 2BE5 F;  2GXB A;  3RPU A;  2OBP A;  2ELK A;  2ZXH A;  3JAM K;  3J7Z I;  3IKT A;  3AQS A;  3MVP A;  3VTI A;  2R7S A;  2A6E F;  5GAD J;  3FMR A;  1RPW A;  1LEB A;  4C30 A;  1KYW A;  2AXL A;  3DTK A;  3FHN A;  3PUB A;  3QPT A;  3BG7 A;  2R7U A;  3T5X A;  3CUQ A;  4ANJ A;  2VPL A;  3PIO F;  4W1U A;  5KK1 A;  3IUO A;  4QPO A;  1IF1 A;  2EIN H;  4I2O A;  4AIJ A;  1SMY F;  1LDJ A;  1XCB A;  4FTH A;  3EUH A;  3S2D J;  2Z99 A;  3CJR B;  2LKX A;  1IN8 A;  5K58 A;  3KCC A;  1UHM A;  2W1O A;  5IYB J;  4KA4 A;  1P9Q C;  2CW8 A;  4PJ0 C;  2JA8 J;  5GPA A;  5HNH A;  3OY9 A;  3DQV C;  4RAZ A;  1ZRF A;  2ZJR F;  2LRE A;  4G94 A;  2Z5U A;  3F0C A;  4L9T A;  2WY8 Q;  1FTZ A;  3GTJ J;  3ZRG A;  2NNY A;  4D5C A;  3GLX A;  3V8L A;  1HLV A;  3HTJ A;  3E6M A;  2W84 A;  3CCR I;  1TQI A;  1YS7 A;  4XKB A;  2KZG A;  5CVU A;  3K4K A;  5H9T A;  3FXJ A;  4QPQ A;  1OCT C;  1Y56 A;  2ADU A;  4BEH B;  3S3N A;  2V1N A;  1FMV A;  3DFG A;  3I5U A;  4E6K G;  2GUH A;  1MBK A;  3R60 A;  1QNT A;  2AO9 A;  2D1V A;  4GXO A;  2XGX A;  1OMI A;  3W2W A;  4CCO A;  1G3T A;  2PJR B;  1ORK A;  3AQT A;  2IBD A;  2BGC A;  1H8A C;  4N9H A;  3GZ6 A;  3WE3 A;  1B9M A;  2BHY A;  1H9G A;  1UAA A;  2F07 A;  4LIV A;  3S1Q J;  4XN3 A;  4Y3O A;  4BY7 J;  2HWV A;  2QQB A;  4KUM A;  2E1M C;  5EZH A;  3E0J B;  2R5Y B;  2JQ7 A;  3BWG A;  3DV8 A;  4BE2 A;  3IH3 A;  3SWH A;  4NC8 A;  4NB5 A;  3OYD A;  5FFZ A;  4J00 A;  1KU9 A;  1VQ8 I;  3BR3 A;  2YVE A;  4XRS A;  2ZCM A;  3OV8 A;  1K83 J;  3V6G A;  2PJP A;  3HOT A;  1MBF A;  1JUM A;  2XV4 S;  1R58 A;  1Z1D A;  5J4Y A;  3OS1 A;  3CCV I;  2Y2Z A;  3G56 A;  2W25 A;  4OWR B;  3IL2 A;  1I1G A;  4HBL A;  5FGL A;  2LLK A;  2L3D A;  5BMZ A;  2PX9 A;  1PP7 U;  4A93 J;  3C3W A;  4IHW A;  5LLQ A;  1M1E B;  5KNL A;  1APL C;  4PSW A;  3X2Q H;  1EH7 A;  2DT5 A;  2EA2 A;  1GXP A;  2KMU A;  5M3M J;  4Q5S F;  1G8X A;  4WXD A;  3WGH A;  2PMH A;  1OYW A;  2JPC A;  1QPM A;  3GTP J;  3HTA A;  2FRH A;  2P5K A;  4PGH A;  2W57 A;  3CDH A;  5BPD A;  2GXA A;  2P0W A;  1AHD P;  3H0D A;  2B3W A;  2DI3 A;  2NS8 A;  3CME I;  2FJI 1;  3JSP A;  2Z1D A;  4QLC U;  3Q9V A;  4HA8 A;  4XID A;  2DDB A;  4KYW A;  3HGG A;  4NEL A;  1OFC X;  4S05 A;  2CV0 A;  5F1R A;  2XF5 A;  2ELJ A;  1TNT A;  1DPR A;  5FGM A;  1JJ8 C;  2V26 A;  3FDY A;  1F43 A;  3CCM I;  1R49 A;  1R71 A;  2R5Z B;  4LOC A;  3P5J A;  4PJM A;  2R7W A;  4GRI A;  3RH2 A;  1SD6 A;  4ME9 A;  2ETH A;  4D7M A;  2IP2 A;  3JR9 A;  4NNJ A;  3MQ0 A;  3LJL A;  3CC4 I;  3ELK A;  1ETW A;  2MYS A;  5HS8 A;  2E7X A;  3HOZ J;  1K79 A;  3IRR A;  1TWH J;  1AWC A;  2KT0 A;  1U9N A;  1LE8 B;  1SAU A;  2L0K A;  3IV5 A;  2H27 A;  2M8E A;  3EPZ A;  4Y52 J;  2DMU A;  1ZRC A;  1UB9 A;  5GAH J;  2QKO A;  2XAJ A;  1ZG1 A;  2VT2 A;  5IP9 J;  1UI6 A;  2W4S A;  1DGR M;  3BR1 A;  3K2A A;  1K78 B;  2K9M A;  4K2E A;  5H2F C;  2HVS A;  3IWF A;  2MD5 A;  4A69 C;  1R5H A;  1NTC A;  4KWA A;  4A3J J;  3A0H C;  3BQY A;  5FLM J;  3EDP A;  1IJW C;  2MH9 A;  1QHG A;  2ZXJ A;  1KU2 A;  4BAY A;  4G7H F;  2EV6 A;  2LG4 A;  1KON A;  2IXS A;  3JW4 A;  5HS9 A;  4A5M A;  2F5C A;  2M4K A;  1OCC H;  5KHD A;  1ON2 A;  1W7P B;  3VOE A;  1WH5 A;  3F22 A;  3VYU B;  5LFA A;  1N25 A;  2HZD A;  4B8X A;  1HOM A;  1IDY A;  3K69 A;  5GPC A;  3NQO A;  4A3E J;  1BR4 A;  4DYQ A;  1XGO A;  3FMS A;  3IAS 2;  3E5Q A;  4M9Z A;  3S1R J;  2UXI A;  2BBY A;  5B1A H;  1SVO A;  4PFO A;  4M3G A;  3U9G A;  5AON A;  9ANT A;  2GOM A;  3G6E I;  1FOY A;  4BE0 A;  1RIO H;  2G7S A;  2HXI A;  2UZK A;  1EV7 A;  1ZLK A;  3JRA A;  4V2F A;  2KZV A;  2EIL H;  1BI1 A;  1LQ1 A;  3NXC A;  2FMY A;  3TL4 X;  5GTH C;  2XPV A;  4IX7 A;  3R61 A;  3WTS C;  3ULQ B;  1R7J A;  2P7C B;  4OIO F;  2R7D A;  3SFI A;  3BT9 A;  3HYI A;  2CRG A;  3AL0 B;  2K9Q A;  4O3M A;  5E8I A;  2K3P A;  4M9S A;  3OR1 C;  4IXA A;  3RYR A;  3FKJ A;  2ZJQ F;  3LL7 A;  3H9J A;  3SZP A;  2CYY A;  5LHI A;  2OI8 A;  3F8B A;  3NNR A;  4OU0 A;  2TDX A;  2Q2E A;  4YEJ A;  1JKO C;  5EZG A;  2RQP A;  2OCE A;  2FNP A;  2ME6 A;  3SFZ A;  3DBH B;  5ICE A;  2ZBK A;  1VND A;  4LK0 F;  2Z3Y A;  2OA4 A;  4BH9 A;  1ZRD A;  2HVQ A;  4NC7 A;  1BJZ A;  5J1R A;  2HQR A;  1JT6 A;  2CUZ A;  4G9Y A;  3PIP F;  5DUK A;  2RV8 A;  3MNL A;  4CDG A;  3DTE A;  2VKE A;  1VQM I;  3MD2 A;  1R1U A;  2XIG A;  4RLQ A;  3LQR A;  1U78 A;  1RNL A;  1PUF A;  5KAF C;  2CV2 A;  5EGO A;  4BQO A;  3M8E A;  2LY9 A;  3RSN A;  2Y9Z A;  3ABL H;  2BVM A;  4RM3 A;  2KKO A;  2LP0 A;  3RKW A;  1XCV A;  3KLO A;  4CYD A;  5HSZ A;  2VKD A;  1JKQ C;  2GIV A;  2EIM H;  2CQN A;  3ISP A;  3QWL A;  4XBF A;  5L3B A;  3CWR A;  3I3L A;  3T1B A;  1LVK A;  3KP7 A;  1FTT A;  1KQ9 A;  1FMW A;  2M7A A;  1E2X A;  5D5X B;  2HQ5 A;  4KN4 X;  3P9I A;  4HAM A;  3GTL J;  1MJ9 A;  1J59 A;  3O3K A;  5B66 C;  2DMN A;  5BOX A;  2KFD A;  2DFF A;  3V4G A;  4KT5 C;  4UY8 I;  2FQ4 A;  3BOQ A;  1W1W E;  5F1J A;  4IHS A;  3GTG J;  5M5W J;  1MKM A;  2I10 A;  2L2O A;  3KP2 A;  4AIH A;  2GBY A;  3SZG A;  4ZYG A;  1X1A A;  1RR7 A;  4RA2 A;  4WF2 A;  3O60 A;  4LG3 A;  1XX5 A;  2PN6 A;  3EUK L;  3JRG A;  2M3A A;  3E1S A;  1K61 A;  4HZF A;  4ICH A;  1WHU A;  1R23 A;  2M2E A;  2IW5 A;  3HOU J;  3RQI A;  4G12 A;  1JJ6 C;  1IV6 A;  2KJC A;  5ILS A;  3RCO A;  3K4L A;  3FXM A;  5DV5 A;  3LST A;  2K5C A;  1DGW Y;  3LHQ A;  4CIC A;  2WBM A;  2E1M B;  3RPU D;  4BGD A;  1RET A;  2V1D A;  3WTW C;  3U1D A;  4U7D A;  3O6B B;  3E3V A;  3GME A;  1Q1H A;  4XLA A;  1YG2 A;  1U8B A;  1XSD A;  1SFU A;  3JCU C;  1MNE A;  2F6C A;  4PFP A;  3ABT A;  1FY7 A;  1OR7 C;  2ZNY A;  5DM6 F;  3WU2 C;  1IXC A;  3TP0 A;  4RLF A;  3OS0 A;  1UEL B;  1VQ5 I;  1VQL I;  1WPK A;  4FE4 A;  5JHU A;  2FJ1 A;  2VC1 A;  3PNT A;  2ZCX A;  1IRF A;  1P2F A;  4FE7 A;  3F8M A;  3BR2 A;  2YVH A;  2LR8 A;  2ZXI A;  3BTI A;  2KPM A;  4XM3 A;  1Y8R B;  1X1P A;  3O2P E;  4MO7 A;  2Q0O A;  4CUG A;  4OIP F;  1XSV A;  2K85 A;  3T8T A;  3AG2 H;  4BKX A;  4H0E A;  2XDV A;  3A0B C;  3J7A Y;  5EJC A;  2EFQ A;  1ZK8 A;  4IVN A;  2K86 A;  1WH7 A;  3CO6 C;  2KIS A;  3MN2 A;  4ZC3 A;  4IHY A;  4MQ9 F;  4R79 A;  2OTJ I;  1TZL A;  2HKX A;  5L3D A;  4II3 A;  2BEO A;  2FXA A;  3BZK A;  3G73 A;  3H5N A;  3HUG B;  3JRI A;  2L7K A;  3CC2 I;  2EFN A;  1OYY A;  3EGQ A;  3DKW A;  1G4D A;  3V7R A;  3BRU A;  3CZ6 A;  1FOX A;  2QOP A;  2PJR A;  2PBX A;  4JL3 A;  3GUD A;  1PYV A;  4DGW B;  1RKW A;  3B6A A;  2IA0 A;  5FKO A;  4OIN F;  4GCL A;  3K70 D;  1R1V A;  2K7L A;  1JGG A;  4CHU A;  2VQH A;  1A6I A;  4WX9 A;  3KP4 A;  4HX8 A;  3KP3 A;  4IPA A;  3SEZ A;  1SFE A;  2KIF A;  2JT1 A;  5E8G A;  2XDN A;  1YLF A;  4ESF A;  5GAE J;  3JTG A;  3CCJ I;  3RKY A;  3VOK A;  2HEO A;  2RHA A;  2O0Y A;  3OSG A;  1ZAR A;  2HYG D;  1OLT A;  2QQ8 A;  3FXL A;  1WWX A;  4XKC A;  5CW8 A;  3LFU A;  4FHT A;  4NN1 A;  4RB1 A;  1WZ2 A;  2OZU A;  1XSX A;  4C2M A;  3M4O J;  1RC9 A;  4BJ6 C;  4CCM A;  2BOL A;  1MJA A;  3FIS A;  5D4S A;  3HXL A;  3KYL A;  2DBB A;  2Q1Z B;  1REP C;  5GAG J;  1GT0 C;  4LG0 B;  3GWZ A;  1FOW A;  1OKR A;  1VZ0 A;  1EA3 A;  3I59 B;  4F92 B;  1G2H A;  4HG2 A;  2LD5 A;  4Y7N J;  1A5J A;  1IXS B;  3ZQC A;  3C1D A;  1IUY A;  3KYC B;  4EGY A;  3TKY A;  4CA0 A;  1D0X A;  3K1N A;  2ID3 A;  4YZE A;  2NS0 A;  3P9T A;  3JAM Z;  2EQR A;  2F5V A;  2ZCW A;  3G3Z A;  3VWB A;  4OD5 A;  2LYC A;  1YX5 A;  1B8I B;  4PUS A;  1O3Q A;  2V79 A;  3BR5 A;  2R7V A;  1UFM A;  3HSR A;  1I27 A;  3MEX A;  3K8P C;  3SQN A;  3M8J A;  3GTK J;  4RGU A;  2DYR H;  2X6W A;  3I55 I;  3UNG C;  4GYG A;  2E35 A;  1KYZ A;  3ABM H;  1QGP A;  3CRJ A;  5CXG A;  1WJ5 A;  2GA1 A;  4KNY A;  4YEL A;  2G3B A;  4L9N A;  4GFK A;  3ON2 A;  3MFK A;  5J47 A;  1R00 A;  3BY6 A;  2BXZ A;  3LAJ A;  5FRM A;  4PDK A;  2EPF A;  2Z33 A;  1MDM B;  1YI2 I;  1LFB A;  4L9J A;  1OCP A;  2Y69 H;  3QOP A;  4HST A;  5ICG A;  2M87 A;  1S7O A;  2XB5 A;  3RKX A;  5FLX K;  2M4G A;  1KZH A;  3ZQQ A;  3ZR8 X;  3KZZ A;  3K7A J;  2Q2E B;  1LE8 A;  3KLN A;  3FXR A;  2LY1 A;  2V1X A;  5D4R A;  4XQF A;  2DMP A;  3KZ9 A;  1Z21 A;  5TRD A;  1Y0U A;  2BXY A;  2R92 J;  3TP3 A;  1WI9 A;  3L2W A;  1LFU P;  1K78 A;  3KZY A;  3NEU A;  5A2Q K;  2ZO4 A;  3DLL F;  1ZHF A;  3GLL A;  4MFD A;  3M7G A;  3CJQ B;  2RQQ A;  4L5E A;  1Z05 A;  4EEF G;  2CG4 A;  3IH4 A;  1MGT A;  4AVP A;  4MGR A;  2A6T A;  1KU7 A;  3DPJ A;  2VBY A;  2XSD C;  4IOC F;  1T0F C;  1Z3Y A;  1T0F A;  2HPM A;  3RYP A;  1WQ2 A;  2FX0 A;  3M9A A;  2GLO A;  2EIK H;  3B02 A;  5EGO B;  4IKF A;  4IQ4 A;  2F4I A;  1CGP A;  3VP5 A;  4I02 A;  4R1H A;  1W7P A;  1C0W A;  1ZRE A;  2REK A;  2LSO A;  2VXZ A;  2Y48 A;  1T8I A;  2B9S A;  4KIF A;  2TRT A;  5F0C A;  2X51 A;  2LRD A;  4ETS A;  1VQO I;  5C4X J;  1EKE A;  4ESJ A;  3TO7 A;  5HVQ C;  2UXX A;  4EM0 B;  2WWY A;  3TDZ C;  4I99 C;  2FU4 A;  1ZGW A;  4E7Z A;  2ICW G;  5C4J J;  4BU2 A;  3ZN1 A;  4NHJ A;  5CQG A;  4BHB A;  1FWZ A;  2O8X A;  2AQF A;  1RKT A;  1SAX A;  1IO2 A;  5K7Z A;  1SC7 A;  2W24 A;  5K7H A;  2E60 A;  3WHC A;  1A31 A;  4OD4 A;  4NQW B;  2L9N A;  2VC0 A;  4P1W A;  4M73 A;  4UVB A;  1A36 A;  3CC7 I;  2KIQ A;  4HV5 A;  2XAF A;  4P9U A;  1Y39 A;  3PSF A;  5AIP A;  4N0B A;  3VDX A;  3D0S A;  2L54 A;  4B47 A;  3ZN0 A;  2YU3 A;  4S0H B;  4PXI A;  4BQA A;  3OL4 A;  1XS9 A;  2DPU A;  2HNH A;  3GVA A;  3WOD F;  1L0O C;  5L3E A;  2HXO A;  6PAX A;  1JI8 A;  1MND A;  3VOD A;  1RUN A;  4JX6 A;  3JRF A;  2R0Q C;  1ETY A;  2ESN A;  2PBI A;  4I0B A;  4UVA A;  1MBG A;  3COA C;  4HF2 A;  3L2U A;  1W0U A;  3I58 A;  2F4O B;  2Z16 A;  4GO1 A;  1USS A;  2G7U A;  3RPQ A;  4BJ5 C;  2G9W A;  5D8L B;  3P9C A;  4HYE A;  2ESH A;  4UDS A;  1N77 A;  2JRT A;  4U9L A;  1IN6 A;  4DYC A;  1P4W A;  5H6R A;  4EQQ A;  5E3N A;  1O3R A;  2CUE A;  2EBI A;  3QOE A;  4B44 A;  2GEN A;  4P96 A;  2MA3 A;  2R7O A;  2W7N A;  4NBQ A;  2L7M P;  2UXP A;  5D19 A;  2A6H F;  1ZN2 A;  3BJA A;  3E6D A;  3HM5 A;  4DOZ A;  1CF7 B;  1TQP A;  1JHH A;  2OER A;  2YVX A;  3BHQ A;  5ERI A;  1YIJ I;  3GZN B;  4L5J A;  1BOA A;  1DU6 A;  5CXI A;  4AC0 A;  1G3W A;  3QP6 A;  4HDV A;  4MHG A;  4C3J J;  1ZR4 A;  2E71 A;  1N75 A;  3FK6 A;  3DWL E;  1E3P A;  3OIP A;  2XF7 A;  3BJ6 A;  1NK2 P;  2J5P A;  3W2V A;  3C7J A;  4HLX A;  5FO5 A;  4D0P A;  4FET A;  4A12 A;  3BCB A;  1VFC A;  4OIQ F;  2M45 A;  2KDO A;  1Y8Q B;  4HQM A;  2F5F A;  3BCA A;  2JA2 A;  1WKM A;  3CF5 F;  1RUO A;  4ZDP A;  4UUS B;  3I56 I;  3I4M J;  4B09 A;  4BXF A;  1J7K A;  2OCC H;  2HKU A;  4U9N A;  2JPB A;  5DCM A;  5KAI C;  2LOO A;  3VSK A;  2I5U A;  2LF8 A;  1FIP A;  4RM2 A;  3I4P A;  4TV7 A;  3VYR B;  2F2E A;  1I6H J;  2M9H A;  3T6N A;  2IA2 A;  2TCT A;  4KIC A;  1IG7 A;  2HYT A;  1O3T A;  2RAE A;  3ZMV A;  2HGC A;  4E4H A;  1FPQ A;  1O7L A;  4XLC A;  4V2G A;  3BG9 A;  4C9Y A;  3NPI A;  4BE1 A;  4JYK A;  3ZQL A;  1TNS A;  4CO8 A;  1BBY A;  4YG2 F;  2LH9 A;  1UCR A;  4MK6 A;  1BI2 A;  2VJJ A;  1YYV A;  3L2V A;  2HZT A;  3U21 A;  2NVT J;  1LPQ A;  1YJW I;  4BYY A;  5ILV A;  2JVH A;  1QO0 D;  2VKV A;  2EA4 A;  1FBS A;  3E7L A;  1R1T A;  4XON A;  4IOA F;  3HTI A;  2DFE A;  1YIO A;  4L0Z B;  2YU9 J;  4X0G A;  3K1M A;  2CH0 A;  2HU9 A;  4LIT A;  3FM3 A;  3QOD A;  4DQ2 A;  2V7F A;  5LRR A;  3FBI B;  2VON A;  1GHC A;  1O57 A;  2QM3 A;  3OL3 A;  3WTV C;  3F1B A;  2P8T A;  2BY3 A;  5EFY A;  3PO3 J;  1B9N A;  1FYK A;  3OR2 C;  1U2W A;  3GFL A;  3B6C A;  1ZG5 A;  3COL A;  3SYT A;  1W0T A;  3AAF A;  1T2K A;  5IPA A;  3BDD A;  4JBA A;  4XIC A;  1GDT A;  4LD5 A;  4UB8 C;  5J6X A;  4M6X A;  1FP1 D;  4WXC A;  2JUG A;  3DXJ F;  1WJF A;  1ZG3 A;  2DG8 A;  2F5E A;  2ZJP F;  3OYM A;  2H6C A;  3L2C A;  4IRV A;  4QIW N;  3K0L A;  2ZXW H;  3T8R A;  4L62 A;  3H0G J;  3KP6 A;  3OOP A;  3M3Y J;  2PMZ A;  3WE2 A;  1KQ0 A;  2A3S A;  2OAZ A;  5LRS A;  2P5L C;  3HUG A;  2VBW A;  1IRX A;  2M30 A;  3K4J A;  2H1L A;  2CQ7 A;  2W00 A;  1QRY A;  4WIB A;  1WSU A;  1D0Y A;  2K9L A;  1S6L A;  2V6C A;  3LSI A;  2P4W A;  2XAU A;  5DD4 A;  2HKO A;  4F52 A;  4ZH4 F;  4JOM A;  1JTY A;  4EJT A;  2KQR A;  1H9T A;  2Z9O A;  2PEX A;  1DQU A;  5E1Z B;  2VBZ A;  3M1C A;  2V4J C;  2E1N A;  4MFE A;  2MC4 A;  4AU7 A;  3QYF A;  4LJZ F;  2L02 A;  2X4H A;  2X48 A;  5F04 A;  3VPR A;  4L18 B;  1J75 A;  1J9I A;  3CCY A;  3G71 I;  3TW6 A;  5EEA A;  2K4B A;  5ILU A;  2QEN A;  4I76 A;  1JGS A;  1LJ9 A;  2H8W A;  4EM2 A;  3LA2 A;  4U7B A;  3GBG A;  3I9V 2;  4A3D J;  3JRB A;  4HLY A;  3RI4 A;  1MNM C;  1MMA A;  3ZQG A;  5HLT A;  3OYN A;  5DAJ A;  2IGO A;  1MH3 A;  3TDU C;  2XGC A;  4DNC A;  4X1E A;  2CW0 F;  5C4Y A;  4G8X A;  5TIS C;  5IOY A;  1T33 A;  2GAU A;  2IS2 A;  3I71 A;  3RZD J;  2CQK A;  2Y30 A;  4ACI A;  4LG0 A;  4D1Q A;  4RDU A;  3I59 A;  1SVM A;  4EMS A;  2EFP A;  1MBH A;  3CES A;  3T0Y A;  5B3S H;  4YFX F;  3UR3 C;  2NVQ J;  2E34 A;  2M7B A;  4AM3 A;  3S8P A;  1YX3 A;  2COM A;  3C2B A;  1FEX A;  2PMU A;  3TO6 A;  3ASO H;  1X4P A;  3K6G A;  3W6K B;  4WCG A;  2E2I J;  2M0C A;  3ASN H;  3O8H A;  3E97 A;  1OYI A;  5L3G A;  3HSF A;  3FIW A;  5C44 J;  1B8I A;  2RVC A;  3K9T A;  2BVL A;  2NAZ A;  4DYR A;  3HIM A;  2VKH A;  3GZI A;  1E0E A;  4HNU A;  4KT6 A;  4R8H A;  4CCK A;  4UV8 A;  3OYL A;  2WAE A;  1T08 B;  2YUS A;  3L9F A;  2XAS A;  3K4M A;  1HDD C;  4JX4 A;  2ME0 A;  3VVY A;  2MFZ A;  4A3F J;  1MW7 A;  2MW8 A;  3LWF A;  4BS9 A;  3HEF A;  2CGP A;  2XPW A;  2FSW A;  1IAW A;  2VJ4 A;  1FT9 A;  2NP5 A;  2JWT A;  2Q8K A;  5BS6 A;  1IZ1 A;  4ASN A;  2DOD A;  3S3O A;  2M5W A;  2PZ9 A;  4CGZ A;  1V5F A;  2QBY B;  4JQF A;  4NDL A;  1MDM A;  2DTZ A;  4ZYA A;  1T39 A;  3DBR B;  1UZC A;  3L09 A;  2NOJ B;  3PNY A;  2GM4 A;  4EJO A;  3W2A A;  2JA7 J;  2XKO A;  1FBU A;  2VE9 A;  5KVR A;  2R7T A;  2EV0 A;  2LBF B;  3CCL I;  1MD0 A;  1T98 A;  3G7R A;  2E7W A;  1X3W B;  2X1E A;  1PP8 F;  4D5F A;  1LKX A;  3K4B A;  3QYE A;  4N4N B;  1FOK A;  2HOS A;  4M3F A;  2CSO A;  4KFC A;  2QF7 A;  4XRF A;  2HPI A;  3RIR A;  4C3I J;  3ZMD A;  2ELH A;  4ZZL A;  3G1L A;  1BM9 A;  3ZQI A;  3F6O A;  2LVS A;  4F7Z A;  3R0A A;  3S5R A;  1BA5 A;  4XOP A;  2BY0 A;  2HOE A;  3P9K A;  5M5Y J;  4RGR A;  2IJL A;  4QSH A;  2ID6 A;  4G6D A;  5LBQ A;  5IYD J;  1IUF A;  4UV9 A;  1HXD A;  3BQZ A;  5CQE A;  3CP2 A;  1JXS A;  1TW3 A;  1YE9 A;  2KDZ A;  1ETV A;  2E19 A;  3WU0 A;  3LSJ A;  4MTD A;  3FZV A;  1MMG A;  3HGY A;  1ULY A;  3WGG A;  1XMA A;  4XLN F;  4MLO A;  3BG5 A;  3DLA A;  2A05 A;  4MEY F;  2YX7 A;  3BZC A;  3D1N I;  2VLA A;  1LB2 A;  3P7N A;  1D3Y A;  1O7F A;  2A69 F;  2X6Y A;  2WV1 A;  3FXK A;  2IAI A;  3F8N A;  4NQW A;  2UUZ A;  4NC6 A;  2CWE A;  3WHB A;  5IP6 A;  3S3M A;  3WTU C;  3SHF A;  4A3B J;  3E6B A;  3NS4 A;  5EEG A;  3TBI A;  2O7O A;  2ZSH B;  3RDI A;  3HE0 A;  4C2U A;  2PFB A;  2UXU A;  4XNF A;  3GEZ A;  1S9H A;  2KRF A;  1FJL A;  4YII A;  5DCM B;  5E3M A;  3I53 A;  4F3Q A;  2V57 A;  3EYI A;  1X1D A;  2XC7 A;  3I64 A;  3QAH A;  4RGX A;  3VFZ A;  4ENN A;  5TJJ A;  2FBK A;  2VQG A;  1NG7 A;  4L5I A;  3VB2 A;  4XRM A;  3JRC A;  1RRJ A;  2M0M A;  1XGM A;  2IA1 A;  4M72 A;  4S04 A;  2HDC A;  1MMS A;  1I50 J;  1VQ7 I;  4GCT A;  2O3F A;  3S14 J;  1EH6 A;  3J7Y J;  3E5X A;  4U0Y A;  2IGM A;  4MNU A;  1HQC A;  5FD6 A;  2CJJ A;  2IGK A;  2NX4 A;  4B4C A;  4G7Z F;  1MSE C;  2MG4 A;  2STW A;  2KP6 A;  1VTN C;  3KNW A;  1NHA A;  1EJ9 A;  3ANG A;  1BIA A;  3QKX A;  4RBO A;  3FRQ A;  5HDG A;  1HKS A;  2LK2 A;  4HPQ A;  2JA5 J;  3VSL A;  4EJU A;  4HV6 A;  3ZXS A;  1OR7 A;  2E5Z A;  4BQQ A;  1WJA A;  1NH3 A;  2NVX J;  5IOZ A;  1CF7 A;  4PJN A;  2EB7 A;  1FC3 A;  5BQT A;  5FLX Z;  1R5I D;  3HL2 A;  2KRH A;  2HOA A;  3W6V A;  4RS8 A;  5FRN A;  5GTI C;  3F9K A;  3ECO A;  5K7F A;  2X1D A;  1DU0 A;  4GGG A;  4FQG A;  5A2Q Z;  3GTM J;  3ZMT A;  1WRJ A;  3Q0U A;  4M3D A;  3HTS B;  3TW7 A;  1N78 A;  4AIK A;  5D6E A;  1ZGJ A;  1T56 A;  3S1M J;  2IVM A;  3U1K A;  4XKV A;  3MAJ A;  3OOU A;  1OCR H;  2VQC A;  3HJE A;  3Q0V A;  1BW6 A;  4EVI A;  1QZZ A;  1MJB A;  1XB4 A;  4HOB A;  4UUS A;  2DOA A;  3KIO A;  4XLE A;  2QA4 I;  2Q24 A;  5HLG A;  3PUF A;  3BTC A;  3N4M A;  2A61 A;  1OCZ H;  4G7O F;  5J1Y A;  2JVG A;  5IYC J;  1TBX A;  3VIB A;  4PJJ A;  4KMF A;  3OYC A;  3MZY A;  5J1U A;  4M6Y A;  3H35 A;  4II2 A;  2ZNZ A;  3VUQ A;  1JTX A;  4HNT A;  2QGU A;  4D7N A;  2EZH A;  3CMA I;  4CZC A;  4FT8 A;  2FOW A;  2N8G A;  4GFL A;  2Z2S B;  5JI6 A;  4ZYD A;  2DK5 A;  3B81 A;  3RD3 A;  3HTU A;  2ZME C;  4UUT A;  2ZME A;  5HLH A;  4C2T A;  2VJI A;  1A6Q A;  4HW0 A;  4KIG A;  2DTR A;  3LSP A;  2GQQ A;  3KFW X;  1F9N A;  4XOT A;  1TQM A;  1Z6R A;  5E18 F;  2O6G E;  5CJ9 A;  3DPU A;  4BJT A;  3HIF A;  2XRN A;  3DKX A;  3M1E A;  1D1B A;  3MZ8 A;  3HRU A;  4A3L J;  4LIU A;  2COB A;  5IT9 K;  1TT5 B;  2RNJ A;  3GFI A;  1Z67 A;  3ONQ A;  2LC2 A;  2LY2 A;  3KYD B;  1IGN A;  5DTD A;  1F4K A;  5DUI A;  3RZO J;  2HQA A;  2NYX A;  2IGN A;  3CJN A;  5B1B H;  2PMZ N;  3G2B A;  1L3L A;  3K4C A;  1XPX A;  1Z77 A;  1WCM J;  4OOI A;  4IHV A;  4XLP F;  3K4N A;  3H9G A;  5DEQ A;  1ITY A;  1MZB A;  5TGT A;  3WTT C;  1W5C C;  1ZEL A;  4ITV A;  5BNG A;  3LNQ A;  1HDP A;  1E17 A;  4OMZ A;  1U9O A;  3L00 A;  1QBJ A;  3ABK H;  2JK3 A;  5DYM A;  5E17 F;  1Y6I A;  1I3A A;  3Q3S A;  3HDD A;  4IRI A;  3FK7 A;  3F8C A;  3V42 A;  4HF0 A;  3HC7 A;  2MAB A;  2WAQ A;  1ZQ3 P;  3QBM A;  3GFJ A;  4DZJ A;  1P7J A;  2QQA A;  3WTZ A;  3HG9 A;  4AWX B;  1TL8 A;  3CLQ A;  3E6C C;  2NS7 A;  5J4V A;  2QTQ A;  1B59 A;  5HOO A;  1IN4 A;  2L9S A;  1FZP B;  4XLF A;  1WJC A;  2DMT A;  2V9P A;  3R6S A;  4ZZD A;  3H3V K;  3U2R A;  5FB2 A;  4CXF A;  2IEK A;  3F3X A;  3NWS A;  5CVV A;  2W82 A;  2QWT A;  4Y17 A;  2HOT A;  3PNV A;  3J81 K;  5M3F J;  2B1E A;  2D45 A;  2JRM A;  1DP7 P;  1E3O C;  2ZJ2 A;  1SD5 A;  2YX4 A;  1Z7L A;  4DJA A;  2FA5 A;  2IS1 A;  1LEA A;  1BL0 A;  3H3Z A;  1Y1V J;  3OYA A;  2QSF X;  3RTR A;  2L4A A;  1R22 A;  4KMU X;  2MLK A;  2W85 A;  2EJR A;  4RB2 C;  1YW7 A;  3S2W A;  2E36 A;  2JSP A;  3M07 A;  2EIJ H;  1WFX A;  4CCJ A;  1ETQ A;  2DQR A;  3H9Q A;  1WJB A;  1YW9 A;  1YHQ I;  2UXO A;  2E1O A;  1ON1 A;  3FMQ A;  1VF9 A;  2P7V B;  2OD5 A;  2BHZ A;  4QWQ A;  2HYF A;  1QA6 A;  1UG0 A;  2FEZ A;  2ZY9 A;  3DKY A;  3S32 A;  4M3E A;  4LGW A;  3ESW B;  1VI0 A;  2STT A;  1K4S A;  4LFU A;  2CQX A;  2RRE A;  4J19 A;  4P5O A;  1FYL A;  3FX3 A;  2L5Q A;  1ETO A;  2V9V A;  1V4R A;  4RAF A;  4CYC A;  3QP5 A;  3H5A A;  2P6S A;  4I98 B;  3S17 J;  2MLG A;  1PDN C;  3DU5 A;  1B4A A;  2MD0 A;  1Z0X A;  3IKV A;  3K1P A;  2X85 A;  5D5V B;  1X4O A;  1G6N A;  1UHS A;  2WB1 A;  4UHT A;  4HSR A;  4YRV A;  3LOC A;  4Y15 A;  2VL8 A;  3HOW J;  3CCU I;  1TLH B;  4EM1 A;  3BCG A;  1V54 H;  2B0L A;  2ISY A;  3VW2 A;  3MKW B;  1TTY A;  4M71 A;  2UV1 A;  3IWZ A;  4A3G J;  1YW8 A;  1F1Z A;  3CD6 I;  2ZFU A;  3GTO J;  2XF6 A;  1YQA A;  1AOY A;  2NRA C;  3CCS I;  2CQQ A;  4A6E A;  1SAN A;  2DA2 A;  3HZJ A;  2CW7 A;  1UHW A;  4ZJZ A;  1PVE A;  2KL4 A;  3CDL A;  4H4K C;  3CMM A;  3ECH A;  1QU3 A;  1WI3 A;  1LDD A;  1ZTR A;  2BW3 B;  3S15 J;  2XAH A;  3HPH A;  4GYI A;  3EET A;  4F55 A;  1X2N A;  3HRT A;  2QBY A;  2E1C A;  2L9R A;  2R7Q A;  2X6O A;  3JTH A;  3SDB A;  2MBF A;  3NAR A;  2H8R A;  4ZDO A;  4XSX F;  3LSH A;  2L01 A;  4A3K J;  3PFI A;  4RB0 A;  2JN6 A;  4RAG A;  3IH2 A;  5J40 A;  2XGE A;  2LBF A;  2X1C A;  3H5R A;  3TGN A;  2PG4 A;  3J80 K;  4Q48 A;  4M6V A;  2M8G X;  4KIT B;  2E2H J;  1UI5 A;  1IN5 A;  1SD4 A;  2DA5 A;  3KPH A;  3DF8 A;  3LFK A;  3CMY A;  3FF5 A;  5HBU A;  1S5L C;  1JUP A;  2PQ8 A;  3NRG A;  2AQE A;  3ZQF A;  1BI0 A;  3TQN A;  2WA0 A;  1XTA A;  2DA1 A;  1Y1W J;  3JSJ A;  2OJE D;  3ZGK A;  2NVU B;  1HF0 A;  1TWC J;  1YO5 C;  4XMY A;  2BV6 A;  2CFO A;  1ZH5 A;  2VPR A;  5CVI A;  3HB9 A;  3BZ6 A;  1P6R A;  1TWG J;  2HYJ A;  4B43 A;  5HLI A;  4FIS A;  3S1N J;  2FNA A;  1WJD A;  4Y4R A;  5HDN A;  2O5R A;  4JP0 A;  1I3Q J;  2F5D A;  2FD5 A;  4PGG A;  3MKY B;  3PJR A;  3AG4 H;  3OMY A;  3HKZ N;  1ONV A;  3ZMZ A;  2A5W A;  2VJ5 A;  1XMX A;  2DQL A;  2OV7 A;  3OYJ A;  2W53 A;  3V8K A;  4IHX A;  5JHF A;  2ACJ A;  5LGN A;  4U88 A;  2DFH A;  3VW0 A;  1OIS A;  1R5G A;  2GXG A;  4RGS A;  1X58 A;  4C2M J;  3NAU A;  4BAC A;  4XLH A;  3VYS B;  1VQN I;  5FKL A;  3IHU A;  2FF4 A;  5LGU A;  2K27 A;  3DPT A;  3CUQ C;  1D8K A;  4KN7 X;  4IZZ A;  2DFI A;  1QVU A;  1R36 A;  2R7X A;  1K4T A;  2X0L A;  2KJB A;  4N9I A;  4LK1 F;  1OCO H;  2RNG A;  3EUH C;  4Z6Y A;  1TWF J;  2R7F A;  2GFN A;  2B7E A;  1KGS A;  3BG6 A;  4IRG A;  2O9L A;  1HW2 A;  5GP9 A;  2MH2 A;  1BI3 A;  4U0W A;  3KE2 A;  4IRH A;  1MMN A;  1D5Y A;  1POG A;  1U0J A;  2UXN A;  4FAS D;  3R4K A;  1TWA J;  4I7H A;  2L4M A;  1T95 A;  2V1U A;  3A01 B;  2FOK A;  3AFH A;  2WAF A;  1GVD A;  5HDK A;  2H6B A;  3W3C A;  4IF4 A;  2RC4 A;  3CTA A;  1X19 A;  1D0Z A;  3OYF A;  2ZME B;  1UST A;  5FKN A;  2VE8 A;  2CV1 A;  1W5T A;  4F93 B;  2HR3 A;  5DCF A;  4A2U A;  1BR1 A;  3EUA A;  3QPL A;  4EGZ A;  4B3X A;  1WVR A;  3JSO A;  1K6O A;  2LDU A;  4A3M J;  3JRH A;  3DTI A;  1IXR C;  3O8G A;  3HRM A;  2YR2 A;  3IAM 2;  2VBX A;  2R4G A;  4M3B A;  3BRO A;  2WV0 A;  2M34 A;  2DG7 A;  2ECB A;  3HRS A;  2DYS H;  1HCR A;  1B6A A;  3GXO A;  2ZCN A;  2YSR A;  5JVG F;  1AKH B;  1FBQ A;  4YFN F;  3ON4 A;  4JK1 X;  2P81 A;  4E7H A;  3K70 C;  2MC3 A;  1Z6T A;  4GCV A;  1H89 C;  1T6S A;  4YFK F;  4XKW A;  2H94 A;  4DBQ A;  1Y0N A;  5L3C A;  2NVY J;  2V6E A;  2JZY A;  2CO5 A;  2OUM A;  2WGB A;  4PCQ A;  3LMM A;  1MH4 A;  1W36 D;  4Q47 A;  3IC7 A;  1G3S A;  3PPB A;  5ICC A;  2X9D A;  4LB6 B;  4AF5 A;  1JT0 A;  2Y0S N;  4UNO A;  2ZC2 A;  4ON0 A;  4AYB N;  3GX4 X;  1SFX A;  5B5E C;  1D8J A;  2VXD A;  2RAS A;  2Y31 A;  2AXT C;  3FXU A;  3FXO A;  2XRL A;  1BW5 A;  2DLL A;  3JRD A;  2RGV A;  2GOX B;  1IC8 A;  2HTJ A;  3OS2 A;  2L7Z A;  4KJZ A;  4CH7 A;  2XKP A;  2D1H A;  1D5V A;  2VQL A;  2EFO A;  1B72 B;  2P6T A;  2XVC A;  1FX7 A;  3ROU A;  3HOX J;  2JMW A;  4XR6 A;  1VQP I;  1BR2 A;  2E5N A;  1YS6 A;  1EH8 A;  3KEY A;  4A3I J;  1DDN A;  1IV8 A;  5FLV A;  2J5O A;  1RZ4 A;  1HA8 A;  3MCZ A;  5HOD A;  3E5U A;  3MZH A;  1YFH A;  2MSY A;  4ESB A;  4BY1 J;  4A0X A;  3WGI A;  5EG0 A;  2IPQ X;  2H1K A;  5D1R A;  4KIS A;  3CLO A;  3MKL A;  2A2F X;  3VOX A;  1H88 C;  3OIQ A;  5D5U B;  2DXI A;  3IP4 B;  5F64 A;  5LD2 C;  2EZK A;  1IRG A;  5H6Q A;  3DP7 A;  3BNI A;  1HC8 A;  1ETK A;  1V5G A;  2WAQ N;  5FFX A;  4OAZ A;  2XRO A;  2LKS A;  1CQT A;  4LB5 A;  1YJN I;  1I5Z A;  2Y75 A;  3GW2 A;  3HTH A;  5M5X J;  3DBL B;  4EJV A;  3G1M A;  4DW6 A;  2OPT A;  3C2H A;  4FCY A;  4L0Y B;  1YTY A;  5CYV A;  3Q0W A;  2KLO A;  1QZY A;  4EJW A;  1BC8 C;  1FNN A;  4N4O B;  1TW2 A;  1FSE A;  4XOR A;  5DDG A;  4JKZ A;  3QPS A;  4CYC B;  3KEQ A;  1KQ8 A;  2QKL B;  2R3S A;  2G7H A;  3HSE A;  2IT0 A;  2OU2 A;  3C2G A;  3LSR A;  1JE8 A;  2MGQ A;  2JSC A;  2DCE A;  3CDI A;  2EH3 A;  4AVZ A;  1JKP C;  2BY2 A;  4W97 A;  1F5T A;  4E7K A;  3F23 A;  1LVA A;  4CCL A;  3OWT A;  1AU7 A;  1J5Y A;  1STZ A;  2G0E A;  4EAT A;  4GFB A;  3EYY A;  5J8C A;  2FBQ A;  4XN0 A;  1SEU A;  3KZI C;  3PM1 A;  2M1B A;  2PFV A;  4MXM A;  5IT3 A;  4HRI A;  3S93 A;  3L1P A;  3FWE A;  3GTQ J;  2UWM A;  2WUI A;  4DIQ A;  2HI3 A;  3G1O A;  5D18 A;  2BZT A;  3V7C A;  1FSH A;  2G7G A;  3FXQ A;  4RAY A;  1HST A;  2JTV A;  1RI7 A;  2HDW A;  1R9T J;  1HW1 A;  3CCQ I;  4HKU A;  5JFR A;  3ABU A;  3CO7 C;  4AUX A;  5D8K B;  1BJA A;  3H1C A;  5ICF A;  1GV5 A;  4IO9 F;  4IQJ A;  1Z9C A;  2WY7 Q;  3KET A;  2XUB A;  3ZMS A;  2FML A;  1UMQ A;  1E3H A;  4U0V A;  3LQQ A;  4DZP A;  4ABZ A;  1A04 A;  2GA2 A;  2WB1 N;  3ZPL A;  1A35 A;  1S29 A;  3PAS A;  5E1X A;  3OYB A;  4L9V A;  2EWN A;  1X1B A;  2VIX A;  2ZSI B;  1DP3 A;  2DO7 A;  3LSM A;  4J01 A;  2QQ9 A;  3B73 A;  4NUB A;  4CSW A;  2CFX A;  2GIZ A;  3KKD A;  2JUC A;  3MWM A;  3LAP A;  1U5T B;  5JVT A;  3V8J A;  2XHK A;  2DT6 A;  2A5Y B;  3H36 A;  1PUE E;  5CKT A;  3AG1 H;  2LMD A;  3LWJ A;  5E1W A;  3N05 A;  1ZYR F;  3RKQ A;  3TOA A;  5FKK A;  2EZI A;  4HDU A;  2XPU A;  1W7P D;  5K1Y A;  2DOE A;  1K7A A;  2KIU A;  2O61 A;  5JLX A;  4QTR A;  3GF2 A;  2QSH X;  1HKT A;  3SZT A;  4ZTJ A;  1FIA A;  2IU5 A;  2F4M B;  4B1R A;  3ERE D;  5IT9 Z;  1MBJ A;  3LSK A;  2QVO A;  5EF6 A;  3SEQ A;  2EFW A;  2X6X A;  2KRC A;  3BP8 A;  3CQZ J;  3Q5F A;  5DM7 F;  3D5S C;  2LFB A;  1G3Y A;  4ZDL A;  3MKZ A;  2W48 A;  4OMY A;  2OQR A;  1ZKG A;  2VI6 A;  4RB3 C;  1HSJ A;  1K6Y A;  2OQG A;  1XGS A;  4AD9 A;  3HOY J;  3CUQ B;  2BW3 A;  5LHG A;  2RDP A;  1QPI A;  4IJA A;  4Y33 A;  5E3L A;  3L2R A;  3HKZ A;  1P4X A;  2XAG A;  1XMK A;  4MTE A;  4KDP A;  1VQ6 I;  3C07 A;  2D6Y A;  4E7J A;  4YIF A;  3ZOB A;  4HNV A;  1HBX G;  2CUF A;  3V7S A;  3DCF A;  3DEE A;  3FM5 A;  3K2Z A;  1V55 H;  2R7Z J;  3C18 A;  2A68 F;  2JA6 J;  3MMY B;  2VUM J;  3F21 A;  2QUF A;  2XGD A;  3BPV A;  4I0A A;  5L3F A;  3EUP A;  1DUX C;  4A0Y A;  2K3F A;  2EV5 A;  5LEJ A;  2DDA A;  4ZYH A;  4G6T B;  5F0F A;  4AID A;  4CCN A;  4BHP A;  3LSG A;  1YRN A;  3WTX C;  3E7Q A;  3REO A;  4A3C J;  3QQA A;  3QU3 A;  1PJR A;  5JLW A;  4IEJ A;  2F48 A;  3J81 Z;  1ZLJ A;  3PSI A;  2VN2 A;  3ZMU A;  2E2J J;  5LGT A;  1XN7 A;  1G59 A;  4XRS G;  1SVL A;  5DD8 A;  2IS4 A;  1S7A A;  3OSF A;  1WJE A;  2FBI A;  1QZE A;  3DEW A;  1DPU A;  1X3U A;  2YPR A;  3CJT B;  4WXH A;  3H92 A;  2XAQ A;  1U8R A;  4HF1 A;  1D1C A;  3KX2 A;  4G6Q A;  1UJ8 A;  3ERM A;  3HHH A;  3PQJ A;  5DS9 A;  3GYH X;  4XSZ F;  1J09 A;  2ISZ A;  2XB0 X;  2HVR A;  2ECC A;  4A6D A;  2LNB A;  3D5L A;  3WG7 H;  2BYV E;  4UB6 C;  1UG2 A;  1LUJ B;  1RR8 C;  1TC3 C;  2IS6 A;  2O03 A;  1B1B A;  1ZR2 A;  1MBE A;  1OJL A;  1GXQ A;  4ZTF A;  1P4A A;  1R4M B;  1SFO J;  3M8F A;  4I01 A;  4MIM A;  2ZOZ A;  2QWW A;  1J0R A;  1Z7U A;  3I0T A;  5FJ8 J;  1ZGA A;  4E7S A;  3N97 A;  5F27 A;  3K10 A;  4O6J A;  1I6X A;  3BG3 A;  1ODD A;  1XC5 A;  4FX0 A;  5IP7 J;  5FRO A;  5AIQ A;  3PFY A;  2LKP A;  1W36 C;  5D6F A;  5LHH A;  4XK4 A;  1XDS A;  2KIM A;  5C3E J;  4BDZ A;  2V9K A;  3A1Y A;  4A5N A;  1TT0 A;  3ZQH A;  3HOS A;  2R7R A;  5FHP A;  3A01 A;  3BPX A;  5LEK A;  1QQI A;  1W4M A;  2Y0S A;  4AYB A;  3FBN B;  2DA7 A;  4OIR F;  4E7L A;  4JNN A;  4B48 A;  5KCM A;  2AS5 F;  3BR6 A;  1NK3 P;  4YIR X;  2HS5 A;  2DAO A;  4BEH A;  1FP2 A;  2NXN B;  2FBH A;  1ACI A;  5HS7 A;  1O3S A;  3CUO A;  1ERD A;  5EG0 B;  2C6Y A;  3OYK A;  3OYI A;  1ENH A;  1LFP A;  3S16 J;  3F72 A;  3SDG A;  5E20 A;  1U6G A;  3DEU A;  4I09 A;  2DJN A;  1FLI A;  2CMP A;  2EZL A;  1YIT I;  3BJB A;  1BN5 A;  3HOV J;  5ED4 A;  5K5R A;  1AKH A;  2K4J A;  5JR3 A;  3BC8 A;  3DPL C;  2ZB9 A;  2HDD A;  3GO5 A;  4BHC A;  3HPG A;  4PK4 A;  5H20 A;  1OQY A;  5FKM A;  2ZOY A;  4FX4 A;  2VT3 A;  4F91 B;  2QSG X;  2AHQ A;  1Q1V A;  3WG9 A;  5CLS A;  2R5Y A;  4MQV A;  3RJP A;  3F6V A;  2I8D A;  4CZZ A;  2R93 J;  4I6Z A;  3KEO A;  3J80 Z;  3BR0 A;  2QIB A;  5EDN A;  1D1A A;  3IRQ A;  1IDZ A;  5F6F A;  2EK5 A;  3HHG A;  3WU1 B;  4CGR A;  3VVX A;  1LNW A;  1P92 A;  5E3O A;  5IY5 H;  4WWC A;  1R6R A;  3NI7 A;  2QZ8 A;  1MIJ A;  2ZKZ A;  1XGN A;  1MMD A;  2HFH A;  3PL8 A;  1VQ9 I;  5F0H A;  2QEX I;  5J3L A;  2LF7 A;  2FUG 2;  4GDF A;  1JKR C;  1EF4 A;  4DBR A;  1XG1 A;  4LLN A;  4XL9 A;  1U3E M;  3A03 A;  3NRV A;  4P55 A;  4HX7 A;  2NOG A;  3A02 A;  2K02 A;  4OAY A;  2DU9 A;  3ZP5 A;  2FE3 A;  4O5V A;  3WTY C;  2DPD A;  2Y0M A;  1B72 A;  1QHH D;  1OPC A;  1IN7 A;  1KU3 A;  2RKH A;  3TED A;  5CVR A;  1SD7 A;  1GUU A;  1KA8 A;  2DJI A;  2HTS A;  3QRF F;  1NG6 A;  2O8K A;  2QKM B;  2Y9Y A;  1LDK B;  2UXH A;  1VQ4 I;  1AA7 A;  2O7T A;  1JUS A;  3SJM A;  4LLL A;  1X3Z B;  1SMT A;  2FQ3 A;  3Q9S A;  1ZAO A;  2RN7 A;  3VW1 A;  1W5S A;  5AQC A;  3W6J B;  5FD5 A;  4MEX F;  3OIO A;  2GZW A;  3VVZ A;  3ANP A;  2OF7 A;  1SGM A;  2ZFW A;  2DOF A;  4BXU A;  2K9S A;  2P5V A;  3GZ5 A;  2R5Z A;  3QU6 A;  4LLG F;  2OTL I;  3KP5 A;  3TMO A;  2QCO A;  4D9J A;  2WTE A;  4V19 K;  3PO2 J;  5EYR A;  3BTJ A;  3DU6 A;  5K5O A;  4Z2Y A;  1WGX A;  4HQE A;  3CP8 A;  4IHT A;  4PSX A;  3OYH A;  5D5W B;  2BY1 A;  3TO9 A;  4BXX J;  4M9X A;  4DVY P;  4PJL A;  1YOV B;  2PLY A;  1HW5 A;  2DK8 A;  5F08 A;  1RES A;  1T38 A;  3ZQ7 A;  4Q4Z F;  2VOD A;  3GFM A;  3BJO A;  3GEU A;  1J2X A;  5BPI A;  4WK8 F;  4C3H J;  2B63 J;  4GCK A;  2D5V A;  3OYE A;  3J7A O;  1P7I A;  1BOB A;  1V5E A;  1X1C A;  3VYT B;  2CUJ A;  2CS3 A;  2DA6 A;  3NWT A;  3OYG A;  1GLN A;  1MSF C;  3KKC A;  2GWR A;  4E7I A;  3EQL F;  3S2H J;  1JHF A;  4BBR J;  1SFK A;  1BIB A;  2DA4 A;  2H09 A;  1S7E A;  3A4C A;  3LA7 A;  3LA3 A;  5CVJ A;  3ZCO A;  4BDY A;  5FMP A;  4BUP A;  2NNN A;  2VB6 A;  3GCM A;  2VOP A;  4UVC A;  4AC6 A;  2KHM A;  1Z91 A;  1PUF B;  2WC2 A;  4BBS J;  4JX5 A;  3AKZ A;  2OC6 A;  3QYB A;  2VAS A;  3D5R C;  4M74 A;  2XSJ C;  3G4S I;  4RMN A;  3A2K A;  4UXN A;  2IRF G;  4PZJ A;  4X6A J;  4ZYE A;  1GVJ A;  2DMQ A;  2WAD A;  3PQK A;  1ETX A;  2YS9 A;  1FYM A;  1S3J A;  4IL6 C;  3CJD A;  4P9F A;  4BL0 B;  4HX4 A;  2LTP A;  2DN0 A;  2NP3 A;  5HAW A;  2DT7 B;  4KIB A;  3FHZ A;  2K40 A;  1S8N A;  1I1S A;  3CCE I;  1X2M A;  1Z3X A;  3HBL A;  3V78 A;  3RQ4 A;  3AG3 H;  3JRE A;  3F8F A;  4HEA 2;  3CF2 A;  3ML6 A;  1F36 A;  4E70 A;  1V3F A;  2G7L A;  5HNF A;  5E79 C;  1QVT A;  4ENM A;  2DA3 A;  2D2W A;  1IRZ A;  5J8F A;  2QYO A;  3TOB A;  3AL0 C;  4U87 A;  3R0J A;  3L7W A;  4BQN A;  4EV0 A;  3BLY A;  5K5Q A;  4BNC A;  4A0Z A;  2L9V A;  3QPH A;  1YRN B;  1U5T C;  2JJ7 A;  4LMY A;  3IUV A;  2QLZ A;  1U5T A;  5CPR B;  1GV2 A;  1TP4 A;  3L2Q A;  4UUV A;  3SXY A;  2CU7 A;  2L7F P;  1XD7 A;  1I39 A;  4ENK A;  1O4X A;  2DW4 A;  1S72 I;  4ENJ A;  2HQN A;  3I4N J;  1VQK I;  2K9N A;  3I54 A;  3VEP A;  4B3A A;  3H3U A;  2A07 F;  4Y13 A;  2OZ6 A;  1IW7 F;  5EEH A;  1R4N B;  3UKG A;  3BTL A;  1HKQ A;  3FKI J;  2PI0 A;  2VOO A;  1H0M A;  1BC7 C;  1XDU A;  1YJ9 I; 
#chains in the Genus database with same CATH homology
 1H88 C;  2UXU A;  2EZK A;  1FJL A;  2ID3 A;  2ELK A;  5E3M A;  4YZE A;  3BNI A;  3P9T A;  2V57 A;  2EQR A;  1ETK A;  3AQS A;  3MVP A;  2WAQ N;  1B8I B;  1CQT A;  1RPW A;  3BR5 A;  3HTH A;  4XRM A;  5M5X J;  3JRC A;  3G1M A;  4DW6 A;  2OPT A;  4FCY A;  3Q0W A;  1I50 J;  4GCT A;  3GTK J;  4W1U A;  4JKZ A;  3QPS A;  4CYC B;  3S14 J;  4FTH A;  3S2D J;  2NX4 A;  2LKX A;  2CJJ A;  3LSR A;  3CRJ A;  4B4C A;  2MGQ A;  1MSE C;  5CXG A;  5K58 A;  5IYB J;  2EH3 A;  2MG4 A;  2G3B A;  1JKP C;  4GFK A;  4W97 A;  3ON2 A;  2JA8 J;  3KNW A;  5GPA A;  3ANG A;  3QKX A;  4RBO A;  3FRQ A;  1AU7 A;  1LFB A;  2LK2 A;  3F0C A;  1OCP A;  2JA5 J;  2G0E A;  3VOX A;  1FTZ A;  3GTJ J;  4GFB A;  2FBQ A;  4D5C A;  1HLV A;  3HTJ A;  2XB5 A;  3PM1 A;  4MXM A;  2NVX J;  5IOZ A;  3L1P A;  3GTQ J;  2WUI A;  3K7A J;  2HI3 A;  3G1O A;  1LE8 A;  5H9T A;  5D18 A;  1OCT C;  2G7G A;  2HOA A;  2DMP A;  3W6V A;  3KZ9 A;  2R92 J;  3TP3 A;  5K7F A;  1LFU P;  1R9T J;  4HKU A;  1DU0 A;  2GUH A;  1MBK A;  2AO9 A;  4MFD A;  4M3D A;  3Q0U A;  4AUX A;  3GTM J;  3TW7 A;  4L5E A;  1GV5 A;  1T56 A;  4EEF G;  3IH4 A;  3S1M J;  3DPJ A;  3AQT A;  1ORK A;  2IBD A;  3OOU A;  1H8A C;  2XSD C;  3Q0V A;  1BW6 A;  2F07 A;  2FX0 A;  4UUS A;  2GLO A;  3S1Q J;  3NNR A;  5EGO B;  2Q24 A;  1UMQ A;  4BY7 J;  3VP5 A;  3BTC A;  4DZP A;  4ABZ A;  5EZH A;  5J1Y A;  2WB1 N;  5IYC J;  2R5Y B;  3HE0 A;  3VIB A;  3PAS A;  2REK A;  3IH3 A;  5J1U A;  2TRT A;  5F0C A;  3VUQ A;  1JTX A;  5C4X J;  4D7N A;  2EZH A;  3BR3 A;  2YVE A;  4XRS A;  2ZCM A;  1K83 J;  2N8G A;  3KKD A;  3V6G A;  1MBF A;  1JUM A;  4GFL A;  3B81 A;  1ZGW A;  3RD3 A;  5C4J J;  4UUT A;  3LWJ A;  1RKT A;  2Y2Z A;  5K7Z A;  3RKQ A;  3LSP A;  3G56 A;  5FKK A;  2EZI A;  5K7H A;  2XPU A;  3WHC A;  5FGL A;  2LLK A;  4A93 J;  5JLX A;  4IHW A;  4QTR A;  1APL C;  4A3L J;  1FIA A;  2IU5 A;  4B1R A;  2COB A;  5M3M J;  4S0H B;  1MBJ A;  4PXI A;  5EF6 A;  1XS9 A;  1IGN A;  3GTP J;  3HTA A;  5DTD A;  3CQZ J;  3RZO J;  2HXO A;  2LFB A;  2W48 A;  2PMZ N;  4JX6 A;  3JRF A;  1ETY A;  2R0Q C;  1ZKG A;  2VI6 A;  1AHD P;  1Z77 A;  2NS8 A;  1MBG A;  1WCM J;  4IHV A;  3HOY J;  1ITY A;  1W0U A;  3LNQ A;  4XID A;  5BNG A;  1QPI A;  1HDP A;  3HGG A;  1U9O A;  5E3L A;  1OFC X;  4NEL A;  2JK3 A;  3C07 A;  1JJ8 C;  2D6Y A;  1F43 A;  4UDS A;  4HNV A;  3ZOB A;  3Q3S A;  3HDD A;  2R5Z B;  4LOC A;  2CUF A;  3FK7 A;  3DCF A;  1ZQ3 P;  3RH2 A;  3QBM A;  4DZJ A;  1P7J A;  4DYC A;  4D7M A;  4ME9 A;  2R7Z J;  5E3N A;  3JR9 A;  2CUE A;  3LJL A;  2EBI A;  2GEN A;  2NS7 A;  2JA6 J;  1ETW A;  2VUM J;  2QTQ A;  2XGD A;  3EUP A;  2L7M P;  2UXP A;  5D19 A;  3HM5 A;  3HOZ J;  2DMT A;  1TWH J;  2KT0 A;  3H3V K;  2OER A;  5F0F A;  1U9N A;  1LE8 B;  3BHQ A;  2L0K A;  3IV5 A;  2IEK A;  3LSG A;  1YRN A;  3E7Q A;  4Y52 J;  4A3C J;  2QWT A;  3QQA A;  2HOT A;  1DU6 A;  2DMU A;  5M3F J;  4AC0 A;  5CXI A;  5JLW A;  2QKO A;  4IEJ A;  4C3J J;  1ZR4 A;  1E3O C;  5IP9 J;  2E2J J;  3FK6 A;  1UI6 A;  3K2A A;  3BR1 A;  1BL0 A;  4XRS G;  1Y1V J;  1NK2 P;  4A69 C;  1NTC A;  4KWA A;  4A3J J;  3OSF A;  1VFC A;  3BQY A;  5FLM J;  1IJW C;  3DEW A;  1ETQ A;  4UUS B;  2UXO A;  2E1O A;  3I4M J;  2HKU A;  1VF9 A;  5DS9 A;  1WH5 A;  1FIP A;  2XB0 X;  4M3E A;  1HOM A;  2ECC A;  1IDY A;  1VI0 A;  2M9H A;  1I6H J;  3T6N A;  2TCT A;  5GPC A;  1IG7 A;  2HYT A;  4A3E J;  2CQX A;  1UG2 A;  4DYQ A;  2RAE A;  1TC3 C;  3S1R J;  2UXI A;  4J19 A;  1ZR2 A;  1MBE A;  1OJL A;  4V2G A;  3BG9 A;  1SFO J;  3NPI A;  4JYK A;  1ETO A;  3ZQL A;  4MIM A;  2ZOZ A;  4M3G A;  9ANT A;  4CYC A;  4MK6 A;  5FJ8 J;  3S17 J;  2G7S A;  2HXI A;  5F27 A;  3JRA A;  4V2F A;  3BG3 A;  1Z0X A;  1XC5 A;  2NVT J;  5IP7 J;  1UHS A;  3NXC A;  2VKV A;  3E7L A;  3LOC A;  2XPV A;  3HTI A;  4XK4 A;  3HOW J;  5C3E J;  2YU9 J;  3BCG A;  3SFI A;  3VW2 A;  3BT9 A;  2CRG A;  3ZQH A;  2K9Q A;  5FHP A;  3A01 A;  4A3G J;  2OI8 A;  3GTO J;  2DA7 A;  4JNN A;  2CQQ A;  1JKO C;  1SAN A;  2DA2 A;  5EZG A;  3F1B A;  2ME6 A;  3BR6 A;  1NK3 P;  1VND A;  3PO3 J;  5EFY A;  3CDL A;  3B6C A;  3COL A;  1WI3 A;  1ZTR A;  1BJZ A;  5J1R A;  1W0T A;  3S15 J;  5IPA A;  5EG0 B;  1X2N A;  1JT6 A;  4XIC A;  1GDT A;  2L9R A;  2X6O A;  1ENH A;  3S16 J;  3SDG A;  3NAR A;  2H8R A;  3MNL A;  2DJN A;  2EZL A;  2DG8 A;  3BJB A;  3HOV J;  2VKE A;  4A3K J;  1AKH A;  2JN6 A;  2ZB9 A;  1U78 A;  4QIW N;  2HDD A;  1PUF A;  5EGO A;  5FKM A;  3H0G J;  3IH2 A;  3M3Y J;  4L62 A;  2ZOY A;  2LY9 A;  2XGE A;  2Y9Z A;  2AHQ A;  1Q1V A;  2R5Y A;  2LP0 A;  2R93 J;  4I6Z A;  5HSZ A;  4M6V A;  1QRY A;  2M8G X;  3BR0 A;  1JKQ C;  2QIB A;  5EDN A;  2E2H J;  1IDZ A;  1UI5 A;  2DA5 A;  3CMY A;  3CWR A;  4CGR A;  3VVX A;  5HBU A;  5E3O A;  1JTY A;  1JUP A;  3NRG A;  3ZQF A;  3NI7 A;  1FTT A;  2DA1 A;  1Y1W J;  2HQ5 A;  3JSJ A;  4MFE A;  1HF0 A;  5F0H A;  3GTL J;  1TWC J;  5J3L A;  1JKR C;  1EF4 A;  2VPR A;  2DMN A;  2X48 A;  3HB9 A;  5F04 A;  3VPR A;  1XG1 A;  1TWG J;  2FQ4 A;  2HYJ A;  3A03 A;  3CCY A;  3TW6 A;  5EEA A;  4FIS A;  3S1N J;  2NOG A;  3A02 A;  4I76 A;  5F1J A;  3GTG J;  5M5W J;  4JP0 A;  1I3Q J;  2FD5 A;  2I10 A;  3GBG A;  4A3D J;  3JRB A;  1B72 A;  3HKZ N;  1MNM C;  3ZQG A;  5DAJ A;  3TED A;  2GBY A;  2W53 A;  1GUU A;  1MH3 A;  4IHX A;  1RR7 A;  2O8K A;  2XGC A;  2Y9Y A;  4X1E A;  3VW0 A;  2UXH A;  3O60 A;  5C4Y A;  4C2M J;  1X58 A;  5IOY A;  3NAU A;  1T33 A;  2O7T A;  1JUS A;  3SJM A;  2Y30 A;  3RZD J;  3JRG A;  4ACI A;  5FKL A;  3VW1 A;  1K61 A;  4ICH A;  2M2E A;  4RDU A;  3HOU J;  3RQI A;  4G12 A;  1MBH A;  1JJ6 C;  5AQC A;  1QVU A;  1IV6 A;  3OIO A;  3VVZ A;  2NVQ J;  3ANP A;  3C2B A;  2OF7 A;  1FEX A;  1SGM A;  3LHQ A;  1TWF J;  2GFN A;  2E2I J;  2K9S A;  2O9L A;  2M0C A;  5GP9 A;  3O8H A;  2R5Z A;  1RET A;  2QCO A;  1D5Y A;  3FIW A;  5C44 J;  1B8I A;  3PO2 J;  1POG A;  5EYR A;  1U8B A;  3BTJ A;  4DYR A;  3HIM A;  1WGX A;  1TWA J;  3GZI A;  3A01 B;  4BXX J;  1GVD A;  2YUS A;  3TP0 A;  1WPK A;  4FE4 A;  5F08 A;  1RES A;  1HDD C;  2FJ1 A;  5FKN A;  4JX4 A;  2ME0 A;  2ZCX A;  3GEU A;  3VVY A;  4FE7 A;  4A3F J;  3BR2 A;  2YVH A;  2LR8 A;  2MW8 A;  4C3H J;  3HEF A;  3BTI A;  3QPL A;  2XPW A;  2B63 J;  4GCK A;  2D5V A;  2NP5 A;  4MO7 A;  2JWT A;  4A3M J;  1P7I A;  3JRH A;  3O8G A;  2PZ9 A;  4BKX A;  4M3B A;  4NDL A;  2DA6 A;  1ZK8 A;  2M34 A;  2DTZ A;  2DG7 A;  2ECB A;  1MSF C;  3KKC A;  3S2H J;  1HCR A;  4BBR J;  2DA4 A;  1S7E A;  2ZCN A;  1WH7 A;  5FMP A;  1AKH B;  3ON4 A;  2GM4 A;  2P81 A;  3MN2 A;  4IHY A;  2JA7 J;  4AC6 A;  1PUF B;  4BBS J;  4JX5 A;  1H89 C;  2NVY J;  3JRI A;  3G7R A;  2WGB A;  4X6A J;  2DMQ A;  1ETX A;  2YS9 A;  4D5F A;  1MH4 A;  3EGQ A;  2HOS A;  3CJD A;  4M3F A;  3BRU A;  2LTP A;  3PPB A;  2QF7 A;  2DN0 A;  2X9D A;  2NP3 A;  2QOP A;  4AF5 A;  5HAW A;  1JT0 A;  2Y0S N;  4C3I J;  2K40 A;  4AYB N;  2PBX A;  4JL3 A;  3G1L A;  1X2M A;  2RAS A;  3HBL A;  1RKW A;  2Y31 A;  2LVS A;  3B6A A;  2XRL A;  5FKO A;  3ZQI A;  1BA5 A;  3S5R A;  3V78 A;  4GCL A;  3JRE A;  1BW5 A;  3JRD A;  1JGG A;  1F36 A;  5M5Y J;  1A6I A;  4QSH A;  1IC8 A;  2ID6 A;  2L7Z A;  5IYD J;  2G7L A;  1IUF A;  1QVT A;  2DA3 A;  2XDN A;  3BQZ A;  1IRZ A;  3VOK A;  2KDZ A;  2RHA A;  1ETV A;  2E19 A;  3OSG A;  3LSJ A;  1B72 B;  3HGY A;  5CW8 A;  1YRN B;  2JJ7 A;  3HOX J;  3IUV A;  2JMW A;  4NN1 A;  1GV2 A;  3M4O J;  2CU7 A;  2L7F P;  4MLO A;  3BG5 A;  4A3I J;  1O4X A;  3D1N I;  3FIS A;  5FLV A;  2WV1 A;  3I4N J;  1GT0 C;  2K9N A;  4B3A A;  5HOD A;  2IAI A;  5IP6 A;  4A3B J;  3WHB A;  1G2H A;  2MSY A;  2LD5 A;  4BY1 J;  3UKG A;  3BTL A;  5EG0 A;  3FKI J;  4Y7N J;  1A5J A;  3ZQC A;  2O7O A;  2H1K A;  5D1R A;  3MKL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...