3BTDE

The crystal structures of the complexes between the bovine beta-trypsin and ten p1 variants of bpti.
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
222
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structures of the complexes between bovine beta-trypsin and ten P1 variants of BPTI.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PROTEIN (TRYPSIN)
total genus 52
structure length 222
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3btdE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3btdE02
1O30A 5E0JA 2TGDA 5JBAS 3RMNH 2OBOA 5E0GA 4I8HA 1CT0E 3QWCH 4I33A 3RXSA 5GCHF 2OC1A 1CA8B 1S84A 1N8OB 4KGAA 1OP0A 2UWOA 1YF4A 1UTJA 4OGYA 3F6UH 5A0AE 1PQ8A 3RM0H 3SU6A 1O31A 1TBRH 3NCLA 3EE0B 1MD7A 1VITH 3SJIA 2AEIH 2ZCKP 2VWLA 1TGNA 2CHAB 2Q6GA 5GIBA 3SI3H 3F9GA 1Z8GA 3RC6A 3F9HA 3O8BA 4I31A 1P2NA 1SSXA 3MWIU 3UPEA 1QB6A 1HBTH 3U9AH 1O2MA 3B23B 3BG8A 5DJ7A 1OWHA 4CHAB 5A09A 1C1MA 4A1TA 3QN7A 2C8YB 5C2ZA 1GBHA 1MU8B 1SMFE 2ANYA 1DWEH 2F3CE 3M5MA 1BOQA 1GMHG 3KNXA 1A5GH 3F9EA 5FBIA 1GMDF 1W7GH 4AZ2B 4D9QA 2BTCE 4DGJA 3PWCA 2PKAB 2FDAA 2P59A 3SQEE 1BJVA 1H9LB 2SNWA 3DUXH 1W14U 1Y3XA 4JYVH 4X2WA 3ODDA 2G5NA 1Y5BT 1OWDA 2G81E 3MTYA 4DG4A 1NRPH 2V6NA 1QBVH 1TGSZ 5C5NA 1LVMA 4GAWA 3TPIZ 1WTGH 2H5DA 4UD9H 2P8OC 5T6GA 1P2JA 1Z8IB 4X6OA 3FP8E 1EB1H 1O3NA 2Z3DA 5TCAA 1SGQE 2VIQA 2BYAX 3BTTE 1MBQA 4JK6A 3VB3A 5FX5A 1QBNA 1F0TA 2BDHA 4Y71A 3SNDA 1C5WB 5F8ZA 2A7HA 2ZHWH 4UFEH 1D6WA 2FYRA 3HATH 5HM9A 1P9SA 3TNTA 2GGVB 2XC0A 2OQUA 3EAJA 4JZFH 1RJXB 1AB9B 2QN5T 2FOBA 2AMDA 1GJ9B 2PTCE 2Z9IA 1WOFA 2BY9X 4AOQA 2QF0A 4ISNA 4KP0A 3A87A 4KELA 4H6SB 3RXTA 1ETRH 3I77A 3SUEA 1TABE 1C4V2 2H2ZA 2ZTYA 3HGNA 5GJ4B 1A46H 1PPZA 3T5FH 2FI4E 2ZNKH 5FCRA 4A1XA 5JB9S 4YOIA 2BOHB 3SGAE 2VVUA 4GSOA 1BITA 3MO3A 2VIWA 2XCFA 3WY8A 1YPLH 1S6HA 3DD2H 2O8MA 1JOUB 5G4BA 1WBGB 2ZC9H 1EZQA 1QGFA 3ENSB 1ELTA 4GHQA 1SQAA 3H5CB 2QY0B 3ZVBA 1Z6EA 1PQ7A 1U6QA 3M3SA 2SGQE 1SPJA 3ZVGA 1H8IH 1GI7B 2J92A 3RXQA 3UR6A 2IPHA 2FOHA 1AMHA 1IQEA 1ELEE 1ANBA 1OSSA 1TNKA 3UOUA 4AG2A 1AFQB 1PPHE 3RXOA 2FX6A 4YOGA 1RTFB 2CHAC 1EASA 1QJ6B 4ZHAA 1PYTD 3HKIB 4IMZA 1GJ5H 1NC6A 4U30A 5LPRA 3SGBE 2ZI2H 3UFAA 1O3OA 1MKXK 3UNSA 3F68H 1HAIH 3E6PH 2BD3A 2W7SA 2SNVA 1THPB 4UFFH 3URCA 1KXCA 1P2MA 1V2WT 1GVLA 1SQTA 2XXLA 1C2JA 5GCHG 3SNEA 1A3BH 1FZZA 2HWLB 1D3DB 1E36B 2OQ5A 1PQ5A 1P2QA 1P2OA 4CREA 2VIVA 2BDAA 2ZQ1A 3HGPA 1JIMA 3BV9B 5GPIB 3SV6A 1BBRK 1A1RA 2Y5GA 4ABAA 1BMAA 1QHRB 1UHBB 7LPRA 4IS5A 4JZEH 3K9XB 4ZXYH 1G37A 1EB2A 3TGKE 2W3KA 4Y8XA 2ZEBA 5PTPA 1O33A 1UK2A 4ZROA 4A92A 2H9HA 5EQQA 1NRSH 1O5EH 2FX4A 4BOHA 3PM3A 2LPRA 1DWCH 1GHBG 1VJ9U 2GD4B 2GT7A 5EU8A 4ZKRU 5LGOA 1SGEE 1UVUH 2DUCA 2FESH 1DXWA 3L3TA 1GMCF 2ZHDA 3H7OA 2ZDMA 4ZKNU 2A5AA 1FY3A 1MQ6A 1O3IA 2OBQA 1LHEH 4XFQA 6LPRA 1SLWB 3QK1A 1L4DA 1YKTA 4ASHA 4AX9H 3TGJE 5EOKA 1ESTA 2PW8H 1C2EA 4ABEA 3MH6A 4OS1A 1AHTH 2GT8A 3M5LA 1ZJDA 2D8WA 4I8GA 1HXFH 4CRAA 1HJAC 1K28D 1ZMNA 3ELAH 4OS2A 4Y0YE 4AFZA 1DANH 3VEQB 1GI8B 3GYMA 1OP8A 2BY7X 4D9RA 1P12E 1UTNA 4RKOB 3BIUH 4TY7A 1QNJA 2B0FA 1T32A 3O8RA 4MDSA 1DY8A 2OINA 4AFQA 3SW2B 1Y3WA 2BDYA 1V3XA 1DVAH 1K2I1 1GBTA 2A0QB 3RLYH 1BJUA 2AGGX 1MU6B 1ABIH 2ULLA 1C5OH 3LGYA 5DP3A 5BRRE 1RIWB 2HPPH 3PYHA 1RRKA 1O34A 3DFJA 3U1JB 2XYAA 1Q2WA 1O3CA 1TRNA 2WYGA 1G3CA 3ZVCA 4ABJA 1SLUB 2QV1A 1C5SA 1E34B 2RDLA 1ZR0A 2ALPA 2GP9B 3W94A 4SGAE 2P93A 2DE8A 1C2FA 1VZQH 5E2PA 2W5EA 1DFPA 3GY8A 5HMAA 1NRNH 1V2JT 3RXIA 3A86A 4DIIH 3RU4E 1O2XA 4YLQH 3GCHB 5E8EH 1AKSA 5F8TA 1MKWK 3QZQA 1O3KA 2ZDKA 4AGJA 1IAUA 3P6ZB 3QGJA 2ANWA 4WY3A 1BDAA 2QAAA 4NZQA 3P8OA 3S9CA 3ATIA 3S0NA 1ANEA 3LC5A 1G30B 1VJAU 1SGFG 3OTJE 3PWBA 4FUIA 1OS8A 1IHTH 1C5VA 4JK5A 3SN8A 1P57B 1SGPE 1WTHD 4JMYA 4WMEA 1ELBA 3HK6B 2A1DB 2Q1JA 1EXFA 3HPTB 3K6YA 5FCKA 4FUEA 1SGCA 1HJ9A 2C8WB 4MLFB 5FPYA 3SUGA 4LXBH 1EOJA 3W95A 3SV2H 1C5ZB 2FOCA 1O32A 2O8WA 2WV4A 2FMJA 3GDUA 3SOSA 1UCYK 4ZHLU 1IQMA 1L1GA 1TLDA 1S5SA 2BDCA 4I32A 1ABJH 1C2HA 2FLRH 1LQDB 2VJ1A 4XE4A 3UUZA 1BTZA 2FOFA 1O2ZA 3MU8A 2H9EH 2J38A 3V0XA 3FAOA 3LJOA 1BTWA 5A8YA 1KIGH 9ESTA 2PGQB 2VINA 3I29A 1W0YH 1WSSH 2W3IA 4GVUA 5J4SA 3MU1A 1TX6A 4I8LA 1BQYA 3AVZA 1C2GA 1V2ST 1F92A 4U32A 2Z9LA 3M3VA 1C5UA 2GCTB 1UTPA 1ZYOA 4DT7B 4OS7A 4B76A 2PKSC 2WPHS 3OY6U 1KXDA 1S81A 1A4WH 7GCHG 3LPRA 2ZCLP 1QA0A 2Y82A 3TIUA 3CS7A 2ZIQH 5A0CA 2BY8X 2WPIS 1AO5A 2PTNA 1UTLM 1F0UA 1A7SA 4O97A 1C2LA 1C5NH 2VU8E 2BLQA 2PR3A 2F9OA 1AU8A 2I6QA 1C2DA 5T6DA 2PUQH 4FU7A 2ZDAH 2XWBI 1O3LA 5EW2H 3TU7H 2AERH 3DFLA 5EG4A 2TPIZ 1W12U 1RTLA 1S83A 5T6FA 4Y7AA 3ITIA 2JH5D 5CE1A 1Q31A 1FUJA 1J16A 2ZFFH 1GI1A 3KN2A 1P04A 3D62A 2SFAA 1GGDB 4Y6DA 1DUEA 1AI8H 1S82A 2PUXB 1Y3VA 2BVRH 2ZHQH 1FXYA 3TH4H 1KLIH 1L0ZA 1V2OT 1C1WH 2ZU3A 1ZMJA 2GDDA 3SJKA 4AFSA 1AUTC 2Z6BD 3BTKE 4WVPE 3RXAA 4WXIA 1PQAA 2EC9H 2Z7FE 1HAVA 3S7KB 3FZDA 1O2LA 1HNEE 3T25A 1ZJKA 4FUGA 4NWLA 4K1SA 1QRWA 1TQ0B 1HAGE 2TIOA 1NFWA 3Q77A 1C9TA 1YCPH 3KGPA 1O3HA 1GI9B 4NA8A 1TFXA 1O3AA 1G9IE 1V2KT 1HIAB 5AF9H 3MNSA 3A8AA 2O8UA 3RXPA 2GZ7A 1HAVB 3BIVH 2R2WU 1SVPA 2RCEA 3P70B 1Y3UA 2V0BA 4I8JA 4K8YA 4B2BA 1AN1E 1CHOF 1T31A 1DX5M 1SB1H 4M7GA 4O03A 5CHAB 3TITA 1ZPCA 4Y8ZA 1HAYB 4IC5A 3M37A 1Z8RA 1NY22 2P3TB 2QCYA 1UO6A 3GY6A 1XVOA 3OU0A 1ETSH 1P0SH 1AFQC 1NRQH 1C1UH 3BTEE 4GCHG 2JETB 1O37A 1UTOA 2HVXA 3ZVFA 2ANKH 1W3CA 3RMMH 2JH0D 1ELAA 5HM2A 4ZH8A 4K5ZA 4YTAA 1HCGA 3K6ZA 1K1JA 2G8TA 2ZHEH 1SLVB 1B0EA 1NRRH 1DITH 3BTME 3ZYEA 1G32B 1C1RA 3MHWU 3UR9A 3U69H 4AGKA 1A5IA 3P8FA 1ZZZA 2FO9A 2G51A 1SG8B 1NFYA 4SGBE 3R3GB 2ZP0H 3P92A 1GBMA 3SHAH 2VH0A 4BAHB 2BMGB 2VNTA 1N8OC 2ZFQH 1SHYA 5ETXA 3BTWE 2G4TA 1GJ4H 1AE5A 2V3HH 1INCA 1GMDG 1ACBE 1MKXH 2ZA5A 1F7ZA 1QFKH 1H8DH 1TOCB 3OSYA 1ETTH 4B2CA 5H4IB 3KF2A 5K0HA 4UDWH 1GBBA 3UNRA 3E8LA 4WH8A 1O5CB 1Y59T 1FI8A 1OXGA 4MTBA 4CBNA 1DWDH 1O2QA 3OX7U 3ZV9A 1GHBF 5EGMA 5IYTA 2FWWA 2BLVA 3GCTG 2WPLS 3EGKH 1FDPA 1V2RT 1BTHH 1ELVA 5F6MA 4ABFA 2Y7ZA 1RGQA 1O3FA 2WUBA 3A80A 2A4QA 5GXPA 3P17H 2A31A 1HB0B 5BPEA 3SJ9A 1BT7A 3ATMA 4OS6A 1HIAA 2ZGJA 1AZ8A 4ISLA 1K1LA 3ESTA 1IQLA 4FVDA 1D4PB 4R8TB 4DIHH 2P95A 4ZXXH 3U1IB 1DM4B 3TLOA 2HGTH 3KQBA 1S0RA 1W0ZU 4INHA 5L6NH 1TRMA 2BXUH 5AFYH 3ZZ4A 4BAQB 1GI4A 2HALA 4O3UA 1FMGA 1O2VA 1V2NT 2FLBH 2A4GA 2WV5A 3VB6A 1MQ5A 2FI3E 5AHGH 1PPBH 1GI6A 3P8GA 1KXEA 2BDBA 1V2QT 4RN6A 1UK4A 1KTTB 2GTBA 3E1XB 1EKBB 1YC0A 3T62A 2DE9A 1FY5A 2ZPRA 2V3OH 3GY3A 1LMWB 2GKVE 1CVWH 3VB7A 2BD9A 2ZPSA 8ESTE 4AYYB 2HNTE 3SNBA 2NU0E 2H9TH 1C4U2 4F49A 1CA0B 1DOJA 2FIRH 1ZRKA 1KSNA 3FFGA 8GCHF 2PSXA 1BRCE 3A7TA 2BLOA 3RXRA 4XBBA 1GBEA 1LHDH 1OWEA 3GCHC 4X8VH 3SJ8A 3PTBA 3EYDA 5C3NA 5DPAA 1ZLRA 4IMQA 2GV7A 3FP7E 2F9UA 4GLYA 4XBCA 4DCDA 5DP8A 1HAXB 1QB1A 1AB9C 1QL8A 1GI2A 1F5KU 2B7DH 1TPPA 2H1UA 3NZIA 2FTMA 1FPHH 1VCQA 1NU7B 1O2NA 1P2KA 1AUJA 4X1PU 3T28A 1MZAA 3KIDU 1S0QA 1YPMH 2AGIX 3RC4A 1GBCA 1QIXB 2HLCA 2ZU2A 2ALVA 1ANDA 5C1XA 1GBIA 2BY5X 1MKWH 2FOMB 3E0PB 2OC7A 2WPMS 3A7WA 4KTSA 1MAYA 3ZZ6A 1TNJA 4FVBA 1TA6A 2BDGA 1V2PT 1AQ7A 1GMCG 3IWMA 1AFEH 2ZDLA 4JZDH 4D76A 2BQ6B 2M5TA 1YPGH 4MPUA 2BZ6H 5EXMA 1L1JA 6ESTA 3SUDA 2C8XB 1RTKA 3K2UA 4X2YA 1EQ9A 3LKWA 4FUHA 4INLA 2ILNA 1YPJH 4NSVA 3GISB 3NPSA 1ELDE 4IBLH 3MNBA 2VWNA 4NFEA 1SGIB 2UWLA 1ORFA 4DY7B 5DP9A 1TNGA 2YNBA 1TMBH 5FPTA 2J95A 1E0FD 4MNXA 4MPXA 3RXFA 1FV9A 1O2JA 2WYJA 2CGAA 2F83A 1IHSH 3RXGA 3NUMA 3Q3XA 4FU8A 1AY6H 3GCNA 1P9UA 2ODQA 3Q3KA 4X1SU 1GJCB 1YPHC 4IC6A 1ZHPA 3EDXB 1AKSB 3I78A 3B9FH 4AORA 1GBDA 2XBXA 2HNTF 1Z1JA 1QRXA 5A0BA 1TX8A 4AN7A 1NFXA 3ZZ9A 1GL1A 1C1SA 1XUGA 1A3EH 1D6RA 1FLEE 2EI7A 4K3JA 2W26A 1UVPA 1NS3A 1YPHE 3M7QA 1AVXA 1IQFA 3SU0A 3VGCB 2AIPA 3QX5H 2ODYB 3G01A 1ZGVA 4K1EA 1C5LH 1B5GH 1VCPA 5EW1H 5F8XA 3T29A 1OWIA 1CGIE 3SO3A 4ISOA 1ZSKA 5FPSA 3FP6E 1J14A 1BRAA 1BMLA 1L1NA 2J4IA 4ISHH 3V7TA 3LGTA 2PWXA 4KTCA 2ZHFH 3PMHB 3UNQA 1LO6A 4ISIH 4HTCH 1ZSLA 1OP2A 3LH1A 1MAXA 3HK3B 3RP2A 5ABWA 2BZAA 4J2YB 3PROA 1WYKA 1SGRE 1NROH 4NWKA 3ZV8A 1EPTC 1C1TA 4B74A 2K1QA 5HGGA 1O2SA 4Y0ZE 4MNVA 4IN1A 4X8TH 4D7FA 4FUDA 1SC8U 1F0RA 2GCHF 5A2MH 4WH6A 1B7XB 1Z6JH 2ZFRH 1CBWC 1J9CH 1A0LA 5DKMA 1ARBA 3S9BA 3EQ0H 3Q3YA 2G4UA 1O5DH 1SLXB 3EA7A 3BEIB 2CV3A 4NFFA 4CHAC 3KHVA 1XUIA 1BBRE 3A83A 2G00A 3PLKA 3QZRA 1BBRH 3SGQE 2BD4A 1AZZA 3PLPA 1EATA 1BTYA 2HOBA 4Z6AH 1GJ8B 2FP7B 1HAZB 2GDEH 3H7TA 3SHCH 1DSTA 1C4Y2 1XUFA 3RUOA 1ARCA 5JBBS 4YT6H 3Q76A 1HDTH 2NWNA 3V13A 2BHGA 1GHZA 2BQWB 1LCYA 1LHFH 1OKXA 1MTSA 1O2UA 1ZSJA 3E16B 2P3FH 1GI5A 4A7IB 4R0IA 5DK1A 1Z8JB 1TWXB 1Z7KA 4JZ1A 2PV9B 3MU4A 3KEEA 2A45B 1C5PA 5DO4H 3LGVA 2PKAA 2GX4A 3UWIA 4YESB 2QYIA 4DVAU 5IDKA 2FI5E 4Y7BA 1FPCH 1UVOA 4K69A 4TPYA 4X1RU 2GVFA 3RMLH 2AH4X 1QBOA 3AAUA 1BTPA 2XBVA 5A8ZA 1O2OA 4UFDH 2ZZUH 1K1PA 1NESE 3A82A 3B8JA 4NGAH 4DW2U 1SBWA 1MTNC 4FUCA 1W10U 4ZKOU 1C2KA 1CT4E 3RXMA 3GOVB 2A7CA 1VGCB 2HPQH 4X0WU 2BD5A 3PMBB 4YO9A 2XC4A 3D49H 4YOJA 4I8KA 5EPYA 1O2TA 1EJMA 5HYOA 1CQQA 1SGDE 3S9AA 2ODPA 1C1OA 4U01A 1O39A 1UTKA 2Q6FA 1ZTKA 2ZPQA 2JETC 9LPRA 4OS5A 1O2YA 4FUFA 4H4FA 2VIDA 3SV8A 1O5FH 2FTLE 1G3DA 1HXEH 1LPGB 3D65E 2STAE 5JPMH 1HGTH 1OYTH 2ANMH 4XSKU 1PPFE 1G3BA 1K1NA 1FY4A 3M3TA 1RXPA 3SU1A 4WMDA 2FS8A 2O8TA 1O5AB 1W13U 3A8BA 1KLJH 3A81A 2FZZA 4MPVA 1FQ3A 1TMUH 3GCTF 1BRUP 3MFJA 1V2MT 4X2VA 3ZZ5A 1UTMA 4X6MA 1AE8H 2BVXH 2ZGCA 1SL3A 2FODA 4WJG2 2ASUB 4ZHMU 4BNRA 1EUFA 4WWYA 4HZHA 2XW9A 2WPKS 2Y5HA 5ESTE 1UVTH 2UUFB 2BQ7B 1S85A 3RXKA 4AYVB 4X6PA 2Z3EA 1EJAA 3P95A 3BTDE 1OPHB 4LK4A 3LOXA 3MU5A 1XKAC 4ZUHA 2Z94A 3MNCA 8LPRA 1A0HB 2H5CA 1P05A 2OCVB 3M7TA 1DICA 4H6TA 3M35A 1YPKH 4NIWA 1HAOH 3NK8A 1FIWA 1HUTH 1ESAA 2BX4A 1SI5H 1XMNB 3PB1E 2STBE 4JCNA 4ABBA 4DURA 1GJDB 4HGCA 2YOLA 3AASA 1QR3E 1C1VH 1LQEA 3R0FA 4TYDA 3E90B 5DGJA 4F4OC 4J1YA 3VXFH 2ZGBH 1O5BB 1O2PA 4IW4E 3UQOA 1K1OA 3GY5A 5FX6A 2ZU4A 5DP4A 2EA3A 1MCTA 1G2LA 8KME2 1ZPBA 4RSPA 4U2WA 1EAIA 1O3PB 1XX9A 2QC2A 3U8RH 3TJUA 4Y76A 4YM9A 3LGWA 4BANB 3A89A 5FBEA 5LH8A 3RXCA 4THNH 1GDNA 1ZMLA 1TX7A 3SV7A 4CRDA 3SI4H 4WMFA 1JXPA 1O3BA 5C5OA 1LHCH 1C1PA 4XDEA 2PKSB 1O2GH 3QTVH 1TNLA 2A5IA 3A85A 2ZTXA 4X2XA 3GY2A 1KDQA 2BD8A 3BEFB 4K60A 1DSUA 1BB0B 1D9IA 7GCHF 2LNCA 2OC0A 2Y81A 1JIRA 5CMXH 4CRFA 4X1QU 1OOKB 1DLEA 5E2OA 1JRTA 1W11U 3ODFA 3VGCC 1PPGE 2NU2E 1O3EA 1PYTC 3FVFB 1YLDA 2RG3A 2VB0A 2Q6DA 2ZQ2A 1KY9A 1Z1IA 1GWAA 4PROA 4CR9A 4FUBA 1QB9A 3A8DA 1K9OE 5EQSA 1XUKA 3K65B 1O38A 1ELGA 2AIQA 2H6MA 2KAIB 1LDTT 1P3CA 3RXUA 6GCHG 1THRH 2NU4E 1C1NA 1PFXC 2UUKB 3T27A 2SGEE 3F1SB 4Y8YA 5DG6A 1SR5C 4Y11E 3VB5A 1YCPK 1GGDC 1TPAE 1C1QA 4BXSA 5I25A 4B71A 1JMOH 1GG6C 1EAXA 4MQAA 1CGJE 1MTUA 1TBQH 3U8OH 4HFPB 4K8BA 3EA9A 1L2EA 1DE7H 1HV7A 3LH3A 2BLWA 1O5GH 5EODA 1YM0A 2XWAA 1ZOMA 3TNSA 1ZTLA 3GICB 1O2RA 1FN8A 2ZECA 3SQHE 1UHBA 4WXVA 5GWZA 1MD8A 1UVSH 1BTUA 2KAIA 2FOGA 3NXPA 2ZFPH 3VPKA 2TGTA 1LHGH 4DOQA 3ZZ7A 1TALA 3ZZDA 2ZGHA 4XBDA 1NTPA 1GJBB 5SGAE 4E05H 1V6DA 1KDQB 3BTQE 1F5LA 4CRBA 3M36A 2P3UB 2HRVA 1BRBE 2ZFSA 2O8LA 1TRYA 1NZQH 1XM1A 2B9LA 5CHAC 2F91A 1AWHB 3E0NB 1Q3XA 2Y80A 5C67A 2ESTE 4BTTB 4NA7A 1MZDA 2BD2A 5EXLA 4NIVA 5JBCS 1QRZA 1NO9H 1AGJA 3NKKA 1GBAA 4UFGH 1H4WA 4ZMAH 4FU9A 3L33A 1EZSC 2CF8H 1TB6H 3BF6H 5JDUB 3SUFA 1KTSB 2BD7A 2Y6TA 1CE5A 2G5VA 6CHAB 3SU4A 1SOTA 2AMQA 1K1MA 3CENA 2FPZA 3RXEA 1TPOA 1VR1H 1WQSA 1BHXF 2OXSA 5EQRA 1ZRBA 3BSQA 3SU2A 3BTFE 4MPWA 1W2KH 2OD3B 3AAVA 1SGFA 2B8OH 3A7VA 4O9VA 4VGCC 4GHTA 5I46H 3ZVDA 2PLXA 1BMMH 1HJ8A 5TJXA 2FS9A 2TGPZ 1HFDA 1CSOE 1G2MA 4Q2KA 3RU4T 2ZU5A 1TNIA 2J94A 3SNAA 4TWYA 1CBWB 2VGCC 5JYIA 4K1TA 4JYUH 3SV9A 4X8SH 1WAYB 1NM6A 6CHAC 1N6XA 3AW1A 3LONA 4NIYA 1MBMA 1A61H 1QJ7B 3PMJA 2OP9A 2WUCA 1FAXA 1Y5UT 2R3UA 3FANA 1GI3A 3A84A 1LVYA 1F0SA 3GCOA 1GDQA 5K7RA 2R0KA 3DT0H 2TBSA 1T8OA 2ZTZA 1QL7A 3MO6A 1GL0E 4GPGA 4UE7H 1HRTH 3A7ZA 3IG6B 2SGPE 5AVDA 1CGHA 3LIWA 2XTTB 1H9IE 1L4ZA 1GPZA 1T4UH 2F9PA 1V2UT 1DUAA 1WCZA 1EJNA 4A1VA 2PFEA 3ZZAA 2THFB 2P8OB 2PSYA 1ZHRA 2F9BH 3RXLA 3A7XA 2VVCA 1DWBH 2A32A 2CJIA 1IQHA 3UIRA 5L2ZH 4NZLA 1K21H 2J9NA 3Q00A 2OUAA 1SFQB 1BUIA 2B5TB 4BAOB 3LGIA 1TGTA 2QXHA 1YYY1 3KL6A 2C4FH 4MVNA 3ZZ8A 1QA7A 2BOKA 3RXHA 5L30H 2ZDVH 3MO9A 1GCDA 1EP6A 1PPEE 2GCTC 1QCPA 1C5XB 1GVZA 3E3TA 3UREA 1GG6B 4CRGA 3MI4A 1V2VT 2XBYA 2AYWA 3UQVA 2GZ8A 1S6FA 3KQCA 1QQUA 3MNXA 1GHYH 1FNIA 3PO1C 2AS9A 2IJOB 2IN2A 2A4OA 4JZIA 3JZ2B 1NT1A 4GUXA 4ESTE 2FOEA 3V3MA 3QLPH 5FAHA 3RC5A 1LPZB 3TVJB 1TGCA 4YT7H 1G36A 1GHAG 5J4QA 1O3MA 1C2MA 2ZF0H 3KCGH 1IQNA 1RD3B 3LJJA 4AB8A 1MMJN 2CN0H 3L6PA 1SOZA 5B6OA 1EPTA 1LPKB 2FM2A 3AW0A 1QURH 1TYNA 1C5RA 4BAMB 2FYQA 4JYTA 1NU9A 2A7JA 1GHVH 1WU1A 1XUJA 1MH0A 1TAWA 4Q7ZA 4BTIB 1OWKA 1Y8TA 1IQIA 1P02A 1TONA 3PMAB 3EA8A 5EXNA 1BIOA 2ZFTA 1FY8E 2TGAA 4MG3A 2GMTC 2CXVA 1CT2E 3MH5A 1QY6A 4D8NA 1FIZA 3SNCA 3A7YA 1W8BH 1XXFA 3PTNA 1GBKA 1EPTB 2BXTH 3HKJB 3U98H 3O8CA 1GJAB 4GCHF 1WQVH 3SBKA 3URDA 2JKHA 4B73A 4ABGA 5AFZH 5GDSH 3MMGA 3STJA 5DP7A 1XVMA 1V2LT 1T8LA 4IGDA 3U8TH 1XUHA 3V12A 2D2DA 2VH6A 3F9FA 5DP5A 3FZZA 2XRCA 1YPEH 1ESBA 5LPEA 1O3DA 4B75A 1KLTA 1OX1A 3LDXH 4NA9H 1DT2A 2YNAA 3LGUA 1CHOG 3LC3A 1DS2E 3IITA 3STIA 1Y5AT 2OTVA 2BDIA 4I7YH 1A2CH 1SGNE 1GJ6A 1ID5H 3M7UA 1MTVA 4BTUB 2OC8A 4E06H 5EPNA 4UEHH 2HNTC 3TJOA 1BA8B 2W7UA 1GI0A 1LTOA 2BVSH 5T3HA 2SGDE 3UY9A 1DY9A 2OLGA 4CH2B 1P3EA 2VIOA 3TJNA 2UWPA 1DDJA 7KMEH 4TWWA 2QA9E 4A5TS 4XOJA 1T8MA 4CRCA 1O3JA 1C5TA 4WF8A 4NCYA 4NSYA 5FHTA 5L2YH 3BEUA 1YCPM 2RA3A 4NG9H 3N7OA 1D3QB 1C5YB 1C5MD 3RXDA 2WINI 2ZCHP 1UTQA 1T8NA 4AG1A 1P11E 5A8XA 1RIWC 4MNYA 1EAUA 1W7XH 1P8VC 2TRMA 3GY4A 1HAHH 1XXDA 1M9UA 4QT8C 3RLWH 1ZGIA 1YBWA 3LT3A 1O2IA 1O36A 4ZKSU 2CMYA 1AD8H 1QQ4A 2Z9KA 2CF9H 1H1BA 1LVBA 2EI8A 2D26C 1BHXB 2F9VA 3RU4D 1D3PB 4KKDA 1KXAA 2ZDNA 3MOCA 1O0DH 1BTXA 1VITG 4X8UH 4MNWA 1AIXH 3BG4B 2ZGXH 1B0FA 4ABIA 4HI3A 1AVGH 1VCWA 3TH2H 1J15A 2P94A 1UCYH 2A5KA 2ZO3H 1P09A 4K2YA 2D1JA 1UK3A 1GHXH 1AWFH 1EX3A 2NU3E 4ABHA 1VITF 3UOPA 3SU3A 2QXIA 2BX3A 2AFQB 1HAPH 4E7NA 2Y5FA 1TIOA 8GCHG 1H9HE 3TH3H 1GCTB 1P2IA 3MH4A 5C1YA 4FUJA 3PO1B 3ZZCA 2A2QH 5HXFA 4KTUA 3A88A 7ESTE 1N6YA 4BXWA 3ATLA 1GBLA 1NN6A 1PJPA 2O9QA 3RMOH 4ABDA 4VGCB 3TGIE 4FXGH 1P01A 2GCHG 3ZYDA 2Z9JA 4Y79A 3OY5U 1LVOA 2QXGA 2FOAA 1YLCA 1YP9A 1KXFA 4OGXA 2C90B 5F03A 2PHBA 4IN2A 1TQ7B 2VVVA 2P16A 1VGCC 2R9PA 3P8NA 3A8CA 3BTGE 1QTFA 1TE0A 1DXPA 3PV4A 4YLUA 4DJZB 1XKBC 2VGCB 3TK9A 2GMTB 4Y10E 2J34A 1F5RA 1HYLA 2JH6D 2R2MB 4INKA 1EAWA 3ATKA 1O2WA 2AMPA 1F2SE 1GJ7B 4B1TA 1TBZH 3CP7A 5C20A 2SGAA 4TY6A 4Z0KA 1JBUH 3GDVA 1SFIA 1P10A 1TA2A 1AVWA 1X7AC 2ZKSA 1J17T 2R0LA 2UUJB 1GMHF 5ESBA 3M5OA 4AB9A 1C9PA 3QGNB 4LZ4B 1ELFA 3QO6A 2UUYA 5DP6A 2I6SA 3O8DA 2G52A 1O2HA 2QGRA 1GDUA 1ZHMA 2QF3A 3BTHE 3TJVA 1GHWH 4LOYH 1IQGA 5JBTA 4LZ1H 3PLBA 1P06A 3CS0A 4E7RG 2C3SA 2J2UA 3QUMP 3TK5A 2WPJS 1G3EA 2FEQH 4OS4A 1TNHA 1TMTH 2QXJA 1MTWA 2GZ9A 3M5NA 5LPFA 3S7HB 1ANCA 1K22H 1MCVA 4D7GA 1BMNH 4AFUA 2R3YA 1T4VH 4Q7YA 3KQEA 6GCHF 1V2TT 3QTOH 5E0HA 1SGTA 3SZNA 2VWOA 1EOLA 1MTNB 5FXLA 1J8AA 3ZVEA 2A4RA 1O2KA 3ZVAA 1HLTH 2EEKA 2G55A 3SJOA 1FJSA 1C5QA 1K1IA 5C1UA 1JRSA 2C93B 1FN6A 2C8ZB 1MUEB 2NU1E 1THSH 3BN9A 2SGFE 1UJ1A 2XCNA 4CR5A 1KXBA 1A5HA 2Y7XA 1IQJA 3T26A 1TPSA 3KQDA 2ZU1A 1GHAF 1FY1A 1CU1A 2XC5A 3OYPA 1ZPZA 3D23A 4Q7XA 2V35A 1OWJA 2BB4A 3RXBA 1D3TB 2IOTA 3RM2H 1NFUA 1T7CA 4H42U 4YZUA 3JZ1B 5JB8S 4X1NU 1O3GA 1N1LA 3RXJA 2XNIA 3QDZB 1P03A 4X6NA 1EP5A 4NIXA 1RS0A 2AGEX 1GBFA 3M61U 1PPCE 1RFNA 3S69A 3ZZ3A 3C27B 1GCTC 1HPGA 3BG4C 2Z9GA 2VWMA 3SORA 1TOMH 1CO7E 1FAKH 4Q80A 1LKAA 2F9NA 1WV7H 4O3TA 1E38B 4UONA 1ELCA 3LU9B 1HJAB 1JWTA 2QIQA 1QL9A 1SGYE 1BCUH 1NPMA 4RKJB 1E35B 2A2XH 3MH7A 1OYQA 2BM2A 3RDZA 1GBJA 3VB4A 3GDSA 4A6LA 1ZTJA 1IOEA 1Z71A 3UTUH 3GYLB 1Y3YA 2RA0A 2GV6A 2Z3CA 1LKBA 3VXEH 1GVKB 3T2NA 2FXRA 1TGBA 3C1KA 3DA9B 1EZXC 3SU5A 3MU0A 1CA0C 3E91A 1E37B 1CHGA 4B2AA 1UMAH 4BAKB 1QJ1B 3VFEA 1IQKA 2EI6A 3ZZBA 1KYNA 2ZG0H 2ZWLH 3DHKH 2VIPA 4ZAEA 3RXVA 1FONA 2XBWA 3MYWA 1EZUC 1BZXE 1WUNH 1A0JA 1SHHB 1YGCH 5TCCA 1O35A 4CH8B 3UWJH 3GY7A 4TPIZ 3NWUA 1DLKB 1SQOA 3ATWA 2PGBB 3TK6A 1UCYE 4CBOA 2BY6X 1C2IA 1DPOA
chains in the Genus database with same CATH superfamily
1O30A 5E0JA 2TGDA 5JBAS 3RMNH 2OBOA 5E0GA 4I8HA 1CT0E 3QWCH 4I33A 3RXSA 5GCHF 2OC1A 1CA8B 1S84A 1N8OB 4KGAA 1OP0A 2UWOA 3DSGA 1YF4A 1UTJA 4OGYA 3F6UH 5A0AE 1PQ8A 3RM0H 3SU6A 1O31A 1TBRH 3NCLA 3EE0B 1MD7A 1VITH 3SJIA 2AEIH 2ZCKP 2VWLA 1TGNA 2CHAB 2Q6GA 5GIBA 3SI3H 3F9GA 1Z8GA 3RC6A 3F9HA 3O8BA 4I31A 1P2NA 1SSXA 3MWIU 3UPEA 1QB6A 1HBTH 1YY3A 1O2MA 3U9AH 3B23B 3BG8A 5DJ7A 1OWHA 3FOAA 4CHAB 5A09A 1C1MA 4A1TA 3QN7A 2C8YB 5C2ZA 1GBHA 1MU8B 1SMFE 2ANYA 1DWEH 4RT0A 2F3CE 3M5MA 1BOQA 1GMHG 3KNXA 2JIZD 1A5GH 3F9EA 5FBIA 1GMDF 1W7GH 4AZ2B 4D9QA 2BTCE 4DGJA 3PWCA 2PKAB 2FDAA 2P59A 3SQEE 1BJVA 1H9LB 2SNWA 3DUXH 1W14U 1Y3XA 4JYVH 4X2WA 3ODDA 2G5NA 1Y5BT 1OWDA 2G81E 3MTYA 4DG4A 1NRPH 2V6NA 1QBVH 1TGSZ 5C5NA 1LVMA 4GAWA 3TPIZ 1WTGH 2H5DA 4UD9H 2P8OC 5T6GA 1P2JA 1Z8IB 4X6OA 3FP8E 1EB1H 1O3NA 2Z3DA 5TCAA 1SGQE 2VIQA 2KM0A 2BYAX 3BTTE 1MBQA 4P00A 4JK6A 3VB3A 5FX5A 1QBNA 1F0TA 2BDHA 4Y71A 3UB0A 5GNDA 3SNDA 1C5WB 5F8ZA 2A7HA 2ZHWH 4UFEH 1D6WA 2FYRA 3HATH 5HM9A 1P9SA 3TNTA 2GGVB 2XC0A 2OQUA 3EAJA 4JZFH 1RJXB 1AB9B 2QN5T 2FOBA 5HIZA 2AMDA 1GJ9B 2PTCE 2Z9IA 1WOFA 2BY9X 4AOQA 2QF0A 4ISNA 4KP0A 3A87A 4KELA 4H6SB 3RXTA 1ETRH 3I77A 3SUEA 1TABE 1C4V2 2H2ZA 2ZTYA 2XOKD 3HGNA 5GJ4B 1A46H 3FO8D 1PPZA 3T5FH 2FI4E 2ZNKH 5FCRA 4A1XA 5JB9S 4YOIA 2BOHB 3SGAE 2VVUA 4GSOA 2YMSB 1BITA 3MO3A 2VIWA 2XCFA 3WY8A 1YPLH 1S6HA 3DD2H 2O8MA 1JOUB 5G4BA 1WBGB 2ZC9H 1EZQA 1QGFA 3ENSB 1ELTA 4GHQA 1SQAA 3H5CB 2QY0B 3ZVBA 1Z6EA 1PQ7A 1U6QA 3M3SA 2SGQE 1SPJA 3ZVGA 1H8IH 1GI7B 2J92A 3RXQA 5KGOA 2VBCA 3UR6A 2IPHA 2FOHA 1AMHA 1IQEA 1ELEE 1ANBA 1OSSA 1TNKA 3UOUA 4AG2A 1AFQB 1PPHE 3RXOA 2FX6A 4YOGA 1RTFB 2CHAC 1EASA 1QJ6B 4ZHAA 1PYTD 3HKIB 4IMZA 1GJ5H 1NC6A 4U30A 5LPRA 3SGBE 2ZI2H 3UFAA 1O3OA 1MKXK 1YWUA 3UNSA 3F68H 1HAIH 3E6PH 2BD3A 2W7SA 2SNVA 1THPB 4UFFH 3URCA 1KXCA 1P2MA 1V2WT 1GVLA 1SQTA 2XXLA 1C2JA 5GCHG 3SNEA 1A3BH 1FZZA 2HWLB 1D3DB 1E36B 2OQ5A 1PQ5A 1P2QA 1P2OA 4CREA 1K0HA 2VIVA 1WDIA 2BDAA 2ZQ1A 3HGPA 1JIMA 3BV9B 5GPIB 3SV6A 1BBRK 1A1RA 2Y5GA 4ABAA 1BMAA 1QHRB 1UHBB 7LPRA 4ZCNA 4IS5A 4JZEH 5EJZA 3K9XB 4ZXYH 1G37A 1EB2A 3W1EA 3TGKE 2W3KA 4Y8XA 2ZEBA 5PTPA 1O33A 1UK2A 4ZROA 4A92A 2H9HA 5EQQA 1NRSH 1O5EH 2FX4A 4BOHA 3PM3A 2LPRA 1DWCH 1GHBG 1VJ9U 2GD4B 2GT7A 5EU8A 4ZKRU 5LGOA 1SGEE 1UVUH 1H8ED 2DUCA 2FESH 1DXWA 3L3TA 1GMCF 2ZHDA 3H7OA 3PRDA 2ZDMA 4ZKNU 2A5AA 1FY3A 1MQ6A 1O3IA 2OBQA 1LHEH 4XFQA 6LPRA 1SLWB 3QK1A 1L4DA 1YKTA 4ASHA 4AX9H 3TGJE 5EOKA 1ESTA 2PW8H 1C2EA 4ABEA 3MH6A 4OS1A 1AHTH 2GT8A 2F4LA 3M5LA 1ZJDA 2L74A 2D8WA 4I8GA 1HXFH 4CRAA 1HJAC 1K28D 5T1VA 1ZMNA 3ELAH 4OS2A 4Y0YE 4AFZA 1DANH 3VEQB 1GI8B 3GYMA 1OP8A 2BY7X 4D9RA 1P12E 1UTNA 2L6OA 4RKOB 3BIUH 4TY7A 1QNJA 2B0FA 1T32A 3O8RA 4MDSA 2OINA 1DY8A 4AFQA 3SW2B 1Y3WA 2BDYA 1V3XA 1DVAH 1K2I1 1NBMD 1GBTA 3SZEA 2A0QB 3RLYH 1BJUA 2AGGX 1MU6B 1ABIH 2ULLA 1C5OH 3LGYA 5DP3A 5BRRE 1RIWB 2HPPH 3PYHA 1RRKA 1O34A 3DFJA 3U1JB 2XYAA 1Q2WA 1O3CA 1TRNA 2WYGA 1G3CA 3ZVCA 4ABJA 1SLUB 2QV1A 1C5SA 1E34B 2RDLA 1ZR0A 2ALPA 2GP9B 3W94A 4SGAE 2P93A 2DE8A 1C2FA 1VZQH 5E2PA 2W5EA 1DFPA 3GY8A 5HMAA 1NRNH 1V2JT 3RXIA 3A86A 4DIIH 3RU4E 1O2XA 4YLQH 3GCHB 5E8EH 1AKSA 5F8TA 2QF4A 1MKWK 3QZQA 1O3KA 2ZDKA 4AGJA 1IAUA 3P6ZB 3QGJA 2ANWA 4WY3A 1BDAA 2QAAA 4NZQA 3P8OA 3S9CA 3ATIA 3S0NA 1ANEA 3OTPA 3LC5A 1G30B 1VJAU 1SGFG 3OTJE 3PWBA 4FUIA 1OS8A 1IHTH 1C5VA 4JK5A 3SN8A 1P57B 1SGPE 1WTHD 4JMYA 4WMEA 2IJD1 1ELBA 3HK6B 2A1DB 2Q1JA 1EXFA 3HPTB 3K6YA 5FCKA 4FUEA 1SGCA 1HJ9A 2C8WB 4MLFB 5FPYA 3SUGA 4LXBH 1EOJA 3W95A 3SV2H 4HG6A 1C5ZB 2FOCA 1O32A 2O8WA 2WV4A 2FMJA 3GDUA 3SOSA 1UCYK 4ZHLU 1IQMA 1L1GA 1TLDA 1S5SA 2BDCA 4I32A 1ABJH 1C2HA 2FLRH 1LQDB 2VJ1A 4XE4A 3UUZA 1BTZA 2FOFA 1O2ZA 3MU8A 2H9EH 2J38A 3V0XA 3FAOA 3LJOA 1BTWA 5A8YA 1KIGH 9ESTA 2PGQB 2VINA 4ASUD 3I29A 1W0YH 1WSSH 2W3IA 4GVUA 5J4SA 3MU1A 1TX6A 4I8LA 1BQYA 3AVZA 1C2GA 1V2ST 1F92A 1YLNA 4U32A 2Z9LA 3M3VA 1C5UA 2GCTB 1UTPA 1ZYOA 4DT7B 4OS7A 4B76A 2PKSC 2WPHS 3OY6U 1KXDA 1S81A 1A4WH 7GCHG 3LPRA 2ZCLP 1QA0A 2Y82A 3TIUA 3CS7A 2ZIQH 5A0CA 2BY8X 2WPIS 1AO5A 2PTNA 1UTLM 3N99A 1F0UA 1A7SA 4O97A 1C2LA 1C5NH 2VU8E 2BLQA 2PR3A 2F9OA 1AU8A 2I6QA 1C2DA 2AHME 5T6DA 2PUQH 4FU7A 2ZDAH 3F2FA 1O3LA 2XWBI 5EW2H 3TU7H 2AERH 3DFLA 5EG4A 2TPIZ 1W12U 1RTLA 1S83A 5T6FA 4Y7AA 3ITIA 2JH5D 5CE1A 1Q31A 1FUJA 1J16A 1S6LA 2ZFFH 1GI1A 3KN2A 1P04A 3D62A 2SFAA 1GGDB 3NRLA 5C0TA 4Y6DA 1DUEA 1AI8H 1S82A 2PUXB 2RFKC 1Y3VA 2BVRH 2ZHQH 1FXYA 3TH4H 5CDFE 1KLIH 1L0ZA 1V2OT 1NBME 1C1WH 2ZU3A 1ZMJA 2GDDA 3SJKA 3F2GA 4AFSA 1AUTC 2Z6BD 3BTKE 4WVPE 3RXAA 4WXIA 1PQAA 2EC9H 2Z7FE 1HAVA 3S7KB 3FZDA 1O2LA 1HNEE 3T25A 2F43B 3RXFA 1ZJKA 4FUGA 4NWLA 4K1SA 1QRWA 1TQ0B 1HAGE 2TIOA 1NFWA 3Q77A 1C9TA 1YCPH 3KGPA 1O3HA 1GI9B 4NA8A 1TFXA 1O3AA 1G9IE 1V2KT 1HIAB 5AF9H 3MNSA 3A8AA 2O8UA 3RXPA 2GZ7A 1HAVB 3BIVH 2R2WU 1SVPA 2RCEA 3P70B 1Y3UA 2V0BA 4I8JA 4K8YA 4B2BA 2WZQA 1AN1E 1CHOF 1T31A 1DX5M 1SB1H 4M7GA 4O03A 5CHAB 3TITA 1ZPCA 4Y8ZA 1HAYB 4IC5A 3M37A 1Z8RA 1NY22 2P3TB 2QCYA 1UO6A 3GY6A 1XVOA 2KR7A 3OU0A 1ETSH 1P0SH 1AFQC 1NRQH 1C1UH 3BTEE 4GCHG 2JETB 1O37A 1UTOA 4I86A 2HVXA 3ZVFA 2ANKH 1W3CA 3RMMH 5HKKD 2JH0D 1ELAA 5HM2A 4ZH8A 4K5ZA 1E1RD 4YTAA 1HCGA 3K6ZA 1K1JA 2G8TA 2ZHEH 2QF5A 1SLVB 3PRBA 1B0EA 1NRRH 1DITH 3BTME 3ZYEA 1G32B 4DT4A 1C1RA 2M2AA 3MHWU 3UR9A 4XD7D 3U69H 4AGKA 1A5IA 2IPQX 3P8FA 1ZZZA 2FO9A 2G51A 1SG8B 1NFYA 4SGBE 3R3GB 2ZP0H 3P92A 1GBMA 3SHAH 2YMSD 2VH0A 4BAHB 2BMGB 2VNTA 1N8OC 2ZFQH 1SHYA 5ETXA 3BTWE 2G4TA 1GJ4H 1AE5A 2V3HH 3U28C 1INCA 1GMDG 1ACBE 1MKXH 2ZA5A 1F7ZA 1QFKH 1H8DH 1TOCB 3OSYA 1ETTH 4B2CA 5H4IB 3KF2A 3F0PA 5K0HA 4UDWH 1GBBA 3UNRA 3E8LA 4WH8A 2JJ1D 1O5CB 1Y59T 1FI8A 1OXGA 4MTBA 4CBNA 1DWDH 1O2QA 3OX7U 3ZV9A 1GHBF 5EGMA 5IYTA 2FWWA 2BLVA 3GCTG 2WPLS 4B6EA 3EGKH 1FDPA 1V2RT 1BTHH 1ELVA 3N7EA 5F6MA 4ABFA 2Y7ZA 1RGQA 3F3BA 1O3FA 2WUBA 3ZIAD 3A80A 2A4QA 5GXPA 3P17H 2A31A 1HB0B 5BPEA 2J97A 3SJ9A 1BT7A 3OEHD 3ATMA 4OS6A 1HIAA 2ZGJA 1AZ8A 4ISLA 1K1LA 3ESTA 1IQLA 4FVDA 1D4PB 4R8TB 4DIHH 2P95A 4ZXXH 3U1IB 1DM4B 3TLOA 2HGTH 3KQBA 1S0RA 1W0ZU 4INHA 4P02A 5L6NH 1TRMA 2BXUH 5C17A 5AFYH 3ZZ4A 4BAQB 1GI4A 2W6ID 2HALA 4O3UA 1FMGA 1O2VA 1V2NT 2FLBH 2A4GA 2WV5A 3VB6A 1MQ5A 2FI3E 5AHGH 1PPBH 1GI6A 3P8GA 1KXEA 2BDBA 1V2QT 4RN6A 1UK4A 1KTTB 2GTBA 5IK2D 3E1XB 1EKBB 1YC0A 3T62A 2DE9A 1FY5A 2ZPRA 2V3OH 3GY3A 1LMWB 2GKVE 1CVWH 3VB7A 2BD9A 2ZPSA 8ESTE 4AYYB 2V7QD 2HNTE 2OK5A 3SNBA 2NU0E 2H9TH 1C4U2 4F49A 1CA0B 1DOJA 2FIRH 1ZRKA 1KSNA 3FFGA 8GCHF 2PSXA 1BRCE 3A7TA 3FKSD 3PV2A 2BLOA 3RXRA 1SQRA 4XBBA 1GBEA 1LHDH 1OWEA 3GCHC 4X8VH 3SJ8A 3PTBA 3EYDA 5C3NA 5DPAA 1ZLRA 4IMQA 2GV7A 3FP7E 2F9UA 4GLYA 4XBCA 4DCDA 5DP8A 1HAXB 1QB1A 1AB9C 1QL8A 1GI2A 1F5KU 2B7DH 1TPPA 2H1UA 3NZIA 2FTMA 2LP6A 1FPHH 1VCQA 1NU7B 1O2NA 1P2KA 1AUJA 4X1PU 3T28A 1MZAA 3KIDU 1S0QA 1YPMH 2AGIX 3RC4A 1GBCA 1QIXB 2HLCA 2ZU2A 2ALVA 1ANDA 5C1XA 1GBIA 2BY5X 1MKWH 2FOMB 3E0PB 2OC7A 2WPMS 3A7WA 4KTSA 1MAYA 3ZZ6A 1TNJA 4FVBA 1TA6A 4Z1MD 2BDGA 4TT3D 1V2PT 1AQ7A 1GMCG 3IWMA 1AFEH 2ZDLA 4JZDH 4D76A 2BQ6B 2M5TA 1YPGH 4MPUA 2BZ6H 1UW7A 5EXMA 1L1JA 6ESTA 3SUDA 2KX4A 2C8XB 1RTKA 3K2UA 4X2YA 1EQ9A 3LKWA 4FUHA 4INLA 2ILNA 1YPJH 4NSVA 3GISB 3NPSA 1ELDE 4IBLH 3MNBA 2VWNA 4NFEA 1SGIB 2UWLA 1ORFA 4DY7B 5DP9A 1TNGA 2YNBA 1TMBH 5FPTA 2J95A 1E0FD 3GS9A 4MNXA 4MPXA 1FV9A 1O2JA 2WYJA 2CGAA 2F83A 1IHSH 3RXGA 3NUMA 2K0QA 3Q3XA 4FU8A 1AY6H 3GCNA 1P9UA 2ODQA 3Q3KA 4X1SU 1GJCB 2W6JD 1YPHC 4IC6A 1ZHPA 3EDXB 1AKSB 3I78A 3B9FH 4AORA 1GBDA 2XNDD 1KMHB 4B6FA 2XBXA 2HNTF 1Z1JA 1QRXA 5A0BA 1TX8A 4AN7A 1NFXA 3ZZ9A 1GL1A 1C1SA 1XUGA 1A3EH 1D6RA 1FLEE 2EI7A 4K3JA 2W26A 1UVPA 2CK3D 1NS3A 1YPHE 3M7QA 1AVXA 1IQFA 3SU0A 3VGCB 2AIPA 3QX5H 2ODYB 3G01A 1ZGVA 4K1EA 1C5LH 1B5GH 1VCPA 5EW1H 5F8XA 3T29A 1OWIA 1CGIE 3SO3A 4ISOA 1ZSKA 5FPSA 3FP6E 1J14A 1BRAA 1BMLA 1L1NA 2J4IA 4ISHH 3V7TA 3LGTA 2PWXA 4KTCA 2ZHFH 3PMHB 3UNQA 1LO6A 4ISIH 4HTCH 1ZSLA 3DSOA 1OP2A 1E1QD 3LH1A 1MAXA 3HK3B 3RP2A 5ABWA 2BZAA 4J2YB 3PROA 1WYKA 1SGRE 1NROH 4NWKA 3ZV8A 1EPTC 1C1TA 4B74A 2K1QA 5HGGA 3F0OA 1O2SA 4Y0ZE 4MNVA 4IN1A 2KCOA 4X8TH 4D7FA 4FUDA 1SC8U 1F0RA 2GCHF 5A2MH 4WH6A 1B7XB 1Z6JH 2ZFRH 1CBWC 1J9CH 1A0LA 5DKMA 1ARBA 3S9BA 3EQ0H 3Q3YA 3EE7A 2G4UA 1O5DH 1SLXB 3EA7A 2J98A 3BEIB 2CV3A 4NFFA 4CHAC 3KHVA 4FETA 1XUIA 1BBRE 3A83A 2G00A 4F48B 3PLKA 3QZRA 1BBRH 3SGQE 2BD4A 1AZZA 3PLPA 1EATA 1BTYA 2HOBA 4Z6AH 1GJ8B 2FP7B 1HAZB 2GDEH 3H7TA 3SHCH 1DSTA 1C4Y2 1XUFA 3PV5A 3RUOA 1ARCA 5JBBS 4YT6H 3Q76A 1HDTH 2NWNA 3V13A 2BHGA 1GHZA 2BQWB 1LCYA 1LHFH 1OKXA 1MTSA 1O2UA 1ZSJA 3E16B 2P3FH 1GI5A 4A7IB 4R0IA 5DK1A 1Z8JB 1TWXB 1Z7KA 4JZ1A 2PV9B 3MU4A 3KEEA 2A45B 1C5PA 5DO4H 3LGVA 2PKAA 2GX4A 3OE7D 4YESB 3UWIA 2QYIA 4DVAU 5IDKA 2FI5E 4Y7BA 3SYJA 1FPCH 1UVOA 4K69A 4TPYA 4X1RU 2GVFA 3RMLH 2AH4X 1QBOA 3AAUA 1BTPA 2XBVA 5A8ZA 1O2OA 2HLDD 4UFDH 2ZZUH 1K1PA 1NESE 3A82A 3B8JA 4NGAH 4DW2U 1SBWA 1MTNC 4FUCA 2KCYA 1W10U 4ZKOU 1C2KA 1CT4E 3RXMA 3GOVB 2A7CA 5EJLA 3VG8A 1VGCB 2HPQH 4X0WU 2BD5A 3PMBB 4YO9A 2XC4A 3D49H 4YOJA 4I8KA 5EPYA 1O2TA 1EJMA 5HYOA 3FN8A 1W0JD 1CQQA 1SGDE 3S9AA 2ODPA 1C1OA 4U01A 1O39A 1UTKA 2Q6FA 1ZTKA 2ZPQA 2JETC 9LPRA 4OS5A 1O2YA 4FUFA 4H4FA 2VIDA 3SV8A 1O5FH 2FTLE 1G3DA 1HXEH 1LPGB 3D65E 2STAE 1BMFD 5JPMH 1HGTH 1OYTH 2ANMH 4XSKU 1PPFE 1G3BA 1K1NA 5EJ1A 1FY4A 3M3TA 1RXPA 3SU1A 4WMDA 5C0UA 5KECA 2FS8A 2O8TA 1O5AB 1W13U 3A8BA 1KLJH 3A81A 2FZZA 4MPVA 1FQ3A 1TMUH 3GCTF 1BRUP 3MFJA 1V2MT 2J98B 4X2VA 3ZZ5A 1UTMA 4X6MA 1AE8H 2BVXH 2ZGCA 1SL3A 2FODA 4WJG2 2ASUB 4ZHMU 4BNRA 1EUFA 4WWYA 4HZHA 2XW9A 2WPKS 2Y5HA 3OAAD 5ESTE 1UVTH 2UUFB 2BQ7B 1S85A 3RXKA 4AYVB 4X6PA 2Z3EA 1EJAA 3P95A 3BTDE 1OPHB 4LK4A 3LOXA 3MU5A 1XKAC 4ZUHA 2Z94A 3MNCA 8LPRA 1A0HB 2H5CA 1P05A 2OCVB 3M7TA 1DICA 4H6TA 3M35A 1YPKH 4NIWA 1HAOH 3NK8A 1FIWA 1HUTH 4F55A 1ESAA 2BX4A 1SI5H 1XMNB 3PB1E 2STBE 4JCNA 4ABBA 4DURA 1GJDB 2WV9A 2WPDD 4HGCA 2YOLA 3AASA 1QR3E 1C1VH 1LQEA 3R0FA 4TYDA 3E90B 5DGJA 4F4OC 4J1YA 3VXFH 2ZGBH 1O5BB 1O2PA 4IW4E 3UQOA 1K1OA 3GY5A 5FX6A 2ZU4A 5DP4A 2EA3A 1MCTA 1G2LA 8KME2 1ZPBA 4RSPA 4U2WA 1EAIA 1O3PB 1XX9A 2QC2A 3U8RH 3TJUA 4Y76A 4YM9A 3LGWA 4BANB 3A89A 5FBEA 5LH8A 3RXCA 4THNH 1QZ8A 1GDNA 1ZMLA 1TX7A 3SV7A 4CRDA 3SI4H 4WMFA 1JXPA 1O3BA 5C5OA 1LHCH 3CNRA 4M9FA 1C1PA 4XDEA 2PKSB 1O2GH 3QTVH 1TNLA 2A5IA 3A85A 5CHBA 2ZTXA 4X2XA 3GY2A 1KDQA 2BD8A 3BEFB 4K60A 1DSUA 1BB0B 1D9IA 7GCHF 2LNCA 2OC0A 1SKYE 2Y81A 1JIRA 5CMXH 4CRFA 4X1QU 1OOKB 1DLEA 5E2OA 1JRTA 1W11U 3ODFA 3VGCC 1FX0B 1PPGE 2NU2E 1O3EA 1PYTC 3FVFB 1YLDA 2RG3A 2VB0A 2Q6DA 2ZQ2A 1KY9A 1Z1IA 1GWAA 4PROA 4CR9A 4FUBA 1QB9A 3A8DA 1K9OE 5EQSA 1XUKA 3K65B 1O38A 1ELGA 2AIQA 2H6MA 2KAIB 1LDTT 1P3CA 3RXUA 6GCHG 1THRH 2J5UA 2NU4E 1C1NA 4Q4LA 1PFXC 2UUKB 3T27A 2SGEE 3F1SB 4Y8YA 5DG6A 1SR5C 4Y11E 2WHXA 3VB5A 1H8HD 1YCPK 4AC9A 1GGDC 1TPAE 1C1QA 4BXSA 5I25A 4B71A 1JMOH 1GG6C 1EAXA 3H09A 4MQAA 1CGJE 1MTUA 1TBQH 3U8OH 2JJ2D 4HFPB 4K8BA 3EA9A 1L2EA 1DE7H 1HV7A 3LH3A 2BLWA 1O5GH 5EODA 1YM0A 2XWAA 1ZOMA 3KYGA 4ACBA 3TNSA 1ZTLA 3GICB 1O2RA 1FN8A 2ZECA 3SQHE 1UHBA 4WXVA 5GWZA 1MD8A 1UVSH 1BTUA 2KAIA 2FOGA 3NXPA 2ZFPH 3KYFA 3VPKA 2TGTA 1LHGH 4DOQA 3ZZ7A 1TALA 3ZZDA 2ZGHA 4XBDA 1NTPA 1GJBB 5SGAE 4E05H 1V6DA 1KDQB 3BTQE 1F5LA 4CRBA 3M36A 2P3UB 2HRVA 1BRBE 2ZFSA 2O8LA 1TRYA 1NZQH 1MABB 1XM1A 2B9LA 5CHAC 2F91A 1AWHB 3E0NB 1Q3XA 4Q63A 2Y80A 2V3MA 5C67A 2ESTE 4RI0A 4BTTB 4NA7A 1MZDA 2BD2A 5EXLA 4NIVA 5JBCS 1QRZA 1NO9H 1AGJA 3NKKA 1GBAA 4UFGH 1H4WA 4ZMAH 4FU9A 3L33A 1EZSC 2CF8H 1TB6H 3BF6H 5JDUB 3SUFA 1KTSB 2BD7A 2Y6TA 1CE5A 2G5VA 6CHAB 3SU4A 1SOTA 2AMQA 1K1MA 3CENA 2FPZA 3RXEA 1TPOA 1VR1H 1WQSA 1BHXF 2OXSA 5EQRA 1ZRBA 3BSQA 3SU2A 4ACAA 3BTFE 4MPWA 4TSFD 1W2KH 2OD3B 3AAVA 2EY4C 1SGFA 2B8OH 3A7VA 4O9VA 4VGCC 4GHTA 5I46H 3ZVDA 2PLXA 1BMMH 1HJ8A 5TJXA 2FS9A 2TGPZ 1HFDA 1CSOE 1G2MA 4Q2KA 3RU4T 2ZU5A 5FL7D 1TNIA 2J94A 3SNAA 4TWYA 1CBWB 2VGCC 3DSPA 5JYIA 4K1TA 4JYUH 3SV9A 4X8SH 1WAYB 1NM6A 6CHAC 1N6XA 3AW1A 3LONA 4NIYA 1MBMA 1A61H 1QJ7B 3PMJA 2OP9A 2WUCA 1FAXA 1Y5UT 2R3UA 3FANA 1GI3A 2RDEA 3A84A 1LVYA 1F0SA 3GCOA 1GDQA 5K7RA 2R0KA 3DT0H 3F2HA 2TBSA 1T8OA 2ZTZA 1QL7A 3MO6A 1GL0E 4GPGA 4UE7H 3AK5A 1HRTH 3A7ZA 3IG6B 2SGPE 5AVDA 1CGHA 3LIWA 2XTTB 1H9IE 1L4ZA 1GPZA 1T4UH 2F9PA 1V2UT 1DUAA 1WCZA 1EJNA 4A1VA 2PFEA 3ZZAA 2THFB 2P8OB 2PSYA 1ZHRA 2F9BH 3RXLA 3A7XA 2VVCA 1DWBH 2A32A 2CJIA 1IQHA 3UIRA 5L2ZH 4NZLA 1K21H 2J9NA 3Q00A 2OUAA 1SFQB 1BUIA 2B5TB 4BAOB 3LGIA 1TGTA 2QXHA 1YYY1 3KL6A 2C4FH 4MVNA 3ZZ8A 1QA7A 2BOKA 3RXHA 5L30H 2ZDVH 3MO9A 1GCDA 1EP6A 1PPEE 2GCTC 1QCPA 1C5XB 1GVZA 3E3TA 3UREA 1GG6B 4CRGA 3MI4A 3WWBA 1V2VT 2XBYA 2AYWA 3UQVA 2GZ8A 1S6FA 2QE7D 1QQUA 3KQCA 3MNXA 1GHYH 1FNIA 3PO1C 2AS9A 2IJOB 2IN2A 2A4OA 4JZIA 3JZ2B 1NT1A 4GUXA 4ESTE 2FOEA 3V3MA 3QLPH 5FAHA 3RC5A 1LPZB 3TVJB 1TGCA 4YT7H 1G36A 1GHAG 5J4QA 1O3MA 1C2MA 2ZF0H 3KCGH 1IQNA 1RD3B 3LJJA 4AB8A 5DN6D 1MMJN 2CN0H 3L6PA 1SOZA 5B6OA 1EPTA 1LPKB 2FM2A 3AW0A 1QURH 1WXRA 1TYNA 1C5RA 4BAMB 2FYQA 4JYTA 1NU9A 2A7JA 1GHVH 1WU1A 1XUJA 1MH0A 1TAWA 4Q7ZA 4BTIB 1OWKA 2KFWA 1Y8TA 1IQIA 1P02A 1TONA 3PMAB 3EA8A 5EXNA 1BIOA 2ZFTA 1FY8E 2TGAA 4MG3A 2GMTC 2CXVA 1CT2E 3MH5A 1QY6A 4D8NA 1FIZA 3SNCA 3A7YA 1W8BH 1XXFA 3PTNA 1GBKA 1EPTB 2BXTH 3HKJB 3U98H 2JDID 1GJAB 4GCHF 3O8CA 1WQVH 3SBKA 3URDA 2JKHA 4B73A 4ABGA 5AFZH 5GDSH 3KQ5A 3MMGA 3STJA 5DP7A 1XVMA 1V2LT 1T8LA 4IGDA 3U8TH 1XUHA 3V12A 2K8IA 2D2DA 2VH6A 3F9FA 5DP5A 3FZZA 2XRCA 1YPEH 1ESBA 5LPEA 1O3DA 4B75A 1KLTA 1OX1A 3LDXH 4NA9H 1DT2A 2YNAA 3LGUA 1CHOG 3LC3A 1DS2E 3IITA 3STIA 1Y5AT 2OTVA 2BDIA 4I7YH 1A2CH 1SGNE 1GJ6A 1ID5H 3M7UA 1MTVA 4BTUB 2OC8A 4E06H 5EPNA 4UEHH 2HNTC 3TJOA 1BA8B 2W7UA 1GI0A 1LTOA 2BVSH 5T3HA 2SGDE 3UY9A 1DY9A 2OLGA 4CH2B 1P3EA 3WWFA 2VIOA 3TJNA 2UWPA 1DDJA 7KMEH 4TWWA 2QA9E 4A5TS 3N7DA 1T8MA 4XOJA 4CRCA 1O3JA 1C5TA 4WF8A 4NCYA 4NSYA 5FHTA 5L2YH 3BEUA 2EQNA 1YCPM 2RA3A 4NG9H 3N7OA 1D3QB 1C5YB 1C5MD 3RXDA 2WINI 2ZCHP 1UTQA 1T8NA 4AG1A 1P11E 5A8XA 1RIWC 4MNYA 1EAUA 1W7XH 1P8VC 2TRMA 3GY4A 1HAHH 1XXDA 1M9UA 4QT8C 3RLWH 1ZGIA 1YBWA 3LT3A 1O2IA 2YMSC 1O36A 4ZKSU 2CMYA 1AD8H 1QQ4A 2Z9KA 3WW7A 2CF9H 1H1BA 1LVBA 2EI8A 2D26C 1BHXB 1OHHD 2F9VA 3RU4D 1D3PB 4KKDA 1KXAA 2ZDNA 3MOCA 3OFND 1O0DH 1BTXA 1VITG 4X8UH 4MNWA 1AIXH 3BG4B 2ZGXH 1B0FA 4ABIA 4HI3A 1AVGH 1VCWA 3TH2H 1J15A 2P94A 1UCYH 2KZ4A 2A5KA 2ZO3H 1P09A 4K2YA 2D1JA 1UK3A 1GHXH 1AWFH 4OM9A 1EX3A 2NU3E 4ABHA 2KCPA 1VITF 3UOPA 3SU3A 2QXIA 2BX3A 3MQKC 2AFQB 2WSSD 1HAPH 4E7NA 2Y5FA 5C94A 1TIOA 8GCHG 1H9HE 3TH3H 1GCTB 1P2IA 3MH4A 5C1YA 4FUJA 3PO1B 5F53A 2A2QH 3ZZCA 2GJGA 5HXFA 4KTUA 3A88A 7ESTE 1N6YA 4BXWA 3ATLA 1GBLA 1NN6A 1PJPA 2O9QA 3RMOH 4ABDA 4VGCB 3TGIE 4FXGH 4RT1A 1P01A 2GCHG 3ZYDA 2Z9JA 4Y79A 3OY5U 1LVOA 2QXGA 2FOAA 1YLCA 1W0KD 1YP9A 1KXFA 2KCAA 4OGXA 2C90B 5F03A 2PHBA 3DCLA 4IN2A 4XRNA 1TQ7B 5DSFA 2VVVA 2P16A 1VGCC 2R9PA 3P8NA 3A8CA 3BTGE 1QTFA 1TE0A 1DXPA 3PV4A 4YLUA 1EFRD 4DJZB 1XKBC 2VGCB 3TK9A 2GMTB 4Y10E 2J34A 1F5RA 1HYLA 2JH6D 2R2MB 4INKA 1EAWA 3ATKA 1O2WA 2AMPA 1F2SE 1GJ7B 4B1TA 1TBZH 3CP7A 5C20A 2SGAA 4TY6A 4Z0KA 1JBUH 3GDVA 5B6LA 1SFIA 1P10A 1TA2A 1AVWA 1X7AC 2ZKSA 1J17T 2R0LA 2UUJB 1GMHF 5ESBA 3M5OA 4AB9A 1C9PA 1VKYA 3QGNB 4LZ4B 1ELFA 3QO6A 2UUYA 5DP6A 2I6SA 3O8DA 2G52A 1O2HA 2QGRA 1GDUA 1ZHMA 2QF3A 3BTHE 3TJVA 1GHWH 4FOUC 4LOYH 5HIYA 1IQGA 5JBTA 4LZ1H 3PLBA 1P06A 3CS0A 4E7RG 2C3SA 2PP6A 2J2UA 3QUMP 3TK5A 2WPJS 1G3EA 2FEQH 4OS4A 1COWD 1TNHA 1TMTH 2QXJA 1MTWA 2GZ9A 3M5NA 5LPFA 3S7HB 1ANCA 1K22H 1MCVA 4D7GA 1BMNH 4AFUA 2R3YA 1T4VH 4Q7YA 3KQEA 6GCHF 1V2TT 3QTOH 5E0HA 1SGTA 3SZNA 2VWOA 1EOLA 1MTNB 5FXLA 1J8AA 3ZVEA 2A4RA 1O2KA 3ZVAA 1HLTH 2EEKA 2G55A 3SJOA 1FJSA 1C5QA 1K1IA 5C1UA 1JRSA 2C93B 1FN6A 2C8ZB 1MUEB 2NU1E 1THSH 3BN9A 2SGFE 1UJ1A 2XCNA 4CR5A 1KXBA 2HVYB 1A5HA 2Y7XA 1IQJA 3T26A 1TPSA 3KQDA 2ZU1A 1GHAF 1FY1A 1CU1A 2XC5A 3OYPA 1ZPZA 3D23A 4Q7XA 2V35A 1OWJA 2BB4A 3RXBA 3OEED 1D3TB 2IOTA 3RM2H 1NFUA 1T7CA 4H42U 4YZUA 3JZ1B 5JB8S 4X1NU 1O3GA 1N1LA 2LELA 3RXJA 2XNIA 3QDZB 1P03A 4X6NA 1EP5A 4NIXA 1RS0A 2AGEX 1GBFA 3M61U 1PPCE 1RFNA 3S69A 3ZZ3A 3C27B 1GCTC 1HPGA 3BG4C 2Z9GA 2VWMA 3SORA 1TOMH 1CO7E 1FAKH 4Q80A 1LKAA 2F9NA 1WV7H 4O3TA 1E38B 4UONA 1ELCA 3LU9B 1HJAB 1JWTA 2QIQA 1QL9A 1SGYE 1BCUH 1NPMA 4RKJB 1E35B 2A2XH 3MH7A 1OYQA 2BM2A 1E79D 3RDZA 1GBJA 3VB4A 3GDSA 4A6LA 1ZTJA 1IOEA 1Z71A 3UTUH 3GYLB 1Y3YA 5EIYA 2RA0A 2GV6A 2Z3CA 1LKBA 3VXEH 1GVKB 3T2NA 2FXRA 1TGBA 3C1KA 3DA9B 1EZXC 3SU5A 3MU0A 1CA0C 3E91A 1E37B 1CHGA 4B2AA 1UMAH 4BAKB 1QJ1B 3VFEA 1IQKA 2EI6A 3ZZBA 1KYNA 2ZG0H 2ZWLH 3DHKH 2VIPA 4ZAEA 3RXVA 1FONA 2XBWA 3MYWA 1EZUC 1BZXE 1WUNH 1A0JA 1SHHB 5KEDA 1YGCH 5TCCA 1O35A 4CH8B 3UWJH 3GY7A 4TPIZ 3NWUA 1DLKB 1SQOA 3ATWA 2PGBB 3TK6A 1UCYE 4CBOA 2BY6X 4YXWD 1C2IA 3UAIC 1DPOA
chains in the Genus database with same CATH topology
1O30A 5E0JA 2TGDA 5JBAS 3RMNH 2OBOA 5E0GA 4I8HA 1CT0E 3QWCH 4I33A 3RXSA 5GCHF 2OC1A 1CA8B 1S84A 1N8OB 4KGAA 1OP0A 2UWOA 1YF4A 1UTJA 4OGYA 3F6UH 5A0AE 1PQ8A 3RM0H 3SU6A 1O31A 1TBRH 3NCLA 3EE0B 1MD7A 1VITH 3SJIA 2AEIH 2ZCKP 2VWLA 1TGNA 2CHAB 2Q6GA 5GIBA 3SI3H 3F9GA 1Z8GA 3RC6A 3F9HA 3O8BA 4I31A 1P2NA 1SSXA 3MWIU 3UPEA 1QB6A 1HBTH 3U9AH 1O2MA 3B23B 3BG8A 5DJ7A 1OWHA 4CHAB 5A09A 1C1MA 4A1TA 3QN7A 2C8YB 5C2ZA 1GBHA 1MU8B 1SMFE 2ANYA 1DWEH 2F3CE 3M5MA 1BOQA 1GMHG 3KNXA 1A5GH 3F9EA 5FBIA 1GMDF 1W7GH 4AZ2B 4D9QA 2BTCE 4DGJA 3PWCA 2PKAB 2FDAA 2P59A 3SQEE 1BJVA 1H9LB 2SNWA 3DUXH 1W14U 1Y3XA 4JYVH 4X2WA 3ODDA 2G5NA 1Y5BT 1OWDA 2G81E 3MTYA 4DG4A 1NRPH 2V6NA 1QBVH 1TGSZ 5C5NA 1LVMA 4GAWA 3TPIZ 1WTGH 2H5DA 4UD9H 2P8OC 5T6GA 1P2JA 1Z8IB 4X6OA 3FP8E 1EB1H 1O3NA 2Z3DA 5TCAA 1SGQE 2VIQA 2BYAX 3BTTE 1MBQA 4JK6A 3VB3A 5FX5A 1QBNA 1F0TA 2BDHA 4Y71A 3SNDA 1C5WB 5F8ZA 2A7HA 2ZHWH 4UFEH 1D6WA 2FYRA 3HATH 5HM9A 1P9SA 3TNTA 2GGVB 2XC0A 2OQUA 3EAJA 4JZFH 1RJXB 1AB9B 2QN5T 2FOBA 2AMDA 1GJ9B 2PTCE 2Z9IA 1WOFA 2BY9X 4AOQA 2QF0A 4ISNA 4KP0A 3A87A 4KELA 4H6SB 3RXTA 1ETRH 3I77A 3SUEA 1TABE 1C4V2 2H2ZA 2ZTYA 3HGNA 5GJ4B 1A46H 1PPZA 3T5FH 2FI4E 2ZNKH 5FCRA 4A1XA 5JB9S 4YOIA 2BOHB 3SGAE 2VVUA 4GSOA 1BITA 3MO3A 2VIWA 2XCFA 3WY8A 1YPLH 1S6HA 3DD2H 2O8MA 1JOUB 5G4BA 1WBGB 2ZC9H 1EZQA 1QGFA 3ENSB 1ELTA 4GHQA 1SQAA 3H5CB 2QY0B 3ZVBA 1Z6EA 1PQ7A 1U6QA 3M3SA 2SGQE 1SPJA 3ZVGA 1H8IH 1GI7B 2J92A 3RXQA 3UR6A 2IPHA 2FOHA 1AMHA 1IQEA 1ELEE 1ANBA 1OSSA 1TNKA 3UOUA 4AG2A 1AFQB 1PPHE 3RXOA 2FX6A 4YOGA 1RTFB 2CHAC 1EASA 1QJ6B 4ZHAA 1PYTD 3HKIB 4IMZA 1GJ5H 1NC6A 4U30A 5LPRA 3SGBE 2ZI2H 3UFAA 1O3OA 1MKXK 3UNSA 3F68H 1HAIH 3E6PH 2BD3A 2W7SA 2SNVA 1THPB 4UFFH 3URCA 1KXCA 1P2MA 1V2WT 1GVLA 1SQTA 2XXLA 1C2JA 5GCHG 3SNEA 1A3BH 1FZZA 2HWLB 1D3DB 1E36B 2OQ5A 1PQ5A 1P2QA 1P2OA 4CREA 2VIVA 2BDAA 2ZQ1A 3HGPA 1JIMA 3BV9B 5GPIB 3SV6A 1BBRK 1A1RA 2Y5GA 4ABAA 1BMAA 1QHRB 1UHBB 7LPRA 4IS5A 4JZEH 3K9XB 4ZXYH 1G37A 1EB2A 3TGKE 2W3KA 4Y8XA 2ZEBA 5PTPA 1O33A 1UK2A 4ZROA 4A92A 2H9HA 5EQQA 1NRSH 1O5EH 2FX4A 4BOHA 3PM3A 2LPRA 1DWCH 1GHBG 1VJ9U 2GD4B 2GT7A 5EU8A 4ZKRU 5LGOA 1SGEE 1UVUH 2DUCA 2FESH 1DXWA 3L3TA 1GMCF 2ZHDA 3H7OA 2ZDMA 4ZKNU 2A5AA 1FY3A 1MQ6A 1O3IA 2OBQA 1LHEH 4XFQA 6LPRA 1SLWB 3QK1A 1L4DA 1YKTA 4ASHA 4AX9H 3TGJE 5EOKA 1ESTA 2PW8H 1C2EA 4ABEA 3MH6A 4OS1A 1AHTH 2GT8A 3M5LA 1ZJDA 2D8WA 4I8GA 1HXFH 4CRAA 1HJAC 1K28D 1ZMNA 3ELAH 4OS2A 4Y0YE 4AFZA 1DANH 3VEQB 1GI8B 3GYMA 1OP8A 2BY7X 4D9RA 1P12E 1UTNA 4RKOB 3BIUH 4TY7A 1QNJA 2B0FA 1T32A 3O8RA 4MDSA 1DY8A 2OINA 4AFQA 3SW2B 1Y3WA 2BDYA 1V3XA 1DVAH 1K2I1 1GBTA 2A0QB 3RLYH 1BJUA 2AGGX 1MU6B 1ABIH 2ULLA 1C5OH 3LGYA 5DP3A 5BRRE 1RIWB 2HPPH 3PYHA 1RRKA 1O34A 3DFJA 3U1JB 2XYAA 1Q2WA 1O3CA 1TRNA 2WYGA 1G3CA 3ZVCA 4ABJA 1SLUB 2QV1A 1C5SA 1E34B 2RDLA 1ZR0A 2ALPA 2GP9B 3W94A 4SGAE 2P93A 2DE8A 1C2FA 1VZQH 5E2PA 2W5EA 1DFPA 3GY8A 5HMAA 1NRNH 1V2JT 3RXIA 3A86A 4DIIH 3RU4E 1O2XA 4YLQH 3GCHB 5E8EH 1AKSA 5F8TA 1MKWK 3QZQA 1O3KA 2ZDKA 4AGJA 1IAUA 3P6ZB 3QGJA 2ANWA 4WY3A 1BDAA 2QAAA 4NZQA 3P8OA 3S9CA 3ATIA 3S0NA 1ANEA 3LC5A 1G30B 1VJAU 1SGFG 3OTJE 3PWBA 4FUIA 1OS8A 1IHTH 1C5VA 4JK5A 3SN8A 1P57B 1SGPE 1WTHD 4JMYA 4WMEA 1ELBA 3HK6B 2A1DB 2Q1JA 1EXFA 3HPTB 3K6YA 5FCKA 4FUEA 1SGCA 1HJ9A 2C8WB 4MLFB 5FPYA 3SUGA 4LXBH 1EOJA 3W95A 3SV2H 1C5ZB 2FOCA 1O32A 2O8WA 2WV4A 2FMJA 3GDUA 3SOSA 1UCYK 4ZHLU 1IQMA 1L1GA 1TLDA 1S5SA 2BDCA 4I32A 1ABJH 1C2HA 2FLRH 1LQDB 2VJ1A 4XE4A 3UUZA 1BTZA 2FOFA 1O2ZA 3MU8A 2H9EH 2J38A 3V0XA 3FAOA 3LJOA 1BTWA 5A8YA 1KIGH 9ESTA 2PGQB 2VINA 3I29A 1W0YH 1WSSH 2W3IA 4GVUA 5J4SA 3MU1A 1TX6A 4I8LA 1BQYA 3AVZA 1C2GA 1V2ST 1F92A 4U32A 2Z9LA 3M3VA 1C5UA 2GCTB 1UTPA 1ZYOA 4DT7B 4OS7A 4B76A 2PKSC 2WPHS 3OY6U 1KXDA 1S81A 1A4WH 7GCHG 3LPRA 2ZCLP 1QA0A 2Y82A 3TIUA 3CS7A 2ZIQH 5A0CA 2BY8X 2WPIS 1AO5A 2PTNA 1UTLM 1F0UA 1A7SA 4O97A 1C2LA 1C5NH 2VU8E 2BLQA 2PR3A 2F9OA 1AU8A 2I6QA 1C2DA 5T6DA 2PUQH 4FU7A 2ZDAH 2XWBI 1O3LA 5EW2H 3TU7H 2AERH 3DFLA 5EG4A 2TPIZ 1W12U 1RTLA 1S83A 5T6FA 4Y7AA 3ITIA 2JH5D 5CE1A 1Q31A 1FUJA 1J16A 2ZFFH 1GI1A 3KN2A 1P04A 3D62A 2SFAA 1GGDB 4Y6DA 1DUEA 1AI8H 1S82A 2PUXB 1Y3VA 2BVRH 2ZHQH 1FXYA 3TH4H 1KLIH 1L0ZA 1V2OT 1C1WH 2ZU3A 1ZMJA 2GDDA 3SJKA 4AFSA 1AUTC 2Z6BD 3BTKE 4WVPE 3RXAA 4WXIA 1PQAA 2EC9H 2Z7FE 1HAVA 3S7KB 3FZDA 1O2LA 1HNEE 3T25A 1ZJKA 4FUGA 4NWLA 4K1SA 1QRWA 1TQ0B 1HAGE 2TIOA 1NFWA 3Q77A 1C9TA 1YCPH 3KGPA 1O3HA 1GI9B 4NA8A 1TFXA 1O3AA 1G9IE 1V2KT 1HIAB 5AF9H 3MNSA 3A8AA 2O8UA 3RXPA 2GZ7A 1HAVB 3BIVH 2R2WU 1SVPA 2RCEA 3P70B 1Y3UA 2V0BA 4I8JA 4K8YA 4B2BA 1AN1E 1CHOF 1T31A 1DX5M 1SB1H 4M7GA 4O03A 5CHAB 3TITA 1ZPCA 4Y8ZA 1HAYB 4IC5A 3M37A 1Z8RA 1NY22 2P3TB 2QCYA 1UO6A 3GY6A 1XVOA 3OU0A 1ETSH 1P0SH 1AFQC 1NRQH 1C1UH 3BTEE 4GCHG 2JETB 1O37A 1UTOA 2HVXA 3ZVFA 2ANKH 1W3CA 3RMMH 2JH0D 1ELAA 5HM2A 4ZH8A 4K5ZA 4YTAA 1HCGA 3K6ZA 1K1JA 2G8TA 2ZHEH 1SLVB 1B0EA 1NRRH 1DITH 3BTME 3ZYEA 1G32B 1C1RA 3MHWU 3UR9A 3U69H 4AGKA 1A5IA 3P8FA 1ZZZA 2FO9A 2G51A 1SG8B 1NFYA 4SGBE 3R3GB 2ZP0H 3P92A 1GBMA 3SHAH 2VH0A 4BAHB 2BMGB 2VNTA 1N8OC 2ZFQH 1SHYA 5ETXA 3BTWE 2G4TA 1GJ4H 1AE5A 2V3HH 1INCA 1GMDG 1ACBE 1MKXH 2ZA5A 1F7ZA 1QFKH 1H8DH 1TOCB 3OSYA 1ETTH 4B2CA 5H4IB 3KF2A 5K0HA 4UDWH 1GBBA 3UNRA 3E8LA 4WH8A 1O5CB 1Y59T 1FI8A 1OXGA 4MTBA 4CBNA 1DWDH 1O2QA 3OX7U 3ZV9A 1GHBF 5EGMA 5IYTA 2FWWA 2BLVA 3GCTG 2WPLS 3EGKH 1FDPA 1V2RT 1BTHH 1ELVA 5F6MA 4ABFA 2Y7ZA 1RGQA 1O3FA 2WUBA 3A80A 2A4QA 5GXPA 3P17H 2A31A 1HB0B 5BPEA 3SJ9A 1BT7A 3ATMA 4OS6A 1HIAA 2ZGJA 1AZ8A 4ISLA 1K1LA 3ESTA 1IQLA 4FVDA 1D4PB 4R8TB 4DIHH 2P95A 4ZXXH 3U1IB 1DM4B 3TLOA 2HGTH 3KQBA 1S0RA 1W0ZU 4INHA 5L6NH 1TRMA 2BXUH 5AFYH 3ZZ4A 4BAQB 1GI4A 2HALA 4O3UA 1FMGA 1O2VA 1V2NT 2FLBH 2A4GA 2WV5A 3VB6A 1MQ5A 2FI3E 5AHGH 1PPBH 1GI6A 3P8GA 1KXEA 2BDBA 1V2QT 4RN6A 1UK4A 1KTTB 2GTBA 3E1XB 1EKBB 1YC0A 3T62A 2DE9A 1FY5A 2ZPRA 2V3OH 3GY3A 1LMWB 2GKVE 1CVWH 3VB7A 2BD9A 2ZPSA 8ESTE 4AYYB 2HNTE 3SNBA 2NU0E 2H9TH 1C4U2 4F49A 1CA0B 1DOJA 2FIRH 1ZRKA 1KSNA 3FFGA 8GCHF 2PSXA 1BRCE 3A7TA 2BLOA 3RXRA 4XBBA 1GBEA 1LHDH 1OWEA 3GCHC 4X8VH 3SJ8A 3PTBA 3EYDA 5C3NA 5DPAA 1ZLRA 4IMQA 2GV7A 3FP7E 2F9UA 4GLYA 4XBCA 4DCDA 5DP8A 1HAXB 1QB1A 1AB9C 1QL8A 1GI2A 1F5KU 2B7DH 1TPPA 2H1UA 3NZIA 2FTMA 1FPHH 1VCQA 1NU7B 1O2NA 1P2KA 1AUJA 4X1PU 3T28A 1MZAA 3KIDU 1S0QA 1YPMH 2AGIX 3RC4A 1GBCA 1QIXB 2HLCA 2ZU2A 2ALVA 1ANDA 5C1XA 1GBIA 2BY5X 1MKWH 2FOMB 3E0PB 2OC7A 2WPMS 3A7WA 4KTSA 1MAYA 3ZZ6A 1TNJA 4FVBA 1TA6A 2BDGA 1V2PT 1AQ7A 1GMCG 3IWMA 1AFEH 2ZDLA 4JZDH 4D76A 2BQ6B 2M5TA 1YPGH 4MPUA 2BZ6H 5EXMA 1L1JA 6ESTA 3SUDA 2C8XB 1RTKA 3K2UA 4X2YA 1EQ9A 3LKWA 4FUHA 4INLA 2ILNA 1YPJH 4NSVA 3GISB 3NPSA 1ELDE 4IBLH 3MNBA 2VWNA 4NFEA 1SGIB 2UWLA 1ORFA 4DY7B 5DP9A 1TNGA 2YNBA 1TMBH 5FPTA 2J95A 1E0FD 4MNXA 4MPXA 3RXFA 1FV9A 1O2JA 2WYJA 2CGAA 2F83A 1IHSH 3RXGA 3NUMA 3Q3XA 4FU8A 1AY6H 3GCNA 1P9UA 2ODQA 3Q3KA 4X1SU 1GJCB 1YPHC 4IC6A 1ZHPA 3EDXB 1AKSB 3I78A 3B9FH 4AORA 1GBDA 2XBXA 2HNTF 1Z1JA 1QRXA 5A0BA 1TX8A 4AN7A 1NFXA 3ZZ9A 1GL1A 1C1SA 1XUGA 1A3EH 1D6RA 1FLEE 2EI7A 4K3JA 2W26A 1UVPA 1NS3A 1YPHE 3M7QA 1AVXA 1IQFA 3SU0A 3VGCB 2AIPA 3QX5H 2ODYB 3G01A 1ZGVA 4K1EA 1C5LH 1B5GH 1VCPA 5EW1H 5F8XA 3T29A 1OWIA 1CGIE 3SO3A 4ISOA 1ZSKA 5FPSA 3FP6E 1J14A 1BRAA 1BMLA 1L1NA 2J4IA 4ISHH 3V7TA 3LGTA 2PWXA 4KTCA 2ZHFH 3PMHB 3UNQA 1LO6A 4ISIH 4HTCH 1ZSLA 1OP2A 3LH1A 1MAXA 3HK3B 3RP2A 5ABWA 2BZAA 4J2YB 3PROA 1WYKA 1SGRE 1NROH 4NWKA 3ZV8A 1EPTC 1C1TA 4B74A 2K1QA 5HGGA 1O2SA 4Y0ZE 4MNVA 4IN1A 4X8TH 4D7FA 4FUDA 1SC8U 1F0RA 2GCHF 5A2MH 4WH6A 1B7XB 1Z6JH 2ZFRH 1CBWC 1J9CH 1A0LA 5DKMA 1ARBA 3S9BA 3EQ0H 3Q3YA 2G4UA 1O5DH 1SLXB 3EA7A 3BEIB 2CV3A 4NFFA 4CHAC 3KHVA 1XUIA 1BBRE 3A83A 2G00A 3PLKA 3QZRA 1BBRH 3SGQE 2BD4A 1AZZA 3PLPA 1EATA 1BTYA 2HOBA 4Z6AH 1GJ8B 2FP7B 1HAZB 2GDEH 3H7TA 3SHCH 1DSTA 1C4Y2 1XUFA 3RUOA 1ARCA 5JBBS 4YT6H 3Q76A 1HDTH 2NWNA 3V13A 2BHGA 1GHZA 2BQWB 1LCYA 1LHFH 1OKXA 1MTSA 1O2UA 1ZSJA 3E16B