3BTDE

The crystal structures of the complexes between the bovine beta-trypsin and ten p1 variants of bpti.
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
222
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structures of the complexes between bovine beta-trypsin and ten P1 variants of BPTI.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PROTEIN (TRYPSIN)
total genus 52
structure length 222
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3btdE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3btdE02
1UVPA 1P04A 2BTCE 2VU8E 4B2CA 1YBWA 1WTHD 2BB4A 3BTQE 1W0YH 1C5VA 1C9TA 1NY22 5C20A 2VWOA 4DW2U 2FDAA 3TPIZ 1E35B 1XX9A 1O5BB 3ZYDA 1OWDA 4AG1A 4ABBA 1GJDB 3RLWH 3BEIB 2C8XB 2ZFTA 1VJAU 2C93B 2ZTZA 2AS9A 1DICA 2QXJA 2VIQA 1C4U2 3KF2A 5FCRA 1PPFE 3U69H 1GBIA 3HGPA 1FV9A 2ZDMA 2BQWB 3Q3YA 1AO5A 4X1SU 1LHCH 4CRCA 3TH4H 1P06A 4GCHF 1SGQE 3A7VA 1GBDA 1XUGA 1BRCE 4TYDA 4O3UA 5GPIB 3MOCA 1SLUB 4YESB 2GCTB 2TPIZ 1AVXA 5EPYA 5C5OA 1B7XB 1ELDE 1SPJA 4DJZB 1NESE 2ESTE 2P95A 4MTBA 3RM0H 1MTNB 4CRBA 4CHAB 4YT6H 1CGHA 1SGPE 1TNGA 4ISOA 5F03A 1W7GH 2WUBA 3GCNA 1IQFA 1TGTA 1ZMJA 3ZVEA 3D62A 1L4DA 3NPSA 1ANCA 5JBCS 5LPEA 1UTQA 4NGAH 1TNLA 1H9IE 3BG4B 1C5YB 1SLVB 1DM4B 2B8OH 1IQMA 1C5XB 3SU6A 1S83A 2R2MB 2BDAA 3MYWA 5HM9A 1EZUC 2JETB 4DOQA 3LGTA 3RLYH 1ELFA 3BTHE 1OOKB 3M3SA 4JZDH 4Y8YA 2WPKS 1G2MA 2QF0A 3GCHC 3P8OA 2Y5FA 3E91A 1HYLA 1TE0A 2BLOA 1E0FD 2OTVA 1LQDB 3MHWU 1PQ5A 1QQUA 4R8TB 1P09A 1O0DH 2ZPRA 2Q6GA 5L6NH 4D7GA 1MMJN 1C2HA 1KDQB 2EI7A 3SZNA 1GJ4H 1O2SA 4FVDA 1V2TT 1EASA 2ANYA 5GIBA 1KTSB 3GDUA 1GI3A 2OUAA 1W3CA 2VIDA 3TJOA 1PPZA 2B9LA 4X1PU 1YPGH 1DITH 1SGTA 1ETRH 2A4GA 1UTPA 3SGBE 1FZZA 4CREA 5DO4H 5HM2A 3ZVGA 1SGYE 4X8VH 1XUHA 2J9NA 1O3LA 2QF3A 1P3CA 1CT2E 1DPOA 3PMHB 1LHGH 2BVRH 2VIOA 1B5GH 4FUDA 1P10A 3E8LA 3Q3XA 2OBOA 1MKWK 4NA7A 1MBMA 3SV7A 3HGNA 1GMHG 1GPZA 1S6FA 3BSQA 3QTOH 4FUFA 5A8ZA 2TBSA 4B73A 1EZSC 3A84A 4BAQB 3RXBA 4KELA 4Q7ZA 1EB1H 1P02A 1BRBE 3STIA 1J9CH 4K1EA 3SUGA 2TGDA 2PKSC 1OS8A 1DWEH 1XKBC 3MO6A 1MBQA 4FU7A 4MPVA 4MQAA 1LMWB 1QGFA 2AERH 2ZFFH 4ABDA 5TJXA 3MH7A 1HAZB 1C1SA 1OP8A 1C2IA 5E0JA 2C8ZB 6GCHF 2A5IA 3URCA 4NWKA 5B6OA 3KNXA 3E16B 3DA9B 2WPMS 2VH0A 4IN2A 2AMDA 1SGCA 2CJIA 2TRMA 1D6RA 3SOSA 3O8CA 1MTWA 3TGIE 2C8WB 3UOUA 2ZZUH 1C2LA 2WYJA 1C2GA 1RGQA 1S5SA 1HBTH 2G4TA 3MI4A 4LXBH 3ZZ3A 1DS2E 4MNWA 1ZSLA 3GY5A 1Q3XA 1UK4A 4YZUA 1PPCE 2GZ7A 4LZ4B 3R3GB 1WUNH 1OWIA 3SV2H 2XXLA 1ZGIA 4GPGA 4FUJA 1KDQA 2H2ZA 1OP0A 1F0TA 2RCEA 2XCNA 1OSSA 2G81E 1ZRBA 2Z94A 3P95A 1GHBF 3RXUA 1EB2A 1HJAC 2VWNA 1YPEH 3F9GA 3SNDA 3ZZBA 3HKIB 1GHAF 1YM0A 2BLVA 4ZHMU 1T8MA 2B5TB 2R9PA 1QY6A 1UVTH 1TNHA 1GBLA 2GDDA 5EW2H 4Q7YA 4DIHH 1C1UH 5CE1A 1GBBA 4D7FA 1OKXA 3K6YA 1NC6A 1QA0A 3BTME 1KY9A 1SBWA 1H8IH 2WV4A 3VXEH 1C4Y2 1KTTB 2FPZA 1W7XH 3D23A 4NSYA 5A0AE 4BNRA 4AYYB 1VCPA 3F9EA 1L2EA 5CMXH 1BJUA 3A88A 1YF4A 1V2WT 4Y11E 2BY7X 2FODA 1LO6A 1Z8JB 1Y5UT 3M36A 1W14U 2AGIX 2ZNKH 3PLBA 2SGAA 1O33A 4U2WA 1JWTA 1ZSJA 1FPCH 2HPQH 4IGDA 4U32A 4WH8A 1D3PB 3BEFB 3LH3A 3SJKA 1AWHB 2OD3B 2BZ6H 1K1LA 4CRGA 5T6FA 4CHAC 1FDPA 4GHQA 1QJ7B 2AGGX 2ODPA 4INKA 1Y3UA 1EPTC 1GHVH 4JMYA 5A0CA 4I8JA 1C2FA 3RMLH 1ZMLA 3DD2H 2HNTF 1D3QB 1Y8TA 4ISHH 1QR3E 3A83A 3EE0B 3T5FH 1P01A 2XWAA 1TONA 3ZZ4A 5ABWA 3C27B 5IDKA 1O5AB 2ZFRH 4D8NA 1TX8A 1EP5A 1EOJA 2Q1JA 4INHA 1UTLM 3ZVFA 5EW1H 3SGAE 3NXPA 4X1RU 4WMEA 4GAWA 2WPJS 4XBDA 5JB9S 2D26C 3QGJA 5TCCA 1S6HA 4UFEH 1GBCA 1RTFB 1AIXH 1XXFA 3KQBA 3IWMA 2BVXH 1CO7E 4Y71A 4IBLH 2WYGA 4ZMAH 1AVWA 5E0HA 3U8OH 3Q00A 3S9BA 1MKXK 3T26A 3S7HB 1O3FA 1NM6A 1UVUH 1E34B 3B9FH 3QN7A 1XKAC 1V2KT 2F9UA 2AIPA 2ZEBA 2J92A 2ZGJA 1FY4A 1IQHA 1W2KH 3QTVH 4K69A 3K6ZA 1H8DH 2NU3E 2P3FH 1VR1H 1ESTA 4UONA 3NWUA 4Y10E 4CBOA 1OYTH 2FM2A 1C5QA 4UFFH 1WV7H 1CA0C 5L30H 5T3HA 1EJMA 3MTYA 2HLCA 4WXIA 1V2VT 1TPOA 1KXAA 2G55A 1EZXC 1BB0B 1ARCA 4ZXXH 1MTNC 3K2UA 1T4VH 2C8YB 1S82A 2BY6X 2FI4E 2D1JA 1O2YA 1TA6A 1QIXB 2M5TA 3QO6A 3IG6B 3BIUH 4AFQA 1NS3A 2OCVB 1O3DA 4ISLA 1P8VC 2XC0A 3O8DA 3F68H 4B76A 5EG4A 2FOBA 2GVFA 2H9EH 3E90B 1C5WB 4AYVB 1LPKB 1OX1A 1ESAA 1O5FH 3GYLB 3M7QA 1GJ5H 1TOCB 4Y0YE 5GCHF 5C1YA 4BOHA 3SI3H 2FI3E 4O3TA 4AN7A 2WINI 4I8LA 1CA0B 3U1IB 1QRWA 3GY6A 1CHGA 4ZKNU 1OYQA 3AVZA 2VVUA 1ZTLA 3LGYA 3M5LA 1D4PB 1UK2A 2A7JA 2ZG0H 4Z6AH 1L1JA 5FX5A 4VGCB 1TNJA 1HJAB 3BN9A 2GCHF 5BRRE 4E06H 3LC3A 1GHZA 2ZHEH 5E0GA 1HAVA 1K1IA 1QL9A 1WOFA 5DJ7A 4X6OA 1QBVH 1ZMNA 1EAUA 2BDGA 4KTSA 1XUJA 3O8RA 1T32A 2FZZA 1LHEH 3A7TA 1J8AA 3E0NB 2VNTA 4BTUB 5LH8A 4M7GA 2PSYA 1CVWH 2CHAB 1BMAA 3MO9A 1QRZA 1KIGH 1BTHH 1K1MA 2EC9H 1EATA 3UFAA 1QJ1B 1D3TB 3P92A 3MU0A 2ANKH 5J4QA 3P8FA 1MUEB 5JPMH 1QA7A 2ZU2A 5IYTA 2BLWA 1P05A 1NFYA 3SORA 2PKSB 4BAMB 2Z6BD 2F9OA 1PFXC 3N7OA 3T25A 1FXYA 1PYTC 1SGFG 1P3EA 1K1NA 1P2MA 3L3TA 9ESTA 3VB5A 1PPEE 4ABAA 1EOLA 1GI8B 5JBBS 1F0RA 1DY9A 1O5EH 5DKMA 2BYAX 5EPNA 4YO9A 1O38A 8GCHF 1ELAA 1DWBH 1TABE 1D3DB 2PGQB 1VCQA 2Z9JA 2JH5D 4X2YA 2Y81A 3TLOA 4Y0ZE 1SOZA 1XUKA 2I6SA 1MTSA 3A8CA 3T27A 1AFEH 1KXCA 1HAXB 2VGCB 3OU0A 2QIQA 3F9HA 2VIVA 2ZIQH 3RC4A 5A2MH 3QZRA 1BZXE 3BTGE 2BDBA 1FLEE 2G5NA 1BTZA 2QV1A 2QXGA 4B71A 2ZA5A 1MTVA 1AKSA 1TX7A 2BQ7B 2GCTC 1ZTJA 2SGEE 1LKAA 4YOIA 1ACBE 3Q77A 1PQ7A 2A7HA 1HJ8A 3RXIA 1BQYA 2ZGBH 3E0PB 3T62A 1QB1A 2BLQA 1BTPA 4AOQA 1TQ0B 3KIDU 1OWEA 3UQVA 3D65E 1CSOE 1O39A 1G32B 1RXPA 3BG4C 3BTFE 1HB0B 2ILNA 1PPBH 1XVMA 3EA7A 1GJ7B 1V2LT 1SC8U 1SMFE 2XBYA 1BITA 1D6WA 3KQDA 1UTOA 2BD5A 1ZRKA 3FVFB 1EZQA 2RA0A 1A3BH 4XE4A 3A81A 2Y6TA 3GCHB 1W11U 7LPRA 3HPTB 4FU8A 3RXVA 1V2RT 2A32A 1O3AA 2DE9A 4CRDA 2SFAA 1QL8A 3A89A 1UVSH 1C1WH 2JH6D 1G36A 4SGBE 1HAYB 1W8BH 2YOLA 2ZPQA 4CRFA 3RXQA 1O3BA 2BY9X 3RC6A 1A1RA 4B1TA 1BJVA 1MAXA 2F83A 4I8GA 1RS0A 2P59A 3ZVAA 2BD2A 1F5LA 4XOJA 4DT7B 3AAVA 4JK6A 3ZZAA 1V2OT 1GHBG 1GHWH 1MTUA 1INCA 3M3VA 2G00A 1MZDA 2RG3A 4Y6DA 1O3NA 3MFJA 4DIIH 2P16A 3A85A 3EQ0H 1C2EA 1YPMH 1NRSH 2ZCLP 1M9UA 4OS5A 1MCVA 1UVOA 4TWWA 5E2OA 5K0HA 3BF6H 3BTTE 3M7TA 1GG6B 1C5PA 2GV6A 5AVDA 2O8MA 1C1VH 2GT8A 4JZFH 3STJA 3T29A 2FOFA 1MH0A 4WXVA 4FUCA 1XUFA 4Y76A 3VB4A 3DFJA 4B75A 3K65B 1FY1A 1MQ5A 7ESTE 2AMPA 4HZHA 2B7DH 2BY8X 2FOEA 1GBFA 4OS4A 4AB9A 3KHVA 2FESH 4JZ1A 1QB6A 2BX4A 2HRVA 3GY2A 4ABFA 3S7KB 1MAYA 4TPYA 4BTTB 1TALA 4IC5A 1EPTA 3MNSA 4X6PA 3SN8A 3VB3A 1QBOA 1SB1H 1AI8H 3RDZA 2DUCA 2VVVA 3ZZ7A 1SQOA 2SNVA 1GI5A 4F49A 2FYQA 2Y82A 3SW2B 1HAVB 1Q31A 3RXRA 5EODA 1SGRE 2QN5T 2W3KA 1SI5H 5JYIA 1AQ7A 3GISB 3HK3B 4TWYA 3EA9A 2BOHB 3UR6A 1ELGA 2ZHWH 3KEEA 5EXLA 1GDUA 4ZHLU 1FY3A 1WYKA 1MU8B 3M3TA 1YPKH 1VGCB 3ATKA 2IPHA 1CBWB 4MNYA 5GXPA 1LVBA 1YP9A 1FUJA 1GBJA 2QYIA 1FAXA 2ZP0H 1TYNA 2FYRA 1A3EH 1FJSA 1JBUH 1N1LA 5DG6A 1RTLA 2Z9IA 3RXKA 1V2JT 1GWAA 4MPWA 3SUEA 3PM3A 1P2OA 3W94A 1T8OA 3A8DA 2G51A 2WPLS 5EQRA 2NU4E 2GD4B 4YOJA 1T8NA 3BTWE 1BBRH 1P9SA 2ZWLH 3LJOA 1AU8A 1O30A 5J4SA 2ALPA 2ZU3A 5DP3A 3RXSA 2EA3A 3QX5H 1BCUH 3PLKA 1P11E 4FUEA 3RC5A 1CA8B 5T6GA 4A5TS 4K8BA 2P8OC 5DPAA 2CF8H 1O2WA 1IQNA 1THRH 2VGCC 1YLCA 4BXSA 3U9AH 1XVOA 3SNBA 1CBWC 3RP2A 1FN8A 2Z9KA 2BDIA 5FHTA 3QZQA 3PTNA 2J94A 3IITA 1P9UA 3SU4A 4AFUA 5EGMA 4WVPE 1KLIH 1IQGA 3EAJA 1E36B 1NRRH 3PMJA 3S0NA 1A0HB 1EPTB 1SLXB 4YTAA 4AFZA 1CGIE 1DE7H 1O31A 5EOKA 3ZZ5A 4D76A 1ZJKA 1P0SH 4NG9H 2FIRH 3PMBB 3TU7H 5F8ZA 2AH4X 4FVBA 2TIOA 4ABGA 4ASHA 2OC7A 2XBVA 1BA8B 1FONA 1BTYA 2W5EA 3B8JA 3RMNH 2BM2A 2VWLA 1O3CA 2CHAC 1HJ9A 1O3GA 2XW9A 3V13A 4ABHA 5A09A 1YC0A 1DLEA 1WBGB 2QGRA 5DP6A 1KXEA 4AGKA 2R0LA 1TAWA 4MPUA 1GMCG 1HNEE 4Z0KA 1PPGE 3M5OA 2PUQH 2BXTH 5A8YA 4X2WA 1TMUH 4D9RA 1FI8A 3EGKH 3PYHA 4X8TH 1SGIB 1SFIA 1G3DA 1E37B 2J34A 3PWBA 3A7ZA 2XRCA 2OC0A 2H5CA 1V2PT 1YCPM 5FPSA 4IMZA 4XBBA 3F1SB 4B2BA 1E38B 1T31A 3JZ1B 2BMGB 3WY8A 2Y80A 1Y59T 6GCHG 2V3HH 1V2NT 1SGEE 1TNKA 2A31A 3SJ8A 2Z9LA 3LC5A 5LPRA 1DUEA 3A8BA 1LVOA 1G3CA 3ZZ6A 4MPXA 1ANDA 2GTBA 3MH6A 5FXLA 1YPHE 1TBRH 2A1DB 3TNSA 1KYNA 1UMAH 1QRXA 2FLRH 1MKWH 1ID5H 4GLYA 3SHAH 1O3EA 2ZTXA 2THFB 1BMNH 4ZKRU 1C1PA 4BAOB 3KGPA 2ASUB 2ZU1A 4AG2A 2K1QA 2IOTA 3LT3A 1IQKA 5DP9A 3OY5U 2KAIB 2QA9E 3ESTA 3ZZDA 3MH5A 5LGOA 4AZ2B 4IC6A 1OWKA 4KKDA 2GDEH 3ODFA 5JBTA 1NRQH 1O2GH 3L33A 2FOCA 3LGVA 2VB0A 3ENSB 3LGIA 1GI2A 4Y8XA 1ANEA 1F2SE 3AW1A 4ISIH 4MLFB 1DANH 1EXFA 4WMDA 1GDNA 1P2IA 2FTLE 1GJ8B 3MO3A 1O2JA 4X6NA 4TPIZ 2BVSH 2OC1A 1XM1A 3UY9A 2UUFB 2CMYA 3ZVBA 3V12A 2AMQA 4A1XA 1B0FA 1AZ8A 1QFKH 1H4WA 2J2UA 2OC8A 5FCKA 2ZF0H 2IJOB 2FLBH 1NU7B 2OQUA 1PQAA 1UTJA 2H6MA 1GGDC 1U6QA 2Z9GA 3LOXA 1NFXA 4X6MA 1V2QT 1EAWA 3RU4T 4CBNA 4CR9A 3KQCA 3AAUA 4VGCC 1O2UA 1A2CH 3S9CA 1FIWA 3BEUA 2FS9A 3JZ2B 1DSUA 4NZLA 1N8OB 1TWXB 4I8HA 1O2XA 4UD9H 1P2NA 2FEQH 3O8BA 3SUDA 3A7XA 2GZ9A 6LPRA 1O2TA 3C1KA 1GMDG 4MNVA 1C5OH 1O3JA 2W3IA 1GJBB 1OXGA 1L1NA 3E6PH 5DGJA 4CH2B 1SQAA 3A87A 2PW8H 4IW4E 2SGPE 1J15A 3ZYEA 3SGQE 2TGAA 1G2LA 4INLA 3H5CB 1NT1A 1MD8A 2ULLA 2I6QA 3SJ9A 1F0SA 4ISNA 2VIWA 3BV9B 1W13U 4NIYA 2GT7A 4JZEH 4IMQA 1GBEA 3H7OA 4Y7BA 4JYVH 2W7UA 4K1TA 4DY7B 3SU1A 1WAYB 3SQHE 3SV9A 2AYWA 1SG8B 1TNIA 1PJPA 1LCYA 2OP9A 8LPRA 1HDTH 4TY6A 5LPFA 1YCPH 2ZPSA 4GVUA 4NIWA 1TIOA 3SO3A 5FX6A 4K3JA 3T2NA 2SGQE 2FWWA 3M37A 2ALVA 3VEQB 1FIZA 3FAOA 3CP7A 3RU4E 4YT7H 5PTPA 1Z8IB 2BZAA 1UTKA 2P3UB 3M5MA 3U8TH 2XWBI 3RXFA 1CHOG 1RIWC 2BD3A 2PFEA 3UWIA 1BMLA 1VGCC 2OBQA 2LNCA 2V0BA 2FOAA 2Y5HA 3BIVH 3LPRA 3UREA 2BD9A 2GGVB 2R3UA 3M7UA 2ZO3H 3VPKA 3MNCA 1C1QA 4YM9A 1NU9A 1FN6A 1K1JA 1QNJA 4B74A 1GVKB 1GDQA 2FOGA 1UCYH 2A2XH 4K2YA 1QL7A 2XC4A 2O8WA 2O8TA 1GL1A 3A7WA 4FUHA 4BAKB 3ATIA 5EXMA 5DP4A 3OX7U 1K28D 1O2OA 1YPHC 3CS0A 1Y5BT 4J2YB 2A5AA 6CHAB 2GP9B 1ZPBA 1GVLA 1SLWB 3KCGH 2W26A 7GCHF 1DDJA 4NFFA 3PO1B 4JYUH 3PTBA 2FXRA 2ZU5A 1KLJH 4ABEA 2ZGHA 4RKJB 1SR5C 3SBKA 3SUFA 2BQ6B 2GCHG 3RXJA 1TOMH 4H6SB 1AMHA 4ZROA 4X8UH 1GBKA 3PROA 4B2AA 2P8OB 5EXNA 2BDCA 4BAHB 3MWIU 4J1YA 1T8LA 1LVYA 1O2VA 1AB9C 4UEHH 1TGNA 1UTNA 1L1GA 2UUKB 2ZQ1A 5C3NA 1F0UA 4ESTE 1O2QA 1JIRA 4LOYH 1Y3WA 2PV9B 2Y5GA 4K60A 4AORA 3SNCA 1TFXA 3SHCH 3V3MA 4MDSA 1QQ4A 1SFQB 3U1JB 1C5ZB 3M5NA 1EAXA 1THPB 1IAUA 4X1NU 2CXVA 1C2MA 4Q2KA 1JOUB 4RN6A 4HI3A 3PMAB 3SU2A 5C1UA 1O32A 1XUIA 3ATLA 4E7RG 4OS6A 1AD8H 1K22H 1YKTA 2LPRA 5GCHG 2CV3A 2OXSA 1SHHB 2TGTA 1ZGVA 1S85A 1O34A 1V2UT 1HAIH 1C1OA 2P3TB 5HXFA 1TMBH 5DK1A 3NUMA 4DVAU 4LK4A 4FUBA 1TPPA 4O9VA 4WMFA 1G37A 1YYY1 1CQQA 1F92A 4SGAE 1G3EA 1GI1A 2EEKA 3DT0H 5I46H 2ZGCA 1UK3A 1GG6C 1GCDA 1RFNA 3I77A 5HMAA 2J95A 1LHDH 1AHTH 1O36A 3GY8A 2HWLB 4CRAA 5TCAA 1AZZA 1W0ZU 3GYMA 3NZIA 5ESTE 1AUTC 1NFWA 3FANA 1BRAA 3PLPA 3RXHA 4I33A 1GHYH 1YLDA 2XCFA 2F9BH 4F4OC 4R0IA 1QB9A 3SU0A 5BPEA 1ELVA 1HRTH 1PQ8A 3HKJB 2QY0B 1C5LH 4KTUA 2WPHS 3P70B 3QDZB 4H6TA 3FP6E 3TGKE 1ETSH 3U8RH 2NU1E 3UPEA 3TVJB 5JDUB 4KGAA 1SVPA 5DP8A 4CH8B 4X1QU 1MQ6A 3TJNA 4NIXA 4YOGA 3QUMP 2GMTB 2Y7ZA 2H9TH 1FAKH 2Q6FA 1RTKA 3ZZCA 1IHSH 2BD8A 1KLTA 1BBRE 1O3KA 2FOMB 4O03A 4WF8A 1OPHB 3UNRA 1QCPA 1DVAH 1BTUA 3NK8A 1IQLA 4HFPB 4OGYA 4AFSA 1UTMA 1P2KA 1O2HA 1C1NA 4RSPA 4D9QA 1A7SA 2BXUH 3EYDA 2P93A 4NA8A 4A1TA 1C1RA 1O2MA 4MNXA 1UCYE 1HXFH 5GDSH 2SNWA 1B0EA 2ZKSA 4HGCA 2FMJA 3RXEA 5EQSA 1IOEA 2ZFQH 3UTUH 2ZDLA 2ZFSA 5F8XA 1JRSA 4MVNA 1ZJDA 5HGGA 2R2WU 5AHGH 1KXBA 2Q6DA 1A5GH 3UR9A 5A8XA 1BIOA 1A0JA 1P2JA 4OS1A 1CT0E 2STBE 4DCDA 4TY7A 4WJG2 2GMTC 1AE5A 1UCYK 3ATWA 1Y3XA 2VINA 2Y7XA 4AGJA 5T6DA 9LPRA 3I78A 1QURH 2HGTH 2EI8A 2Z3CA 5FPYA 5JBAS 1O2NA 1FMGA 3QLPH 4DGJA 2G5VA 1HAPH 3G01A 1VZQH 1F5RA 1GMHF 1Z8GA 4YLQH 4DG4A 1RIWB 3MU1A 3RXMA 3LJJA 2VJ1A 5C5NA 1BBRK 3TJVA 1IQEA 1OWHA 1XMNB 3S9AA 2F9VA 3NKKA 1GCTC 4ZH8A 1NFUA 3FP7E 3S69A 3URDA 3SQEE 1S81A 4OGXA 4WH6A 1UHBA 1PPHE 2ZDKA 2A4RA 2O8LA 1O2IA 3AASA 3KL6A 5GJ4B 4BANB 1C5SA 1L4ZA 1DWDH 4K1SA 4A6LA 1W12U 3PO1C 3BTKE 1EP6A 1HXEH 2FX4A 3V0XA 1SSXA 5C1XA 1ORFA 2PHBA 1NRNH 5I25A 2DE8A 3AW0A 4OS7A 2HOBA 1VITH 2GKVE 4A7IB 4PROA 1C9PA 3ZZ8A 8GCHG 2XNIA 2O9QA 1FQ3A 1HPGA 1F5KU 2ZFPH 5AFYH 1Z1IA 3PB1E 3OSYA 4GHTA 1T7CA 4I8KA 2ZQ2A 2H1UA 3OTJE 3VGCB 3LH1A 2P94A 2BDHA 1L0ZA 3SJIA 2Z3DA 3ZV9A 4AX9H 1ZHPA 1SQTA 2ODYB 2UUJB 3P8NA 1C2KA 1ELEE 4DURA 3GCTF 1V3XA 4ZKSU 2BY5X 5G4BA 3VB6A 1Z1JA 3P17H 2FO9A 1MU6B 1C1TA 3ODDA 1IHTH 4ZAEA 4NWLA 3M35A 2BHGA 4XSKU 1GHXH 3E1XB 3SI4H 1K2I1 4O97A 1GBAA 2XBWA 5ETXA 5SGAE 3P6ZB 1AFQC 3ATMA 3ZZ9A 2WPIS 2QXHA 1HAOH 3K9XB 2PWXA 2ANMH 2HPPH 4E05H 1ABJH 4Y79A 3OYPA 2AEIH 1GI6A 3V7TA 2HALA 3GICB 1N6YA 4JYTA 1KSNA 2OQ5A 2UWOA 1MKXH 4QT8C 1HCGA 1DFPA 1LHFH 4NIVA 4K8YA 3RXDA 4NZQA 1J14A 1TGSZ 2B0FA 3U98H 2D2DA 1RRKA 2PTCE 2J4IA 4FXGH 4E7NA 5FBIA 2XTTB 1HGTH 1ESBA 1RD3B 2SGFE 2FS8A 5DP5A 2ODQA 2QCYA 3CENA 4Y7AA 3UWJH 2D8WA 4Q80A 3SJOA 3H7TA 3RMOH 3UNSA 4ABJA 2JETC 1EQ9A 1LPZB 1SHYA 1LVMA 1MD7A 2FP7B 4FU9A 4NSVA 4X2XA 1TBZH 4XDEA 2QXIA 4KP0A 2XYAA 2ZDNA 4UFDH 1FPHH 4I32A 3RXPA 4NFEA 1K9OE 3TJUA 1A46H 3Q3KA 4XBCA 1AFQB 4WWYA 3T28A 2OLGA 1C5UA 3PV4A 4ZKOU 2HNTE 1EJAA 2C3SA 2ZHQH 3LGUA 1D9IA 4NA9H 1ZSKA 4ZXYH 1O3PB 5F8TA 1ZHRA 1JXPA 2GX4A 1GI7B 1AB9B 1O2PA 3SV8A 1AN1E 1THSH 3KN2A 1UO6A 1QTFA 1AKSB 3B23B 2AIQA 7KMEH 5DP7A 1BOQA 2BD7A 1G30B 2W7SA 4CR5A 1XXDA 4K5ZA 4I31A 2PUXB 1LPGB 5FBEA 3DFLA 1BTWA 1WCZA 1Y3YA 2FOHA 3BG8A 1GGDB 1TRMA 2ZDVH 3D49H 4OS2A 5AFZH 3MU5A 3QGNB 1GI0A 1JRTA 1GHAG 3Q76A 1NRPH 2Z7FE 1GMDF 1DXPA 1TMTH 4AB8A 1TBQH 1A5HA 1N8OC 3UIRA 2C4FH 2V6NA 3MU4A 3TH3H 1DT2A 1CU1A 1ABIH 3A8AA 1VCWA 1TGCA 2IN2A 3TH2H 2ZC9H 1ELTA 3LKWA 1QBNA 1WQSA 4XFQA 4FUIA 1GI4A 4JCNA 1TPAE 3TNTA 1ZPZA 3RXOA 3GDSA 1LQEA 2VIPA 1DY8A 1K1OA 2FX6A 1GCTB 5A0BA 4YLUA 1A0LA 3MMGA 2BDYA 4JZIA 1TB6H 2J38A 1HLTH 3E3TA 1UHBB 2A2QH 4IS5A 4U01A 1BTXA 1ELCA 1AWFH 3ZVCA 1YPLH 5K7RA 2ZTYA 1C5NH 1WTGH 1KXDA 1O2LA 1HAHH 1ANBA 3GCOA 3RMMH 1C4V2 1ARBA 1GL0E 3LDXH 4FUGA 2NU2E 1IQJA 1S0QA 2G8TA 2AFQB 2C90B 3SNEA 3FP8E 1YCPK 1P03A 1O35A 1NTPA 1O5CB 1GBMA 4ZHAA 2PSXA 3LGWA 1DX5M 4X0WU 2CN0H 1T4UH 2XBXA 2ANWA 4RKOB 1EAIA 1SGFA 4THNH 3ZV8A 1Z7KA 4HTCH 3EDXB 1MZAA 2VWMA 3RXCA 1Q2WA 3ELAH 1EX3A 1WU1A 1UJ1A 1EJNA 5CHAB 2UWPA 1P2QA 6CHAC 1DUAA 1DOJA 3VB7A 5AF9H 1AVGH 4H4FA 2ZHFH 3RXTA 8ESTE 2GV7A 1S0RA 3QWCH 1H9LB 1TX6A 2ZCKP 1PYTD 1SGDE 2PLXA 3GDVA 4JK5A 3PWCA 3MH4A 1VJ9U 3A86A 2ZGXH 3LU9B 1Z6JH 1P12E 2BD4A 3LIWA 1FY8E 1NZQH 2UUYA 2F3CE 1ZYOA 5C67A 4I7YH 1J16A 2BX3A 2O8UA 3GOVB 2NWNA 3F6UH 5FAHA 1G3BA 3SU3A 3ITIA 2G4UA 5C2ZA 4KTCA 3RM2H 1C5MD 1C2DA 3HK6B 2PKAB 1GJCB 1K21H 2FTMA 2H5DA 3EA8A 1O5GH 2STAE 2BOKA 2A0QB 1TGBA 1JIMA 2WV5A 1GBTA 3UOPA 4Q7XA 1G9IE 1LDTT 4UDWH 1V6DA 1VITG 2RA3A 2ZU4A 3RXGA 1BHXF 2PR3A 3MNBA 5JB8S 4WY3A 8KME2 2F9NA 3A7YA 6ESTA 3VXFH 1A4WH 1NROH 2CF9H 1OP2A 3VGCC 3DUXH 1ETTH 1O3OA 2R3YA 3DHKH 3RXAA 3GY7A 1C2JA 1Z6EA 3UQOA 1NPMA 2TGPZ 3SU5A 1JMOH 1WQVH 2FI5E 1BT7A 1O3MA 1V2ST 1RJXB 2VH6A 2V35A 3OY6U 4U30A 2XC5A 1QHRB 4UE7H 4A92A 3TGJE 4BTIB 1A61H 2HNTC 3M61U 1BHXB 3QK1A 1BRUP 3BTEE 2QAAA 5ESBA 1TRNA 1TA2A 4GCHG 1FY5A 1DSTA 3LONA 4A1VA 2F91A 1Z71A 1ZLRA 5H4IB 4GUXA 2V3OH 1C1MA 1GBHA 2HVXA 1S84A 1O2ZA 4LZ1H 1BMMH 1TPSA 3P8GA 1K1PA 5E2PA 5EU8A 2F9PA 1CT4E 1HIAB 1QJ6B 1ZOMA 3SV6A 1EKBB 1LKBA 1C5RA 2A5KA 1SGNE 5HYOA 1AY6H 1ZTKA 1ZHMA 1FNIA 1GVZA 1VITF 4X8SH 1P57B 1ZR0A 3GY4A 1AE8H 2NU0E 2PTNA 2OINA 1F7ZA 1OWJA 1NO9H 1ZPCA 4GSOA 5E8EH 3A82A 2A45B 2PKAA 2SGDE 1GJ6A 1GJ9B 1O2RA 1MCTA 2AGEX 1BDAA 3FFGA 3UUZA 4ZUHA 1LTOA 2ZHDA 1TLDA 1N6XA 3FZDA 3W95A 1H9HE 3R0FA 1GMCF 5F6MA 1WSSH 2YNBA 2A4QA 2Z3EA 2ZCHP 1Z8RA 2EI6A 1BUIA 1Y3VA 2YNAA 2JH0D 3ZVDA 1ZZZA 1NN6A 2H9HA 1X7AC 2GZ8A 3SNAA 2QC2A 1HV7A 2CGAA 5L2ZH 3KQEA 3TK9A 1EUFA 1YPJH 1KXFA 3FZZA 1DLKB 1SOTA 1TQ7B 1V2MT 2A7CA 5EQQA 2G52A 1GI9B 1AGJA 7GCHG 3RXLA 1HUTH 2KAIA 2UWLA 1A5IA 1DWCH 3I29A 3A80A 5FPTA 5GWZA 2VVCA 3UNQA 3BTDE 3NCLA 3GCTG 1SL3A 2ZECA 1CGJE 3TK5A 1DXWA 1C5TA 3HATH 5CHAC 2RDLA 1W10U 4NCYA 2PGBB 3F9FA 1H1BA 3VFEA 3RU4D 1TRYA 1O3HA 4IN1A 2JKHA 1O37A 1AUJA 1IQIA 1HFDA 2WUCA 4Y8ZA 1CHOF 4X2VA 5L2YH 3L6PA 4ABIA 1YGCH 1O3IA 2R0KA 3TITA 4H42U 1ELBA 2A4OA 3MNXA 1HAGE 3TIUA 3TK6A 1CE5A 1Y5AT 1O2KA 3RUOA 1HIAA 4BXWA 3MU8A 3GY3A 3CS7A 4MG3A 4UFGH 1GJAB 1J17T 2ZDAH 2ZI2H 1O5DH
chains in the Genus database with same CATH superfamily
1UVPA 1P04A 2BTCE 2VU8E 4B2CA 1YBWA 1WTHD 2BB4A 1E1RD 3BTQE 1W0YH 1C5VA 1C9TA 1NY22 5C20A 2VWOA 4DW2U 2FDAA 3TPIZ 1E35B 1XX9A 1O5BB 2KCYA 3ZYDA 3FKSD 1OWDA 4AG1A 4ABBA 1GJDB 3RLWH 3BEIB 2C8XB 2ZFTA 1VJAU 2C93B 2ZTZA 3N7EA 2AS9A 1DICA 2QXJA 2VIQA 1C4U2 3KF2A 5FCRA 1PPFE 3U69H 1GBIA 3HGPA 1FV9A 2ZDMA 2BQWB 3Q3YA 1AO5A 4X1SU 1LHCH 4CRCA 3TH4H 1P06A 4GCHF 1SGQE 3A7VA 1GBDA 1XUGA 1BRCE 4TYDA 4O3UA 5GPIB 3MOCA 1SLUB 4YESB 2GCTB 2TPIZ 1AVXA 5EPYA 5C5OA 1B7XB 1ELDE 1SPJA 4DJZB 1NESE 1VKYA 2ESTE 2P95A 4MTBA 3RM0H 1MTNB 4CRBA 4CHAB 4YT6H 1CGHA 1SGPE 1TNGA 4ISOA 5F03A 1W7GH 2WUBA 3GCNA 1IQFA 1TGTA 3CNRA 1ZMJA 3ZVEA 3D62A 1L4DA 3NPSA 1ANCA 5JBCS 5LPEA 1UTQA 4NGAH 1TNLA 1H9IE 3BG4B 1C5YB 1SLVB 1DM4B 2B8OH 1IQMA 3KYFA 5KGOA 1C5XB 3SU6A 1S83A 2R2MB 2BDAA 3MYWA 5HM9A 1EZUC 2JETB 4DOQA 3LGTA 3RLYH 1ELFA 3BTHE 1OOKB 3M3SA 4JZDH 4Y8YA 2WPKS 1G2MA 2QF0A 3GCHC 3P8OA 2Y5FA 3E91A 1HYLA 2AHME 1TE0A 2BLOA 1E0FD 2OTVA 3MQKC 1LQDB 3MHWU 1PQ5A 1QQUA 4R8TB 1P09A 1O0DH 4ACAA 2ZPRA 2Q6GA 5L6NH 4D7GA 1MMJN 1C2HA 1KDQB 2EI7A 3SZNA 1GJ4H 1O2SA 4FVDA 1V2TT 1EASA 2ANYA 5GIBA 1KTSB 3GDUA 1GI3A 2OUAA 2W6JD 3OTPA 1W3CA 2VIDA 3F0PA 3TJOA 1PPZA 2B9LA 4X1PU 1YPGH 1DITH 1SGTA 1ETRH 2A4GA 1UTPA 3SGBE 1FZZA 4CREA 5DO4H 5HM2A 3ZVGA 1SGYE 4X8VH 1XUHA 2J9NA 1O3LA 2QF3A 1P3CA 1CT2E 1DPOA 3PMHB 1LHGH 2BVRH 2VIOA 1B5GH 4FUDA 1P10A 3E8LA 3Q3XA 2OBOA 1MKWK 1E1QD 4NA7A 1MBMA 3SV7A 3HGNA 1GMHG 1GPZA 1S6FA 3BSQA 3QTOH 4FUFA 5A8ZA 2TBSA 4B73A 1EZSC 3A84A 4BAQB 3RXBA 4KELA 4Q7ZA 1EB1H 1P02A 1BRBE 3STIA 1J9CH 4K1EA 3SUGA 2TGDA 2PKSC 1OS8A 1DWEH 5C94A 1XKBC 3MO6A 1MBQA 4FU7A 4MPVA 4MQAA 1LMWB 1QGFA 2AERH 2ZFFH 4ABDA 5TJXA 3MH7A 1HAZB 1C1SA 1OP8A 1C2IA 5E0JA 2C8ZB 6GCHF 2A5IA 3URCA 4NWKA 5B6OA 3KNXA 3E16B 2WV9A 3DA9B 2WPMS 2VH0A 4IN2A 2AMDA 1SGCA 2CJIA 2TRMA 1D6RA 3SOSA 3O8CA 1MTWA 3TGIE 2C8WB 3UOUA 2ZZUH 1C2LA 2WYJA 1C2GA 1RGQA 1S5SA 1HBTH 2G4TA 3MI4A 4LXBH 3ZZ3A 1DS2E 5EJZA 4MNWA 1ZSLA 1H8HD 3GY5A 1Q3XA 1UK4A 4YZUA 1PPCE 1SQRA 2GZ7A 4LZ4B 3R3GB 1WUNH 1OWIA 3SV2H 2XXLA 1ZGIA 4GPGA 4FUJA 1KDQA 2H2ZA 1OP0A 1F0TA 2RCEA 2XCNA 1OSSA 2G81E 4RT0A 1ZRBA 2Z94A 1BMFD 3P95A 1GHBF 3RXUA 1EB2A 1HJAC 2VWNA 1YPEH 3F9GA 3SNDA 3ZZBA 3HKIB 1GHAF 1YM0A 2BLVA 4ZHMU 1T8MA 2B5TB 2R9PA 1QY6A 1UVTH 1TNHA 1GBLA 2GDDA 5EW2H 4Q7YA 4DIHH 1C1UH 5CE1A 1GBBA 4D7FA 1OKXA 3K6YA 1NC6A 1QA0A 3BTME 1KY9A 1SBWA 1H8IH 2JJ1D 2J98A 2WV4A 3VXEH 1C4Y2 1KTTB 2FPZA 1W7XH 3D23A 4NSYA 5A0AE 4BNRA 4AYYB 1VCPA 3F9EA 1UW7A 1L2EA 5CMXH 1BJUA 3A88A 1YF4A 1V2WT 4Y11E 2BY7X 2FODA 1LO6A 1Z8JB 5FL7D 1Y5UT 3M36A 1W14U 2AGIX 2ZNKH 1YLNA 3PLBA 2SGAA 2VBCA 1O33A 4U2WA 1JWTA 1ZSJA 1FPCH 2HPQH 4IGDA 3SZEA 4U32A 4WH8A 1D3PB 3BEFB 3LH3A 3SJKA 1AWHB 2OD3B 2BZ6H 1K1LA 4CRGA 5T6FA 4CHAC 1FDPA 4GHQA 1QJ7B 2AGGX 2ODPA 4INKA 1Y3UA 1EPTC 1GHVH 4JMYA 5A0CA 4I8JA 1C2FA 3RMLH 1ZMLA 3DD2H 2HNTF 1D3QB 1Y8TA 4ISHH 1QR3E 2YMSB 4OM9A 3A83A 3EE0B 3T5FH 1P01A 2XWAA 1TONA 3ZZ4A 5ABWA 3C27B 5IDKA 1O5AB 2ZFRH 2W6ID 4D8NA 1TX8A 1EP5A 1EOJA 2Q1JA 4INHA 1UTLM 3ZVFA 5EW1H 3SGAE 3NXPA 4X1RU 4WMEA 2V7QD 4GAWA 2WPJS 4XBDA 5JB9S 2D26C 3QGJA 5TCCA 1S6HA 4UFEH 1GBCA 1RTFB 1AIXH 1XXFA 3KQBA 3IWMA 2BVXH 1CO7E 4Y71A 4IBLH 2WYGA 4DT4A 4ZMAH 5EIYA 4P00A 1AVWA 2KCPA 5E0HA 3U8OH 3Q00A 3S9BA 1MKXK 3T26A 3S7HB 1O3FA 1NM6A 1UVUH 1E34B 3B9FH 3QN7A 1XKAC 1V2KT 2F9UA 2AIPA 2ZEBA 2J92A 2ZGJA 1FY4A 1IQHA 1W2KH 3QTVH 4K69A 3K6ZA 1H8DH 2NU3E 2P3FH 1VR1H 1ESTA 4UONA 3NWUA 1YWUA 4Y10E 4CBOA 1OYTH 2FM2A 1C5QA 4UFFH 1WV7H 1CA0C 5L30H 3SYJA 5T3HA 1EJMA 3MTYA 2HLCA 4WXIA 1V2VT 1TPOA 1KXAA 2G55A 1EZXC 1BB0B 1ARCA 3OFND 1MTNC 4ZXXH 3K2UA 1T4VH 2C8YB 1S82A 2BY6X 2FI4E 2D1JA 1O2YA 1TA6A 1QIXB 2M5TA 3QO6A 3IG6B 3BIUH 4AFQA 1NS3A 2OCVB 2PP6A 1O3DA 4ISLA 1P8VC 2XC0A 3O8DA 3F68H 4B76A 5EG4A 2FOBA 2GVFA 2H9EH 3E90B 1C5WB 4AYVB 1LPKB 2F43B 3VG8A 1OX1A 1ESAA 1O5FH 3GYLB 3M7QA 1GJ5H 1TOCB 4Y0YE 5GCHF 5C1YA 4BOHA 5HIYA 2OK5A 1S6LA 3SI3H 2RDEA 2FI3E 4O3TA 5HKKD 4AN7A 2WINI 4I8LA 1CA0B 3U1IB 1QRWA 3GY6A 1CHGA 4ZKNU 1OYQA 3AVZA 2VVUA 1ZTLA 3LGYA 3M5LA 2WHXA 1D4PB 1UK2A 2A7JA 2ZG0H 4Z6AH 1L1JA 5FX5A 4VGCB 1TNJA 1HJAB 3BN9A 2GCHF 5BRRE 4E06H 3LC3A 1GHZA 2ZHEH 5E0GA 1HAVA 1K1IA 1QL9A 1WOFA 5DJ7A 2KZ4A 4X6OA 1QBVH 1ZMNA 1EAUA 2V3MA 2BDGA 4KTSA 1XUJA 3O8RA 1T32A 2FZZA 1LHEH 3A7TA 1J8AA 3E0NB 2VNTA 4BTUB 5LH8A 4M7GA 2PSYA 1CVWH 2CHAB 1BMAA 3UB0A 3MO9A 1QRZA 1KIGH 1BTHH 1K1MA 2EC9H 1EATA 3N7DA 3UFAA 1QJ1B 1D3TB 3P92A 3MU0A 2ANKH 5J4QA 3P8FA 1MUEB 5JPMH 1QA7A 2ZU2A 4ASUD 5IYTA 2BLWA 1P05A 1NFYA 3SORA 2PKSB 3DSOA 4BAMB 2Z6BD 2F9OA 1PFXC 3N7OA 3T25A 1FXYA 1PYTC 1SGFG 4M9FA 1P3EA 1K1NA 1P2MA 2XNDD 3L3TA 9ESTA 3VB5A 1PPEE 4ABAA 1EOLA 1GI8B 5JBBS 1F0RA 1DY9A 1O5EH 5DKMA 2BYAX 5EPNA 2IPQX 4YO9A 1O38A 8GCHF 1ELAA 1DWBH 1TABE 5CHBA 1D3DB 2PGQB 1VCQA 5EJLA 2Z9JA 2JH5D 4X2YA 2Y81A 3TLOA 2KCAA 4Y0ZE 1SOZA 1XUKA 2I6SA 4HG6A 1MTSA 3A8CA 3T27A 1W0KD 1AFEH 1KXCA 1HAXB 2VGCB 3OU0A 2QIQA 3F9HA 2VIVA 2ZIQH 3RC4A 5A2MH 3QZRA 1BZXE 3BTGE 2BDBA 1FLEE 2G5NA 1BTZA 2QV1A 2QXGA 4B71A 2ZA5A 1MTVA 1AKSA 1TX7A 2BQ7B 2GCTC 1ZTJA 2SGEE 1LKAA 4YOIA 1ACBE 3Q77A 1PQ7A 2A7HA 1HJ8A 3RXIA 1BQYA 2ZGBH 3E0PB 3T62A 1QB1A 2BLQA 1BTPA 4AOQA 1TQ0B 3KIDU 2F4LA 3DSGA 1OWEA 3OAAD 3DSPA 3UQVA 3D65E 1CSOE 1O39A 1G32B 1RXPA 3BG4C 3BTFE 1HB0B 2ILNA 1PPBH 1XVMA 3EA7A 1GJ7B 1V2LT 1SC8U 1SMFE 2XBYA 2YMSD 1BITA 1D6WA 3KQDA 1UTOA 2BD5A 1ZRKA 3FVFB 1EZQA 2RA0A 2EQNA 1A3BH 4XE4A 3A81A 2Y6TA 3GCHB 1W11U 7LPRA 3HPTB 4FU8A 3RXVA 1V2RT 2A32A 1O3AA 2DE9A 4CRDA 2SFAA 1QL8A 3A89A 1UVSH 1C1WH 2JH6D 1G36A 4SGBE 1HAYB 1W8BH 2YOLA 2ZPQA 4CRFA 3RXQA 3F2GA 1O3BA 2BY9X 3RC6A 1A1RA 4B1TA 1BJVA 1MAXA 2F83A 3KYGA 4I8GA 1RS0A 2P59A 3ZVAA 2BD2A 1F5LA 4XOJA 4DT7B 3AAVA 4JK6A 3ZZAA 1V2OT 1GHBG 1GHWH 1MTUA 2RFKC 1INCA 3M3VA 2G00A 1MZDA 2RG3A 4Y6DA 1O3NA 3MFJA 4DIIH 2P16A 3A85A 3EQ0H 1C2EA 1YPMH 1NRSH 2ZCLP 1M9UA 2JDID 4OS5A 1MCVA 1UVOA 4TWWA 5E2OA 5K0HA 3BF6H 3BTTE 3M7TA 1GG6B 1C5PA 2GV6A 5AVDA 2O8MA 1C1VH 2GT8A 4JZFH 3STJA 3T29A 2FOFA 1MH0A 4WXVA 4FUCA 1XUFA 4Y76A 3VB4A 3DFJA 3AK5A 4B75A 3K65B 1FY1A 1MQ5A 7ESTE 2AMPA 4HZHA 2B7DH 2BY8X 2FOEA 1GBFA 4OS4A 4AB9A 3KHVA 2JJ2D 2FESH 4JZ1A 1QB6A 2BX4A 2HRVA 3GY2A 4ABFA 3S7KB 3F2FA 1MAYA 4TPYA 4BTTB 1TALA 4IC5A 1EPTA 3MNSA 4X6PA 3SN8A 3VB3A 1QBOA 1SB1H 5C0UA 1AI8H 3RDZA 2DUCA 2VVVA 3ZZ7A 1SQOA 4AC9A 2SNVA 1GI5A 4F49A 2FYQA 2Y82A 3SW2B 1HAVB 1Q31A 3RXRA 5EODA 1SGRE 2QN5T 2W3KA 1SI5H 5JYIA 1AQ7A 3GISB 3HK3B 4TWYA 3EA9A 2BOHB 3UR6A 1ELGA 2ZHWH 3KEEA 5EXLA 1GDUA 4ZHLU 1FY3A 1WYKA 1MU8B 3M3TA 1YPKH 1VGCB 3ATKA 2IPHA 1CBWB 4MNYA 1QZ8A 5GXPA 1LVBA 1YP9A 1FUJA 1GBJA 2QYIA 1FAXA 2ZP0H 1TYNA 2FYRA 1A3EH 1FJSA 1JBUH 1N1LA 5DG6A 1RTLA 2Z9IA 3RXKA 3F3BA 2KR7A 1V2JT 1GWAA 4MPWA 3SUEA 3PM3A 1P2OA 3W94A 1T8OA 3A8DA 2G51A 2WPLS 5EQRA 2NU4E 2GD4B 4YOJA 1T8NA 3BTWE 1BBRH 1P9SA 2ZWLH 3LJOA 1AU8A 1O30A 5J4SA 2ALPA 2ZU3A 5DP3A 3RXSA 2EA3A 3QX5H 1BCUH 3KQ5A 3PLKA 4F48B 1P11E 4FUEA 3RC5A 1CA8B 2IJD1 5T6GA 4A5TS 4K8BA 2P8OC 5DPAA 2CF8H 1O2WA 1IQNA 1THRH 2VGCC 1YLCA 4BXSA 3OE7D 3U9AH 5KEDA 1XVOA 2WPDD 3SNBA 1CBWC 3RP2A 3UAIC 1FN8A 2Z9KA 2BDIA 5FHTA 3QZQA 3F0OA 3PTNA 2J94A 3IITA 1P9UA 3SU4A 4AFUA 5EGMA 4WVPE 1KLIH 1IQGA 3EAJA 1E36B 1NRRH 3PMJA 3S0NA 2QF5A 1A0HB 1EPTB 1SLXB 4YTAA 4AFZA 1CGIE 1DE7H 1O31A 5EOKA 3ZZ5A 4D76A 1ZJKA 1P0SH 4NG9H 2FIRH 2QE7D 3PMBB 3TU7H 2YMSC 5F8ZA 2AH4X 4FVBA 2TIOA 4ABGA 4ASHA 2OC7A 2XBVA 1BA8B 1FONA 1BTYA 2W5EA 3B8JA 3RMNH 2BM2A 3PV2A 2VWLA 1O3CA 2CHAC 1HJ9A 1O3GA 2XW9A 3V13A 4ABHA 5A09A 1YC0A 5B6LA 1DLEA 1WBGB 2QGRA 5DP6A 1KXEA 4AGKA 2R0LA 1TAWA 4F55A 4MPUA 1GMCG 1HNEE 1KMHB 3WWFA 4Z0KA 1PPGE 3M5OA 2PUQH 2BXTH 5A8YA 4X2WA 1TMUH 4D9RA 1FI8A 3EGKH 3PYHA 4X8TH 1SGIB 1SFIA 1G3DA 1E37B 2J34A 3PWBA 3A7ZA 2OC0A 1V2PT 2H5CA 2XRCA 1YCPM 5FPSA 4IMZA 4XBBA 3F1SB 4B2BA 1E38B 1T31A 3JZ1B 2BMGB 3WY8A 2Y80A 1Y59T 6GCHG 1V2NT 2V3HH 1SGEE 1TNKA 2A31A 3SJ8A 2Z9LA 2LP6A 3LC5A 5LPRA 1DUEA 3A8BA 1LVOA 1G3CA 3ZZ6A 4MPXA 1ANDA 2GTBA 3NRLA 3MH6A 5FXLA 2EY4C 1YPHE 1TBRH 2A1DB 3FO8D 1KYNA 3TNSA 1UMAH 1QRXA 3U28C 2FLRH 1MKWH 1ID5H 4GLYA 3SHAH 1O3EA 2ZTXA 2THFB 1BMNH 4ZKRU 1C1PA 4BAOB 3KGPA 2ASUB 2ZU1A 4AG2A 2K1QA 2IOTA 3LT3A 1IQKA 5DP9A 3OY5U 2KAIB 2QA9E 3ESTA 3ZZDA 3MH5A 5LGOA 4AZ2B 4IC6A 2CK3D 1OWKA 4KKDA 2GDEH 1COWD 3ODFA 5JBTA 1NRQH 1O2GH 3L33A 2FOCA 5F53A 3LGVA 2WZQA 2VB0A 3ENSB 3LGIA 1GI2A 2J97A 4Y8XA 1ANEA 1F2SE 3AW1A 4ISIH 4MLFB 1DANH 1EXFA 4WMDA 1GDNA 1P2IA 2FTLE 1GJ8B 3MO3A 1O2JA 4X6NA 4TPIZ 2BVSH 2OC1A 1XM1A 3UY9A 2UUFB 2CMYA 2M2AA 5C17A 3ZVBA 3V12A 2AMQA 4A1XA 1B0FA 1AZ8A 1QFKH 1H4WA 2J2UA 2OC8A 5FCKA 2ZF0H 2IJOB 2FLBH 1NU7B 2OQUA 1PQAA 1UTJA 2H6MA 1GGDC 1U6QA 2Z9GA 3LOXA 1NFXA 4X6MA 1V2QT 1EAWA 3RU4T 4CBNA 4CR9A 3KQCA 3AAUA 4VGCC 1O2UA 1A2CH 3S9CA 1FIWA 3BEUA 2FS9A 3JZ2B 1DSUA 4NZLA 1N8OB 1TWXB 4I8HA 1O2XA 5HIZA 4UD9H 1P2NA 2FEQH 3O8BA 3SUDA 3A7XA 2GZ9A 6LPRA 1O2TA 3C1KA 1GMDG 4MNVA 1C5OH 1O3JA 2W3IA 1GJBB 1OXGA 1L1NA 3E6PH 5DGJA 4CH2B 1SQAA 3A87A 2PW8H 4Z1MD 4TT3D 4IW4E 2SGPE 1J15A 3ZYEA 3SGQE 2TGAA 1G2LA 4INLA 3H5CB 1NT1A 1MD8A 2ULLA 2I6QA 3SJ9A 1F0SA 4ISNA 2VIWA 3BV9B 1W13U 4NIYA 2GT7A 4JZEH 5C0TA 2K0QA 4IMQA 1GBEA 3H7OA 4Y7BA 4JYVH 2W7UA 4K1TA 4DY7B 3SU1A 1WAYB 3SQHE 3SV9A 2AYWA 1SG8B 1TNIA 1PJPA 1LCYA 2OP9A 8LPRA 1HDTH 4TY6A 5LPFA 1YCPH 2ZPSA 4GVUA 4NIWA 1TIOA 3SO3A 5FX6A 4I86A 4K3JA 3T2NA 2SGQE 2FWWA 3M37A 2ALVA 3VEQB 1FIZA 3FAOA 3CP7A 3RU4E 4YT7H 5PTPA 1Z8IB 2BZAA 1UTKA 2P3UB 3M5MA 3U8TH 2XWBI 3RXFA 1CHOG 1RIWC 2BD3A 2L74A 2PFEA 3UWIA 1BMLA 1VGCC 2OBQA 2LNCA 2V0BA 1WDIA 2FOAA 2Y5HA 3BIVH 3LPRA 3UREA 2BD9A 2GGVB 2R3UA 3M7UA 2ZO3H 3VPKA 3MNCA 1C1QA 4YM9A 3PRBA 1NU9A 1FN6A 1K1JA 1QNJA 4B74A 1GVKB 1GDQA 2FOGA 1UCYH 2A2XH 4K2YA 1QL7A 2XC4A 2O8WA 2O8TA 1GL1A 3A7WA 4FUHA 1H8ED 4BAKB 3ATIA 5EXMA 5DP4A 1FX0B 1K28D 3OX7U 1O2OA 1YPHC 3CS0A 1Y5BT 4J2YB 2A5AA 6CHAB 2GP9B 1ZPBA 1GVLA 1SLWB 3KCGH 2W26A 7GCHF 1DDJA 4NFFA 3PO1B 4JYUH 3PTBA 2FXRA 2ZU5A 1KLJH 5DSFA 4ABEA 2ZGHA 4Q63A 4RKJB 1SR5C 3SBKA 3SUFA 2BQ6B 2GCHG 3RXJA 1TOMH 4H6SB 1AMHA 5EJ1A 4ZROA 4X8UH 1GBKA 3PROA 4B2AA 4XRNA 2P8OB 5EXNA 2BDCA 4BAHB 3MWIU 4J1YA 1T8LA 1LVYA 1O2VA 1AB9C 4UEHH 1TGNA 1UTNA 1L1GA 2UUKB 2ZQ1A 5C3NA 1F0UA 4ESTE 1O2QA 1JIRA 4LOYH 1Y3WA 2PV9B 2Y5GA 4FETA 4K60A 4AORA 3SNCA 1TFXA 3SHCH 3V3MA 4MDSA 1QQ4A 1SFQB 3U1JB 1C5ZB 3M5NA 1EAXA 1THPB 1IAUA 4X1NU 2CXVA 1C2MA 4Q2KA 1JOUB 4RN6A 4HI3A 3PMAB 3SU2A 5C1UA 5GNDA 1O32A 1XUIA 3ATLA 4E7RG 4OS6A 1AD8H 1K22H 1YKTA 2LPRA 5GCHG 2CV3A 2OXSA 1SHHB 2TGTA 4ZCNA 1ZGVA 2KCOA 2J98B 1S85A 1O34A 1V2UT 1HAIH 1C1OA 2P3TB 5HXFA 1TMBH 5DK1A 3NUMA 4DVAU 4LK4A 3EE7A 4FUBA 1TPPA 4O9VA 4WMFA 1G37A 1YYY1 1CQQA 1F92A 4SGAE 1G3EA 1GI1A 2EEKA 3DT0H 5I46H 2ZGCA 1UK3A 1GG6C 1GCDA 1RFNA 3I77A 5HMAA 2J95A 1LHDH 1AHTH 1O36A 3GY8A 2HWLB 4CRAA 5TCAA 1AZZA 1W0ZU 3GYMA 3NZIA 5ESTE 1SKYE 1AUTC 1NFWA 3FANA 1BRAA 3PLPA 3RXHA 4I33A 2QF4A 1GHYH 1YLDA 2XCFA 2F9BH 4F4OC 4R0IA 1QB9A 3SU0A 5BPEA 1ELVA 1HRTH 3FOAA 1PQ8A 3HKJB 2QY0B 1C5LH 4KTUA 2WPHS 3P70B 3QDZB 4H6TA 3FP6E 3TGKE 1ETSH 3U8RH 2NU1E 2LELA 3UPEA 3TVJB 5JDUB 4KGAA 1SVPA 5DP8A 1YY3A 4CH8B 4X1QU 1MQ6A 3TJNA 4NIXA 4YOGA 3QUMP 2GMTB 2Y7ZA 2H9TH 1FAKH 2Q6FA 1RTKA 3ZZCA 1IHSH 2BD8A 2WSSD 1KLTA 1BBRE 1O3KA 2FOMB 4O03A 4WF8A 1OPHB 3UNRA 1QCPA 1DVAH 1BTUA 3NK8A 1IQLA 4HFPB 4OGYA 4AFSA 1UTMA 1P2KA 1O2HA 1C1NA 4RSPA 4D9QA 1A7SA 2BXUH 3EYDA 2P93A 4NA8A 4A1TA 1C1RA 1O2MA 4MNXA 1UCYE 1HXFH 5GDSH 2SNWA 1B0EA 2ZKSA 4HGCA 2FMJA 3RXEA 5EQSA 1IOEA 2ZFQH 3WW7A 3UTUH 2ZDLA 2ZFSA 5F8XA 1JRSA 4MVNA 1ZJDA 5HGGA 2R2WU 5AHGH 1KXBA 2Q6DA 1A5GH 3UR9A 5A8XA 1BIOA 1A0JA 1P2JA 4OS1A 1CT0E 2STBE 4DCDA 4TY7A 4WJG2 2GMTC 1AE5A 1UCYK 3ATWA 1Y3XA 2VINA 2Y7XA 4AGJA 5T6DA 9LPRA 3I78A 1EFRD 1QURH 2HGTH 2EI8A 2Z3CA 5FPYA 5JBAS 1O2NA 1FMGA 3QLPH 4DGJA 2G5VA 1HAPH 3G01A 1VZQH 1F5RA 1GMHF 1Z8GA 4YLQH 4DG4A 1RIWB 3MU1A 3RXMA 3LJJA 2VJ1A 5C5NA 1BBRK 3TJVA 1IQEA 3FN8A 1NBMD 1OWHA 1XMNB 3S9AA 2F9VA 3NKKA 1GCTC 4ZH8A 1NFUA 3FP7E 3S69A 3URDA 3SQEE 1S81A 4OGXA 4WH6A 1UHBA 1PPHE 2ZDKA 2A4RA 4RT1A 2O8LA 2HVYB 1O2IA 3AASA 3KL6A 5GJ4B 4BANB 1C5SA 1L4ZA 1DWDH 4K1SA 4A6LA 3H09A 1W12U 3PO1C 3BTKE 1EP6A 1HXEH 2FX4A 3V0XA 1SSXA 5C1XA 1ORFA 2PHBA 1NRNH 5I25A 2DE8A 3AW0A 4OS7A 2HOBA 1VITH 2GKVE 4A7IB 4PROA 1C9PA 3ZZ8A 8GCHG 2XNIA 2O9QA 1FQ3A 1HPGA 3F2HA 1F5KU 2ZFPH 5AFYH 1Z1IA 3PB1E 3PV5A 3OSYA 4GHTA 1T7CA 4I8KA 2ZQ2A 2H1UA 3OTJE 3VGCB 3LH1A 2P94A 2BDHA 1L0ZA 3SJIA 2Z3DA 3ZV9A 4AX9H 1ZHPA 1SQTA 5KECA 2ODYB 2UUJB 3P8NA 1C2KA 1ELEE 4DURA 3GCTF 1V3XA 4ZKSU 2BY5X 5G4BA 3VB6A 1Z1JA 3P17H 2FO9A 1MU6B 1C1TA 3ODDA 1IHTH 4ZAEA 4NWLA 3M35A 2BHGA 4XSKU 1GHXH 3E1XB 3SI4H 1K2I1 4O97A 1GBAA 2XBWA 5ETXA 5SGAE 3P6ZB 1AFQC 3ATMA 3ZZ9A 2WPIS 2QXHA 1HAOH 3K9XB 2PWXA 2ANMH 2HPPH 4E05H 1ABJH 4Y79A 3OYPA 2AEIH 1W0JD 1GI6A 3V7TA 2HALA 3GICB 1N6YA 4JYTA 1KSNA 2OQ5A 2UWOA 1MKXH 4QT8C 1HCGA 1DFPA 1LHFH 4NIVA 4K8YA 3RXDA 4NZQA 1J14A 1TGSZ 2B0FA 3U98H 2D2DA 1RRKA 2PTCE 2J4IA 4FXGH 4E7NA 5FBIA 2XTTB 1HGTH 1ESBA 1RD3B 2SGFE 2FS8A 5DP5A 2ODQA 4ACBA 2QCYA 3CENA 2KX4A 4Y7AA 3UWJH 2D8WA 4Q80A 3SJOA 3H7TA 3RMOH 3UNSA 4ABJA 2JETC 1EQ9A 1LPZB 1SHYA 1LVMA 1MD7A 2FP7B 2JIZD 4FU9A 4NSVA 4X2XA 1TBZH 4XDEA 2QXIA 4RI0A 4KP0A 2XYAA 2ZDNA 4UFDH 1FPHH 4I32A 3RXPA 4NFEA 1K9OE 3TJUA 1A46H 3Q3KA 4XBCA 1AFQB 4WWYA 3T28A 2OLGA 3N99A 1C5UA 3PV4A 4ZKOU 2HNTE 1EJAA 2C3SA 2ZHQH 3LGUA 1D9IA 4NA9H 1ZSKA 4ZXYH 1O3PB 5F8TA 1ZHRA 1JXPA 2GX4A 1GI7B 1AB9B 1O2PA 3SV8A 1AN1E 1THSH 3KN2A 1UO6A 1QTFA 5T1VA 1AKSB 3B23B 2AIQA 7KMEH 1WXRA 5DP7A 1BOQA 2BD7A 1G30B 2W7SA 4CR5A 1XXDA 2XOKD 4K5ZA 4I31A 2PUXB 1LPGB 5FBEA 3DFLA 1BTWA 4Q4LA 1WCZA 1Y3YA 2FOHA 3BG8A 1GGDB 1TRMA 2ZDVH 5DN6D 3D49H 4OS2A 5AFZH 3MU5A 3QGNB 1GI0A 1JRTA 1GHAG 3Q76A 1NRPH 2Z7FE 1GMDF 1DXPA 1TMTH 4AB8A 1TBQH 1A5HA 1N8OC 3UIRA 2C4FH 2V6NA 3MU4A 3TH3H 1DT2A 1CU1A 1ABIH 3A8AA 1VCWA 1TGCA 2IN2A 3TH2H 2KFWA 2ZC9H 1ELTA 3LKWA 1QBNA 1WQSA 4XFQA 4FUIA 1GI4A 4JCNA 1TPAE 3TNTA 1ZPZA 1E79D 3RXOA 3GDSA 1LQEA 2VIPA 1DY8A 1K1OA 2FX6A 1GCTB 5A0BA 4YLUA 1A0LA 3MMGA 2BDYA 4JZIA 1TB6H 2J38A 1HLTH 3E3TA 1UHBB 2A2QH 3OEHD 4IS5A 4U01A 1BTXA 1ELCA 1AWFH 3ZVCA 1YPLH 3WWBA 5K7RA 2ZTYA 1C5NH 1WTGH 1KXDA 1O2LA 1HAHH 1ANBA 3GCOA 2HLDD 3RMMH 1C4V2 1ARBA 1GL0E 3LDXH 4FUGA 2NU2E 1IQJA 1S0QA 2G8TA 2AFQB 2C90B 3SNEA 3FP8E 1YCPK 1P03A 1O35A 1NTPA 1O5CB 1GBMA 4ZHAA 2PSXA 3LGWA 1DX5M 4X0WU 2J5UA 2CN0H 1T4UH 2XBXA 2ANWA 4RKOB 1EAIA 1SGFA 4THNH 3ZV8A 1Z7KA 1NBME 4HTCH 3EDXB 1MZAA 2VWMA 3RXCA 1Q2WA 3ELAH 1EX3A 1WU1A 1UJ1A 1EJNA 2GJGA 5CHAB 2UWPA 4TSFD 1P2QA 6CHAC 1DUAA 1DOJA 3VB7A 5AF9H 1AVGH 4H4FA 2ZHFH 3RXTA 8ESTE 2GV7A 1S0RA 3QWCH 1H9LB 1TX6A 2ZCKP 1PYTD 1SGDE 2PLXA 3GDVA 4JK5A 3ZIAD 3PWCA 3MH4A 1VJ9U 3A86A 2ZGXH 2K8IA 3PRDA 3LU9B 1Z6JH 1P12E 2BD4A 3LIWA 1FY8E 1NZQH 2UUYA 2F3CE 1ZYOA 5C67A 4I7YH 1J16A 2BX3A 2O8UA 3GOVB 2NWNA 3F6UH 5FAHA 3W1EA 2L6OA 1G3BA 3SU3A 3ITIA 2G4UA 5C2ZA 4KTCA 3RM2H 1C5MD 1C2DA 3HK6B 2PKAB 1GJCB 4B6EA 4XD7D 1K21H 2FTMA 2H5DA 3EA8A 4YXWD 1O5GH 2STAE 2BOKA 2KM0A 2A0QB 1TGBA 1JIMA 2WV5A 1GBTA 3UOPA 4Q7XA 1G9IE 1LDTT 4UDWH 1V6DA 1VITG 2RA3A 2ZU4A 3RXGA 1BHXF 2PR3A 3MNBA 5JB8S 4WY3A 8KME2 2F9NA 3A7YA 1K0HA 6ESTA 3VXFH 1A4WH 1NROH 2CF9H 1OP2A 3VGCC 3DUXH 1ETTH 1O3OA 2R3YA 3DHKH 3RXAA 3GY7A 1C2JA 3GS9A 1Z6EA 3UQOA 1NPMA 2TGPZ 3SU5A 1JMOH 1WQVH 2FI5E 1BT7A 1O3MA 4B6FA 1V2ST 1RJXB 2VH6A 2V35A 3OY6U 4U30A 2XC5A 1QHRB 4UE7H 4A92A 3TGJE 4BTIB 1A61H 1OHHD 2HNTC 3M61U 1BHXB 3QK1A 1BRUP 3BTEE 2QAAA 5ESBA 1TRNA 1TA2A 4GCHG 1FY5A 1DSTA 3LONA 4A1VA 2F91A 1Z71A 1ZLRA 5H4IB 4GUXA 2V3OH 1C1MA 1GBHA 2HVXA 1S84A 1O2ZA 4LZ1H 1BMMH 1TPSA 3P8GA 1K1PA 5E2PA 5EU8A 2F9PA 1CT4E 1HIAB 1QJ6B 1ZOMA 3SV6A 1EKBB 1LKBA 1C5RA 2A5KA 1SGNE 5HYOA 1AY6H 1MABB 1ZTKA 1ZHMA 1FNIA 1GVZA 1VITF 4X8SH 1P57B 1ZR0A 3GY4A 1AE8H 2NU0E 3OEED 2PTNA 2OINA 1F7ZA 1OWJA 1NO9H 1ZPCA 4GSOA 5E8EH 3A82A 2A45B 2PKAA 2SGDE 1GJ6A 1GJ9B 1O2RA 1MCTA 2AGEX 1BDAA 3FFGA 3UUZA 4ZUHA 1LTOA 2ZHDA 1TLDA 1N6XA 3FZDA 3W95A 1H9HE 3R0FA 1GMCF 5F6MA 1WSSH 2YNBA 2A4QA 2Z3EA 2ZCHP 1Z8RA 2EI6A 1BUIA 1Y3VA 2YNAA 2JH0D 3ZVDA 1ZZZA 1NN6A 4P02A 2H9HA 1X7AC 2GZ8A 3SNAA 2QC2A 1HV7A 2CGAA 5L2ZH 3KQEA 3TK9A 1EUFA 1YPJH 1KXFA 3FZZA 1DLKB 1SOTA 1TQ7B 1V2MT 2A7CA 5EQQA 2G52A 1GI9B 1AGJA 7GCHG 3RXLA 1HUTH 2KAIA 2UWLA 1A5IA 1DWCH 3I29A 3A80A 5FPTA 5GWZA 2VVCA 3UNQA 3DCLA 3BTDE 3NCLA 3GCTG 1SL3A 4FOUC 2ZECA 1CGJE 3TK5A 1DXWA 5IK2D 1C5TA 3HATH 5CDFE 5CHAC 2RDLA 1W10U 4NCYA 2PGBB 3F9FA 1H1BA 3VFEA 3RU4D 1TRYA 1O3HA 4IN1A 2JKHA 1O37A 1AUJA 1IQIA 1HFDA 2WUCA 4Y8ZA 1CHOF 4X2VA 5L2YH 3L6PA 4ABIA 1YGCH 1O3IA 2R0KA 3TITA 4H42U 1ELBA 2A4OA 3MNXA 1HAGE 3TIUA 3TK6A 1CE5A 1Y5AT 1O2KA 3RUOA 1HIAA 4BXWA 3MU8A 3GY3A 3CS7A 4MG3A 4UFGH 1GJAB 1J17T 2ZDAH 2ZI2H 1O5DH
chains in the Genus database with same CATH topology
1UVPA 1P04A 2BTCE 2VU8E 4B2CA 1YBWA 1WTHD 2BB4A 3BTQE 1W0YH 1C5VA 1C9TA 1NY22 5C20A 2VWOA 4DW2U 2FDAA 3TPIZ 1E35B 1XX9A 1O5BB 3ZYDA 1OWDA 4AG1A 4ABBA 1GJDB 3RLWH 3BEIB 2C8XB 2ZFTA 1VJAU 2C93B 2ZTZA 2AS9A 1DICA 2QXJA 2VIQA 1C4U2 3KF2A 5FCRA 1PPFE 3U69H 1GBIA 3HGPA 1FV9A 2ZDMA 2BQWB 3Q3YA 1AO5A 4X1SU 1LHCH 4CRCA 3TH4H 1P06A 4GCHF 1SGQE 3A7VA 1GBDA 1XUGA 1BRCE 4TYDA 4O3UA 5GPIB 3MOCA 1SLUB 4YESB 2GCTB 2TPIZ 1AVXA 5EPYA 5C5OA 1B7XB 1ELDE 1SPJA 4DJZB 1NESE 2ESTE 2P95A 4MTBA 3RM0H 1MTNB 4CRBA 4CHAB 4YT6H 1CGHA 1SGPE 1TNGA 4ISOA 5F03A 1W7GH 2WUBA 3GCNA 1IQFA 1TGTA 1ZMJA 3ZVEA 3D62A 1L4DA 3NPSA 1ANCA 5JBCS 5LPEA 1UTQA 4NGAH 1TNLA 1H9IE 3BG4B 1C5YB 1SLVB 1DM4B 2B8OH 1IQMA 1C5XB 3SU6A 1S83A 2R2MB 2BDAA 3MYWA 5HM9A 1EZUC 2JETB 4DOQA 3LGTA 3RLYH 1ELFA 3BTHE 1OOKB 3M3SA 4JZDH 4Y8YA 2WPKS 1G2MA 2QF0A 3GCHC 3P8OA 2Y5FA 3E91A 1HYLA 1TE0A 2BLOA 1E0FD 2OTVA 1LQDB 3MHWU 1PQ5A 1QQUA 4R8TB 1P09A 1O0DH 2ZPRA 2Q6GA 5L6NH 4D7GA 1MMJN 1C2HA 1KDQB 2EI7A 3SZNA 1GJ4H 1O2SA 4FVDA 1V2TT 1EASA 2ANYA 5GIBA 1KTSB 3GDUA 1GI3A 2OUAA 1W3CA 2VIDA 3TJOA 1PPZA 2B9LA 4X1PU 1YPGH 1DITH 1SGTA 1ETRH 2A4GA 1UTPA 3SGBE 1FZZA 4CREA 5DO4H 5HM2A 3ZVGA 1SGYE 4X8VH 1XUHA 2J9NA 1O3LA 2QF3A 1P3CA 1CT2E 1DPOA 3PMHB 1LHGH 2BVRH 2VIOA 1B5GH 4FUDA 1P10A 3E8LA 3Q3XA 2OBOA 1MKWK 4NA7A 1MBMA 3SV7A 3HGNA 1GMHG 1GPZA 1S6FA 3BSQA 3QTOH 4FUFA 5A8ZA 2TBSA 4B73A 1EZSC 3A84A 4BAQB 3RXBA 4KELA 4Q7ZA 1EB1H 1P02A 1BRBE 3STIA 1J9CH 4K1EA 3SUGA 2TGDA 2PKSC 1OS8A 1DWEH 1XKBC 3MO6A 1MBQA 4FU7A 4MPVA 4MQAA 1LMWB 1QGFA 2AERH 2ZFFH 4ABDA 5TJXA 3MH7A 1HAZB 1C1SA 1OP8A 1C2IA 5E0JA 2C8ZB 6GCHF 2A5IA 3URCA 4NWKA 5B6OA 3KNXA 3E16B 3DA9B 2WPMS 2VH0A 4IN2A 2AMDA 1SGCA 2CJIA 2TRMA 1D6RA 3SOSA 3O8CA 1MTWA 3TGIE 2C8WB 3UOUA 2ZZUH 1C2LA 2WYJA 1C2GA 1RGQA 1S5SA 1HBTH 2G4TA 3MI4A 4LXBH 3ZZ3A 1DS2E 4MNWA 1ZSLA 3GY5A 1Q3XA 1UK4A 4YZUA 1PPCE 2GZ7A 4LZ4B 3R3GB 1WUNH 1OWIA 3SV2H 2XXLA 1ZGIA 4GPGA 4FUJA 1KDQA 2H2ZA 1OP0A 1F0TA 2RCEA 2XCNA 1OSSA 2G81E 1ZRBA 2Z94A 3P95A 1GHBF 3RXUA 1EB2A 1HJAC 2VWNA 1YPEH 3F9GA 3SNDA 3ZZBA 3HKIB 1GHAF 1YM0A 2BLVA 4ZHMU 1T8MA 2B5TB 2R9PA 1QY6A 1UVTH 1TNHA 1GBLA 2GDDA 5EW2H 4Q7YA 4DIHH 1C1UH 5CE1A 1GBBA 4D7FA 1OKXA 3K6YA 1NC6A 1QA0A 3BTME 1KY9A 1SBWA 1H8IH 2WV4A 3VXEH 1C4Y2 1KTTB 2FPZA 1W7XH 3D23A 4NSYA 5A0AE 4BNRA 4AYYB 1VCPA 3F9EA 1L2EA 5CMXH 1BJUA 3A88A 1YF4A 1V2WT 4Y11E 2BY7X 2FODA 1LO6A 1Z8JB 1Y5UT 3M36A 1W14U 2AGIX 2ZNKH 3PLBA 2SGAA 1O33A 4U2WA 1JWTA 1ZSJA 1FPCH 2HPQH 4IGDA 4U32A 4WH8A 1D3PB 3BEFB 3LH3A 3SJKA 1AWHB 2OD3B 2BZ6H 1K1LA 4CRGA 5T6FA 4CHAC 1FDPA 4GHQA 1QJ7B 2AGGX 2ODPA 4INKA 1Y3UA 1EPTC 1GHVH 4JMYA 5A0CA 4I8JA 1C2FA 3RMLH 1ZMLA 3DD2H 2HNTF 1D3QB 1Y8TA 4ISHH 1QR3E 3A83A 3EE0B 3T5FH 1P01A 2XWAA 1TONA 3ZZ4A 5ABWA 3C27B 5IDKA 1O5AB 2ZFRH 4D8NA 1TX8A 1EP5A 1EOJA 2Q1JA 4INHA 1UTLM 3ZVFA 5EW1H 3SGAE 3NXPA 4X1RU 4WMEA 4GAWA 2WPJS 4XBDA 5JB9S 2D26C 3QGJA 5TCCA 1S6HA 4UFEH 1GBCA 1RTFB 1AIXH 1XXFA 3KQBA 3IWMA 2BVXH 1CO7E 4Y71A 4IBLH 2WYGA 4ZMAH 1AVWA 5E0HA 3U8OH 3Q00A 3S9BA 1MKXK 3T26A 3S7HB 1O3FA 1NM6A 1UVUH 1E34B 3B9FH 3QN7A 1XKAC 1V2KT 2F9UA 2AIPA 2ZEBA 2J92A 2ZGJA 1FY4A 1IQHA 1W2KH 3QTVH 4K69A 3K6ZA 1H8DH 2NU3E 2P3FH 1VR1H 1ESTA 4UONA 3NWUA 4Y10E 4CBOA 1OYTH 2FM2A 1C5QA 4UFFH 1WV7H 1CA0C 5L30H 5T3HA 1EJMA 3MTYA 2HLCA 4WXIA 1V2VT 1TPOA 1KXAA 2G55A 1EZXC 1BB0B 1ARCA 4ZXXH 1MTNC 3K2UA 1T4VH 2C8YB 1S82A 2BY6X 2FI4E 2D1JA 1O2YA 1TA6A 1QIXB 2M5TA 3QO6A 3IG6B 3BIUH 4AFQA 1NS3A 2OCVB 1O3DA 4ISLA 1P8VC 2XC0A 3O8DA 3F68H 4B76A 5EG4A 2FOBA 2GVFA 2H9EH 3E90B 1C5WB 4AYVB 1LPKB 1OX1A 1ESAA 1O5FH 3GYLB 3M7QA 1GJ5H 1TOCB 4Y0YE 5GCHF 5C1YA 4BOHA 3SI3H 2FI3E 4O3TA 4AN7A 2WINI 4I8LA 1CA0B 3U1IB 1QRWA 3GY6A 1CHGA 4ZKNU 1OYQA 3AVZA 2VVUA 1ZTLA 3LGYA 3M5LA 1D4PB 1UK2A 2A7JA 2ZG0H 4Z6AH 1L1JA 5FX5A 4VGCB 1TNJA 1HJAB 3BN9A 2GCHF 5BRRE 4E06H 3LC3A 1GHZA 2ZHEH 5E0GA 1HAVA 1K1IA 1QL9A 1WOFA 5DJ7A 4X6OA 1QBVH 1ZMNA 1EAUA 2BDGA 4KTSA 1XUJA 3O8RA 1T32A 2FZZA 1LHEH 3A7TA 1J8AA 3E0NB 2VNTA 4BTUB 5LH8A 4M7GA 2PSYA 1CVWH 2CHAB 1BMAA 3MO9A 1QRZA 1KIGH 1BTHH 1K1MA 2EC9H 1EATA 3UFAA 1QJ1B 1D3TB 3P92A 3MU0A 2ANKH 5J4QA 3P8FA 1MUEB 5JPMH 1QA7A 2ZU2A 5IYTA 2BLWA 1P05A 1NFYA 3SORA 2PKSB 4BAMB 2Z6BD 2F9OA 1PFXC 3N7OA 3T25A 1FXYA 1PYTC 1SGFG 1P3EA 1K1NA 1P2MA 3L3TA 9ESTA 3VB5A 1PPEE 4ABAA 1EOLA 1GI8B 5JBBS 1F0RA 1DY9A 1O5EH 5DKMA 2BYAX 5EPNA 4YO9A 1O38A 8GCHF 1ELAA 1DWBH 1TABE 1D3DB 2PGQB 1VCQA 2Z9JA 2JH5D 4X2YA 2Y81A 3TLOA 4Y0ZE 1SOZA 1XUKA 2I6SA 1MTSA 3A8CA 3T27A 1AFEH 1KXCA 1HAXB 2VGCB 3OU0A 2QIQA 3F9HA 2VIVA 2ZIQH 3RC4A 5A2MH 3QZRA 1BZXE 3BTGE 2BDBA 1FLEE 2G5NA 1BTZA 2QV1A 2QXGA 4B71A 2ZA5A 1MTVA 1AKSA 1TX7A 2BQ7B 2GCTC 1ZTJA 2SGEE 1LKAA 4YOIA 1ACBE 3Q77A 1PQ7A 2A7HA 1HJ8A 3RXIA 1BQYA 2ZGBH 3E0PB 3T62A 1QB1A 2BLQA 1BTPA 4AOQA 1TQ0B 3KIDU 1OWEA 3UQVA 3D65E 1CSOE 1O39A 1G32B 1RXPA 3BG4C 3BTFE 1HB0B 2ILNA 1PPBH 1XVMA 3EA7A 1GJ7B 1V2LT 1SC8U 1SMFE 2XBYA 1BITA 1D6WA 3KQDA 1UTOA 2BD5A 1ZRKA 3FVFB 1EZQA 2RA0A 1A3BH 4XE4A 3A81A 2Y6TA 3GCHB 1W11U 7LPRA 3HPTB 4FU8A 3RXVA 1V2RT 2A32A 1O3AA 2DE9A 4CRDA 2SFAA 1QL8A 3A89A 1UVSH 1C1WH 2JH6D 1G36A 4SGBE 1HAYB 1W8BH 2YOLA 2ZPQA 4CRFA 3RXQA 1O3BA 2BY9X 3RC6A 1A1RA 4B1TA 1BJVA 1MAXA 2F83A 4I8GA 1RS0A 2P59A 3ZVAA 2BD2A 1F5LA 4XOJA 4DT7B 3AAVA 4JK6A 3ZZAA 1V2OT 1GHBG 1GHWH 1MTUA 1INCA 3M3VA 2G00A 1MZDA 2RG3A 4Y6DA 1O3NA 3MFJA 4DIIH 2P16A 3A85A 3EQ0H 1C2EA 1YPMH 1NRSH 2ZCLP 1M9UA 4OS5A 1MCVA 1UVOA 4TWWA 5E2OA 5K0HA 3BF6H 3BTTE 3M7TA 1GG6B 1C5PA 2GV6A 5AVDA 2O8MA 1C1VH 2GT8A 4JZFH 3STJA 3T29A 2FOFA 1MH0A 4WXVA 4FUCA 1XUFA 4Y76A 3VB4A 3DFJA 4B75A 3K65B 1FY1A 1MQ5A 7ESTE 2AMPA 4HZHA 2B7DH 2BY8X 2FOEA 1GBFA 4OS4A 4AB9A 3KHVA 2FESH 4JZ1A 1QB6A 2BX4A 2HRVA 3GY2A 4ABFA 3S7KB 1MAYA 4TPYA 4BTTB 1TALA 4IC5A 1EPTA 3MNSA 4X6PA 3SN8A 3VB3A 1QBOA 1SB1H 1AI8H 3RDZA 2DUCA 2VVVA 3ZZ7A 1SQOA 2SNVA 1GI5A 4F49A 2FYQA 2Y82A 3SW2B 1HAVB 1Q31A 3RXRA 5EODA 1SGRE 2QN5T 2W3KA 1SI5H 5JYIA 1AQ7A 3GISB 3HK3B 4TWYA 3EA9A 2BOHB 3UR6A 1ELGA 2ZHWH 3KEEA 5EXLA 1GDUA 4ZHLU 1FY3A 1WYKA 1MU8B 3M3TA 1YPKH 1VGCB 3ATKA 2IPHA 1CBWB 4MNYA 5GXPA 1LVBA 1YP9A 1FUJA 1GBJA 2QYIA 1FAXA 2ZP0H 1TYNA 2FYRA 1A3EH 1FJSA 1JBUH 1N1LA 5DG6A 1RTLA 2Z9IA 3RXKA 1V2JT 1GWAA 4MPWA 3SUEA 3PM3A 1P2OA 3W94A 1T8OA 3A8DA 2G51A 2WPLS 5EQRA 2NU4E 2GD4B 4YOJA 1T8NA 3BTWE 1BBRH 1P9SA 2ZWLH 3LJOA 1AU8A 1O30A 5J4SA 2ALPA 2ZU3A 5DP3A 3RXSA 2EA3A 3QX5H 1BCUH 3PLKA 1P11E 4FUEA 3RC5A 1CA8B 5T6GA 4A5TS 4K8BA 2P8OC 5DPAA 2CF8H 1O2WA 1IQNA 1THRH 2VGCC 1YLCA 4BXSA 3U9AH 1XVOA 3SNBA 1CBWC 3RP2A 1FN8A 2Z9KA 2BDIA 5FHTA 3QZQA 3PTNA 2J94A 3IITA 1P9UA 3SU4A 4AFUA 5EGMA 4WVPE 1KLIH 1IQGA 3EAJA 1E36B 1NRRH 3PMJA 3S0NA 1A0HB 1EPTB 1SLXB 4YTAA 4AFZA 1CGIE 1DE7H 1O31A 5EOKA 3ZZ5A 4D76A 1ZJKA 1P0SH 4NG9H 2FIRH 3PMBB 3TU7H 5F8ZA 2AH4X 4FVBA 2TIOA 4ABGA 4ASHA 2OC7A 2XBVA 1BA8B 1FONA 1BTYA 2W5EA 3B8JA 3RMNH 2BM2A 2VWLA 1O3CA 2CHAC 1HJ9A 1O3GA 2XW9A 3V13A 4ABHA 5A09A 1YC0A 1DLEA 1WBGB 2QGRA 5DP6A 1KXEA 4AGKA 2R0LA 1TAWA 4MPUA 1GMCG 1HNEE 4Z0KA 1PPGE 3M5OA 2PUQH 2BXTH 5A8YA 4X2WA 1TMUH 4D9RA 1FI8A 3EGKH 3PYHA 4X8TH 1SGIB 1SFIA 1G3DA 1E37B 2J34A 3PWBA 3A7ZA 2XRCA 2OC0A 2H5CA 1V2PT 1YCPM 5FPSA 4IMZA 4XBBA 3F1SB 4B2BA 1E38B 1T31A 3JZ1B 2BMGB 3WY8A 2Y80A 1Y59T 6GCHG 2V3HH 1V2NT 1SGEE 1TNKA 2A31A 3SJ8A 2Z9LA 3LC5A 5LPRA 1DUEA 3A8BA 1LVOA 1G3CA 3ZZ6A 4MPXA 1ANDA 2GTBA 3MH6A 5FXLA 1YPHE 1TBRH 2A1DB 3TNSA 1KYNA 1UMAH 1QRXA 2FLRH 1MKWH 1ID5H 4GLYA 3SHAH 1O3EA 2ZTXA 2THFB 1BMNH 4ZKRU 1C1PA 4BAOB 3KGPA 2ASUB 2ZU1A 4AG2A 2K1QA 2IOTA 3LT3A 1IQKA 5DP9A 3OY5U 2KAIB 2QA9E 3ESTA 3ZZDA 3MH5A 5LGOA 4AZ2B 4IC6A 1OWKA 4KKDA 2GDEH 3ODFA 5JBTA 1NRQH 1O2GH 3L33A 2FOCA 3LGVA 2VB0A 3ENSB 3LGIA 1GI2A 4Y8XA 1ANEA 1F2SE 3AW1A 4ISIH 4MLFB 1DANH 1EXFA 4WMDA 1GDNA 1P2IA 2FTLE 1GJ8B 3MO3A 1O2JA 4X6NA 4TPIZ 2BVSH 2OC1A 1XM1A 3UY9A 2UUFB 2CMYA 3ZVBA 3V12A 2AMQA 4A1XA 1B0FA 1AZ8A 1QFKH 1H4WA 2J2UA 2OC8A 5FCKA 2ZF0H 2IJOB 2FLBH 1NU7B 2OQUA