3BTSA

Crystal structure of a ternary complex of the transcriptional repressor gal80p (gal80s0 [g301r]) and the acidic activation domain of gal4p (aa 854-874) from saccharomyces cerevisiae with nad
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
422
structure length
384
Chain Sequence
NAAPIRVGFVGLNAAKGWAIKTHYPAILQLSSQFQITALYSPKIETSIATIQRLKLSNATAFPTLESFASSSTIDMIVIAIQVASHYEVVMPLLEFSKNNPNLKYLFVEWALACSLDQAESIYKAAAERGVQTIISLQGRKSPYILRAKELISQGYIGDINSIEIAGNGGWYGYERPVKSPKYIYEIGNGVDLVTTTFGHTIDILQYMTSSYFSRINAMVFNNIPEQELIDERGNRLGQRVPKTVPDHLLFQGTLLNGNVPVSCSFKGGKKNLVIDIHGTKRDLKLEGDAEISNLVLYYSGKEIMEVYHLRNYNAIVGNIHRLYQSISDFHFNTPSQFVMQGFDFEGFPTLMDALILHRLIESVYKSNMMGSTLNVSNISHYSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NADP regulates the yeast GAL induction system.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords Galactose/lactose metabolism regulatory protein GAL80
total genus 128
structure length 384
sequence length 422
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3btsA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3btsA01
2YY7A 1GPDG 3OEWA 4FS3A 3BZUA 1NR7A 4FFLA 4D45A 3KVOA 3ONDA 4CUZA 3HWRA 4LISA 3ITKA 2VHZA 3LC7O 4INAA 1Z7EA 5BQFA 3Q2KA 2VOJA 3E9QA 2BGLA 2ZCUA 3KSUA 5J9GA 3RROA 1B26A 1F8FA 2QZ9A 3TNLA 5TNXA 4Z9FA 2GPTA 3WMWA 4Y98A 4DPMA 2QRJA 1O8CA 3PGXA 3FNGA 4EW6A 5ENVA 3SX2A 3NJ4A 4L8VA 4H16A 3LT0A 5DN9A 2ZCVA 3VZRA 4F46A 3BMOA 1MFZA 4GSLA 1PJLA 4RPGA 5TF4A 4G65A 2CZCA 4MIEA 1HLDA 5BNFA 3TZHA 5JAMA 5L7TA 3VDRA 3DBVO 3WGYA 1DIGA 2AMFA 2B83A 2DTXA 3CXRA 3E8XA 3FNFA 1PR9A 2Q1TA 3JQ9C 2BELA 4CLXA 3KM0A 2D2IA 2DQ4A 3TQHA 5CHEA 1TLTA 3S2FA 3DL2A 3WSVA 4DA9A 3AUAA 1NVTA 1IPEA 1WVGA 5H82A 1OMOA 4WLEA 1TA4A 3ZWNA 3R0IA 1KVTA 3LYLA 4UEOA 2AE2A 5ES3A 1N1GA 3IJPA 3KYCB 2FHSA 3O8QA 1KVSA 4GX5A 4ALIA 4FJ2A 2ZTUA 4RDHA 2EKLA 5G4LA 4BNGA 1MC5A 3VPSA 4E5KA 1DBVO 4E2WA 4CUJA 3C1AA 1KY5A 5JDIA 1JVBA 3ICCA 5FF9A 5BT9A 4AG3A 2OZPA 4MOWA 1EMDA 3AY6A 1U3TA 2D8AA 4CM8A 1KETA 4CV2A 2PZJA 5LCXA 4R5MA 4E32A 1YH3A 2O3RA 3EVTA 1YQXA 3CEAA 4NH4A 4TVOA 3F47A 5F21A 1DFGA 1LRLA 2J5QA 3RJ9A 1PJ4A 4OOEA 3I3OA 1PSDA 4BQPA 4CLRB 2WYWA 1ISMA 4YA6A 4NK4A 1YO6A 5BSHA 1K3TA 4BNMA 2Q2QA 3JYPA 3OA0A 4U6QA 2BF7A 5LDGA 2C0CA 1ENOA 1U28A 3DAFA 4XD2A 3NTOA 4IZIA 4D3FA 1NYTA 2JCVA 2PFGA 3NV9A 2RBEA 4RF5A 3RCBA 1CRWG 4HV4A 1DIBA 2HMUA 2HRZA 5JY6A 5LC1A 2IE0A 4GH5A 1I2ZA 2B36A 2D5AA 2H1SA 2RHCA 1LSSA 2FPGA 4DBZA 2VWPA 2FN7A 1H9BA 5BNTA 1DIAA 3GAFA 3ZHYA 4YAKA 1GV0A 2XOXA 1F12A 5AXDA 1JA9A 3H9QA 3PK0A 1WZIA 1C0IA 1GUZA 1EUDA 5AQ1A 4XR9A 3ZWBA 4CJXA 2BD0A 2FPIA 3GPIA 4LVCA 3GZ4A 1EQ2A 2YV2A 1NFQA 3FNEA 3QE3A 4AL4A 3ZW8A 4PLFA 4YR9A 2NV6A 4HBGA 2EEZA 1WMBA 3GN1A 3MWEB 1BMDA 4LVUA 4JBGA 4TWRA 3BHMA 1QR6A 4U8GA 4EBFA 5KVQA 4J7CA 3GH3A 2GASA 3H9GA 3DZGA 4CLEA 5A06A 2E6UX 5ITVA 3KTDA 3IP3A 3PEFA 4BKQA 3H9UA 4PIVA 2X23A 1XQ1A 2RAFA 5KVCA 3UW3A 2JL1A 5KTKA 4AJPA 2HDHA 1IHXA 4TMFA 3N7UA 5KVSA 4LK3A 1YDWA 1ONPA 4TVBA 2E37A 1GPJA 1PQWA 2GR9A 2GNAA 4W9NA 3RUAA 3ZNNA 3D5QA 2ZATA 3RBZA 1C14A 1IHYA 4UVIA 3OJLA 3F4LA 3TPCA 3DB2A 4DIOA 1MUUA 1A72A 4UEJA 1IB6A 1T4DA 1DIHA 2WEKA 1UZNA 3RJ5A 5KJEA 4K6CA 3CMCO 1YB5A 1ULUA 3W4KA 3P5SA 4PG8A 3OFSA 4FFMA 5DF1A 2EG9A 5DULA 2X0JA 3P2OA 1U4SA 3H5AA 5CFZA 2H5LA 3AM3A 2VWGA 1D4FA 2Y1OA 3GFBA 2I3AA 3LF1A 1U8FO 1DO8A 3STHA 3IIEA 3EAGA 5IXYA 3IUPA 2P68A 3VOSA 3VKUA 2B5WA 2PLAA 4PGFA 1RWBA 3QA9A 1B3RA 3GNTA 2VQ3A 3F6YA 4KTTE 1HETA 3P7MA 4IQ0A 2EW2A 2CDBA 2NNLD 1TT5A 3IJRA 3W8EA 4CMEA 1HKUA 3AOEC 4ZU3A 3EUWA 1IZ0A 4XYMA 2PD3A 1A7AA 4OKNA 2HJSA 5JPIA 3F1LA 5L3ZA 3WQSB 2DPGA 2W2LD 1LDMA 2AQHA 2I66A 5F5NA 5T67A 1SZJG 3QVSA 4KZPA 3ZU3A 1EFLA 2G1UA 5MGBA 3G1UA 3BHJA 3PVZA 2OXIA 2WD8A 3U0BA 1HRDA 4YVFA 1GCUA 3ETDA 2Y66A 3GGPA 3L0DA 3F5QA 3RASA 1YBMA 2CDAA 3G79A 4W7IA 3EDMA 3VVBA 2PGJA 5CDYA 5HM8A 4NI5A 2NTJA 4K26A 3ZN2A 2X0RA 4UREA 1FDSA 2GN9A 2GUGA 4HP8A 3L6OO 2X86A 2UVDA 2Q4EA 1K6JA 4IGFA 2ZQYA 4RF3A 1Y6JA 1LSOA 4E0BA 1X14A 1YKFA 3GK3A 5C7IO 1U3UA 4RVFA 3UGKA 3H7AA 1VE9A 3L07A 3M1LA 4LN1A 4W7HA 1ENZA 2W90A 2VUTA 1O94A 4YAEA 4PLWA 4MKRA 1QV7A 3S2IA 1NAIA 2X5KO 3M1AA 3WS7A 3GNQA 3TL3A 3WQQA 3KSDO 4LRTB 1V3UA 1AHIA 4LGVA 3P2YA 1M67A 3CKYA 2C7VA 2CSUA 2YDYA 3BYZA 3WWZA 1ARZA 4CQMA 4I9UA 1W6UA 1Y8RA 3HJAA 3A1NA 5THKA 1O5IA 1ONNA 5JDCC 2QIOA 3RI3A 5I7FA 3BTUA 2R00C 1GDHA 3CINA 4CMIA 4EGFA 2WM3A 1SAYA 3RBXA 3RFXA 3U62A 4BGEA 4BNNA 3PFWO 4CR6A 4K28A 1HXHA 1B14A 3QLJA 1G0NA 3Q0EA 3R6DA 2G17A 1O0SA 2DBZA 2JFGA 3B1JA 1MG5A 3ANLA 1FF9A 1PGOA 2VTEA 4RL6A 5EERA 4RORA 2V6MA 3WB9A 1DDOA 5K6AC 2Q22A 3JV7A 1PGPA 3WGHA 3U4DA 1J5PA 3MZ0A 5IDWA 3RUHA 3WLFA 1PQUA 3NGXA 4EUFA 1WNTA 3H4VA 3HADA 1ADCA 1NFRA 2VCYA 5A9SA 3GG2A 3D4OA 3NDRA 3VC7A 3PFFA 1LX6A 3VZQA 3I9JA 3MWDB 4CMGA 1HDZA 3UFXA 4BNJA 4WCFC 3M2TA 3GDGA 4AJEA 4HFRA 4F6LA 3LK7A 5A04A 3DBHB 4PVDA 5IN5A 2D59A 1B7GO 5ER9A 3TOXA 1IY8A 3W6ZA 2SCUA 5T64A 4MVJD 2OP1A 3O4RA 1CETA 5M6DA 1XG5A 5FI5A 3I4CA 3HDQA 1KC3A 4R16A 5EQFA 5ICSA 3RFVA 2Y05A 1AHHA 2PGDA 2X4GA 4CLHA 1XWFA 4RVGA 3LZ6A 4I08A 3TRIA 2C5EA 3ZWMA 4DBVO 5JE8A 1LQTA 4B4WA 3FRJA 1DAPA 2HK7A 2R00A 1LXCA 1H93A 1H9AA 3IAHA 4I9NA 2WE7A 1M76A 1HDOA 1SEPA 2E4AA 5CEEA 3SBOA 3UICA 4R41A 2R6JA 4JJFA 4WCDA 4MIOA 2B37A 3DZIA 4IIUA 1X1EA 1PZGA 3ZGYA 2DC1A 2HSDA 3DBRA 5B12A 3I83A 4F3YA 3QIVA 4B3JA 5AXBA 1Z6ZA 4XQEA 4IDGA 1HZZA 4RQUA 4TZKA 2ZTMA 1ZJYA 4ND4A 4PLYA 3WMXA 5KWEA 3KUXA 3TFQA 1V8BA 1QRRA 4BMSA 2IXBA 5CDTA 2DU8A 3JYOA 4DRYA 4Q39A 1Y7TA 1W8DA 4M86A 4RV9A 2Q50A 2JKVA 2GLXA 3OJOA 1PS9A 2ZB4A 1ZK3A 3LC1O 4R3NA 1B16A 1I3NA 3ST7A 2B4QA 5CDSA 3D7LA 1C1XA 1JKIA 2X6TA 3ZNPA 1UUFA 5DZSA 1Y9EA 4BV9A 4EYEA 3D1LA 2YZ7A 1GR0A 1H6BA 4Z0HO 3NUGA 3KBOA 4IS2A 5FI3A 2XXJA 3ZCXA 3JD0A 4MVJE 1R37A 5I9NA 4YJDA 3DEYX 4GAEA 3GVPA 1E1NA 5BSGA 5ICMA 3H2ZA 5F1OA 1Z74A 4WASA 4YT5A 5G0WA 4HWKA 4Y6SA 3DXFA 4E5PA 4IUYA 1KVUA 3JD3A 3OSUA 3CUKA 4QFDA 1R0SA 3A4VA 3IUSA 4GPD1 5B4TA 3RU7A 1PJBA 5L4SA 1NXQA 3KEOA 1NHWA 4JBHA 1BWSA 3AOGA 1PS8A 4CPDA 2NUAA 4KOAA 4ALJA 4FOOA 3PP8A 4OAQA 3LF2A 3ETEA 5I9LA 1PS0A 1R66A 3ASVA 1BXGA 5GMOA 1LC0A 1B2LA 2X58A 3I6IA 2W2KB 4QFCA 3K8ZA 4DIBA 4RLHA 5J23A 3KOUA 4JBIA 3U49A 1MXHA 4FC6A 1C1DA 2P9EA 4CMCA 1E1LA 3KV3O 2DAPA 4HADA 1YQDA 2ZIZA 4QEDA 2CMDA 4HXYA 4WLVA 3ROQA 1NX6A 5JLAA 4FBGA 2W98A 1YONA 5CDGA 1JWBB 4YXFA 4GBJA 1TT7A 3MJVA 2HCTA 4AJKA 5ADHA 3EZYA 4IXTA 5G0SA 5DBGA 4R51A 3H3JA 4XB2A 2GO1A 3TZKA 3PZRA 3GGOA 1T2DA 4ILKA 1YXMA 3JQAA 1A4IA 1EFKA 1EUCA 2EWMA 1HWYA 4DYDA 4RVSA 3DOJA 3IMFA 4JNKA 1V35A 2AQIA 4J1TA 3AFMA 1UR5A 2X1HA 1D1SA 1Q0LA 5KJ6A 1CWUA 5IJZA 5L53A 1PWXA 1AXEA 2NTNA 1E7SA 3G3EA 3GMDA 1ADGA 4DGSA 2PD4A 4N5NA 2C07A 2W2KA 3GGGA 4OMUA 3BMNA 2HK8A 3FR8A 2IDZA 3I1JA 2Y1CA 1VLLA 2VHWA 4BO0A 1TVEA 4O59O 3MJTA 3MJCA 4XA8A 4CQLB 4E5YA 1GYQA 2UYYA 4Y6PA 2Y93A 4BV8A 4A03A 3ZDFA 1QYXA 3D3WB 1Y8RB 4YAJA 5U4QA 5A02A 3AOEA 5L51A 5JW6A 1NFFA 1X0XA 1IULA 4EDFA 2Y99A 1JDJA 4XWYA 1T2AA 4NK5A 4IJKA 4I9HA 1GU7A 2DUUA 2EP5A 4RVUA 4UULA 3V1UA 2C82A 4PZDA 6ADHA 3Q1LA 4GMGA 1RM0A 4UVGA 1EK6A 3QY9A 3WDSA 4U5QA 9LDTA 4AICA 4BO8A 6LDHA 1H2BA 1PWZA 2I9PA 2ZYGA 3ROPA 3E5MA 5EIOA 1I24A 1ZO8A 2VWHA 2CVOA 4NFSA 1ZFNA 1PZHA 2G0TA 4BNUA 3FSRA 5KJCA 3PQEA 4N5MA 5CPBA 4PN3A 5JFOA 3NT5A 3B70A 2X8LA 4PG6A 1DC4A 1SMKA 3GA0A 1CDOA 3QSGA 3ON5A 4A26A 1JU9A 5KIAA 4YWJA 2ZTVA 5DBIA 2AQKA 4RDIA 4Y9DA 3ZV6A 4A10A 4A73A 1KVQA 2NQ8A 1JN0A 1I5RA 1HSZA 8LDHA 3D0OA 2VHXA 1GL3A 3HDYA 4P4LA 2BFAA 3FPCA 4MPDA 4DPLA 3WQRA 3DHEA 4WOKA 5L4NA 2DM6A 5A9RA 3KYBA 3PTZA 4Z0TA 3KYDB 1E1MA 3ZNQA 3RC1A 4G2NA 1MC4A 5L95A 3UOGA 1P9LA 1ZEJA 1Z82A 1UDBA 2EF1A 5G0TA 3U4HA 2V6BA 2PZLA 5IN4A 4Q3CA 1T4BA 4TRMA 1YBVA 3ANMA 4Z0PA 4YT8A 5A9TA 2AA3A 4PRKA 4D46A 3UF0A 4RVDA 3H3FA 4A2CA 1Q7BA 2P91A 1NBOA 4DWVA 2EW8A 3DOCA 4DLLA 2I6TA 1MLDA 3PXXA 3JQFC 4PZCA 5COQA 1DOHA 3RIHA 1M66A 3IOYA 3ZU5A 4J2OA 2VWQA 4FFOA 3UHAA 3WGZA 4YT2A 3AW9A 1XR3A 1ULSA 4PLVA 1E3LA 3HNPA 4FSHA 3BTOA 9LDBA 4MKXA 4P4GA 4YRAA 3PHHA 4DYVA 4P8RA 2DBRA 5CAEA 4RO0A 3E1KA 1PL7A 3SJ7A 3HE3A 3W8FA 1U7HA 3M6IA 1Z7BA 1Q1NA 4O6VA 3JD2A 1MV8A 3I5MA 4E5MA 1A27A 1MFPA 4LSMA 2V6FA 4UUMA 5EQDA 1WMAA 4EZBA 2FPPA 1EEHA 4XRGA 3C7CB 2EJWA 4QTZA 4NR0A 3PJFA 2NU9A 4J49A 1CQIA 3DHNA 4YBZA 1MB4A 4BO1A 1KERA 1UZMA 2PZKA 1VL0A 4UAGA 5HRUA 3ZW9A 4KUHA 4CM8B 4PLGA 3U9LA 5GY7A 3GHYA 3EY4A 4Z9YA 4EUEA 3P19A 4FFNA 1RYDA 4RPLA 4ZQHA 5A05A 4WJZA 5EN4A 3LLSA 3TF5A 1I2CA 3GRKA 3ORFA 3DZKA 5IDQA 5L40A 5THQA 4R4JA 1LC3A 4TROA 4RPHA 4RLSA 1I33A 3NYWA 3QWAA 1Y1PA 5C7LO 4BNFA 3ZHBA 3FNHA 3GRPA 1PL8A 4Q3NA 1E3SA 2GERA 4I5DA 4QECA 4OXYA 4N7RA 3L6EA 2DFDA 2PH5A 5B4VA 4JROA 4QQRA 1IE3A 4J0EA 3O9ZA 1KOLA 3UAGA 3IC5A 4CM9D 4ZN6A 3QVOA 3EC7A 4EJMA 5CG1A 5GZ1A 2NACA 3PHJA 4MVJF 5A4DA 1ZW1A 1VJTA 1QMGA 2YHIA 3ANNA 2NU8A 3BIOA 2Y68A 2Y1EA 1FDWA 3PHLA 3OQ6A 2FR8A 3DAGA 4D79A 2ZYDA 1L1FA 4KWIA 3WFJA 1XEAA 2PWZA 3C7AA 4CODB 2YV3A 2VT2A 4DMMA 3LQFA 3KYDA 2IYOA 4NU6A 1E7QA 2VNSA 1IUKA 2Q49A 3DFZA 2ZB8A 4ZQFA 3QV1A 5IZCC 1LA2A 3K6JA 4D3DA 3GN2A 3JQ8B 1ORRA 1A9YA 3V2GA 1GQQA 4LSWA 4J7XA 2BLLA 1DC3A 3DBLB 3UN1A 1P1FA 2Y1GA 1U5AA 1I01A 4DQUA 2G82A 3JQCA 3ABIA 2EP7A 1FDTA 1JTVA 3V2HA 2D5CA 2HLPA 1E77A 1KBZA 3PGJA 4E5NA 5JYFA 1PZEA 2RH4A 3OEYA 3GG9A 3OF2A 1PTJA 3MOGA 1P31A 4JGBA 4JIGA 2ZYAA 5EL0A 5JAQA 3TOZA 4J3FA 4PFJA 2VYNA 1F17A 1NPYA 1T2EA 2WD7A 3KEQA 4IS3A 5DNAA 3VZSA 4LCEA 4IGEA 5ILOA 1P0CA 1LI4A 2NVUA 4Y6RA 5AYVA 1I3KA 4ALKA 1PL6A 4BNKA 3PDUA 4Y67A 2HMTA 1OC2A 4HKTA 4QX6A 5KVVA 4IBOA 2F00A 5T57A 2DTDA 1LLCA 1UXKA 3CE6A 2ZQZA 4S1VA 2GCGA 2NLOA 2VZ0A 7ADHA 1N8KA 4YJFA 1N7HA 4FB5A 1W4ZA 1G1AA 5C5IA 2VOEA 1PJ3A 3LVFO 1L7DA 1Q7CA 1SCUA 2OP0A 4BQRA 1D1TA 2QQ5A 1T1RA 1S6YA 3W8DA 1I3MA 2NU6A 4PG5A 1EK5A 3HUDA 1R16A 2JD1A 4WPGA 3H9JA 3TJRA 4ID9A 4RJTA 1N92A 2VN8A 4XIJA 4U6SA 1PR3A 1SOVA 1UDCA 1BTOA 5L4LA 1UAGA 3E9NA 1EBFA 1NQOA 1R12A 4B4OA 4BNVA 1E6EA 3PYMA 4J4BA 2CFCA 1X7DA 2DTEA 3UH1A 4HUJA 5DT9A 4BB5A 3AI3A 5KOIA 4F45A 5K6AA 3RKRA 3GVXA 3DMYA 2JAHA 4G5HA 2FZWA 2VUSA 3FTPA 1A71A 1Q2XA 2PR2A 2YHUA 3JD4A 4IMRA 3QVXA 3K96A 2VNAA 5AXCA 3JQFA 4A0SA 4BHTA 1BDBA 4E30A 2IODA 5TIIA 2HK9A 1K89A 3H5RA 4FC7A 4YQYA 5JS6A 1LDYA 3D4PA 3NTQA 3JQ8A 4E2XA 5TQVA 3UKOA 4CR8A 2I5PO 3DMTA 5TC4A 1CJCA 3D3EA 1N2SA 1M75A 2OBYA 3C1OA 3HB5X 1DFHA 1MXFA 3WBFA 2YW9A 1VJ0A 1B0AA 4IDEA 3RWBA 3WJAA 4FQ8A 3QP9A 4W6ZA 2I99A 1E5LA 1T1SA 3WNQA 4CQMB 4B3IA 5T73A 5DOVA 4H7PA 4EJ0A 1KIFA 2HJRA 5TX7A 2X0NA 1HF3A 4BNTA 4CM9A 3GFGA 1H94A 2BKAA 3LT1A 1OBFO 2EGGA 2Q1UA 2P2SA 4OM8A 1QYCA 4CV3A 5IZCA 3OH8A 3I6QA 4UEKA 2JHGA 3MCVA 4GLOA 1Z75A 4FFRA 4R1SA 1BHSA 2YDXA 5I8WA 1EDZA 5IDXA 2P9GA 3WOHA 1EQUA 1YJQA 3C85A 3CSDA 3MJSA 3JTMA 3VTFA 3W6UA 1LLUA 3QWBA 1M2WA 1HDGO 1DLJA 3GZNA 1A9ZA 4XEHA 4FN4A 4NFHA 3AFNA 1DIRA 3JQAB 3DOOA 4JLWA 4NNJA 5F5LA 1IZ9A 2QYSA 4WEQA 3DMTC 1E3WB 3C24A 3FWNA 4KWHA 4BNZA 2J8ZA 2YFHA 1ZUD1 2O48X 3AM4A 4R3WA 4J2HA 4UVEA 4BKOA 2Z1NA 3ENKA 1C0KA 4EI2A 3F3SA 1P1HA 2B5VA 5DOZA 4ZJUA 4JX8A 4X54A 3TZQA 2VYVA 2UAGA 1HYHA 3GC6A 1D8AA 2POQX 3ZH2A 1GEGA 1NAHA 3DC2A 5ILGA 1OFGA 4ALMA 3R3JA 4GSKA 1ZK1A 3V5NA 1KS9A 1GUFA 4WNIA 1NM5A 4JN6B 2JCXA 3OICA 3PJDA 8ADHA 1S7CA 4RZIA 1A4UA 1UXHA 1RKXA 1SPXA 2C5AA 5G0VA 3VKVA 4MJLA 1TB4A 4OIMA 4YJGB 3COSA 3ZHXA 1LBEA 4DLAA 3RC9A 1NQAO 3PWSA 1NWHA 4XGNA 2BH9A 1AN9A 3TZ6A 5C3MA 1C1DB 2AEMA 4RPJA 1E3JA 4BUCA 4IDAA 3ZU4A 5H81A 4XQ9A 4LRSB 4DREA 2XF8A 2IEBA 3WICA 4ALLA 1U1IA 1EE2A 3QW2A 2DUWA 3CZMA 4NBTA 2IZZA 4NQZA 1LDGA 1WAMA 1WW8A 4ZA2A 1V3TA 1H6DA 4K9DA 3A14A 4FDAA 4WKGA 1GQ2A 1YL6A 4OXKA 4XIYA 4CL8A 1I32A 1AGNA 4E2ZA 5DBFA 3NX4A 2V6GA 5KJ1A 1AE1A 2J5KA 4XRRA 1ADFA 2D4AA 2VT3A 2ZB3A 1N5DA 3LLVA 4M8SA 4BNLA 2Y0EA 5COBA 3INGA 2VHVA 2JAPA 4OHUA 3L6DA 5B1YA 2ZJ0A 4J1NA 4ZICA 2O4UX 4NZ9A 4YYZA 2C54A 1E7RA 1PGJA 1SC6A 1B8VA 5IF3A 4FCCA 5JCJD 2A35A 2BFMA 1O89A 1HE3A 1ZCJA 5BR7A 1E3WA 4BGUA 1P33A 2BGMA 1E3IA 1HT0A 3WTCA 4RPKA 1I0ZA 3HFSA 2P4HX 1ZVMA 4ZGWA 4O0LA 1ZXLA 1LEHA 4URFA 3EHEA 4BO5A 4FD3A 1ISIA 3N58A 2IYPA 4G81A 4E3ZA 1NHGA 1BRMA 1ML3A 3DZHA 3FCOA 3LSYA 2O2YA 4BNHA 4D43A 3HSKA 5FWNA 4FJ0A 4XGIA 3VVCA 2EXXA 3MJ4A 5L9AA 4P38A 2Y0DA 1HE4A 3GVHA 1R4NB 4KUGA 4MVJA 4GL4A 1LSJA 3DTYA 1GV1A 4OKIA 1OAAA 1XA0A 4ALNA 3GDOA 4YDRA 1T2FA 4PVCA 1JAYA 3TFOA 4Q9NA 3C1TA 4FGWA 4HNGA 4BKPA 1M6WA 3M2PA 1EVIA 5KNLA 3PQFA 2WDZA 4HFMA 4NPCA 3K2EA 1UZLA 3AUSA 3RUFA 2VZ9A 3NT2A 3E18A 1GQYA 5F1KA 4DL9A 1V9LA 3V1TC 3VH3A 2E49A 3JYQA 4Q3DA 3K31A 3QWFA 3I9KA 4AJ2A 2EKPA 2P5UA 4W99A 4LMRA 1ZEMA 4Y8VA 2YQ4A 1ZNQO 3ONEA 1VI2A 4B7UA 3U5TA 1PX0A 2DT5A 1GFSA 2UDPA 1YWGO 3I9MA 1ZH8A 3NRCA 4N18A 4XYLA 1NQ5A 4I1IA 3VPFA 2O2SA 3BHIA 4P4NA 3PI7A 1JAXA 1YL5A 2PY6A 3N74A 1EDOA 4IDBA 1TXGA 5L7YA 2OORA 1UXIA 3TZCA 1QYDA 3WGIA 3GPDG 4I5EA 1HE5A 1QYVA 4RQTA 3ZNOA 4YEDA 4KQWA 4RZHA 1Y81A 3WYCA 3RUCA 3TWOA 3WR5A 4PLTA 3GT0A 1OI7A 1RM3A 1K2WA 3E03A 4PCVA 4UUPA 1MX3A 3HZZA 1PJSA 1P1KA 1DB3A 1K6XA 4FGSA 4E2YA 1PQPA 1U2GA 4ZVVA 5G4KA 2O3QA 2NADA 2Q45A 3I52A 1QV6A 3ZWAA 1ZSVA 3IKVA 5ITWA 4NHEA 3EZLA 4K6FA 1TEHA 4CM6A 2OGUA 3DHYA 4EITA 2JFFA 4R9RA 3OQ1A 2WD7B 1KY4A 3UCEA 4KTVE 1XKQA 4B4UA 1QKIA 1EVJA 3PLNA 1GD1O 1Z73A 4R01A 3RFTA 4PLCA 2CD9A 5FFFA 1CF2O 1N9GB 3JYNA 3D4NA 4CM7A 3EYWA 1P0FA 3GLQA 4OYRA 4UUNA 2X5JO 5JYEA 3BA1A 1OZAA 3NEPX 5KCZA 1YJ8A 5I9MA 4JCOA 4PRLA 5BNIA 2FY8A 4DTIA 2VYVD 1SEVA 2C29D 1DAOA 3IP1A 4FIZA 4JK3A 1VKOA 5U1PA 3W4JA 1DFIA 3VPGA 5JC1A 4D7AA 4J43A 2DPHA 1K6IA 4ND3A 1DPGA 1ENPA 3ZV5A 3JQ7A 4D44A 4E31A 4B4VA 4W9NC 4NBRA 1ISJA 1RM4A 4OO3A 1LRKA 1SO8A 2OL4A 1UH5A 3PLRA 5JCXA 2DLDA 5IZ4A 4LW8A 4J1QA 1SB9A 1KYQA 3SJUA 5CEFA 4HNHA 1DSSG 3IS3A 1DHTA 4QO7A 4CM4A 3R1IA 5JY1A 4GX2A 3AI2A 2AG5A 3GHHA 4AFNA 2ZTLA 1WXDA 4AJLA 5HWSA 1YGYA 1XSEA 3PJGA 5KKCA 3S2EA 4BS9A 1E0DA 1QLHA 1W0CA 3AM5A 4DVJA 2OOSA 4ONEA 3JQAD 1TT5B 1P45A 3W4IA 2O3JA 1WP4A 3H65A 4JXKA 3ZV4A 5JNLA 5HS6A 5I7EA 3ENNA 5JAIA 4DC1A 3JQEA 3GQVA 2HRBA 3ZWCA 2EJVA 3NGLA 3BMQA 3VZPA 1LNQA 4OGWA 5G4KB 1HDCA 1R4NA 2GN4A 2IRWA 3SXPA 4L75A 5G2OA 1YBAA 2CVQA 4WLOA 2NSDA 3VDQA 1LTHR 4OXNA 2W2LA 3WJ7A 4GQAA 1XU9A 3K5PA 4XKJA 2OBNA 1F0YA 2DVMA 1VC2A 3TL2A 3WLEA 4MINA 2JCYA 3PIDA 3I4FA 4L4XA 4WGGA 3S55A 4XZ3A 2W8ZA 1T25A 4MP6A 2PKRA 1XYGA 2CDCA 3H5NA 3WIDA 3HB4X 1EUZA 1ZXBA 3AUUA 1IYZA 4JP2A 3RU9A 2HMWA 3TDKA 2ZJ1A 4YAIA 3Q9NA 1GUYA 4DLBA 3KZVA 1Q0HA 3AI1A 3LDHA 3KXDA 1HDYA 4P22A 3CMMA 4CMJA 1XGKA 3WSWA 3O03A 3VTZA 5TT0A 3S1LA 4E12A 1I30A 4O63O 3VHRA 4Z3DA 4EUHA 3AUTA 3L9WA 2AHRA 1V6AA 3DWFA 1V3VA 4MDHA 4YPOA 1EE9A 4PZEA 3L4SO 2WYVA 4MVJG 3WG9A 4EEZA 1HLPA 4HFJA 2D3TA 1CEQA 3PHIA 4ND2A 5A5EA 2WWRA 3FTNA 1FMCA 4WNCA 1CERA 3LC2O 1JVSA 3JQGA 4RGBA 4XCVA 4CMIB 2EHDA 2YYYA 1JKFA 1LLQA 2J3JA 3AU9A 2UUPA 2IZ1A 5EESA 2C2YA 3I9OA 1H6AA 4S3MA 5AOVA 4WLFA 3NTRA 2Q2VA 1DC6A 2Y1FA 4HFNA 4ITUA 3VH2A 4AJ4A 4D42A 1SNYA 2EGHA 3NJ8A 4CM3A 1HSOA 1YQGA 1BXGB 5JDCA 5JCJA 3WYBA 2JJYA 1UJMA 1XIVA 4FW8A 1RJWA 2B69A 4I5FA 4BOYA 1J4AA 4YJHA 2C2XA 2ZKLA 3DDNA 3WIEA 4H15A 4II2A 1O6ZA 1Z45A 1YVEI 3TN7A 2GRAA 3JSAA 3CZRA 5K0ZA 1NQTA 2AW5A 4BO4A 3K9QO 2JHFA 1RPNA 4J1SA 1YB1A 4YRBA 1YOVA 2Q1WA 4YQZA 5IXSA 2EIHA 2FRDA 2FMUA 2JFHA 4W82A 4MO2A 1F06A 3O38A 4CMKA 3H2SA 3G0OA 1DEHA 3RC2A 1VL8A 1M6HA 4M54A 4BNYA 3KLMX 4WCFA 3FN4A 3INTA 1DRUA 1Q0QA 3NDJA 5JO0A 4KMSA 3RKUA 4XQGA 4Q3BA 1HL3A 2A94A 3ICPA 4BO2A 4I8XA 4XYGA 4ZQGA 1BG6A 4TKMA 5BSFA 3FF4A 2QG4A 3OHSX 1XU7A 4XQCA 1GY8A 2Z95A 1IL0A 2GD1O 2I67A 4R9SA 1LDEA 3T4EA 4EEXA 4QT0A 2YUTA 1EBUA 3B6ZA 1P77A 5IAAA 1U5CA 4IM7A 4CLOA 1E6WA 1GADO 3ONFA 2O3UA 3F5SA 2VTDA 3D3WA 4NFYA 4RCVA 4NJOA 1MP0A 2OO5A 4E13A 1XHLA 2VUUA 2GN6A 4J4HA 3MTJA 2VRBA 2CF6A 3GDFA 3BMNB 1E5QA 4Z3KA 2AEJA 1T26A 4ND1A 3WGQA 4BGVA 4WECA 4B8ZA 1BGVA 2E48A 2QW8A 2Y1DA 5KKAA 3L77A 1QP8A 1PGQA 5AXAA 1H2HA 4BGIA 5T6BA 2CY0A 5F1PA 1E92A 4R1NA 1A7KA 2VRCA 3FD8A 3MTGA 2ET6A 2DFVA 4AJHA 4MVJM 3QQPA 3HDJA 1BXZA 4CMEC 1UP4A 2PK3A 1I10A 4WLUA 2P4QA 1OC4A 4QO8A 3HDHA 1D7OA 5DCUA 3UCFA 1WDMA 1FXSA 1NP3A 1ZSNA 4DUPA 5DCYA 3HG7A 1YE3A 2OMEA 2H63A 1WZEA 2WSBA 3GEGA 4PLPA 2F1KA 3D5TA 1HYEA 2JD0A 4A5OA 1E3EA 3WNVA 1HE2A 1AXGA 3RAJA 1BVUA 1L7EA 4XDYA 1XQ6A 4XR4A 1YS4A 1VM6A 4L9RA 4MVJI 4ND5A 3Q2IA 2NVWA 2I76A 4B79A 1PIWA 3C7DB 4TRRA 4A7PA 1ZK2A 2I3GA 1PU2A 4B3HA 4XYEA 1JW9B 2PKQP 2P9CA 5JXWA 2ZB7A 3ZU2A 1GYPA 2HO5A 1LSUA 2EERA 5EPOA 4YTEA 4XB1A 3KHUA 3U4CA 1XELA 4NBWA 5H83A 1XDWA 2PTGA 1R0KA 1EZ4A 2PA3A 4AJ1A 1EVYA 2Q2WA 3GOHA 3K2BA 2PZMA 2RIRA 3GAZA 4NMHA 4IZHA 3PZBA 1KC1A 1UDAA 4IJUA 1YB4A 1HEUA 3GF4A 3GMSA 3Q3CA 1U8XX 4E21A 3FBGA 1P44A 4AJOA 3T4XA 3U3XA 3FR7A 2BFPA 4J4TA 4YRDA 4B7CA 3S8MA 4BMVA 1R4MB 4QSMA 4D3SA 1UXJA 4IXWA 4MP8A 3D64A 1BSVA 1HYGA 1U9JA 1VJ1A 1ZSYA 2FSVA 3DZFA 3SLKA 4LCJA 2NWQA 4C4OA 3DBHA 2BGKA 3OP4A 3BMOB 4NBUA 4QXMA 1P1JA 3PDJA 2X22A 3IL2A 3K92A 4GGPA 3PYXA 3OQBA 2QZZA 5ER6A 1ZIDA 3DBLA 1ISFA 5A9SB 4UVDA 4FFPA 3MOIA 1WWKA 1NVGA 3QHAA 4JP3A 3GY0A 4L0QA 5DP1A 2CNBA 1LUAA 2Q1SA 1GZ3A 2J3KA 4HX5A 4K1LA 4KQXA 4JJIA 1VSUA 4NG5A 2GN8A 4ESOA 4Q3AA 5B37A 1LQUA 2O4CA 1G0OA 1I8TA 2NQTA 1RYEA 4KDEA 2BI7A 2O50A 1Y8QA 5TRTA 1P74A 1YDEA 1U2DA 3EW7A 3EK2A 3ZV3A 2OHXA 3O8QB 3OMLA 5CG2A 1O95A 3I9NA 4CR7A 3DZBA 1I36A 3B1KA 1PJQA 3SC6A 2WTBA 1BW9A 1DJNA 2GGSA 1KVRA 2J3HA 4OQYA 5A3VA 4WEOA 2AQ8A 1VL6A 3AWDA 1A5ZA 2Q3EA 3FHLA 4IDCA 4YJGA 2C59A 4GGOA 4OJNA 5I7SA 4B8WA 4H3VA 4KDFA 4FOSA 1GYRA 1NPDA 1ID1A 4DXHA 4J91A 1R15A 4OL9A 3MJEA 1PJTA 4L4RA 3FI9A 3ROMA 1HDXA 3GUCA 4TKLA 2H6EA 3U09A 4F6CA 3E6AA 1ZK4A 4M1QA 1FJHA 1KEVA 3V1YA 4BKRA 3JYLA 4XYBA 3DR3A 2CF5A 4J0FA 4WUVA 1LJ8A 4TQGA 1ZK0A 1JQBA 3OM9A 2GZ1A 2A9FA 4RVHA 3ZHZA 3ZI0A 5GZ3A 4OQZA 2Y0CA 2HKIA 2C7GA 4ZRMA 3AY3A 4HY3A 2X5OA 4U0KA 4E4YA 1YOVB 4IMPA 1P1IA 3GUYA 2AXQA 3IDSA 2BFOA 3GR6A 1QORA 3OJ0A 3R3SA 2Q99A 1TI7A 3SC4A 4WOJA 3VH1A 3ZWWA 4EJ6A 2GZ3A 1ZMOA 4J9VA 4PLZA 3BXXA 1U4OA 4BNWA 3HHPA 5JYDA 3C8MA 4NBVA 1KEPA 3HN2A 3G1TA 4ZD6A 3DBRB 1Y9AA 2QRKA 3ZWPA 3L4BC 4GKBA 3WXBA 3DTTA 4IJWA 4XGKA 2LDXA 4TRJA 1HZJA 5TS3A 4YACA 3ASUA 3WFIA 4PG4A 1MA0A 1NWCA 3VPXA 5EINA 1DRWA 4MVJH 5C37A 1RM5A 5DDIP 3PQDA 3RD5A 4R1TA 3F4BA 2D0IA 4II3A 1VKNA 1VPDA 5HA5A 1NR1A 3X2FA 5A3JA 4AJIA 2IZ0A 2X7HA 3C3XA 2VRCD 5TJ9A 2FSSA 4MVJP 2TMGA 1MG0A 1X7HA 3RUEA 1JWAB 2P5YA 4IDFA 2BMAA 1NPTO 4R1UA 4BNXA 2O23A 4GVLA 3Q11A 4R54A 2LDBA 3KO8A 1U3WA 4GLLA 4M87A 4J6FA 4IJVA 2O7SA 3WBBA 1P1RA 1GCOA 1K0UA 2FR0A 1ISHA 4IIVA 3BAZA 3QWIA 4BO9A 3W1VA 1F8GA 4BMNA 4D0SA 2XPCA 4YB8A 3UXYA 2B4RO 4MKZA 4TZTA 3K73O 4IQ8A 2FOIA 3MEQA 1PGNA 3DFUA 1B8UA 4PLHA 1LRJA 1QG6A 3JQ9A 3KLPX 4BB6A 3JD1A 4XX0A 4CLRA 2X9VA 1O9BA 4WK6A 4GI2A 1C0LA 1DXYA 2NTVA 3KB6A 3ROKA 4CL3A 2ZK7A 4OSOA 1LDBA 3JQ6A 1W73A 1N1EA 3ZWOA 4CQMD 5IDYA 3F46A 2B4TO 1GZ6A 1HTBA 1X7GA 5JO9A 2BHLA 2Q4BA 1BXKA 1UP6A 1EVZA 4DMLA 1X15A 3NKLA 2R2GA 2W4QA 3EGOA 5DP2A 1ZZEA 2Z5LA 1GAEO 5FEUA 3GVIA 1IOLA 2PGLA 5JDIC 1G6KA 5CDUA 3PYLA 1HDRA 3UCXA 2CVZA 2QRLA 5HTOA 1ZJZA 4IDDA 4M89A 1MGOA 1PJCA 2YV1A 3PRJA 4A27A 4MP3A 5BSEA 4UVHA 3RBVA 3DQPA 4R5HA 1GTMA 1QLJA 2X9GA 5TSDA 3WGTA 4PG7A 5A03A 5C7OO 4Z9XA 4IY1A 1N9GA 1ADBA 2Q46A 1P3DA 3HN7A 4Q3EA 1R6DA 1B8PA 3ZWVA 2WMDA 4CMHA 4R69A 1YRLA 3WX0A 3QVWA 5CEJA 4DQVA 3L9XA 2YJZA 2YFQA 2QX7A 4O1MA 4M49A 3DONA 5JYAA 4U0JA 2O7QA 3AK4A 4NDNE 4OOFA 1E1KA 4XJSA 2BI8A 4LMPA 1SBYA 4CLDA 1YL7A 4ZHSA 2DKNA 2HAEA 2IXAA 2VZ8A 3PPIA 5A5FA 3CH6A 2GZ2A 3HFGA 2FZEA 5ENDA 4CMAA 1SB8A 3JQBA 2AG8A 2G76A 1Y5RA 3CPSA 4CLOB 2PNFA 3BMCB 1GEEA 1GZ4A 2RCYA 4WCFB 4NIMA 4J9UE 5G0UA 1U3VA 3ZWXA 3DZJA 5COAA 2H9IA 3ADOA 5TLSA 5I7VA 4MIYA 4N5LA 2JD2A 3H8VA 3BMCA 2HMSA 3OA2A 2Y67A 3KETA 2HMVA 4KUEA 3I9LA 5F3RA 2FR1A 4BVAA 4AJJA 2GYYA 1KEWA 4CV0A 4BNIA 5KJFA 5JMPA 2ILTA 2AE1A 2QYTA 4I5GA 1DHRA 2XXBA 2HU2A 4BO3A 3ITDA 4DC0A 2V65A 3F1KA 3RC7A 2FWMX 4M55A 4OSPA 4QUKA 3RVDA 2V7PA 3LU1A 2VHYA 3VAZA 1X13A 3ADPA 4GX1A 4CV1A 3UUWA 2B35A 2PD6A 4ZQEA 2B0JA 4JQCA 3ULKA 1OOEA 1LDNA 3CTMA 4FJ1A 4AJNA 3E9MA 4NJMB 3TSCA 1NNUA 5JBIA 1I3LA 4GMFA 1UP7A 4GX0A 5A1TA 2TMDA 3G17A 4J16A 5TJHA 3EVNA 4BIIA 1B3BA 4GVXA 5T5QA 4TRNA 3V8BA 1WLYA 4AVYA 2GDZA 5EJ2A 4U7WA 1WDLA 4O5OA 2WJPA 3JQGB 4C7JA 5U9CA 2D1YA 4E6PA 5TGDA 5MDHA 3V2UA 4CUKA 1CIVA 1Y8QB 4D0RA 4CMBA 3OETA 1E7WA 3PJEA 3E48A 1J6UA 3JQ7B 3B1FA 3G49A 2FP4A 1AUPA 4CQLA 5IFLA 2RHRA 3K30A 3OJFA 1H6CA 5JSFA 1C1XB 1ZMTA 2HUNA 5GZ6A 2PKQO 5DCWA 1JKJA 1UAYA 3KSZO 4ZRNA 5T8KC 2NVUB 5LDHA 2QHXA 1PEDA 1ZKMA 1ONOA 4C7KA 5L45A 3BTVA 2E82A 4UUOA 4ZQBA 3OECA 5CPFA 1JLLA 1FK8A 2A92A 2YQ5A 3FPLA 1DLIA 3A06A 3QVTA 1XLTA 1QYWA 1U7TA 2J6IA 2DBVO 4WE3A 3PIIA 2NM0A 4B7XA 2XAAA 4IINA 3UVEA 2X0IA 3GNSA 1LU9A 4DIFA 3JCZA 4IQGA 1VRWA 3A9WA 2BRUA 1IPFA 1F14A 2C20A 1NASA 1PJ2A 2WE8A 1E6UA 3OIFA 1XCBA 1X0VA 2HQ1A 4FR5A 2DBQA 3T7EA 5FYDA 2YHIB 3ZZNA 1ENYA 4BO6A 3O26A 4GWKA 3DAPA 2WYUA 1FDVA 1BVRA 1H5QA 1E7YA 1WDKA 1N7GA 2NVBA 3PWKA 3IQDB 1R4MA 3JQDA 4GWGA 1Q7GA 3HQ4O 3I23A 4NJMA 5IG2A 1ZBQA 5TT1A 1QXSA 4L4SA 2OUIA 3ZWYA 4DQXA 1T24A 4IPTA 1H0KA 4J7UA 1T2CA 4BKUA 1BDMA 4GKVA 1DRVA 3SLGA 1NTOA 2PV7A 1B15A 4BO7A 3FWZA 3Q9UA 3QWHA 3BMQB 1E7MA 3WGOA 1ISGA 4Z6KA 5JAZA 3H9EO 2J5RA 5L7WA 4D41A 2I65A 3OJEA 3T7CA 3KRTA 3PWZA 4L73A 3BTSA 2X9NA 2EKQA 4CM4B 3NT4A 3JQBC 3AJRA 5T8KA 4BL5A 1Y5MA 5JMWA 1J0XO 2RH8A 2UUOA 3A28A 3H6KA 4XJTA 3WWYA 3WGGA 2UV8A 3QRWA 4ROSA 3LT2A 3VH4A 4CM5A 1SOWA 3AY7A 4RF4A 1I2BA 1K5HA 3WYEA 2G5CA 2IEDA 5HBRA 2OFPA 1UXGA 2O3SA 4W4TA 1KEUA 1PZFA 1C0PA 2NU7A 3EMKA 3LT4A 1V0JA 3GEDA 4J90A 3RQSA 5I8ZA 3DO5A 3PHGA 1CQJA 2PH3A 1J49A 1WPQA 3RUIA 5JC8A 3U4IA 3NDIA 1C3VA 4RF2A 3AU8A 2VYND 1LLDA 3F9IA 5CP8A 3OBBA 2GSDA 4WLNA 2Z1MA 1D3AA 2GF2A 4NU5A 4OH1A 3Q6IA 4XDZA 4N54A 4R68A 1DJQA 1X1TA 3SEFA 3OIGA 3VPHA 5K9ZA 4YT4A 1QSGA 3GZNB 4YJHB 3S2GA 3KYCA 4YCAA 2CUKA 3NAQA 4L74A 3IKTA 3E82A 3GEMA 1FDUA 3E5RA 2J3IA 3INRA 5EMHA 3FBTA 4JJGA 4CM1A 3SVTA 1VSVA 5B4UA 1CYDA 3ETGA 3WTBA 4KP7A 4TSKA 4YJFB 2AEFA 4E33A 2A4KA 7MDHA 2O3TA 3RUDA 3X2EA 4FPXA 1NVMB 1BW9B 4DPKA 4L76A 3L4BA 3OIDA 3GVCA 5HS4A 3QJ5A 3RSHA 3CIFA 2EV9A 1DC5A 4YAGA 5AVOA 3B20A 1R0LA
chains in the Genus database with same CATH superfamily
3QVLA 3UPUA 1GPDG 4LF9B 1RIIA 1X86B 1IAVA 3B8EA 1OX5A 3BIJA 1WKBA 3KVOA 1TF7A 1OXBB 2QD4A 2LE0A 1MEEA 3DJYA 3EQ6A 2RAUA 4JYCA 4E09A 5JNUA 3LC7O 1N5JA 1O77A 3PFCA 4HQOA 4HRYA 2NV2B 1Z7EA 2VR1A 2BZGA 4Q00A 3ORHA 2PWPA 2QXTA 2V6IA 3FGOA 2VOJA 3Q15C 4RQBA 5A62A 3FFWA 5CVDA 4YUXA 3KSUA 4MGEA 2QZ9A 3CY6A 3QV2A 4Z9FA 2GPTA 4C3OB 3RAEC 4EMUA 2VJYA 5BRJA 4KFTA 3JXEA 2A3RA 1UK9A 1SXHA 1OBOA 4YLYA 1ZA2A 4EW6A 1SD1A 1QX4A 1W46A 3SX2A 3NONA 1UBKS 1OXXK 3WRWA 5EIEA 2ZCVA 3VZRA 1ZLXA 16PKA 3KR9A 4PW0A 5CIYA 3HJCA 4KW7A 2BR3A 4FYJA 2BM8A 4OVKA 1U7ZA 1XTPA 2GBIA 4GMXA 2R97A 4IDPA 4YH1A 5IMSA 1OYVA 1SULA 3QE0A 4R1PA 1E4VA 3BZBA 4HQNA 4N39A 2GBFA 1P2SA 3U6KA 5FPTA 4KX3A 1JG2A 1DINA 4NNOA 1JYSA 3VDRA 5JV5A 1O03A 5AIBA 3CXRA 3LFHA 2MSEB 2G9QA 1CE8A 3BWCA 1XZJA 5EMKA 4YHBA 4CLXA 4JBXA 2A1IA 1RU3A 2YZ2A 1IVYA 4OXXA 2C4KA 1G20B 3VC1A 4IUCS 5HMMA 4C7JA 5AUNB 1JF8A 3AUAA 1N5MA 2WG0A 1NVTA 4N4AA 3ZI4A 4LJKA 1WVGA 2ZOSA 1E2IA 3D81A 4X1IB 5H82A 4CXMA 1FUKA 4J0KA 3IRUA 3R0IA 1KVTA 1EX7A 4R0VA 2JVIA 3LYLA 3V8VA 3TEFA 2WFAA 1J06A 3N86A 4M0UA 3A70A 4IIFA 1GWNA 3ZTWA 1F8XA 3A3KA 5SYNA 3A4TA 3QEJA 4ZJYA 1KO5A 4B45A 4FJ2A 4ITVA 3E2MA 2EKLA 2WHEA 4U2GA 2IT1A 2KSQA 1NW7A 2PX0A 2IC5A 3FOBA 4RSGA 3ZV7A 1NI4A 2P3LA 4ZT4A 3VPSA 4BRSA 3C3AA 1ZXXA 3HY4A 2OV3A 2PSJA 1XI2A 4IJ5A 1A8QA 1S4MA 2V7WA 5JDIA 1JVBA 1GZUA 2FUCA 5FF9A 4AG3A 3GLUA 2V8OA 1NJGA 5K20A 5KX5F 1QQTA 1W88A 4LG1A 4G67A 4PSDA 2FUNB 1E2NA 1YFKA 1KETA 1J90A 2EZ4A 5CW1A 4JDUA 4E32A 3KR1A 1JEYA 4YROA 5DI9A 4FZ3A 3VR2D 2CNNA 3L8DA 4KITB 1FFGA 2WU1A 5EHXA 3V7FA 4TN5A 1YK0A 4JQYA 3DNFA 1LPAB 4AKIA 3NWJA 1KYYA 1QZUA 2IYAA 4K03A 1CY4A 4JFRA 3SIPA 2XMRA 5KNBA 2IGTA 2GMWA 5E9JA 1QFZA 4CLRB 2QN1A 2FNAA 1EUCB 2Z98A 3ZEAA 4NK4A 2AI3A 1NXPA 1PT7A 1YO6A 2OO7A 3G2NA 3IT1A 4ILEA 3T3DA 2HN9A 2V74B 1ZGZA 2Q2QA 1PTKA 1MNAA 4C4XA 3VKFA 5IRCD 3O1HB 2BF7A 4PRYA 2C0CA 4U6QA 121PA 1ENOA 1SWVA 1HTTA 1ZKDA 3O82A 4D3FA 2ZUBA 1NYTA 4PQFA 2PFGA 1JKMA 2CLCX 4RF5A 2R8PA 1CRWG 1QK3A 3KDAA 4OXRA 4S2EA 5LBUA 3T0IA 5FTLA 2O06A 2EBWA 1YIAA 3HDTA 5DNUA 3EA0A 1EYZA 2RHCA 3BF7A 3T7SA 1CIPA 2WTAA 4OI1A 4YASA 3R7LA 3UOWA 3M6UA 4BDTA 2RHJA 1D9ZA 2WLSA 3GFPA 4H08A 4XW2A 3IR6A 5ABPA 1X7XB 1B0UA 2VT6A 4UD2A 5B2FA 2BP7A 2RHOA 3T6KA 3H9QA 5J2UA 1W19A 2OCLA 4ZVSA 1COWD 1DAFA 4B6EA 5AQ1A 3TCXB 4CJXA 1LBQA 2LBPA 5J2TA 2CV2A 1P3JA 3VAAA 3ETLA 2BFBB 1C7EA 1EQ2A 1FFAA 2CEKA 2R5NA 3I39X 3QG1A 3PQ8A 4F4DA 2OBLA 3PRYA 2QDKA 2NV6A 1W2WB 4DLSA 1WMBA 1WY7A 2GRJA 3GN1A 3HJUA 3K8QA 2OFXA 3RW9A 3EZXA 3VR5A 2GCOB 4P83A 1T2NA 3CEJA 4V0RA 1BMDA 2PYDA 4JBGA 4RA6B 3PX7A 3TIGA 1YQEA 3DVAA 1SVKA 3BERA 4TWRA 3WZ2A 1TCAA 3OOWA 4V1CI 4J7CA 1U2DC 1MABB 1X7WA 2GASA 2ZEJA 4RV4A 3BJIC 4S35A 2Q7OE 5A4IS 1XEWY 4G4SP 1IEXA 3LNCA 2VQFB 1YR7A 4GR9A 1P2TA 3L46A 4UCXA 1JEDA 4BXOB 5D51S 1W49A 5F98A 3VR2A 4UPDA 3X2SA 2ZRJA 3H9UA 2BEUB 2JRCA 4QQNA 4ZDJA 2X23A 3K71B 1XQ1A 2OHHA 4XWOA 1JENB 1VE5A 2G63A 3EP7B 2XJ9A 3NNSA 4EVQA 2R7MA 3EUAA 5EHGA 3PUKA 3RREA 1F8UA 3N7UA 1YDWA 4KN9S 5DLQC 5IHPA 2FW9A 5KYWB 3JVIA 1ONPA 2HWWA 1CUCA 2QSZA 2Y1XA 3A3YA 3NWBA 4P3KA 1MAAA 5DWQA 4BECA 4ZZ1A 2XF2A 3BVPA 5AJVB 4Z2YA 4Z8YA 3S8EA 2AV6A 2WPDA 1P1CA 4NV3A 5DNCA 3FCSB 4X6LA 1Y5LA 4QUAA 4UEJA 3UJ7A 1IB6A 1XRRA 1ODSA 2M98A 2ONYA 2AFHB 1T4DA 2EHJA 4LY6A 2H1WA 3KUKA 1L3BA 3M6XA 3OPYB 4OG2A 2WEKA 1UZNA 3I1IA 3IBGA 3RJ5A 1P4GA 3GLRA 3CMCO 2WLTA 1NLYA 3NFRA 3ZW7A 4ANFA 1ULUA 3SDZA 4FVTA 1L2TA 1JLKA 2PMKA 1ZRMA 3H87A 3B6EA 3OFSA 2ZS7A 2EG9A 5DF1A 4F2HA 2X0JA 4MUEA 1AF4A 4MV0A 5HIMA 4K6HA 3UJ9A 3AKZA 2A0FA 1ZZGA 2H5LA 4PZ9A 3DVSX 3AM3A 3KZXA 2QQFA 3CF4A 3G13A 4ETMA 2BEKA 2QD2A 2WG2A 1NBEA 3GRRA 1XQYA 4IIJB 4RA6A 4NNPA 3LF1A 2PS3A 1QZTA 5SY6A 3TZBA 1RJEA 1CY8A 3EAGA 5IXYA 3QG5A 1AGXA 4H9GA 3SYRA 4DHWA 3IUPA 1ZHOA 2ST1A 3B9QA 1X92A 2PRKA 3MD9A 3R75A 4K0KB 4M9QA 4TPKA 5EVJA 3K72B 1H3FA 3PDHA 3GNTA 3VPDA 3Q0TA 3NETA 2PL9A 4TL9A 1HETA 2V55B 2WHQA 3ANYB 5FLYA 2EW2A 1JB9A 2RAVA 1Y34E 2NNLD 2NQ2C 1TT5A 2XMPA 3NWPA 1PSWA 2QUHA 1U7XA 3L1KA 1ZONA 1G8YA 5DFAA 1B0PA 2PD3A 3DEAA 2WOJA 1OZ0A 1G3QA 1ZU4A 4HYYA 4NV1A 2RGXA 3PU6A 2Q6OA 2AG1A 3N05A 5F5NA 5GQSA 3RIGA 2W6OA 3G1UA 4NAVA 3BHJA 3PVZA 4OK6A 2PU5A 3C6XA 5KTPA 1K1EA 1WMSA 3QKWA 5HDQA 1F1BA 4JNCA 1R88A 4EVIA 2Y66A 3J81k 3GGPA 3GJ5A 3EWSA 2NPFA 3PKJA 1I7QB 4WKCA 3VVBA 4IX1A 2HA3A 1TTPB 2OZKA 4PHCA 2QX8A 5THXA 1IIRA 4C06A 4RTPA 2VQEB 4MV9A 2X0RA 1ZM3A 1CJMA 3EYAA 4HP8A 1PF7E 4FFWA 2X86A 2Q4EA 5EA2A 2ANCA 4RF3A 1GZHB 1Y6JA 2RJNA 4KE6A 3DCIA 3ZTYA 1DAKA 3ABSB 1C3JA 5C7IO 1U3UA 4IILA 1K86A 4RVFA 5ENZA 1D2EA 4FTWA 3GLTA 2IV7A 2XTNA 3L7KA 2Q21A 5HCUA 1L5ZA 3C41J 2PNJA 1XP5A 1YR1A 2VUTA 1B4DA 2JEZA 4MJ3A 3H17A 5HIAA 4N5HX 4DLUA 3S2IA 2AIRA 3M1AA 4FGUA 2K7FA 3WS7A 2XYHA 2OLJA 1QYIA 3QPBA 3S6JA 4LRTB 2QRUA 5KTRA 4AU1A 1XRJA 4J29A 4UXHA 1FZTA 1RPJA 2CSUA 3BYZA 3WWZA 1Y9JA 1ZH6A 4CQMA 3WC4A 4DSUA 1V48A 3HJAA 3ZD6A 4KXMA 2IH5A 2K5UA 1CZLA 3LUHA 5I7FA 3BTUA 1TIBA 3ELUA 2Q1XA 4OU4A 2B30A 4EGFA 5CBKA 4O4IB 1T5TA 1L4EA 2DUNA 3RBXA 3NALA 1NLMA 4KK4A 3QENA 4CR6A 2ZIFA 4K28A 1HXHA 1B14A 2FWIA 4LS3A 1W76A 4E7OA 2CXHA 3R6DA 4HR7A 4D8TA 2DBZA 1KAQA 1USKA 4KK3A 4ZTBA 4DR3B 1MG5A 2OAGA 1FF9A 3TTYA 1VHWA 4ZEVA 1P6UA 2G0AA 3ZHUA 2EX4A 3LLMA 4YN3A 3O90A 3BC1A 3I6ZA 3NC1C 3Q85A 2Q22A 1Q15A 1U0EA 2NZXA 3I12A 5CFQA 3ZZ0A 3L8MA 3MZ0A 1RFLA 1KSFX 1C9NA 1ZUIA 3IT2A 3PUZA 4Y0NA 5LYJA 1QZZA 1PQUA 2R4UA 4YXWD 2NYVA 3HR7A 1T91A 3NGXA 4S24A 1D4OA 3EEBA 3O2NA 4FBMA 4H1TA 3D8UA 2H11A 2JBAB 2VCYA 4JYMA 5BP7A 1LFAA 3GG2A 4NICA 1YQTA 5K51A 4S1OA 1TJPB 1USIA 2A59A 3C5HA 5EKUA 4HWTA 3VC7A 1U3DA 7AT1A 3FMFA 4CMGA 1E58A 3MG9A 2F3RA 1VCIA 4JJ8A 4OL0A 2OYSA 2GTIA 4HFRA 5ALTA 1E18A 1T8PA 2HNAA 3PF8A 3T3EA 2C2WA 2HLDD 1KTVA 1IUNA 2MTBA 1B7GO 2QU7A 2R8EA 3CF6R 4LBZA 3TOXA 3OX3A 4RANA 1QG2A 3V7NA 2OGTA 2H57A 2SCUA 4QOSA 3WJ2A 3GEBA 2PFSA 3U7JA 1XG5A 3N53A 1RRGA 3KT8A 2GNPA 3HDQA 4RK5A 4KI7A 3H75A 2Y05A 5EKXA 4NAHA 3W5AA 4AS3A 3AVYA 3OWHA 1AHHA 4MJXA 1XZFA 4MW6A 2IHTA 3VKWA 4CLHA 4RVGA 3THXA 2EBHX 4PICA 2C4NA 1V8PA 1LQTA 3FPFA 5JNSA 2ZJ2A 3AF6A 3CT4A 3I5YA 2KM1A 1LXCA 2IUSA 4M1TA 3IAHA 3VTAA 1H9AA 1UPCA 4ZO8A 4EO7A 2I4MA 1SEPA 3RK4A 1GLVA 1RE0A 2YASA 1SC1A 3K15A 2EG5A 3A3PA 2FFQA 3LDFA 3ODPA 4JJFA 4L1KA 2W6CX 4LHYA 4IIUA 4MS1B 4P3OA 1FX0A 4E15A 4NCAA 2B2XA 1SC4A 1Z6GA 3ZGYA 4EYGA 1F2UB 4OU5A 4RY0A 5I3ZA 3DBRA 3ZG6A 4EF5A 3I83A 4F3YA 3QIVA 2ATIA 5AXBA 1NT2A 2GPBA 4IDGA 4RQUA 1PVDA 4XAQA 1WXQA 1FDOA 2CZQA 5KWEA 1KYWA 1W85A 3EGVA 3FUXA 4I55B 3E70C 3M6LA 1V8BA 5GJCA 4BX9A 2BKXA 5CB4F 2C9CA 3K5HA 3R5SA 4RKWA 4BVGA 9MHTA 1G60A 1JJAA 1FRQA 1M1NB 1A9SA 4EKNB 2CDNA 4DIUA 4UJ5A 4NCJA 2IPOA 2G5GX 5E4JA 4RIEA 4DRXB 4FEYA 1ZK3A 1XVTA 5AJYA 1SXJD 1M2NA 4C4YA 2B4QA 5CA1A 1C1XA 1JKIA 2P77A 1G8HA 5CYGA 3ZNPA 1UUFA 1WEKA 4BV9A 1SKQA 3R4VA 4EYEA 3D1LA 3EIOA 4E4RA 3NUGA 4IS2A 4UQLA 2ZSDA 4M0DA 2X5XA 2A86A 5A6SA 3I1FA 3A2MA 5I9NA 2PX3A 5FXMA 4RK0A 3GVPA 2P79A 1E1NA 5BSGA 1KXJA 1XN4A 3CB2A 1H42A 3H2ZA 4WASA 1IHPA 2E4WA 3ZVKA 2G8NA 4E5PA 3DXFA 4A8JC 5ANRB 1DRKA 1HFWA 4RADA 4F9FA 4QFDA 2QZJA 4BB0A 1CY7A 2R79A 1AK1A 3RU7A 1S2MA 3BH7A 4RMGA 5CNIA 2OM2A 1G17A 1L5MA 1NHWA 1V7ZA 2RCNA 1WKVA 3T4PA 3ZQ4A 2I4NA 2NUAA 4KOAA 3HDVA 4MRMB 4FOOA 3PP8A 2Z2IA 3FGZA 5I47A 2IH4A 5DWDA 4AIRA 4OAQA 1EKXA 5DMHA 6PFKA 1XA4A 2BEWB 3L8GA 3ASVA 3H4TA 4TL6A 1JHAA 1LC0A 1B2LA 1E3QA 2X58A 1QBKC 3LYHA 1F4LA 3K8ZA 3THYA 1GUDA 3BXEA 2FEPA 3UAOA 2CE7A 4O1IA 1GPYA 2MSKA 1TO1E 2P9EA 4CMCA 1LBTA 2GWRA 1D03A 4Q02A 1GGVA 3BOSA 2GK6A 1UPFA 1Q22A 4WN9A 1IQRA 2J0SA 4MUNA 1RRMA 3K0SA 2IHVA 1ULZA 3DDOA 4RE6A 4CKCB 1KY2A 1YONA 4G63A 1A7JA 3GT7A 2M1ZA 4WOPA 1U1DA 1CP3A 4UAVA 1ZR2A 2JLVA 1YJBA 4CNQA 1MO5A 4EARA 1OJLA 3AHGA 4MS4A 3VJRA 4KDRA 2CUTA 3JR7A 1ORTA 1G2PA 4IXTA 3ZJ4A 3HCNA 3FGPA 4R51A 1ZOOA 1FFEA 2PZFA 1BS9A 1IAQA 3BFXA 4PCUA 3VU9B 3GGOA 1NVFA 1K6EA 3B1YA 3COWA 3WGLA 2R8YA 4ILKA 4RH3A 5BWNA 1XTBA 5I01A 1QIFA 3JQAA 1I6LA 3LP5A 3PC6A 3UTCA 5BUQA 4FZ5A 5DTIA 4ZI3A 2Z6VA 1E9DA 1Q74A 4D8XA 3AB8A 3PV0A 221PA 3AFMA 1QO0D 1Q0LA 2V3WA 1XBTA 3HY3A 2GZMA 1T9KA 2XUIA 3LKDA 5FOWA 4TWJA 3JATB 4HB3A 4MARA 4QDUA 2W6ID 3M6MD 4TXLA 3BMXA 1QFYA 4IVPA 3ZBQA 4RULA 4JT9A 3G5MA 3H0CA 3GGGA 4OMUA 4CBVA 2XRYA 3FR8A 2XQFA 4FHDA 1VHLA 4KG7A 4A9AA 5ALZA 3WRVA 2P6OA 4AUEA 3JZFA 4JLVA 2W0SA 1T8YA 4EO4A 4C87A 4Z7NB 2VSNA 2QSYA 2OAP1 4RACA 3HRHA 5ALKA 1QYXA 3EEFA 4Y2PA 4FYYA 1JEJA 1QIEA 2XITA 3D3WB 3I6BA 4OHWA 4YAJA 5A02A 4CN8A 1VBFA 3ZDBA 2LV8A 2WWFA 1UBRS 1NFFA 5TPZD 4EDFA 3K8YA 1VLQA 2Y99A 3QKUA 3ZKWB 5BMVA 4HDSB 2BFEA 3GDWA 3EPJA 2WYHA 4AO8A 3LJKA 5HZKA 4RTSA 5KYYA 3HCPA 3Q3IA 2DF8A 2EP5A 6ADHA 3V1UA 2ES4A 1FOEB 1Z12A 4MCJA 3URKA 4C07A 4GMGA 4A0GA 5JD6A 2VS1A 4UVGA 1ZVQA 1EFPB 3QBDA 4IFBA 9LDTA 2DE0X 1QFJA 3ZGZA 5EUQB 1H2BA 4R1QA 2ZYGA 3ROPA 2D7CA 5EIOA 1W4LA 1ZFNA 4HDMA 2XQIA 2H52A 3EN0A 4QU5A 3EAFA 2G1AA 5KJCA 3PQEA 4N5MA 3MQ2A 1I7CB 1KYTA 2CJPA 4LKOA 4LDJA 4G0XA 1YS6A 1NZJA 4OJKA 1W0KA 3WQHA 3A26A 5IVDA 1A8IA 2OZVA 1NRXA 1YMUA 3FKQA 1OX4A 4O33A 4CKBB 2ZXFA 4I3HA 1M6YA 2V0GA 1CDOA 4FOTA 1JU9A 1SD5A 4ZVPA 1RI5A 5AHWA 1G7CA 1P19A 2AQKA 2FRXA 5DBIA 4A2PA 1ESDA 4Y2XA 4A73A 2X3FA 1UPUA 3S1AB 2I2XB 4NESA 4XDHA 4CT0A 1ZUWA 4NATA 1QH0A 3FPCA 4MPDA 2WYOA 2HYIC 1VOTA 2D0OB 1XLWA 3ESRA 4WOKA 3DVQX 3PL1A 2JI4A 3LPNA 2DM6A 2ISQA 1XZPA 2V9ZA 3RH0A 1KH2A 4D4JA 1E1MA 3AY0A 1MC4A 3IUQA 3R20A 1UJ4A 3UOGA 1P9LA 3KTAB 2HX1A 3I2HA 1L4FA 1SQSA 3U4HA 4I4TA 4URZR 3HDGA 2HEGA 2V6BA 4FYWA 3OZUA 2RDMA 4LYHA 5A9TA 1SBTA 4MW5A 3FB1A 2ZUUA 4F4HA 1NUTA 1T4CB 2AA3A 3L5KA 1YDMA 3HL0A 5CNMA 2PUEA 3TPFA 2NGRA 2ZIAA 3H3FA 5F7XA 1DQYA 3IESA 2P91A 4CW7A 5GINE 1EUQA 1UT8A 3IHWA 1Q1ZA 4LE0A 1QHYA 3PC8C 3PXXA 2WTUA 4ZZIA 1LW7A 2OSBA 5JXHA 2QOEA 4C78A 2BEWA 2QTNA 1F2TA 1V7CA 4PM4A 2AF4C 4XIFA 1IH8A 3TLJA 2FX2A 2H5EA 4IHJF 3TIVA 4B84A 1F2DA 3VVMA 9LDBA 1E3LA 3HNPA 3BTOA 4KJXA 1RKUA 2FG7C 3N6XA 4BFSA 2IX9A 4OHXA 3BT7A 4JLOA 4RELA 1EXVA 2XKJE 3ZK8A 1GPUA 1YU9A 2LWIA 4QXRA 5AO9A 3SJ7A 1WZUA 2GVDC 5FUMA 1ZWKA 3M6IA 3SQDA 2B7LA 4LF4B 3VXKA 3NANA 5ALYA 5AVJA 4RPCA 4GKJB 4E5MA 1A27A 4QICA 1N2CE 2FOLA 2YTZA 5EIAA 1T1IA 1H0SA 1A2BA 3DJFA 1W47A 4QXPA 2NU9A 4J49A 2L18A 2R84A 1A4XA 1UBCA 4BO1A 1MB4A 1KERA 2PZKA 4YMTA 1VL0A 4UAGA 2A7QA 4W1QA 3T1YB 1GT91 4KUHA 2HHCA 5BUCA 4DR5B 1XJ5A 1U0FA 2LGJA 1CEXA 3GHYA 4X85A 1UDWA 2GXQA 2XHZA 4MQ4A 1K6MA 2NU6B 4UMEA 4B4KA 4X1OA 1RYDA 4ZQHA 3F4KA 3NPMA 5A05A 1SVIA 5EN4A 1V71A 2OBXA 4IYRA 3DZKA 1BN7A 5L40A 2OZLB 2ZBQA 4TROA 2PXCA 5F4BA 5JJ5A 1RKVA 3QWAA 3TW6A 5B2EA 3C3DA 1RZRA 1KMNA 1QM5A 4KLRA 2GETA 3HBAA 4HNRA 2IYLD 3TM5A 3SYTA 2GN2A 1E3SA 1JR3E 5CT9A 1EJ0A 4UQOA 2PZBA 2QQGA 3WB1A 4ESHA 1SCUB 1UIRA 3R0QA 1G6HA 2PH5A 4N7RA 4R2WA 5D1HA 5J5VA 4C03A 2P5SA 5J2UB 2YN4A 4R31A 1KOLA 4WCVA 3QKRB 1PTJC 1SK8A 1H2EA 2XE4A 1Z47A 2ZI5A 4CM9D 4YUAA 1N5OX 3EC7A 4DNQA 1E1QD 3OWXA 1IHUA 1P9WA 3PHJA 4LDZA 2FRVA 1GILA 4EAQA 2CXSA 3I37X 1CJUC 1QMGA 1EUDB 1OF1A 1P5FA 4KPUB 3BIOA 3A4IA 4C20A 4UOZA 2WDPA 1TEVA 1QCZA 2Y1EA 1KI2A 4G1CA 2GT1A 3K16A 1ODFA 2Q4TA 3OQ6A 2Q2OA 4BFZA 4Y0VA 1L1FA 4H31A 3W6NA 5GONB 1RYNA 1HH4A 2N46A 3G9TA 1I7MB 3WDKA 3B9RA 4UARA 3RVRA 3G9UA 2VT2A 5AOCA 3GT4A 2NV0A 4C6TA 4EZIA 3Q7EA 5JH7A 1CQXA 1Z22A 2ZT6A 5J47A 3T3OA 1JAHA 2Q49A 3LNTA 2XCSB 1JFFB 1KYZA 3AF5A 4LBYA 4ZQFA 3QV1A 5HX7A 4NV0A 5IZCC 1MORA 4CGZA 5ES4B 1IQ0A 1ORRA 1QHFA 1A9YA 2KBFA 1VTKA 4ZAZA 4ND8A 4YCLA 4O08A 4FNAA 1QO9A 4NOJA 1GQQA 1Z39A 1DO0A 4C1NA 4PQYA 5IWCA 2QBYA 4IVRA 1M5RA 5EMJA 1RWVA 3E7DA 3PNKA 4R9NA 2DKOA 1N8SA 1OT3A 1YZTA 2IXFA 1O4VA 3FUVA 1E77A 3FKSA 3C5EA 4JWKA 5JYFA 1XDBA 4QYIB 3GG9A 3CG0A 3VO2A 3N8KA 4MEAA 3WHKA 5GJVC 4GBMA 4P5EA 2XJ4A 3TOZA 2ZYAA 1CZUA 1C3OA 4LF6B 4KPEC 3KEQA 5CH8A 3RTCA 4EG8A 3TI9A 4IGEA 5ILOA 1G6OA 4ZT7A 1LI4A 5AYVA 3DAYA 1NN1A 3JWEA 5JRJA 1JDSA 3UT5A 3PDUA 1SUDA 1XROA 3UT6A 4QX6A 5EP2A 3X44A 4ARIA 4MVCA 1YZVA 2WJHA 1YK1A 2D1SA 1JFVA 5HF9A 2XY4A 2WRZA 5T57A 3D6HA 2QM3A 2D0PB 5B2ZA 3WI7A 3WYDA 3IUMA 3I58A 4DG5A 3W7VA 4BLSA 4QGGA 5JZ9A 4YJFA 1MF7A 2OILA 4AD8A 3IDOA 3QKRA 1AQYA 1TYDE 2LRHA 4OHMA 4OHZA 1J22A 5JS2A 3KUCA 3THOA 2YC2C 3H4IA 2JGIA 1NSYA 5CA1F 1QIKA 1G1AA 3FPAA 2VOEA 1HV8A 3G8AA 2YWCA 1W44A 2ZWOA 1T1RA 3Q10A 1NI3A 3W8DA 3FYHA 3TQTA 1EK5A 4JC8A 1R16A 1Y48E 2JD1A 4XEUA 1PFGA 3AB7A 3U7RA 1BN6A 4RJTA 2DHEA 4XIJA 1TK9A 2NO1A 3CR7A 1PR3A 1BTOA 2H7YA 4ZAWA 5C8VA 3OF5A 1NJSA 1R12A 3RJMA 1KMQA 1CLEA 3GJ3A 2OXTA 2CWDA 2XZOA 1B23P 3HJGA 2P9QA 3UH1A 2DFKB 4EABA 1L5KA 4XX0B 5CLGA 4PCLA 3CA8A 1AG9A 1Z2CA 1ZNZA 4WKPA 3P27A 4JL6A 1MRZA 4KSBA 4LHWA 1EWYA 3KQQA 5REQA 3RKRA 4AN0A 1YZQA 2XE8A 2QN6A 2FZWA 3QVVA 1S3FA 1A71A 1Q2XA 3JD4A 3QVXA 1ZI9A 3PUVA 5FORA 1C30B 4FW9A 1APBA 1N3YA 4PF1A 1Q83A 1Y3DE 1YQQA 5AKGA 1POWA 3E15A 3QYFA 4G0MA 5T41A 4CEHB 3D4PA 3NTQA 5TQVA 3NEAA 3UKOA 5IKPA 4CR8A 3ONVA 1FRZA 1A8UA 4JR0A 1PEAA 4Z4QA 3P96A 3N28A 1M75A 1H2RS 3IMKA 4DYHA 1MXFA 1JSXA 2YW9A 4JFAA 4RXUA 3WLAA 2DH6A 3DLHA 1B0AA 4IDEA 4QGBA 3WJAA 1QCYA 1M83A 4DWOA 3VPAA 4UTNA 1JDBB 4L4ZA 2FWNA 5AUOB 4KQ9A 4CQMB 1T1SA 2ZB2A 1YQ9A 4ZO6A 4GOKA 4X3PA 4EJ0A 3NHWA 1W93A 4QUEA 2AFIB 1EHCA 1P7YA 4QRIA 4ZMBA 2ZP1A 3BGWA 2X0NA 1HF3A 3ETJA 4BNTA 4CM9A 4F4CA 2OXRA 3LT1A 2Q1UA 2DCMA 2DY1A 3H1TA 4C21A 2A9OA 3WLJA 4CV3A 4DFDA 3KQSA 3DEJA 1I2AA 4GLOA 3EWAA 3ITNA 4FFRA 4XPIB 3FH0A 1DRJA 1QGED 3EP8B 2WJ4A 3HLYA 4LRQA 4NZYA 2RGYA 1LK0A 1EQUA 1Y98A 4LX0A 4YAOA 3DULA 2OZLA 3DWEX 4IL5A 2HI0A 2X3YA 1LLUA 3DDZX 4E14A 1NLFA 4FYKA 5FEMA 3ZCPA 1MX5A 1DLJA 5GM1A 3GZNA 4PC3A 4F2WA 2OCBA 5KWSA 3KZMA 1V9SA 4NLLA 3WRYC 4F85A 3EPPA 5CXUA 3FHOA 3DTVB 1DIRA 4GM4A 3IAM6 4LPSA 3JQAB 3SE0A 3G6KA 5I5EA 2JHPA 4FONA 4HDKA 4MS3A 4BN4A 4LF5B 2QN2A 5TVOB 3LCCA 4HNAA 1YNSA 1CYEA 1O7JA 5E1BA 3C24A 4IWYA 1TCUA 2CWWA 3DGEC 2FWJA 4P4TA 3V48A 4DLRA 2YFHA 4FOPA 5HNKA 1S02A 2LVBA 3CO0S 3AX6A 5J1SB 2O48X 1KY3A 2GK4A 4R3WA 3H6HA 3OFJA 4J2HA 4UVEA 3HSSA 1NF3A 2P6UA 3LQ1A 4NTZA 5FA5A 3B7GA 1C0KA 1M5TA 1SUEA 3GO4A 5HGJA 3BXFA 4EI2A 2B5VA 4DMRA 3DL4A 3IKMB 1RQLA 3QFFA 2CCKA 1H0HA 2Y76A 2VYVA 2UAGA 1AQJA 4E08A 1DV2A 2PX2A 5SYAA 1NAHA 3VR6D 3DC2A 2P2NA 2XTAA 5ILGA 3PPYA 4GSKA 1CZOA 4IUDS 3A9VA 2NTEA 5E2AA 2AZMA 1K9SA 1MAUA 1KS9A 2VSYA 5E6SB 2NZJA 2ZI9A 2ZR8A 2A30A 2YIJA 3HMKA 5EJAA 5LZ8A 4E1VA 1S7CA 3OQVA 1A4UA 1F2UA 1QH1B 1RKXA 1SPXA 2X7XA 2ZBGA 2C5AA 3DUFB 4WY5A 4XVRA 5G0VA 2QKYA 2HF8A 3G7UA 2G9VA 3VKVA 1TB4A 3RYCB 4RHEA 5BUSA 5DYNA 2GPJA 1NQAO 3C98A 1P60A 4TUYA 5IKXA 1B93A 2QTVB 2D74A 4U3JB 1EU1A 8OHMA 1Y3IA 2NZ2A 3TZ6A 2XSZA 3K6KA 2QAIA 3QYJA 3REQA 5IX8A 1J1ZA 4L5AA 4RPJA 4BUCA 1RXIA 2BR5A 1NMEA 4KXVA 5DK4A 4I50B 1SVOA 4DREA 1C8LA 4QXAA 1N1MA 5IARA 3OPNA 4GYKA 4DLTA 4YV1A 3FZNA 4OREX 5KSOA 1U1IA 1EE2A 4MYDA 1XXHE 1VBNA 3AUJB 4H6PA 4B44A 3QW2A 5F77A 1E2EA 5C31A 2QR3A 3F8TA 4KJZA 5H70A 4FILA 2BGTA 1RBMA 4ZA2A 1V3TA 2F3PA 1MVLA 2PUHA 3IJ5A 1H6DA 1V4NA 2XDYA 1ZN9A 1D6SA 3OT5A 3SKXA 3FKJA 1SQ0A 2FYTA 3GLHA 3W6PA 4OXKA 4TYNA 1W1IA 1I32A 2I3DA 1UBEA 3NX4A 4F6RA 3L8FA 2WV7A 1A9QA 4OQMA 1J21A 2VDMB 2WSLA 3KX2A 3DF9A 3B6MA 1N5DA 1J99A 1ESNA 1OZHA 5COBA 3OOYA 3INGA 2VHVA 3FFBA 4P0PB 4WK4B 2JAPA 4HMPA 4KQCA 2EFJA 4OHUA 2ZIVB 4HNAB 4GMHA 5EZYA 1BNCA 3PT9A 1M10A 3K9CA 5IKOA 4NZ9A 2RKBA 2C54A 3PNOA 1IM5A 1SC6A 2MSLA 4KGDA 3TQRA 2HOQA 3WSTA 1FC0A 5I5GA 3I2YX 4KCGA 1O9GA 5J40A 3WL7A 5LOVA 2A35A 2ALJA 1DX4A 2BFMA 4CCAA 1O89A 2FMKA 2QS9A 4JKYA 5B1IA 5AVRA 4BGUA 1SH7A 4RPKA 1AHPA 1T0JB 3WP1B 3HFSA 2ZW9A 4O0LA 1LEHA 3CM0A 4HRAA 4BO5A 2QG6A 1AK9A 2W8BA 4JJ4A 1IEWA 3FYSA 1WETA 1KU0A 2EC5A 3B51X 4G81A 4RQAA 5H1YA 2PS1A 3TTTA 1BRMA 2BSAA 4UEQA 3HSKA 3RS4A 2JS7A 5IPFA 2RGRA 3A4MA 4M1KA 3BX1A 2UYQA 3IDFA 4IH4A 4BFLA 1TX4B 1WUIS 3EQZA 3WK4A 3U56A 3TD9A 3E7WA 2Y0DA 3BFVA 3GVHA 4W5HA 3TXXA 4QTUB 1NC3A 3ENVA 4MVJA 2QP3A 1LSJA 4Z99A 4EVSA 4ENRA 1GV1A 2HPHA 2HGSA 3OM0A 4A8JB 4ALNA 1V5WA 1AURA 1W96A 2H29A 3K4HA 3B5IA 3C1TA 2VH2A 4JEHA 2WKPA 4II7A 1TF2A 2QGFA 1EWQA 2ZZNA 1KRXA 4NPCA 3K2EA 4KO1S 4Q66C 2OENG 5TF0A 2VZ9A 3NAGA 4JLKA 1GQYA 4E03A 1HO3A 4JITA 4L5YA 3GFTA 4POAA 3V1TC 3VH3A 1WMFA 2E49A 2HDNB 5KPDA 3L18A 4NKRA 4Q3DA 2HQRA 2EOAA 3VGJA 2EKPA 2VCEA 4RBNA 4RYDA 4EG4A 4MUYA 2AZ4A 4UHJA 1B2RA 1GUAA 2H2IA 4Y8VA 4DJAA 4W5TA 1GZ5A 2ZJ6A 4D82A 5L3VA 4LDNA 3ONEA 1X7ZB 3JASA 3WAGA 1NRIA 3U5TA 1PHPA 1PX0A 3ESZA 5KDLA 1ZH8A 3L40A 3DZ6B 1TUGA 3BRSA 5JMTA 4BBZA 2O2SA 1JG3A 3BHIA 3NDPA 3DZ3B 5CLIA 3TMKA 4W5WA 2R48A 4NF2A 1HT2E 1P61B 2QUKA 4HAOA 2Q5CA 1MKYA 4X0EA 1X9GA 1EDOA 1TXGA 2H06A 3CRNA 1TD9A 2XNKA 3BB1A 4FINA 2PS9A 3E22A 4OB7A 4P7KA 3WBKA 1Z5WA 3DGFC 1TC2A 2G9NA 4TWAA 1USWA 1WKCA 2H0QA 4H77A 3WGIA 4URYR 3CEMA 4WFQA 3TINA 5AI9A 3U48A 5BSWA 4L0MA 4RZHA 5JEDA 2WW8A 4G5XA 5LQNA 1RRFA 4UATA 4GOLD 2JI9A 3GT0A 1OI7A 4PLTA 1T8TA 2VTBB 3BULA 3H0EA 1K2WA 3SC2B 1ZUHA 3BEOA 4P3PA 1ZN7A 1CUFA 1W0JA 3ZIAA 1K6XA 2Q28A 2JJ8A 2J4CA 2ZRHA 1M54A 2AFIE 5CRIA 5IT4A 1MZVA 2PL3A 4YP5A 2YXBA 2NT3A 4MTCA 4OV6B 2YH2A 3DG9A 3I52A 4DEVA 3N2KA 1O94D 1J0AA 1OIWA 3KUDA 1GGHA 2AOTB 5DGCA 3QITA 4D56A 2WK1A 3FUUA 4L78A 5ITWA 3W5BA 1P7VA 3F9RA 4B71A 2QD5A 2FHPA 2QTWB 2X13A 3AKCA 2GFIA 1T3GA 3A1CA 4Q03A 1NUAA 2QLBA 4UXIA 4BAGA 4OQEA 2Y9MB 2H18A 3U3RA 1ISSA 3IULA 3VC2A 4TV8B 4RETA 1MOSA 3AERA 5K3EA 4H4DA 3CS3A 3HVHA 1B00A 2DH5A 1P5HA 2V1XA 3QK7A 1V7PC 1MIOA 4CEHA 1J0DA 3IPYA 4S12A 2CD7A 2JLUA 4B4UA 1EVJA 1I6WA 3IIJA 4INOA 1GP2A 3LX6A 1UBNA 2JFNA 4BFUA 1U8EA 4ZYVA 3OLXA 1M2VB 4RGQA 3A27A 3WLQA 1US8B 3EYWA 2JVKA 1P0FA 3EQ7A 2Q5FA 1OX6A 3GLQA 3P9IA 3ZDZB 2PGOA 2X5JO 3BA1A 5F9MA 5F7ZA 5BV7A 5JBNA 4LGMA 2V7TA 5H5JA 3IVXA 2X77A 5BNIA 1CNMA 1TEZA 1Z4KA 1J5XA 3OD5A 5ITZA 3D8SA 3PFNA 2CNWA 3S70A 4ZK6A 1RXWA 2FSFA 1FJXA 4LZOA 3WK6A 4UXJA 2JFQA 4Z4CA 4J43A 2DPHA 1K6IA 1ENPA 5FULA 2VJCA 1JG6A 3JQ7A 3AHEA 5DW0A 1KKLA 1TJ3A 1Z06A 1RM4A 2AUMA 1LRKA 1SO8A 4OO3A 2HCBA 4P92A 3EC2A 1WMDA 5JCXA 2J4FA 3LWZA 3CNNA 4Q4CA 5JSUA 2WF6A 4LNUA 4MKGA 5FD8A 3SJUA 3WA6A 1R8QA 1Z9BA 3TR0A 1IXKA 3U3JA 5B7NA 5BWMA 4W8GA 5BWLA 1B8OA 3KYIB 3UA4A 1KNQA 4ZMSA 3CVUA 4B83A 2YOHA 4IMIB 4JT4A 5JY1A 5ESDA 4GX2A 1UMCB 2QA5A 5BW8A 5JPCA 3R9XA 4AFNA 1C9DB 1XYYA 4ZRDA 2ZTLA 5SZIA 5SZKB 5BSVA 2GCOA 4U7PB 1J07A 2WKWA 4NOKA 4UBJA 1CJKC 3HUFA 2A0UA 2Z2KA 4NPHA 4QDXA 3LECA 3AVUA 2G4VA 1JMKC 1E0DA 2GI4A 5EXDA 3DTNA 5IF9A 1PP4A 1FSPA 1NQVA 2OOSA 4O4IA 2WSSD 3KD3A 4FD2A 5JT1A 1Y6GA 5HS6A 1H2AS 4F92B 3FOAA 4AI6A 4Q4AB 1E2QA 4EGJA 1Y82A 3TRFA 3HUEA 3U19A 1F5NA 1SOUA 1P29A 1ZH0A 4GDMA 4U02A 2CL6X 1SXJB 3IBYA 4GS5A 3FCYA 3LTEA 1LNQA 2AXEA 3KE9A 1VYHA 1T0IA 1ZD2P 2G1JA 2GN4A 2IRWA 1Z5GA 2FX5A 3DBIA 4LQDA 4M76B 4EEKA 2PZGA 3QU4A 3KZNA 1CR2A 2Q7DA 5KWJA 3GRVA 4CU5A 3CVJA 1PHRA 3VDQA 4LE2A 1ZRSA 4HRVA 4GNKA 1QTIA 1WSDA 2W2LA 5G41A 2OCKA 1G8PA 3P45A 1MMFB 3OVMA 4OQNA 2WIDA 1ZJWA 4NYMQ 2RHWA 4WK2B 1DIOB 1H1LB 4XWAA 2DVMA 1VC2A 2IYEA 3D4IA 5HIJA 4O25A 3DW3X 3E8MA 4REQA 3R76A 2CHEA 3CNLA 1IN6A 1Y6RA 3Q3JB 1M34E 3ROGA 3I4FA 3S55A 4D80A 4XZ3A 2W8ZA 2O14A 4Z1MA 3IXQA 1T25A 2C57A 5CBPB 1OFIA 3RV4A 3FTFA 1N33B 1JLLB 2FSVC 4B0OA 1EUZA 2JEOA 1UPAA 3FFAA 2A8YA 3I2KA 4JP2A 3W7BA 4D2IA 2VUHB 1Z7YA 4RWEA 5EHQA 1JHUA 4ENVA 1QRAA 3KQLA 3ADDA 2PMFA 5K1ZA 5C8DA 1XFAA 4G0OA 1GUYA 4L8GA 2TSYB 5JBQA 1S8NA 3AP1A 3BFJA 1KI7A 2CXXA 4X41A 5KYVA 1I5EA 2JANA 1Z2PX 2NG1A 3MC1A 4XXHA 3S1LA