3BTSA

Crystal structure of a ternary complex of the transcriptional repressor gal80p (gal80s0 [g301r]) and the acidic activation domain of gal4p (aa 854-874) from saccharomyces cerevisiae with nad
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
422
structure length
384
Chain Sequence
NAAPIRVGFVGLNAAKGWAIKTHYPAILQLSSQFQITALYSPKIETSIATIQRLKLSNATAFPTLESFASSSTIDMIVIAIQVASHYEVVMPLLEFSKNNPNLKYLFVEWALACSLDQAESIYKAAAERGVQTIISLQGRKSPYILRAKELISQGYIGDINSIEIAGNGGWYGYERPVKSPKYIYEIGNGVDLVTTTFGHTIDILQYMTSSYFSRINAMVFNNIPEQELIDERGNRLGQRVPKTVPDHLLFQGTLLNGNVPVSCSFKGGKKNLVIDIHGTKRDLKLEGDAEISNLVLYYSGKEIMEVYHLRNYNAIVGNIHRLYQSISDFHFNTPSQFVMQGFDFEGFPTLMDALILHRLIESVYKSNMMGSTLNVSNISHYSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Galactose/lactose metabolism regulatory protein GAL80
publication title NADP regulates the yeast GAL induction system.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 128
structure length 384
sequence length 422
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3btsA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3btsA01
1GEGA 3DHEA 1NHWA 3M1LA 3VAZA 2BI8A 4OQZA 1LC0A 5IZ4A 1JQBA 4OXNA 5COQA 1GQYA 3G3EA 3NV9A 2FR8A 1V35A 2RHRA 3TPCA 3PTZA 3LVFO 4BUCA 1D1SA 3TDKA 2HU2A 4P38A 3WWYA 5TLSA 3QHAA 4CL8A 1NBOA 4IIVA 3GGOA 3SLKA 4IZIA 5JC8A 2DPGA 4I08A 4BB6A 5I8ZA 4DC1A 4BNMA 1XHLA 1YVEI 1MB4A 2FPPA 3DZGA 3AUSA 4KUHA 3JQCA 4DIFA 3DBHA 3WGIA 1HZZA 3DB2A 1U1IA 1R15A 2WDZA 1QYXA 4IDAA 1UDCA 3Q9NA 4QECA 2ZQYA 1V0JA 1DIRA 5KVVA 3KXDA 1BDMA 3ONEA 1HETA 5T64A 2WM3A 1MUUA 1W73A 4J2OA 5EL0A 1A7AA 1ONNA 4UEOA 4ZVVA 4XDYA 3TN7A 3TZQA 3U49A 4IZHA 1B3BA 4OJNA 2VQ3A 3CINA 3VH2A 1O8CA 1ONPA 2W98A 1OOEA 4B3HA 1QR6A 4OKNA 1CEQA 1ULSA 2ZYGA 1O9BA 1WWKA 4E12A 1U2DA 5F1KA 5EMHA 2BGMA 2ZB3A 2CY0A 1E77A 1T25A 1YQXA 4GSLA 1GUYA 4ZQFA 2X0NA 1GYRA 5IXSA 3CXRA 1P3DA 4FJ0A 3L0DA 1LDNA 3F9IA 3K5PA 2XXBA 3H65A 3BZUA 4UUMA 1B2LA 3UF0A 2WE8A 3GUYA 1WP4A 3TRIA 4GPD1 4IXTA 1HEUA 4IJWA 3KEQA 1Y8RB 1KETA 1SEVA 4I5DA 4M49A 4YT4A 4FFNA 4BO9A 2EIHA 1N7HA 1WPQA 1NVMB 4IJKA 2GF2A 1HXHA 5KVSA 1H0KA 3WNVA 1TT5A 4XWYA 4CR7A 3D7LA 4ZICA 2C20A 1NM5A 3SJUA 1C1XB 5JCJA 1GQQA 2X9VA 2R6JA 1KBZA 3PK0A 4UEKA 1ZEJA 3CKYA 1IPFA 1PJQA 4MKRA 1UP4A 4XGIA 1T2AA 1K3TA 1ZK0A 5F5NA 1H93A 1T24A 2JHGA 4ND1A 3UH1A 4S3MA 3PYLA 2C07A 4BO7A 1Y9EA 1T1SA 3KETA 4NHEA 3WFJA 2X5JO 1EMDA 3JYOA 4WNCA 1ZH8A 4BKUA 5DCUA 3S2IA 3VPGA 1LEHA 3CPSA 1DB3A 3AFMA 3OH8A 5JAMA 5JNLA 3BTOA 4LVCA 5CHEA 2A4KA 4W4TA 1PWZA 2VRBA 3DTYA 1ZCJA 3RAJA 3V1TC 1ZEMA 5A05A 1MXFA 2CUKA 4OH1A 1UZNA 2A9FA 3C7DB 4ALIA 1MXHA 3QSGA 1A4IA 4E0BA 4GVLA 4DBVO 3FNEA 2JFFA 5EN4A 1E7WA 3DBRB 4K6FA 2CDAA 2PKQO 3EVNA 3A1NA 2DUUA 3M2TA 3RUCA 3PYXA 2GPTA 3DDNA 2Q4EA 4GKBA 4R69A 2PGJA 4UVGA 4EUFA 4OM8A 1T2DA 5GZ1A 4XD2A 4YAGA 1I5RA 3RC1A 1NNUA 2X58A 2YY7A 3UOGA 4CMBA 4CLOA 3WB9A 3ORFA 3SEFA 3RD5A 2X23A 1N2SA 5JY6A 3U5TA 4CQMB 2FY8A 1CRWG 3QVXA 2VWGA 4YJFA 3F5SA 1ZXBA 3WTBA 4ID9A 1A27A 1OC2A 3IP1A 1XU7A 3KZVA 1PZFA 1UUFA 3BAZA 4ZGWA 5FFFA 3FSRA 3BYZA 4IGFA 3TFQA 3F47A 2AQKA 4R01A 4TWRA 4GI2A 2HJSA 1QYVA 4H3VA 4PVCA 1SAYA 1JKJA 1Z74A 4QUKA 4PG6A 2OOSA 4KQXA 2DBVO 4O63O 1NAHA 3NGXA 1EK6A 1TVEA 5ADHA 5JCJD 3VVCA 2VRCA 1SZJG 3EZYA 1YOVB 5HTOA 1I3NA 2BH9A 2C29D 4IM7A 4YTEA 3TFOA 2X22A 4ZJUA 1DC6A 4RVFA 1DIHA 4MP3A 5IDYA 3V1YA 1GEEA 4U5QA 3SVTA 1I8TA 4W7HA 3OJEA 2P9GA 4UUPA 3C1TA 4OAQA 2I67A 1IZ0A 5T8KA 2Y1FA 1PJSA 1FMCA 2FMUA 1DSSG 3RU7A 3V2GA 4CM8A 4Y9DA 2RCYA 4WEOA 3KYBA 4WASA 1JAYA 1PZGA 4O1MA 2VYNA 2YQ4A 3ANNA 4JLWA 3ZNOA 1UXIA 3NT4A 4MPDA 1LRJA 4II3A 4PLWA 2VOJA 1LLQA 4YT5A 1O6ZA 3OIFA 5B4VA 3OSUA 2W90A 2B69A 3PZRA 2J3IA 1E3EA 1S6YA 5HS4A 4D3SA 5C3MA 1ZBQA 4H16A 4E6PA 1SEPA 3H3JA 4II2A 4Z9XA 3AW9A 2FHSA 2ZIZA 4CM4A 5TJ9A 4NH4A 4BQPA 3FPCA 3PLNA 2OL4A 4CLHA 3FWNA 5GZ3A 5GMOA 5H83A 5L40A 3KHUA 4AJ1A 4RPGA 4B4OA 4MVJM 1I32A 3LDHA 4Q39A 1IL0A 3VZSA 5DOVA 4Y6PA 2DTDA 4E5NA 1X13A 3SBOA 4GX1A 5A9SA 4GVXA 3NGLA 4FJ1A 4O0LA 4JXKA 4FGSA 1E5LA 4BMVA 2Y66A 4IQGA 1E3IA 1W6UA 2Z1NA 1FDUA 1M2WA 3ITDA 2O3JA 4FBGA 2PD4A 4ZU3A 4GSKA 1EK5A 1I2BA 3VPSA 1U3TA 3RUAA 1P1KA 4UUOA 3WGOA 2X1HA 4F46A 4NFYA 2VRCD 1NFRA 3ZWCA 3DFZA 2WMDA 1PGOA 2HLPA 4BNWA 1KS9A 3GC6A 2D4AA 3JQ7B 3ZWPA 2H6EA 1KVSA 2G0TA 2HRBA 2OP0A 4Z3KA 1WDLA 1R4NA 5A9TA 3CH6A 1R4MB 2GNAA 3JD3A 3P2YA 3MOGA 4IQ0A 5A3JA 3D4PA 2J5KA 5GY7A 4YJGB 3VH1A 4INAA 3MJEA 2DFVA 2VYND 1P1IA 5ICMA 1NX6A 5BNTA 3PFFA 3K6JA 4LN1A 3E5RA 4IPTA 3WICA 1ZK4A 2NVUB 2AQIA 3TJRA 3G0OA 1UP7A 4QEDA 1BW9B 3LK7A 5A1TA 5DT9A 3HDYA 2CMDA 2GGSA 3IKVA 4CLEA 3P5SA 3ROQA 2PH3A 4WGGA 2YV1A 3GNSA 3QA9A 3PQEA 1NASA 2YZ7A 3WOHA 1H6CA 3ZV5A 2GDZA 1IUKA 3I3OA 5A5EA 1A72A 2BGLA 1T2CA 3R6DA 2PKRA 3ETGA 1BSVA 3INRA 3ZI0A 4JJIA 1YDEA 2Z5LA 4IGEA 1FDSA 1HRDA 4YQYA 1U4OA 1PQUA 3DQPA 2Q2WA 3GZNA 1QKIA 4CLDA 4B3JA 3GPDG 3D0OA 1YL7A 1I24A 1MFZA 3ASVA 3R3JA 4MOWA 1GYQA 2QRKA 1HE5A 4KUGA 1KVTA 4P4GA 3LLVA 2LDBA 1P0FA 5CDTA 1B7GO 1IY8A 2VOEA 3A4VA 3I9OA 4RDHA 3ZHBA 1R6DA 2QW8A 4CMIB 1DLJA 4KWHA 4AJEA 1C1DA 2V6FA 4KWIA 2FOIA 4XIYA 3NJ4A 1Y1PA 1KEPA 2RIRA 1ENZA 5K0ZA 2VNAA 1LDBA 4AJPA 5EERA 1TLTA 4I9NA 3GNTA 1HDYA 4J7UA 5JW6A 4HFRA 1LI4A 2Q1UA 1EVYA 4I1IA 5DN9A 3A9WA 3UUWA 1KEVA 4WOKA 2BHLA 3RBXA 5I7VA 2PH5A 5JDCA 1LBEA 3C1AA 4H15A 4HNHA 1GPDG 4UULA 2O3SA 4Y98A 3JQFC 2W8ZA 3RFTA 4CR8A 2G17A 2P9CA 1E5QA 5THQA 4TKMA 3F4BA 3FNHA 4MO2A 5G4KB 1HT0A 3IAHA 5I9LA 4U8GA 1SMKA 3NT2A 2EJVA 3U9LA 3ON5A 1U3WA 2B0JA 4L8VA 4PG5A 2O3QA 3AOGA 3RJ9A 4BVAA 4YT8A 4B79A 5G0VA 3GRKA 3PHHA 1V3UA 2VTEA 3A14A 3OQ1A 3WLFA 3R0IA 1HTBA 3PIDA 3D4NA 3RQSA 2VCYA 1NHGA 4BNIA 3ETEA 1O0SA 2DFDA 1DHTA 5JPIA 5KCZA 3QP9A 3E82A 4RLSA 1VJ1A 3A06A 2R00C 1NQOA 5JYAA 2CDCA 3GQVA 3X2EA 2Z1MA 1NP3A 2HO5A 1YRLA 1P1JA 3E6AA 2QQ5A 1PGQA 3ZN2A 2IYPA 3AUTA 3L07A 2QZ9A 2D0IA 1Z7BA 3GNQA 4XR4A 5EINA 4L4SA 1DXYA 4PZEA 3WBBA 4J7CA 4NBUA 3ZWMA 5AOVA 2QIOA 2HMSA 3H9UA 3W6ZA 3DO5A 4DYVA 1Z6ZA 4LK3A 1O94A 4DLAA 5ILOA 5TJHA 5CAEA 3WMXA 3GMDA 4IDBA 4N5LA 2HMTA 3VH3A 2HK9A 1B8PA 4FSHA 1B0AA 3PDJA 3FR8A 5F21A 2A35A 4R9RA 2C82A 3AU8A 3VKUA 3BTSA 5G0TA 4QQRA 1DOHA 3ZWBA 1NQ5A 4BNTA 3EDMA 2PGLA 1QLHA 3RC7A 3KYCB 4ZQHA 3ST7A 4B8WA 5IDQA 1UDBA 2Y1GA 1T4DA 3LT2A 4KDFA 1X1TA 5KJCA 2V6MA 1Y9AA 4Q3NA 1U7HA 3JQ8A 1UXGA 4YBZA 5TT0A 8LDHA 1WZIA 3LC2O 3UHAA 1M66A 1E1KA 2PK3A 4WLFA 1GPJA 2EKQA 3L77A 3EAGA 1E7SA 4QXMA 2D1YA 3RCBA 3EYWA 5L53A 3OJLA 3W4IA 2V65A 4MVJP 1F12A 2X9GA 1J4AA 4CMEA 1DIBA 3KLMX 1ZFNA 2HMVA 3T7EA 1KVRA 3QE3A 4PG7A 1U3UA 1PWXA 2JD2A 4R1TA 2P9EA 4IMPA 4NJMA 4R4JA 4LISA 4WLNA 1VL6A 4N18A 4XCVA 3GH3A 3JQ6A 3ZU5A 3RBVA 3ZWOA 4GWGA 3QVTA 3KVOA 4GMFA 4DC0A 4FFRA 1YO6A 2NLOA 1DLIA 3HB4X 4WCFC 5DP1A 4AJLA 5DF1A 4HX5A 4UAGA 3HHPA 5T57A 1U3VA 4C7JA 2X0RA 3DZBA 4DGSA 4AJ4A 3U4IA 1ISIA 3RIHA 4HV4A 4DRYA 2WTBA 4JBGA 3ZWAA 3OHSX 3O8QA 2HK7A 3GFBA 5TF4A 3W1VA 1LDEA 5G0WA 2PGDA 4YJHB 3IDSA 3H9EO 1EE9A 1Q0HA 5JSFA 1U4SA 3RJ5A 1UH5A 1ADBA 4PLTA 1H94A 4D42A 4XEHA 2F00A 1N9GB 3KRTA 4CMAA 3VKVA 1CDOA 4KOAA 4KZPA 1CQJA 3D3WB 1LQTA 2G1UA 3COSA 3HWRA 3G49A 4D44A 4MIYA 2FPGA 3UCEA 4ZA2A 1A4UA 3DOCA 1OZAA 2DQ4A 2GSDA 4GKVA 4FD3A 2JD0A 2O50A 3U4HA 1PU2A 5T5QA 4DXHA 1RKXA 4AJHA 3VH4A 1HLPA 4M86A 4N54A 3V2UA 1PGJA 3NTRA 3AWDA 3BMOB 1CWUA 3JQEA 3WYCA 5FYDA 1P74A 4PZDA 2VHXA 4IUYA 5BR7A 1PJLA 1O89A 2I66A 1B3RA 3K96A 4BNVA 4UUNA 5C7IO 4B7CA 3AFNA 1A9YA 3HDJA 3GHYA 4L0QA 3GAFA 3F1LA 2J5QA 5ENVA 5IDXA 4E31A 2YUTA 4OO3A 1F17A 2POQX 1E3SA 4J1TA 4JJGA 4IIUA 4CM3A 3QVWA 1M6WA 4J49A 3ETDA 2ZCUA 3D3EA 3IMFA 4DQXA 2IDZA 4JBIA 5CG1A 4Z0TA 2O48X 3HDQA 3PHLA 2JD1A 1AHIA 1P45A 3H9QA 1J6UA 3GDOA 4C7KA 1DC5A 2Q1TA 3HDHA 5U9CA 1SB8A 1SC6A 3IUPA 3MJCA 5LDHA 5B1YA 2YDYA 5J9GA 4D3DA 5KVCA 2ZTLA 3CZRA 4J2HA 3I9LA 1Q0QA 3AI3A 1DRWA 4ALNA 3OIGA 3JTMA 3LT4A 3F5QA 3FTPA 4EBFA 2ZB4A 2ZB7A 3BMQA 4E33A 1AHHA 1NXQA 2G5CA 3PJGA 4L75A 4RPJA 1YBVA 2GN4A 4WJZA 3S2EA 2QYTA 1PS0A 3ZV3A 4W99A 1VE9A 1UXHA 4OIMA 2AE1A 3IP3A 4EJ0A 5CPBA 1BHSA 2ZJ0A 1WAMA 3WNQA 1Y8QB 1CERA 5CDGA 3L4BC 1ORRA 2AEJA 1PJ4A 1FDTA 3ZWWA 5A5FA 4A26A 4FGWA 3HG7A 3GGPA 4XR9A 4BGIA 2O4CA 2AXQA 3DMTC 1UZLA 2C54A 4MDHA 1DRUA 2GLXA 5FF9A 4WE3A 3OA0A 1IZ9A 2PZKA 3LLSA 3AU9A 3H9GA 4WCDA 3MJSA 1KOLA 4CM1A 4EITA 3JQGB 4R68A 2G82A 3Q2IA 1E3JA 4KQWA 3HFGA 2CFCA 2Y1DA 1BDBA 4IINA 3NYWA 4Q3AA 4YAEA 4Q3BA 4DA9A 2DPHA 2J6IA 1GCOA 4OQYA 4PLGA 5AQ1A 3KOUA 3QIVA 3STHA 1NR7A 5IJZA 1E6UA 1ID1A 2EWMA 1I3KA 4UVIA 5I9MA 1F14A 3CSDA 5TT1A 4YRBA 5TSDA 2GUGA 4E2XA 5FWNA 3JYLA 2ZTVA 3KTDA 3F4LA 5DCYA 4RJTA 3VZPA 2VUSA 1X14A 2DVMA 1I0ZA 3R3SA 3N58A 2V6BA 3GDFA 2GN6A 3OA2A 3PEFA 3RFXA 3L6DA 1GY8A 2I3GA 3NTQA 3TNLA 2EERA 1A71A 3W8FA 4EYEA 3HQ4O 4DBZA 4E13A 4IDFA 3PRJA 4Z0PA 4MIEA 1B15A 4GL4A 3U4DA 5I7SA 3DL2A 4K26A 3VZRA 1HE3A 3PWZA 1T2FA 2FR1A 3CEAA 4BO3A 1H2BA 4E32A 4OXKA 4J4TA 4FOSA 1GCUA 4WK6A 1QG6A 1UXJA 2AG8A 5A04A 2I6TA 3GOHA 4J0EA 3B20A 4IBOA 3JQBC 1F8GA 4BO8A 4UREA 5DBIA 4MKZA 3OFSA 4JCOA 1XU9A 5HWSA 4KTVE 3DMYA 3PIIA 4XJSA 1HL3A 3I1JA 1E3WB 3QY9A 1FDVA 2NADA 5TX7A 1PJTA 2X4GA 3KLPX 3S2FA 1YGYA 3TOZA 5EIOA 2OBYA 2OO5A 1E6WA 5TGDA 2O23A 1XKQA 4BNNA 4RF4A 5CEJA 4OKIA 4DPMA 4MVJF 1PEDA 1PR9A 1XELA 3S55A 3V5NA 2I99A 4CMJA 1VJ0A 3PWKA 5IZCA 1BVRA 4CR6A 4PGFA 4BNKA 5C7OO 3HZZA 4J4HA 5K6AC 3JQAB 1PL8A 2OUIA 5JDIA 3H2SA 3QWAA 4HUJA 3ZH2A 4PRLA 4BV8A 1Q7GA 4DQVA 2CF5A 4NMHA 1N1EA 1ZK2A 4DWVA 3CMCO 3BTVA 1IE3A 1E0DA 4RCVA 1JLLA 4CUZA 4EGFA 1ZJZA 3Q1LA 1TA4A 4PLYA 4CM9A 3V2HA 1WMBA 1PZHA 2Y0DA 2ET6A 2CF6A 4CQLA 4L74A 4HWKA 1Y6JA 4BNUA 7MDHA 4HFMA 4FB5A 2C59A 5ENDA 1HSOA 1YDWA 4F6CA 2HUNA 2HMWA 1HDGO 2EV9A 1NVTA 3AY7A 3V8BA 4RZIA 2VHYA 1NPYA 3FBTA 4PLVA 5JXWA 4RL6A 3TSCA 3AY3A 1R0LA 4PLPA 3ZNNA 2FWMX 4XYGA 2AQ8A 3DZIA 4S1VA 2BFAA 2YYYA 2PV7A 1P77A 2NTNA 1FF9A 4ROSA 4L4RA 3RUEA 1CJCA 3FR7A 3UCFA 3IQDB 4FQ8A 3GVPA 2NU7A 1JWAB 3EVTA 1XDWA 1NFQA 3WDSA 3WGTA 4ZD6A 1P44A 5CEFA 4J7XA 5L3ZA 3D4OA 5ER6A 4WCFB 1H6BA 4DQUA 5HM8A 3HNPA 1NQAO 3OBBA 4BO6A 2UUOA 2IE0A 4FS3A 1UZMA 1PZEA 4LMPA 4OHUA 1ISGA 2PZJA 1JW9B 3GA0A 3L4SO 4GAEA 3PGJA 3I9NA 2Y05A 2GR9A 1FXSA 5AXAA 4MVJI 1VL8A 4BMNA 5LDGA 4J1NA 4K6CA 4J43A 1NVGA 3WQQA 3C24A 2EJWA 5TIIA 3GEGA 4KDEA 4ND3A 2FZEA 3HUDA 1EBFA 3ENNA 4RVDA 1K0UA 5KJEA 4AJ2A 4AL4A 4CM9D 4FC6A 3L6OO 1C0PA 4WLEA 3K31A 3U4CA 2Q2QA 4Z9YA 4FOOA 4F45A 4CLRA 1N8KA 5T6BA 4YAIA 1HKUA 1QXSA 2XXJA 4DL9A 1GAEO 3C85A 3ULKA 2Y1OA 4O59O 1I3LA 4E30A 1E3LA 1LRKA 3WR5A 2VUUA 2NV6A 4XX0A 3UW3A 4Q3DA 5A03A 2P2SA 2HQ1A 3BMNB 2WEKA 3Q0EA 4PLZA 4IDDA 3AI1A 2YFHA 4CV1A 1NQTA 4D43A 1DO8A 4A73A 2ILTA 1GZ6A 1OAAA 1RYDA 1QLJA 4FPXA 3DXFA 1BMDA 3H6KA 3AM4A 3K9QO 3EHEA 5JMWA 4MINA 1AGNA 3NT5A 2J3KA 5H81A 4P4LA 4BB5A 4B7XA 3DZHA 4BHTA 2B4TO 3DC2A 2GZ3A 4IQ8A 1UDAA 1LLUA 5CP8A 4YXFA 2GYYA 4FDAA 1LSSA 3ZWNA 1ULUA 3A28A 1XQ6A 2XPCA 3ZV4A 3AOEA 3PQDA 2VZ8A 3LT1A 1PQWA 3FWZA 2O3TA 3KUXA 1E92A 4B3IA 2NQTA 1Z7EA 1C0IA 5FI3A 1YBAA 4L76A 1LA2A 5G0SA 1V3VA 4RGBA 4YQZA 1FJHA 4P22A 5L7TA 2XAAA 5CFZA 3GT0A 2YFQA 2DBRA 4M8SA 5F1OA 4WLVA 3K2BA 4WNIA 1GV1A 2DM6A 1GV0A 2PNFA 3HN7A 4RPLA 1CF2O 4NR0A 2VZ9A 3GEMA 5JAZA 4JNKA 2QG4A 4RV9A 3RUHA 4WECA 3QQPA 4YDRA 4D41A 1NPTO 2JCYA 3P7MA 6LDHA 2C7VA 1KYQA 3AJRA 4GLOA 3OJ0A 1VSVA 2HRZA 2FR0A 2IRWA 4BNGA 2I65A 2CVQA 5AVOA 1K6IA 3GMSA 3WJ7A 4ITUA 2BD0A 1VSUA 5DULA 1Y8RA 3BTUA 2J3HA 4EJMA 3O26A 1GZ4A 4FFOA 3RWBA 2GERA 1HF3A 1F8FA 1R0KA 3VOSA 4PN3A 4MVJH 4N5NA 2EP7A 4PLCA 1YB1A 4I5GA 3MZ0A 2RBEA 1DHRA 4NIMA 1EVZA 3B1FA 4X54A 1C1XA 1M67A 3JQ9A 4GWKA 3TZKA 2OORA 3DBLB 1JN0A 4G2NA 3RROA 4B4VA 3BMCB 1ZVMA 2P68A 3OP4A 3DOJA 2B5WA 1YBMA 1QSGA 4PCVA 3I23A 1X7HA 2Q46A 2WJPA 5B12A 4HFJA 5JCXA 2FP4A 3DWFA 4BNFA 5I7EA 3PHIA 5LC1A 4G5HA 4XB1A 3U62A 3Q2KA 1PJCA 3I9JA 4OOFA 5I7FA 4RF3A 1C0LA 3PWSA 1AN9A 2X0IA 3OQ6A 4CV3A 4LRSB 1HDCA 4Q9NA 4QTZA 3H9JA 4FFLA 4I5EA 3PGXA 4Z0HO 3RC2A 1CQIA 4MIOA 2FZWA 2ZATA 2VN8A 1ADCA 3TQHA 2PZLA 4A27A 3HFSA 2Y93A 2DC1A 3DBVO 2FRDA 1J49A 3CIFA 1JWBB 2VUTA 4LRTB 4BNYA 3DBRA 2JFGA 1U7TA 5T8KC 2YDXA 4HXYA 3WLEA 1DIAA 3ZHYA 3INGA 4ZN6A 5TS3A 2J3JA 3JSAA 3EK2A 2PTGA 4XGNA 2GN9A 2P4QA 4OXYA 1UR5A 3GGGA 2D5AA 3GY0A 3WX0A 3D1LA 4OSOA 3GVIA 2EP5A 2I76A 1J0XO 3H7AA 2RH8A 2GCGA 3ICPA 4IDCA 4JBHA 3ZV6A 4JQCA 3NDIA 2D5CA 1KY4A 2ZQZA 4C4OA 4CQMA 5JYFA 5C37A 2VHZA 2IZ1A 3FRJA 3Q3CA 1ARZA 2ZJ1A 1AXEA 2X5KO 2OBNA 1LUAA 3GHHA 1YL5A 2D3TA 3E5MA 1SOVA 3OMLA 1BXGB 2O3UA 4ALJA 2BF7A 3EZLA 2BGKA 4UVHA 1X1EA 3DTTA 1EBUA 1BXZA 5JMPA 1L7DA 1W0CA 4GGOA 4NK4A 2YHIB 5TC4A 1VI2A 1NTOA 1ZO8A 3DAPA 4R54A 2PKQP 1EDZA 1PTJA 2VT2A 3SXPA 4IDGA 1NPDA 1ADGA 1UXKA 3LC1O 1B26A 1Z45A 2EKPA 4XZ3A 4BMSA 1Y7TA 3DZFA 3MJTA 1JKFA 1SBYA 1X7DA 4NBWA 3ABIA 4DYDA 4CM7A 3EMKA 1LDYA 4KTTE 1ZZEA 3FHLA 3W6UA 1W8DA 3LF2A 1PJ2A 1VM6A 2OFPA 4J3FA 3ASUA 4CPDA 4PG4A 1K6XA 1ADFA 1MGOA 2VHWA 4Z3DA 4HY3A 2NU6A 1ENOA 1OFGA 5FI5A 3WBFA 1MG5A 4GGPA 3ANLA 2WD7A 1H6DA 7ADHA 3SJ7A 4EW6A 5JO0A 4OMUA 2DLDA 3PJFA 4OL9A 2W2KB 3B1JA 1I2ZA 4J9VA 4YYZA 4BOYA 4NZ9A 3ONDA 4QO8A 4W82A 4AG3A 4FW8A 4R51A 4TRNA 5JC1A 3ANMA 1T26A 4XQGA 3SLGA 4DLBA 1B8VA 3G1UA 2NQ8A 1YL6A 1MLDA 1Q7BA 4W9NA 3TWOA 4CQMD 4D0RA 3TF5A 3WG9A 2BELA 1LLDA 4JGBA 4A10A 1DJNA 5KNLA 1WMAA 1P31A 1KC3A 3H5AA 3M6IA 2V6GA 3DFUA 3B1KA 3O03A 5G2OA 4GH5A 1WVGA 1PS8A 4M54A 4M55A 3HE3A 2NTVA 4DUPA 5JYDA 3KSUA 4WLUA 1K89A 2B83A 3NX4A 1G6KA 3JQDA 5BNIA 1ZSNA 5MGBA 1UAYA 5A9RA 2PZMA 1KVQA 4XQCA 1LDGA 3ZHXA 3GFGA 3JQ7A 1YS4A 5FEUA 5KJFA 5DZSA 3RI3A 2CDBA 4XDZA 1MX3A 4XB2A 1R4MA 3C1OA 4R1SA 4RQTA 4RVUA 3DR3A 3DBHB 4R1UA 1EUCA 3JD0A 1LJ8A 4WPGA 3TL3A 4YJGA 4Z9FA 1GUZA 1VKOA 2Q99A 1RM5A 1D7OA 2C2YA 2DBZA 2UDPA 2NVUA 3H8VA 5IFLA 1QMGA 2AEFA 3C7AA 4TRJA 1WDKA 1BW9A 2Q45A 3DOOA 3PYMA 3PJEA 4RO0A 5JDCC 2GD1O 1DFHA 4J91A 5BNFA 4CODB 3O9ZA 4XKJA 1Y5MA 1Q7CA 1KC1A 1ZSVA 4ZQEA 3ROKA 1FK8A 2AHRA 4R3WA 1IB6A 3F6YA 1I10A 3KBOA 1DAOA 4IY1A 2QHXA 2JL1A 5G4LA 1N1GA 4BO1A 3L9WA 2YJZA 3I5MA 1DAPA 1JAXA 1HDRA 4AVYA 1IOLA 4ESOA 4RVHA 5G0UA 5F1PA 5I9NA 1OBFO 3S8MA 1PGNA 1XG5A 1I01A 5EQDA 5L9AA 1B14A 3AM3A 3Q9UA 4EUHA 4D3FA 3L6EA 4DMLA 1IYZA 3K92A 2EF1A 1AE1A 5DDIP 1M6HA 1TT5B 3CMMA 2IEBA 4CMIA 4RLHA 5TRTA 4D0SA 2C5AA 1MC5A 3KEOA 1BRMA 1R16A 2JAPA 5DBGA 5EQFA 4U6QA 1JDJA 1R66A 2NSDA 5B4TA 5L4SA 3KYDA 2H5LA 4HKTA 1ZNQO 1E7QA 1PIWA 5IAAA 1PX0A 2JAHA 3OECA 1PGPA 3WFIA 1NAIA 1I33A 2V7PA 5C5IA 4ND5A 3WYEA 4L4XA 1H9BA 2TMDA 1CIVA 2VT3A 4ONEA 4QT0A 5G4KA 3OQBA 3RVDA 4RF2A 4U0KA 3HJAA 4NDNE 4BIIA 1RWBA 3LYLA 4ALLA 3U3XA 3MEQA 4NG5A 3LU1A 1WW8A 5M6DA 4Y8VA 5BSFA 1TI7A 1PL6A 2XF8A 3I4CA 4YPOA 4R3NA 3GVCA 1MP0A 1ISMA 3MTJA 3UKOA 1CETA 3V1UA 2A92A 1VKNA 3G17A 4BKQA 4DIOA 1XLTA 2GRAA 2Q49A 4ZQGA 1RM3A 3SC4A 4CLOB 1W4ZA 1QV7A 3F1KA 5B4UA 4YB8A 3UGKA 4EDFA 3ZDFA 4BO5A 5KVQA 1Q0LA 4XRRA 1TXGA 2RHCA 3WXBA 2A94A 3OM9A 4YJFB 3GVXA 1RM4A 1J5PA 4XQ9A 4IS2A 4EEXA 1QORA 4I9HA 3E18A 4CMEC 1ZKMA 1XYGA 2HCTA 2JCXA 2FSVA 3SX2A 4CL3A 3HSKA 1UAGA 2Y0CA 3WTCA 2BRUA 3CUKA 5BQFA 4P8RA 2FN7A 2GO1A 3CTMA 4GX0A 3MTGA 4IJUA 4FJ2A 4F3YA 1YB4A 4L73A 3PDUA 2UAGA 1CYDA 2QYSA 1GYPA 4PFJA 4J1SA 3JD1A 5KOIA 1PS9A 1MA0A 3ZHZA 4JROA 2GN8A 1A9ZA 2D59A 3P2OA 2SCUA 2H1SA 5JAQA 4XA8A 3WSVA 3FCOA 2AE2A 4DVJA 1ZK3A 5CDUA 2HMUA 3D64A 3W8EA 3GRPA 2IXBA 3KYCA 3K73O 3MJ4A 4PVDA 3T7CA 4KUEA 2HKIA 2HJRA 2QRLA 3B70A 2Y1CA 4ND4A 1D1TA 3VHRA 3JYNA 2CD9A 1EQUA 2Q2VA 3QW2A 4R5HA 1GR0A 5BT9A 3JCZA 4CM8B 4U0JA 1V9LA 1P0CA 4G65A 4DTIA 3WIDA 5IN4A 1UJMA 2QZZA 4LVUA 4MVJG 3PLRA 2J5RA 5BSHA 2G76A 3HN2A 4CUJA 1QRRA 2PR2A 2HDHA 3ROMA 3KSZO 5ITVA 1PJBA 2XOXA 3QWFA 4R1NA 1T1RA 1OC4A 4LCEA 4CM4B 4E2YA 1C3VA 2VWQA 3DAFA 2HSDA 2Q4BA 2Q3EA 3LT0A 1ENPA 4AJJA 3ZNPA 3RBZA 1MV8A 2NNLD 1QP8A 1GADO 2Y99A 4HBGA 4I8XA 4LW8A 5BSEA 5A9SB 4TRMA 3FPLA 4N7RA 2OMEA 4UEJA 2LDXA 1KEUA 1EFLA 8ADHA 1LX6A 4GX2A 3AI2A 4GX5A 4U6SA 5IXYA 3H5RA 4FCCA 3O4RA 1MG0A 1X15A 1P1HA 1Y81A 5KJ1A 1F06A 1WZEA 2HAEA 2BKAA 2H63A 1M75A 4M87A 2EGGA 4YJHA 1BTOA 3NDJA 4UVDA 1E6EA 2EG9A 4BGEA 2GASA 1I3MA 3N74A 4NU5A 3IJRA 1R4NB 4ALMA 1N9GA 4BGUA 1ZSYA 1E7MA 2UV8A 5A06A 4E2ZA 2E82A 3D3WA 3R1IA 4HFNA 1U2GA 3HADA 3BIOA 4L9RA 1HDOA 4PLHA 4Y6RA 4RPHA 4YWJA 4TZTA 1NWCA 2NU9A 2OHXA 5MDHA 4J16A 3KV3O 4ZHSA 1XSEA 1PSDA 1QYWA 3HB5X 4TQGA 1G1AA 4IDEA 4ZRNA 3ZU4A 3FD8A 4E21A 4Q3EA 2O2SA 4A03A 2GZ1A 3E9MA 2RAFA 3P19A 1DC4A 4JN6B 3BMOA 5JE8A 2PFGA 2AA3A 2NU8A 3OETA 4AJKA 3EUWA 1LSUA 4J0FA 2R2GA 3ZW9A 1HE2A 4NFHA 1ML3A 1ISJA 3AUUA 3GEDA 1E7RA 3GZNB 5KJ6A 1SCUA 4XYBA 2O7SA 3DZJA 2QX7A 3T4XA 1RYEA 3LC7O 4CMGA 1C0KA 3ZZNA 3I9KA 3KB6A 4E4YA 1ISFA 4RVGA 4JP2A 3IKTA 3RC9A 2WD8A 3FN4A 4QX6A 3OEWA 3Q6IA 1QYCA 5TNXA 3WGQA 1DC3A 2B37A 2B36A 2JKVA 5L7YA 1C1DB 2PY6A 5CDSA 3GZ4A 5A02A 5L7WA 4FFMA 1SO8A 1P1RA 3M1AA 4U7WA 1LSOA 4I9UA 4XIJA 2ZTMA 2OP1A 1YB5A 3RUFA 4BNLA 4Y6SA 4RQUA 3UXYA 2I9PA 3FI9A 4MKXA 2DTEA 1OMOA 3E9QA 4J1QA 4GBJA 3T4EA 2WE7A 4DLLA 3LZ6A 4A0SA 4A7PA 1O95A 4BO4A 4GMGA 1R0SA 5U1PA 4CLXA 1ENYA 5L4LA 2DBQA 2B4RO 5JO9A 1XQ1A 4K9DA 1L7EA 3KM0A 1DRVA 2EGHA 1X7GA 1Y8QA 4D46A 2BFPA 4AJIA 4JX8A 5KTKA 4NNJA 1XR3A 4XYLA 1L1FA 2DUWA 3EC7A 4YAJA 1T2EA 5HS6A 3WWZA 3GDGA 2X9NA 3NJ8A 2E37A 1XWFA 4QFCA 2X86A 5ITWA 3BHJA 3GUCA 3U0BA 4NBTA 4E3ZA 2H9IA 1R37A 2TMGA 1Q2XA 1U5AA 4CMCA 2X5OA 3H4VA 3JQGA 2EW8A 4B7UA 5CEEA 4FC7A 4E5YA 5A3VA 4BV9A 1EFKA 3OIDA 5C7LO 4MVJE 3C3XA 3K30A 3MWEB 3N7UA 4JIGA 4YA6A 4YR9A 5KIAA 4H7PA 1E1NA 4Y67A 1VLLA 1GU7A 5KKAA 3RASA 3ZU3A 1LTHR 2X6TA 4JK3A 1D4FA 3WGHA 4EJ6A 1ISHA 3DHNA 5F5LA 4CV0A 2Q1WA 3G79A 4OGWA 3W8DA 1HYHA 4BO0A 3JQFA 1I30A 1BWSA 3FBGA 2WD7B 3BHIA 4YVFA 1LXCA 5IZCC 2Z95A 1HLDA 2PD3A 1DIGA 4WOJA 4JP3A 3ZW8A 4NU6A 5JDIC 5JS6A 1H5QA 3QRWA 3GLQA 5KWEA 2NM0A 2VZ0A 3RUDA 3GG9A 4NJOA 1YH3A 3PP8A 3OEYA 5L95A 4E2WA 1GTMA 1O5IA 3IS3A 4OYRA 2AG5A 2RH4A 2YV2A 2NWQA 5DNAA 4J6FA 3QVSA 5T67A 3KSDO 4YRAA 1ZW1A 1SOWA 4XYEA 2W2LA 3H5NA 9LDBA 3JQ8B 3JD2A 2E6UX 4IS3A 4WUVA 3SC6A 4XQEA 1WNTA 2YQ5A 1AUPA 1SB9A 1TB4A 2R00A 3K2EA 4MP8A 3WGGA 1K2WA 2D8AA 1IHYA 3GK3A 2JJYA 4A2CA 3LSYA 5B37A 1RPNA 3ZWVA 4YACA 1P1FA 3GF4A 1KIFA 3VPFA 1E3WA 4YJDA 3E1KA 3ADPA 4HADA 3WQRA 4B8ZA 4W6ZA 2J8ZA 1B16A 5GZ6A 2OZPA 2B35A 2ZB8A 4J90A 2EHDA 1DFIA 2P91A 1TT7A 3QVOA 3U09A 2WWRA 1HDXA 4LGVA 2VTDA 1K6JA 3EGOA 4NJMB 2CZCA 1HYEA 1VRWA 5L51A 5AXBA 1DBVO 1BVUA 2BI7A 3JV7A 4NI5A 4TZKA 5DOZA 1KY5A 3JQAA 1GUFA 5T73A 2VHVA 1SPXA 4TROA 3JYPA 2NUAA 4J4BA 3OICA 1WLYA 2AW5A 2Q1SA 3QLJA 3RUIA 4RPKA 3NEPX 3VTZA 4R41A 3VPXA 1Y5RA 4BQRA 4FFPA 2CVOA 2UUPA 4KMSA 1YE3A 3MWDB 2VWHA 2D2IA 1LRLA 5COAA 2AEMA 3BA1A 1PQPA 2FSSA 2DAPA 3LF1A 3O8QB 4ND2A 1X0XA 3LQFA 4OSPA 4RORA 5ICSA 1XEAA 3GG2A 4R9SA 3QV1A 1MC4A 2Y1EA 2Q22A 5BSGA 3IJPA 4PLFA 4TVBA 1N5DA 3TZCA 3ADOA 2X7HA 1QV6A 3ZCXA 5F3RA 3PQFA 1WXDA 1HE4A 2W2LD 5LCXA 1YJQA 2FPIA 3DEYX 3I52A 3WMWA 1LDMA 4BNZA 2Y67A 1XIVA 4IJVA 4ZRMA 2QRJA 3TOXA 9LDTA 5CPFA 4B4WA 3WYBA 2CVZA 1EVIA 4LMRA 3I9MA 5AXCA 3WGZA 1AXGA 1KERA 1YQGA 3QJ5A 5JFOA 3ICCA 4EZBA 3VC7A 2O2YA 4PIVA 2VNSA 3I4FA 3AUAA 4YAKA 1B8UA 3E03A 4WCFA 3GR6A 1BGVA 5TQVA 1T4BA 1ZIDA 1PR3A 4FR5A 3RSHA 4DIBA 4O5OA 3VZQA 1XGKA 5HA5A 3NRCA 5L45A 1JVSA 5HBRA 5L4NA 1EEHA 4URFA 1XCBA 4J9UE 2YW9A 1BG6A 1LLCA 1U9JA 2VWPA 1NR1A 3DAGA 3QWIA 3JQAD 3KYDB 3UFXA 1LQUA 4RDIA 3E9NA 2B4QA 3AK4A 4K1LA 1I36A 3BXXA 3UCXA 3I83A 3IOYA 5KKCA 2O7QA 3S2GA 1VL0A 2NACA 3FTNA 1YOVA 3ITKA 1NFFA 3TZHA 3AOEC 1E1MA 5DP2A 3D5QA 3ZU2A 2PWZA 4HNGA 4N5MA 1U8FO 3CE6A 4O6VA 2P5YA 1V3TA 5ES3A 4RVSA 5DBFA 2YHUA 4HP8A 2AMFA 3F3SA 4KP7A 2OXIA 2OGUA 2C7GA 4YCAA 4AFNA 4BNXA 4XGKA 4BS9A 2X8LA 3BMQB 4ILKA 3BMNA 5JAIA 1ZK1A 4NK5A 2DTXA 2X0JA 2WSBA 3ZGYA 5HRUA 2PA3A 3MJVA 3K8ZA 2IZ0A 3TZ6A 1F0YA 4DMMA 1XA0A 1SNYA 3WIEA 4AICA 3CZMA 1HSZA 3W4JA 4RZHA 2VYVA 1LU9A 4A5OA 1ZJYA 3FNGA 3I6QA 1UP6A 2PD6A 3OJOA 1VJTA 4TMFA 2DU8A 1H9AA 1H2HA 2WYVA 1YJ8A 2E48A 4G81A 5EJ2A 2PLAA 1ONOA 3AM5A 4B4UA 2BMAA 3VVBA 4I5FA 3RKRA 3DZKA 4EEZA 3WGYA 2UVDA 4BNHA 3WSWA 1GQ2A 3ONFA 4CJXA 4CMHA 4EI2A 3JQ9C 3NTOA 5I8WA 2DKNA 2ZYDA 2EXXA 3WJAA 3B6ZA 3OJFA 2EEZA 4GQAA 4ZQBA 1JU9A 2UYYA 1YKFA 1JVBA 1PJ3A 2F1KA 3RFVA 4DPKA 1GZ3A 1Z75A 5ILGA 3IC5A 1A7KA 3IL2A 4CM5A 1WDMA 2C2XA 3FNFA 4Q3CA 1HZJA 4WEQA 4D45A 4Z6KA 1D3AA 3IIEA 3JYQA 1RJWA 3E8XA 5IN5A 3ROPA 3OF2A 3MOIA 3PPIA 4RF5A 3M2PA 3L4BA 5COBA 3AY6A 3GN1A 3H2ZA 3DMTA 2ZKLA 5AXDA 4MP6A 1GL3A 1Z82A 3G1TA 3ZNQA 2CNBA 1P33A 2ZYAA 4LCJA 4BL5A 4DREA 2NTJA 4CMKA 3PI7A 1YWGO 3RKUA 1DJQA 4WLOA 2W4QA 2YV3A 4QFDA 2EW2A 2IODA 4R16A 4TVOA 3GN2A 1PL7A 5CDYA 2E4AA 2E49A 3FF4A 4NPCA 2BLLA 2VYVD 1V8BA 3DBLA 4CM6A 1EQ2A 3MCVA 1HYGA 3BMCA 1D8AA 4LSMA 4EUEA 4YT2A 4R5MA 4CV2A 1LNQA 4ALKA 5THKA 3PJDA 4PRKA 2Y68A 1JA9A 1NWHA 1ZUD1 3ZWXA 5H82A 4IMRA 4QO7A 1U5CA 1YONA 3WQSB 3DONA 3C7CB 4TSKA 1FDWA 5ER9A 5A4DA 3PXXA 4WKGA 3PVZA 3KO8A 3RU9A 1Q1NA 4OOEA 1U28A 4MJLA 5JBIA 3WS7A 3C8MA 1E1LA 2IXAA 4K28A 4AJOA 4BGVA 4BNJA 1R12A 1LSJA 4MVJA 3H3FA 1GDHA 4M89A 3I6IA 4QSMA 1N92A 1YQDA 1U8XX 3E48A 3EW7A 4XJTA 3UAGA 3D5TA 3F46A 4D79A 3UVEA 1NYTA 4YRDA 4CQLB 2I5PO 2JFHA 5IG2A 2NVWA 1ZMTA 2P4HX 1BXKA 3UICA 4CUKA 2NVBA 3PHGA 3PZBA 2B5VA 2IEDA 4E5PA 4E5MA 1HDZA 1EE2A 3JQBA 1EZ4A 2Y0EA 4AJNA 4YEDA 1IPEA 1KVUA 2GZ2A 2C5EA 1M76A 4M1QA 1VC2A 1S7CA 1X0VA 4BKRA 1QYDA 3X2FA 5IDWA 1VPDA 4XRGA 2ZCVA 3ENKA 3IUSA 3NAQA 1BXGA 4LSWA 6ADHA 2IYOA 1DEHA 5JLAA 5DCWA 3Q11A 5CG2A 2CSUA 1I2CA 3VDQA 4FIZA 4NBRA 1OI7A 3BHMA 4BO2A 2YHIA 5JY1A 1EUDA 1K5HA 2Q50A 3NUGA 3VPHA 1KEWA 1JTVA 2BFMA 3NKLA 4F6LA 3EY4A 3TL2A 3UN1A 3VTFA 2HK8A 1JKIA 4W9NC 4BKPA 2ZTUA 5K6AA 1DDOA 1EUZA 4GLLA 4DPLA 4P4NA 1HWYA 1IHXA 1RM0A 3QWHA 1EDOA 2BFOA 3PFWO 2DT5A 3O38A 1N7GA 4IXWA 2JCVA 1ZXLA 1GFSA 5U4QA 3GAZA 4NFSA 3JD4A 3S1LA 1G0NA 4FN4A 1E7YA 3VDRA 3NDRA 4NBVA 2P5UA 4PG8A 5K9ZA 3QWBA 1YXMA 4D7AA 3L9XA 1DFGA 4TKLA 4UVEA 2C0CA 5JYEA 4W7IA 4MVJD 1EVJA 2JHFA 4JJFA 3PHJA 2AQHA 2WYWA 4PZCA 5EESA 1H6AA 1GD1O 2EKLA 1G0OA 2ZK7A 3GPIA 2W2KA 3W4KA 2O4UX 4TRRA 2O3RA 3INTA 1A5ZA 2WYUA 5AYVA 1LC3A 3DHYA 5EPOA 4E5KA 1C14A 1V6AA 4CLRB 1ZMOA 3GVHA 1P9LA 4BKOA 1DPGA 2IZZA 5IF3A 1MFPA 4XYMA 1Z73A 3ZWYA 4NQZA 5J23A 1IULA 1TEHA 2I3AA
chains in the Genus database with same CATH superfamily
4QBKA 5EXEA 2BISA 1J33A 5J43A 3GJ0A 4XX0B 2FU5C 3OF5A 4JELA 4DTCA 5ADWA 1GEGA 3PR1A 4L3OA 5TEWA 1H85A 1WV1A 3MYRA 1FS4A 1TCVA 3MRVA 5JH7A 4M2LA 2PXXA 1B0ZA 5TGTA 1L5YA 3HLKA 2WMOB 3NV9A 4TUYF 4CIYA 3QPDA 5M04A 3FTFA 4DANA 1X9GA 4U63A 2JIZA 1CUJA 3KDPA 5TGZA 3U3KA 1J00A 3MCTA 1HGXA 2TRSB 2CZQA 3IPRA 3BWDD 1E60A 2EWWA 4NEHB 1P6QA 1OLSA 3PTZA 3I62A 5K3CA 2EFGA 1EVQA 1D1SA 3RABA 3ROFA 4ZZIA 2P6PA 4MAFA 2HU2A 5JXJA 4P38A 3EGDB 3I42A 4LGCA 3LTEA 3WWYA 5TLSA 2HU7A 1FRZA 3ZIDA 3DCNA 3SLKA 1I4WA 5DLQC 1LQ2A 5BSRA 2CFOA 2W4MA 4DC1A 2DR3A 2JS7A 3LBFA 1O0CA 3AUSA 4TT3D 3U7QB 2JCGA 3DBHA 3E1GA 4LKRA 1HZZA 1G18A 3DB2A 2AI1A 3O2SB 5FBRB 1R15A 1EI9A 2P9FA 5J63A 4KOEC 3UHJA 1FUEA 1DI0A 1UDCA 3GJZA 5LWQA 3IVCA 1SHLA 4LJKA 1YS9A 2EZ4A 3L92A 2EJCA 3PFKA 5E1DA 3JAMA 4PO3X 3P20A 3VC1A 3ONEA 1BDMA 1J2TA 1FOEB 2WM3A 1W73A 3KBBA 4LFBB 2GXSA 4OYYA 4IZHA 1B3BA 1TOAA 3VJRA 3EZFA 3VH2A 1WX1A 3ZVKA 1XPOA 3PNMA 2JJQA 2C57A 5M3BA 2FEOA 2TMYA 4JODA 1EXMA 1N2IA 3KLNA 5F1YA 4E88A 4D56A 4S35A 3H0KA 4IAOA 1E77A 5FP0A 4GSLA 3DMRA 5IM5A 4FMDF 1G98A 4ZQFA 4PGMA 2X0NA 3A7DA 4Y0NA 5IXSA 1BCSB 3V8RA 1LDNA 1JSCA 2V7XA 3T5TA 5ALYA 3ZGVA 1B2LA 3NHSA 5MFPA 2YVAA 3TRIA 4N01A 4ZTBA 1YI8A 1KETA 5JADA 4I5DA 5BVHA 2VAXA 4M49A 2X6QA 2YOHA 3L0PA 1L4LA 1WPQA 1Q1GA 3CNQS 3IEUA 3LX8A 1NY6A 2GF2A 3EUAA 4L9AA 4O4LB 1DRJA 5KVSA 4KU4A 3WNVA 1XLTC 2Q6LA 3BRQA 4XWYA 4CR7A 3HNOA 3D7LA 4MW4A 4ZICA 1K86A 1TUGA 5MN6A 1C1XB 1MU0A 1UC5B 2W2NA 1KBZA 3KJIA 5CCXA 1L1QA 1IPFA 1PJQA 1L3BA 1KDZA 5FOQA 1UK7A 3SP1A 1T0UA 4Z8XA 1H93A 4F4JA 4RTKA 4BJ5A 1ICIA 1VA5A 4R2JA 4RULA 4NHEA 2FP4B 1D6MA 3G2JA 1DXOA 1Z07A 4WNCA 1EE1A 3JYOA 4BKUA 1I7NA 1NU8A 1TCBA 2W6ZA 2WMYA 5DCUA 2Q7OE 3VPCA 3VPGA 2C5FA 4EHJA 3NVKI 1UIMA 3H8WA 4UEQA 5TMEA 5CHEA 1JEQB 1XVVA 3WGUA 4W4TA 1PWZA 3EUEA 4DR6B 3H11B 3OX4A 4KR0A 3WLHA 3EXFB 4Y30A 2IJGX 3GB9A 1K3FA 4D9IA 2W0SA 3EWNA 2WRZA 3AEKB 3GRFA 2DCMA 3MT7A 2XNDA 5JNWA 4KXWA 1GGNA 5J47A 3EOBI 2CNKA 2I2XB 5AP9A 1XTPA 3DOHA 4GVLA 3K8YA 4MQBA 2IEZA 3GLGB 2QUKA 3EVNA 5FOVA 2OYCA 3FETA 1AUXA 3QFHA 5JSQA 3GV0A 2XSZA 3QPAA 4G86A 1A2OA 3S81A 3H4IA 3DDNA 1CSEE 4R2IA 4R69A 1VDZA 3VYTB 3TE6A 5E7JA 1QU3A 1KQ3A 1J2YA 3CRVA 1SXQA 5KYKA 5GZ1A 2NSHA 4DHWA 2IS2A 4YAGA 1XU4A 4HLQB 3RC1A 5AESA 1E2JA 2YY7A 4OQNA 2FETA 2PJDA 4CMBA 4QBIA 2YXNA 3OLYA 4AP6A 2O54A 4WDRA 3U5TA 4CQMB 4CTOA 4EY6A 2VWGA 3W5AA 1M7GA 4WY8A 1JEYA 1A27A 2PN1A 4BZZA 3B2QA 5DNYB 3IP1A 1XU7A 4LRYA 1SUDA 1JV2B 1TPYA 2PIDA 3OLZA 1QZXA 2EVWX 2R8YA 3F47A 3AKCA 4E3WA 2W2XA 3ZS9A 3HFRA 3IQHX 5IMBA 1IJFA 3CWZA 1QVRA 2J41A 4PZZA 5C4GB 5JALA 4KBYA 3R77A 4PG6A 1RPAA 3I39X 4KQXA 4RXTA 3WLSA 1RD4A 2BGJA 2SBTA 3B51X 3KAJA 2Y27A 4O63O 1Z08A 5JHHB 2XMSA 3L1JA 4D8YA 4AMBA 3TAUA 3TKYA 2VRCA 4B6QA 3ZVMA 4TXJA 1WMFA 1J25A 1Y4UA 4PC7A 3CA8A 2C29D 1BH2A 1R0WA 2ZSBA 2YFYA 2FUNB 3N87A 5ARCA 5LZ8A 3TTSA 1DC6A 2OR3A 3B1ZA 3ILSA 3ZIAA 2PUVA 1W36D 2ZUVA 2ZBQA 3GAAA 1GEEA 2GEJA 1OYVA 3OJEA 4QPZA 3CVUA 3HMQA 2XT6A 4FSXA 3C1TA 2CFIA 4OAQA 2I67A 4R6XA 3TXAA 4MUAA 5CLFA 5LQMA 2Y1FA 3RIGA 5ITZA 2XVXA 3EZNA 4OHPA 4ZTUB 1KJ8A 1WABA 3L0CA 2AKYA 3LUBA 1G6OA 1QC5B 3ETCA 1QGUA 3SZLA 5KMGB 1L4FA 5CU7A 3T3IA 3KYBA 5FPPA 1JAYA 3LHIA 5F7JA 3P1JA 4O1MA 2YQ4A 4IIJF 2A5DA 1E1QA 2NU6B 1YZTA 3OUUA 3N8NA 3SXJA 1HC7A 3CCBA 2XNDD 4PLWA 1X80A 2QB5A 4I4CA 2XTAA 3OO1A 4DDVA 1J2EA 4MI9A 1TIKA 3R0ZA 3IR5A 2W90A 1SBIA 3SHWA 4HYTA 4YHHB 1GTSA 2J3IA 1E3EA 3FJ1A 4TWBA 4LE2A 4DG8A 1UBFA 1UINA 1K97A 2OXEA 4UNPA 4H16A 1IN7A 2XSZD 4EPXA 2G5TA 1SEPA 4II2A 4E6EA 4E6PA 2O8BB 1N8SA 3A1SA 5TJ9A 4NH4A 1N8TA 1U2GC 2XKKA 3FPCA 3PLNA 2HLNA 4YI3A 3OVMA 4CLHA 2HBRA 5DBOA 1AKWA 2Q9BA 3BIXA 5GMOA 5H83A 4AJ1A 4EY5A 1CUVA 4AC9A 2CLSA 1F38A 1LZKA 4MV9A 1GA1A 5DOVA 1G3IA 3AEZA 5FTKA 3W90A 2RMKA 3Q8MA 3EPHA 4L0CA 4O0LA 2FA9A 4RC9A 2ZTSA 4ENSA 2Y66A 4IQGA 5JFGA 4V03A 1QANA 2K7FA 1W6UA 2K2WA 5EQJB 2IH5A 2D2FA 4BAZA 4YS6A 3MINA 3ITDA 1D1QA 4ZZ2A 4OG2A 1YIAA 3K0FA 3OZWA 2PD4A 2X5NA 2ZOSA 2FPOA 4A91A 3WYAA 4DUGA 1NF9A 3TINA 3IEVA 1ZM9A 4OU5A 3SYLA 3VPSA 3RYFA 2NPFA 3WGOA 2GAJA 4F46A 3KEMA 3G6KA 4DV2B 1NNEA 2VRCD 1AKTA 2PMFA 4PANA 1RAEA 1AB5A 3RRNA 3T34A 4EZIA 2YZMA 1X7ZB 2WHYA 2ZJ6A 1KS9A 2D4AA 1AKEA 3ZIAD 3A4YA 1JDZA 4JEHA 3QF4B 1M2VA 3ND5A 1I6WA 1L4HA 4JENA 3UJBA 4PYIA 3Q8WA 4Z3KA 1SUEA 2XWPA 3CJQA 4UHHA 1R4NA 5BN5B 5A9TA 3BD6A 3CH6A 1SU8A 2GNAA 4DWWA 4A92A 1E64A 3DKKA 3IDAA 3P2YA 1P5RA 1C7IA 4IQ0A 1FL9A 2P65A 3CZCA 4F2DA 1ZBDA 4JS0A 1NW6A 4MYDA 2J5KA 4YJGB 3MJEA 4QREA 2NPOA 4LNUB 1KFKB 1BGXT 1E1QD 3ANTA 1KBOA 2ZKIA 1RXYA 3NVAA 2C3OA 5BNTA 1XXHA 2NSLA 1GRNA 2BGNA 3K6JA 3E5RA 1FLNA 2H52A 4EO4A 2IY8A 4O4HA 2AQIA 3R76A 3G6WA 4HGPA 4QEDA 4W1QA 1DQZA 3A1CA 3OZIA 5A1TA 1CFJA 1FQWA 2AI2A 3T1OA 4TL8A 1HFKA 3QVGB 3B36A 1C4OA 1I7LA 4B6PA 2FJPA 1VSTA 5ALMA 4KQJA 3GNSA 3QA9A 3MBOA 1JFSA 1NASA 4G0OA 5DBHX 1L4GA 3WOHA 4X7MA 1H6CA 3FNQA 1D4OA 2FEKA 1ESCA 3B7WA 3I3OA 3QVJA 3R5TA 3EGEA 3I04M 1EUYA 3GCDA 4FCVA 3C6YA 3FTDA 3R6DA 4QBTA 3SI7A 2Z5LA 3D7SA 2OC9A 3BHNA 1JXMA 2JLBA 1U4OA 4HAXA 4YQYA 3TMKA 5KTTA 4G0UA 2YR0A 1PQUA 3DQPA 3U81A 1FP4B 1D2CA 1ZQ9A 2AFHE 2VI5A 1BEEA 1T6NA 1AU9A 1G8FA 3QFTA 3IPCA 3ASVA 5AM2A 4RWZA 2QRKA 4D4GA 1X8JA 3IDZA 3TYXA 3PR3A 3VR2A 4F93B 1KVTA 3U4QB 1XCOA 3ZPXA 4EZEA 4IIHA 4CG2A 2JI6A 4DUGD 3NXKA 3ZHBA 4LYFA 2QW8A 4CMIB 2WK1A 1FCJA 3L1UA 3GFQA 2PS3A 2V6FA 1MN6A 2FOIA 4DCVA 1IHDA 4WACA 2RIRA 5LQDA 3GPLA 3NBYC 5K0ZA 2VQSA 4ZDIA 4I9NA 2IVZA 1HDYA 1P2TA 3H1TA 5EXPA 4XASA 5KTOA 1II8B 3HBJA 3Q85A 2HC9A 3UUWA 1KEVA 1W9MA 5D7BA 3U4GA 2GVZC 3OCUA 3ZU6A 2JJMA 1MA3A 3C1AA 3SE7A 3R41A 4B82A 4LWQA 3A27A 5FPKA 3OURA 1LVGA 2ZB2A 4BTEA 2O3SA 3JX9A 2GZAA 3JQFC 3D6MA 3W6OA 4L9SA 4CR8A 1QONA 4PN7A 4R0MA 1RW4A 2J87A 3E9ZA 5IVHA 5THQA 3T9AA 4JBNA 5CVVA 3W05A 3SC2A 1HT0A 2KLHA 3W2EA 3VR5H 4F9GA 2ORVA 1I4LD 5I9LA 1GVNB 4ZO6A 5B6IA 1HORA 3NT2A 1QGED 1TU4A 2CNWD 3ON5A 2JA2A 2O3QA 2B0JA 4L8VA 4U2EA 3WISA 5BVGA 2NO4A 4B79A 3ER6A 3NHLA 1E2NA 1ZN2A 3FCXA 4RD1A 3TQTA 5A4MS 3PC8A 3DE4X 2W2MA 1HTBA 3R0IA 5KAPA 3QEBZ 4MYUA 3HKEA 3MB8A 2Z2KA 3I6YA 3FYDA 2RC6A 2AXNA 2I7VA 5EP3A 5BRJA 1NHGA 4Q82A 1CT9A 1KIMA 3ETEA 3F0TA 4F06A 1OU0A 1ST3A 1XAIA 4H4CA 2GEUA 1RSZA 3E82A 5TQJA 2OECA 3A06A 1JLKA 5JYAA 4G26A 2CUZA 4X6YA 1EFPB 3UTCA 2Z1MA 5D86A 1Z8HA 1NP3A 3VYWA 4E7OA 2IUTA 5IKMA 3PXBA 1P1JA 1ZC4A 2Z4SA 1RHRA 4H1HA 3ZGNA 1DL5A 2IYPA 3AUTA 3QEMB 4XI9A 2D0IA 4U8HA 4ZVRA 4OI4A 3KQNA 4MV5A 5EINA 2E55A 1DXYA 4ND7A 4J3NA 3RB8A 3WBBA 3D1VA 4NBUA 5DM2A 3VR2D 1KJJA 3RVSA 3ZWMA 3E9DA 1CJKC 3H9UA 2ZUSA 2AZDA 4DYVA 1Z6ZA 2X76A 5ILOA 2H1VA 2JZCA 2FF7A 3M6VA 3WMXA 4ZAGA 2P4SA 3PDWA 3Q3JB 2CXPA 3C15C 3HCDA 2HK9A 4I6JA 4JXJA 4V0NA 4BFVA 2AUNA 4FSHA 5LQSA 1YRHA 2ZDGA 3L8FA 4ZMSA 5D3KA 3UGJA 4RTLA 2G6TA 5F21A 1WSAA 2A35A 4L4UA 1THMA 2J9FA 4IWXA 4R9RA 1AD2A 4HVCA 3NM6B 1GPKA 4BNTA 2HMAA 3EDMA 3RC7A 2I2CA 4ZOLF 3UUEA 4DCPA 3A6KA 4DN6A 2JJ8A 1UBKS 4C4ZA 3DO8A 1Y3FE 4EB3A 2WZDA 4F1JA 1C0EA 2IIQA 5KWSA 1BFDA 2BEKA 4KLZA 2V6MA 1JIXA 2VP9A 4GQBA 1W5TA 2J3QA 1U7HA 3ET4A 3JQ8A 2GHQA 3TEMA 1UXGA 2VJMA 4YBZA 1NBAA 1RAHA 3TLCA 1JHQA 2WTXA 3LC2O 1DJOA 1Z0KA 1K8XB 3PRHA 1WKVA 3DKRA 1NBEA 2R8ZA 4BBPA 4Q4HA 2YS7A 4TLMB 2AG6A 3I53A 4QD3A 2IELA 1TO6A 3BE6A 5HVNA 3LHDA 2IS1A 1E4OA 2ZJ2A 3DMFA 3RCBA 1JJ7A 4QXMA 5L53A 1IBLB 4H27A 2CEKA 3VNQA 2GO7A 3EEOA 4HTFA 3BXFA 1YCGA 1FYEA 1TLFA 1H05A 1ZFNA 3D7KA 3EEQA 3WIUA 2HMVA 3T7EA 1RXEA 4GZ6A 1LWNA 3EGWA 1C7RA 2IP4A 4PG7A 2ID8A 2LIPA 1SCAA 3GARA 3O5AA 3PFBA 4GPZA 1C30B 2PX2A 1CU1A 1PWXA 3H0WB 2R6R1 4C29A 2P9EA 4ER7A 2PUAA 2PG3A 4LFAB 5JJKA 1PN3A 1N7IA 4LISA 4XCVA 4N18A 4I46A 5AKXA 3OF3A 4WN9A 2OWEA 3GH3A 3JQ6A 4GWGA 3QVTA 2BFEA 2FOXA 2XUFA 5D8DA 4OQEA 3RV3A 2ODAA 1NULA 5KC9A 1TZKA 4NNPA 4H35A 4AIRA 3HB4X 2OCLA 2BFWA 2QP4A 2YJ3A 4WCFC 1TKAA 3BREA 4KW7A 1VKHA 1F9AA 4IGKA 5K3BA 3SJBA 4ARZB 2YWBA 2V97A 4HDNA 3T3DA 3ER8A 3WRWA 4ZCSA 4UAGA 3OCYA 3HHPA 4YRMA 4F4UA 3JWJA 2GKGA 1RIIA 1XYYA 2X0RA 3HB7A 1O6FA 3ETNA 4FYKA 3RIHA 1AQ6A 3GFPA 2OSBA 3NPMA 3UMRA 3ZWAA 1WSBA 3RVBA 3GFBA 3HEBA 5TF4A 2QTMA 4RZXA 1WG8A 4FNAA 4HEQA 2PUTA 1LDEA 2P9HA 2QQGA 4XLZA 5G0WA 1F3OA 3QLEA 2JZOA 4NCAA 1FDOA 1PVDA 3H9EO 2QTAA 4JV5B 3ZJVA 3E0XA 1U4SA 3RJ5A 3NBXX 2WAYA 2C9ZA 3BF7A 4D42A 3OOJA 3C5CA 2F00A 1N9GB 2PKCA 4PO8A 4ENQA 2MINA 1K7EB 1LW6E 3VKVA 1UADA 2JG3A 1BEZA 1P2GA 1XC7A 1OIWA 1KKUA 2G1UA 3GJRA 3I2HA 2XMGA 3G49A 1VIVA 3HVKA 3KQOA 2FPGA 5AMXA 2Q1XA 5IBRA 4ZA2A 4YXWA 5CDFE 1M1YE 3DOCA 2GSDA 4NCNA 3ND8A 2PYIA 1T4CA 2W6MA 1DTSA 1EWKA 3L6RA 3U4HA 5BUCA 3TR6A 4ZVKA 1H0RA 2QF7A 4DRXB 4Y9SA 3WA6A 4L8GA 1C8BA 1UBJS 2BGTA 1E2MA 4AJHA 4DXHA 1U9CA 4Q7LA 1FSZA 1UAAA 5HSGA 3DWIA 4C2AA 1FDRA 2PBLA 3FVQA 4UHEA 3GH1A 1L5RA 2WW8A 2CXSA 3NTRA 4M6WB 2O57A 1CWUA 5LQNA 2VHXA 4IUYA 4MWEA 2HPZA 5BR7A 2VSOA 1PJLA 2A78A 2I66A 1NYLA 3JZAA 3K96A 3C97A 4FMPA 3N8DA 1AKVA 1NLZA 2XTMA 3C14C 4GOMD 4BNVA 3A26A 1VLZA 3AGPA 4L0QA 1K66A 1XVUA 3GAFA 2WWYA 3BFKA 4K9SA 4WRRA 1E3SA 2ZU0C 1Y1KE 4HS4A 3R7WB 2G1KA 2OB2A 4G0WA 2X8WA 2BZ0A 3UWMA 2D2VA 1ACLA 3D5EA 5LIPA 4J49A 4WZ6A 4YPFA 4F38A 1KIAA 3D3EA 4F1WA 2BSAA 3QBJA 4M0UA 4EP1A 3RG2A 4QM6A 1Q3HA 1UKEA 1A04A 1EAYA 1L9XA 1OFVA 1JXQA 1LBIA 1R0ZA 2GEBA 3K8OE 1VPVA 3LHFA 4QRIA 5CLGA 4BFZA 9ABPA 3AIIA 1AHIA 3ERCA 1K7FB 2QRHA 4CF3A 3HCWA 5JD3A 1U2ZA 4RSRA 3OOEA 4UU0A 1DC5A 2N0SA 3HDHA 3ZJ4A 4ER0A 3K1AB 3FZGA 3R9WA 5U9CA 4L8WB 1SC6A 1R5OA 4M88A 1XB2A 3KQSA 2NW6A 2QX8A 5J9GA 2YDYA 2C97A 3BCRA 3II6X 1NC3A 4IHJB 1L7AA 2ZTLA 2BTQB 3SSOA 1HEYA 4W63A 4AZ0A 5CA0B 2A5LA 3VQTA 5AQEA 4W5JA 1G5IA 3T9CA 3JTMA 2DUMA 4JUFA 4NYIQ 1QFXA 1X39A 2GBGA 3FTPA 1EIZA 3BMQA 3RWOA 4IKEA 1V47A 4IEFB 4V0QA 4E33A 2YRFA 2YS6A 4RIEA 2G5CA 3PJGA 3VU9A 2HF9A 5CFNA 4IDHA 5IX8A 1JPNA 4WJZA 2V54A 3S2EA 3ZV3A 2M6SA 3KKLA 3I8OA 2Q07A 4KH0A 4OIMA 4YXWD 3C3BA 1EDEA 1QM5A 5CPBA 1LPMA 1XNHA 2WKPA 3V8MA 1D0VA 1WAMA 3WNQA 4EMSA 4DV4B 1W581 1CERA 2D1FA 3H84A 2V45A 4LV6A 5TVKA 2HX1A 1FDTA 4IIDA 3RK4A 5CDGA 1ISPA 5LM3A 1HURA 4ZJYA 2VHTA 3GGPA 4MHOA 2AFIA 2FWJA 2AXQA 3DMTC 1FFCA 2I2FA 2LNDA 4XR9A 4MR7B 4COOA 2AKEA 1CTQA 1DRUA 2VBIA 4MUNA 3RE1A 3B1XA 4B09A 2GLXA 5TVGA 4LDJA 5GOTA 4UQLA 5LNK1 3T1TA 4TKUA 4WE3A 2JI8A 2RK6A 3M33A 2VF4X 5CNJA 1L7MA 1RLTA 3AU9A 4WCDA 4X45A 1ZPDA 3G2PA 3MJSA 4ISBA 4V0RA 5FFNA 1KO7A 3I5XA 4YRPA 3RTBA 2P9ZA 1KJ9A 2CHUA 2QWXA 2W9XA 4AZ3B 1E3JA 3IEKA 4EB6B 1G59A 5BW5A 4KVGA 2Y1DA 1BDBA 4ZT7A 1CPYA 4CHTA 1F2UB 4Q3AA 1SG9A 3G85A 5IP5A 4DA9A 4OQYA 2QW0X 2BFDA 5AQ1A 4D2IA 1TAHA 1KI7A 1POWA 2BM9A 3C6XA 1UM9A 3QIVA 3ZCTA 4JLMA 1JYEA 3M81A 2D2XA 5ABPA 1ID1A 4JLSA 3PT9A 2X8AA 4QYWA 5I9MA 3LQQA 1RQGA 5TT1A 2GUGA 1QVAA 2OCGA 1S2MA 3OI7A 2ZTVA 4IX9A 1W19A 1X1QA 2VTKA 3RT1A 2OV2A 3VZPA 1X14A 2DVMA 3HMKA 2G8NA 3DM9B 4B45A 3N58A 5ALNA 3TG8A 5EA2A 3ROGA 1N34B 5IM4F 2BWJA 3Q72A 3W1EA 3MA0A 1MABA 1C1HA 5LXTA 1Q1AA 2EERA 5IKPA 4NOMA 2ISSD 1T5OA 2JLUA 2B4AA 2BFBB 2ZREA 3BIJA 3PRJA 4XD7A 2E4VA 2QT9A 4DNPA 1XDUA 1E4VA 4MIEA 3JATA 3NGMA 4G0MA 4QAQA 2OAP1 1A4RA 2R68A 3DL2A 3U4DA 3DAYA 1HE3A 3PWZA 2HSZA 2PDAA 3WHPA 4ENWA 5BN4A 3P94A 3LOQA 1XZDA 1PFVA 3U1VA 4QKQA 4J4TA 1DE0A 5M29A 3RYTC 1XZMA 3IFSA 3BZWA 1X7YA 5KWJA 1GCUA 1N9ZA 5FV4A 1VXOA 3D8RA 4RENA 3GOHA 2QZSA 4HO1X 1PV4A 2O8CB 1LGYA 3B20A 3LNTA 4IBOA 1EWQA 2R8BA 3JQBC 4JVNA 4KV7A 4BO8A 2OHVA 3F71A 3SWWA 4UREA 3B48A 4MKZA 2VHJA 2X8BA 4PPNA 5HGJA 3SSAA 3T1VA 3DMYA 1M8GA 2WNIA 3I8SA 5E1MA 5EFOA 3RRBA 2H07A 4FD2A 2EZ9A 3D8NA 3DDWA 1O4WA 4B81A 5C8VA 5CITA 1FDVA 2R4UA 1UANA 1V8PA 4L78A 5F33A 3DDZX 2KYRA 3H5VA 3TVTA 1BYIA 1PJTA 2WSIA 1YGYA 3MELA 4Q4CA 1EWYA 5ESRA 4BNNA 4RF4A 4OKIA 2IV7A 3VKFA 3Q88A 3LA6A 3MS7A 4CL0A 4Q19A 1K98A 2X3FA 4H7DA 3HZZA 3T4PA 5K6AC 4KACA 2DP4E 2R5NA 3IMCA 4QQNA 3QWAA 5DJ5A 4P83A 3E22B 4DR2B 2AB0A 1Q7GA 3K71B 5ILQA 4EKDA 2NUAB 3FNIA 3CMCO 3BTVA 3OHPA 3WHIA 1SIBE 4YRLA 3SX0A 4JKYA 4JI2B 2BM0A 2VK4A 3Q1LA 1BZYA 5DE3A 3PXDA 4WZBB 5AHXA 3X1KA 5CK4A 2ZEJA 3FX2A 1ZD9A 4X64B 3CVOA 3VXKA 2KHZA 4CQLA 2B7CA 2I0FA 3RDPA 2BOVA 4ZVUA 3NR2A 1Y3AA 5ICCA 3KZXA 2OE2A 5DISB 3DPUA 3R9IA 3H0VB 5B1EA 2H59A 3GJQA 1ECBA 1YDWA 1HSOA 1NLMA 2VDNB 5AJTA 3IQXA 4WXEA 3FFXA 5FULA 2MSKA 3BJRA 3M1YA 1SN7A 3V8BA 2VXYA 1I2MA 1WB4A 4XD7D 2VHYA 1Z0ZA 1KQPA 3EBOA 1OXMA 3E4DA 5JAPA 2GYWA 4PLVA 1SBHA 3PFHA 4I9GA 4J0GA 4OUKX 3AY3A 1JPVA 3EFOB 3X1ZA 2J0SA 1JQLB 5IBQA 1XDGA 3BZBA 5ALSA 4GMXA 1EP3B 2QRPA 2I4MA 3GZTB 3DXYA 2D6FA 1I9GA 3RODA 2CVPA 2VH2A 3S3TA 2GCNA 4S1VA 1NE7A 5BV8A 2AZXA 2BFAA 2FW8A 5LB4A 3FSEA 4QOGA 3AF4A 3D6FA 1OREA 1P77A 2H1OA 3FR7A 4YC7A 1J21A 1W46A 1XL1A 2Q0HA 4QYTA 4A0FA 1E6CA 1WVMA 2IHBA 3IO3A 5KSZA 2NU7A 1MORA 4JL5A 4BRUA 2BKXA 3EVTA 4I8IA 3WDSA 3ES9A 5E9AA 1W48A 3ICEA 1VB5A 5KAMA 5CEFA 2NSYA 5BR8B 4AUMA 1AV7A 3TK1A 2HZ7A 2C7QA 1NQAO 2B7BA 2AYZA 3OBBA 4JBWA 1DTEA 3C8HA 2IYWA 2UUOA 3AR7A 2A30A 1BQEA 1N2CB 4FS3A 3DT8A 4TTPA 1THTA 3I8XA 1IMJA 2AK3A 3QPWA 4NYIR 1Q6YA 2Z2IA 5ALQA 5ALDA 1AGXA 2ZE7A 1ZGBA 3OPMA 3I9NA 2KBFA 3LOUA 2GR9A 2ZYSA 2WAXA 4NX2A 5AXAA 2XMBA 4MVJI 2IYVA 1EHYA 1KS2A 2NPIA 3K9FC 1SZDA 5K51A 3RARA 3GLKA 3HSYA 4C4AA 2HXSA 4B80A 4PZ0A 4XARA 1TRKA 1NSFA 1NVGA 1C3EA 3L6UA 4PGAA 4JUDX 1OXSC 3WQQA 4UHBA 1QCDA 5EP2A 1E1RA 4QGFA 4O25A 1W2HA 1J1UA 1K0UA 1PBTA 2IHJA 3C98A 1C0PA 1Z38A 4GI3A 5C3UA 3RSGA 4D9CA 5KZMB 1YJCA 1HE8B 4KIGA 5HCUA 1KH2A 3AQIA 1R6AA 2Z6VA 2Q3HA 2FZLA 4Y6LA 5T6BA 2P11A 3T9EA 2OO7A 3RS9A 4R05A 1GAEO 3CR7A 2FZKA 2ZRPA 3C85A 4DL9A 5CH8A 1NJ8A 3JTEA 4F72A 1DQRA 3FZYA 4R2WA 2BL4A 4NDZA 4PLZA 4W8HA 3Q0EA 1Z0FA 4IDDA 2WTAA 3AI1A 5CFMA 1LK7A 3QSYA 3NNNA 4CKEB 1AK9A 5DM0A 2ZIWB 2I2WA 4JKOA 3TZBA 2QGZA 5K3FB 3UJ6A 3OX2A 4WESA 1U2DC 4YCLA 1GZ6A 3IBTA 1R18A 5DGCA 1BMDA 4UUQA 4V0ME 1TD9A 2A5YB 4QXQA 3AM4A 3K9QO 2FI1A 4LOKA 2BMVA 2BW0A 1KTVA 3F8SA 4YH1A 1NRIA 5JMWA 4N5IX 2J67A 2VBFA 4NS4A 4K0RA 1G9SA 3FHCB 3O82A 2BFFB 2EHJA 3T3GA 1K6MA 3E58A 1S2NA 2A14A 2B4TO 3KGDA 4GF5A 5FBVB 4F9TA 5CH3A 3UJ8A 4DLZA 4F12A 4A0QA 5HP4A 3ZWNA 1W93A 1ULUA 4C2TA 1XQ6A 4U2DA 4XUDA 5J5AA 2BMWA 4DLNA 5K20A 2H2DA 1P1BA 3LHKA 3PQDA 4U7DA 3P9CA 3LT1A 1U81A 1GZSA 4GOKA 1FMLA 3JARB 4EAAA 1E92A 2NXJA 3FDZB 5EWJB 3MHTA 3D4IA 1E0AA 3E5NA 4M53A 1EM8A 2ETXA 4WXMA 3RIEA 1GPMA 4HZIA 3ZY2A 1LA2A 4EY8A 3V1KA 1FJHA 4P22A 5JD5A 4FEAA 1EKXA 2QAJA 3LT5A 2XZDA 4URHA 2YFQA 1JLMA 2ON6A 1S1CA 4KI0A 4TUYB 1T3GA 3GEPA 1OFTA 5AI0A 3WLRA 5JROA 2F3SA 1E9VA 2FJ0A 1SUFA 3HKBB 3ILHA 3L7JA 1GV1A 3R6GA 1E1RD 2OAGA 2P2CA 3DCIA 4UDYX 1GV0A 1N36B 2PT5A 3HN7A 1J8MF 1PEKE 1RR6A 1RWMA 2Z2JA 3M3PA 4NR0A 1VG9B 1VLHA 4UM7A 2ZSIA 2FUCA 4RD0A 4RV9A 5FPYA 1Y33E 4WECA 3RUHA 4V0SA 4ZFNA 4YDRA 6LDHA 1NPTO 1G7TA 3FFBA 3BRWA 1ZHHA 2QAGA 4POOA 4RAQA 3DLIA 4JLAA 3HR8A 2IPOA 2PGXA 4K05A 4BNGA 4XX1A 3MAAC 1KQFA 2WA1A 4Z4IA 4DSOA 2YIMA 2QNIA 3AEUB 4MDYA 1MJ5A 3DAOA 3CLUC 2HIMA 3O31A 1NXSA 1JENB 1YCFA 5IJ0A 3BBPA 1TQHA 1CZLA 4C4PA 4KK4A 2GERA 4I19A 3R7NA 2Q4DA 3LIIA 1R0KA 3MJDA 4TZ0A 1J2UA 3QVMA 4PN3A 2R6FA 1SC3A 3DDCA 4F9EA 5FUQA 2BBTA 1U7UA 1YB1A 1J20A 4M0CA 3WKDA 3AESA 2FF5A 4FYIA 3IP7A 3ZTWA 4IYRA 1F2TB 5K09A 1QP0A 1EVZA 2C5HA 3B1FA 1JDVA 4PTLA 2P35A 4B4VA 2JRLA 3O8LA 2P68A 3KL4A 3RQIA 2PSHA 2QSZA 2ZPTX 3DOJA 3IVMA 2P6RA 1O77A 4M1MA 5JPDA 3Q6NA 4OHMA 1JH9A 3HP7A 3DWFA 3C74A 4BNFA 1JFFB 4PAMA 1BH6A 3FZQA 4DQKA 1PJCA 4X7PA 1E3MA 3I9JA 1LF5A 1Z0SA 4RF3A 3PWSA 4CV3A 4X84A 2Q9UA 5DTRA 4YLEA 3STUA 3UOAB 1HDCA 4Q9NA 2PUCA 1T8UA 3H9JA 2XT9A 4NBKA 1YZFA 1YUNA 1YE8A 2ZATA 3FROA 3G5MA 3PX2A 1KR5A 5MN5A 4RE6A 3HFSA 4H59A 4AP9A 2ZBDA 4MQEA 2FRDA 1J49A 3CIFA 1JWBB 1OBVA 3LRPA 4KLAA 4ZHQA 3HXOA 5FRDA 4C06A 3DBRA 1Z5WA 4MO9A 4MS3A 4S1OA 5T8KC 4GRAA 4HXYA 1DIAA 1R27A 3ZHYA 5TS3A 3KALA 3CLRC 4H08A 2DWOA 3EK2A 3UMVA 2GK3A 1KJZA 3DDSA 5DVZA 3GGGA 1UKAA 1FC0A 3WX0A 3D1LA 3GQBB 2EP5A 2VCHA 3GVIA 1J0XO 2RH8A 3B7GA 3L1IA 1ZGHA 3ICPA 4CETA 1XP8A 2GHIA 4C2BA 2VJQA 3NDIA 4URZR 1G6Q1 4HQ6A 4EKIA 5C37A 3WO0A 2VHZA 2IZ1A 1KORA 1ARZA 3JU3A 4XUCA 2XUAA 3K0AB 4LNAA 2OBNA 2FPSA 1LUAA 2V58A 1TYAE 2XKAA 2H7YA 3SE0A 4D4LA 2C8JA 1LWOA 3BSWA 1KSHA 2BF7A 2BGKA 2BM8A 2BM1A 2GJSA 1JEAA 1ZWKA 3UGTA 5BSUA 2YHIB 4QNMA 4IVQA 3TE7A 1DDGA 3DCYA 3BGSA 3KKPA 3O3MB 4CBVA 3Q10A 1IC6A 3DAPA 3EH2A 4NVRA 4WERA 4R54A 2PKQP 1EDZA 3U7RA 4BB9A 4KMMA 4TM7A 4UFOA 4F5DA 2AZTA 1H2XA 3C3KA 1NQWA 1TTPB 1SIUA 2D0DA 4I50F 3EP8B 3G9QA 1UWLA 3CO5A 5AH0A 1UXKA 3WLNA 4BP8A 1CXZA 2YWFA 2GBFA 1XJ5A 2WIGA 4XZ3A 1Y7TA 2NT3A 2GBIA 2WPNA 4X92A 2BHSA 1JKFA 5JSKA 1RXSA 1KAMA 1SD2A 4HAWA 4CKBA 1F2DA 3PQ3A 1UMKA 4CM7A 2BGWA 3QE9Y 3P9SA 1GNRA 4X8HA 1ZZEA 5I7RA 3W6UA 1AH2A 4F96A 1W8DA 3LF2A 1PJ2A 1VM6A 5GV7A 4DT1B 4Y0AA 2DLCX 2A57A 1ND6A 5CLIA 5KTNA 1JILA 1K6XA 1MGOA 1ULHA 4G5OA 4TXHA 4C1NA 2GI4A 4Q3KA 4Z3DA 3HB9A 2C4NA 2X3UA 3I3SR 3D0RA 1RCUA 4ADSG 5FQNA 5FWXA 4NJEB 4MYCA 3BL8A 3E4CA 5AJWA 1NUUA 3SJ7A 3H8SA 3UYKA 1ONBA 4PSUA 3C87A 3LQYA 4PO9A 4YUWA 2I8AA 3OEHA 1CKEA 3UWDA 3KQPA 3N59A 1XPRA 2OZLA 1XTBA 2BTEA 5EIXA 5AICA 1KL7A 3OKCA 2GKOA 2X1LA 4S0XA 4R51A 1SULA 3EGXB 1L5KA 4AG3A 1XALA 2CNLA 4TRNA 3S0JA 1KZ1A 1H2ZA 5I4CA 1T26A 3SLGA 4DLBA 1JG6A 3QU5A 4Z53A 1B8VA 3IBGA 1YL6A 3SR3A 4DUYB 1Q7BA 3W6NA 3PXCX 4UMFA 3PQVA 3MS2A 4X94A 3VU8A 3WG9A 5H9WA 1H8EA 2Q8QA 4IUCS 4A10A 4G1BA 1VLQA 2G77B 4RX1A 3V4FA 1W49A 3M6IA 4OFBA 2V6GA 2VDLB 3IV6A 1MDBA 1RJ9B 3U7GA 1GCAA 3RSOA 4RGVA 1J1ZA 1SKAA 3IVRA 3DSRA 1E1DA 4REQB 5A2QA 1A5AB 4AX8A 4IIJB 2XB2A 1L4BA 4HNUA 5K8TA 4UMVA 3Q41A 4DUPA 2RGEA 3B1VA 1O5TA 3B6IA 2QTRA 1D4AA 2KJQA 3K6KA 2VEDA 5HFNA 1ZSNA 2B8NA 3FDFA 4PBRA 3URMA 5KQRA 2GDJA 3P71T 3V7WA 1VMEA 3FCEA 1J9ZA 3GFGA 4OEHA 1JDBB 3IODA 3PF9A 2IYTA 2DFKB 4AKEA 3ESCA 1YS4A 3JQ7A 5LQKA 2HT6A 3ISJA 5DZSA 3K70D 2UZ4A 1CQPA 3TV1A 1I4DD 3P32A 2VJNA 4TTIA 3B3AA 3V1LA 3RI3A 1JIUA 2CDBA 3MQ4A 2AOVA 3CKKA 2FQ1A 3FLEA 4IHQA 3D6JA 1R4MA 3E7XA 1N3LA 2WSSA 4AXXA 1HOTA 1V5IA 4E70A 2OESA 4UD2A 5DEIA 3SIXA 4CN8A 1X87A 2GK7A 4KE8A 3X44A 3S1SA 2PAAA 1XMJA 1F5SA 1PFYA 1RP7A 4Z9FA 4H1VA 2W0MA 2XZPA 3LP5A 4GKAA 1RLUA 2WG1A 2VXBA 3DZ8A 9GPBA 2I6SA 1CRQA 721PA 2WHPB 4WAUA 2XDQA 3U6KA 3BSFA 4EGSA 2NVUA 4QL3A 3FLAA 5HQ3A 1BW9A 1TKBA 1FW8A 2HL6A 5CRIA 5H8WA 3N2YA 4OU4A 1GHTA 1KYYA 2P3LA 3OEHD 1EP9A 1QOPB 3OP1A 5ALKA 3D4LA 5BNFA 3ZHOA 1FSGA 4I3HA 1G41A 1STOA 2ZAMA 1Y5MA 3BK7A 3PDIB 4QUEA 4E22A 1KC1A 1VKZA 4G8BA 3AUYA 3I72A 4A6PA 1Y5NA 2GNOA 4RVCA 3ROKA 1FK8A 1YC5A 3HKCA 2PYZA 3VKHA 5KOJA 4PQRA 3WHLA 3F6YA 1QCYA 5FADA 1M1XB 1L5MA 1JMYA 2QHXA 2ECFA 1W5EA 1N5JA 1HYQA 1H8ED 1DAPA 2RGWA 1JAXA 1HDRA 2XBLA 3CNLA 1YFKA 3I5MA 4TTVA 4TV9A 5G0UA 3V42A 3WLJA 1GTG1 5LZ2A 3PL5A 1Q6ZA 1PO7A 2NUPB 4P4UA 4MMYB 4AU1A 2C2ZA 1NRXA 3LJKA 2UVPA 3L8ZA 4QBGB 2IX3A 1C1YA 3H4TA 3Q9UA 5J2TB 3CLHA 1IYZA 3LCJA 2X1MA 4N49A 4RA9A 1AE1A 4RESA 1UT5A 3CMMA 1J0BA 3K7EA 1FS6A 4LTNA 3R24A 4OK3A 4YMUA 10MHA 3HV2A 3ZDBA 4PHGA 4RIFA 4BEJA 2C5AA 2W5UA 3QV2A 4KI7A 3FRHA 3D2LA 4A8JC 2HHCA 1R16A 2JAPA 1JIQA 2ZJOA 3EG5A 5C81A 3J81k 1ECGA 5C4MA 3H75A 1FMTA 1HNZB 3VR1A 1SIOA 2NAFA 4L95C 3HVIA 1LS1A 5FOXA 2ZT7A 5B4TA 1WXWA 3RFUA 1YNOA 1JIKA 1PFGA 4RHCA 5L3VA 2WSSD 3GA5A 1PX0A 2JAHA 3L4EA 1PGPA 1SR8A 1O94C 2C3PA 4RSMA 1GSIA 2YASA 1X8XA 5KSOA 4X95A 3F73A 3ESZA 1F7UA 1UEIA 1H1DA 1L7NA 1CIVA 1VIYA 2O8VA 2YNMC 4JBYA 3E0QA 3KXKA 3L49A 4RBNA 5D5QA 5BSMA 3VAYA 2W93A 1YZ3A 1WU7A 3C1UA 3T1YB 2DPYA 4RF2A