3BTSA

Crystal structure of a ternary complex of the transcriptional repressor gal80p (gal80s0 [g301r]) and the acidic activation domain of gal4p (aa 854-874) from saccharomyces cerevisiae with nad
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
422
structure length
384
Chain Sequence
NAAPIRVGFVGLNAAKGWAIKTHYPAILQLSSQFQITALYSPKIETSIATIQRLKLSNATAFPTLESFASSSTIDMIVIAIQVASHYEVVMPLLEFSKNNPNLKYLFVEWALACSLDQAESIYKAAAERGVQTIISLQGRKSPYILRAKELISQGYIGDINSIEIAGNGGWYGYERPVKSPKYIYEIGNGVDLVTTTFGHTIDILQYMTSSYFSRINAMVFNNIPEQELIDERGNRLGQRVPKTVPDHLLFQGTLLNGNVPVSCSFKGGKKNLVIDIHGTKRDLKLEGDAEISNLVLYYSGKEIMEVYHLRNYNAIVGNIHRLYQSISDFHFNTPSQFVMQGFDFEGFPTLMDALILHRLIESVYKSNMMGSTLNVSNISHYSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galactose/lactose metabolism regulatory protein GAL80
publication title NADP regulates the yeast GAL induction system.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 128
structure length 384
sequence length 422
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3btsA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3btsA01
1Y8QB 3C3XA 3F6YA 4RVHA 5HA5A 4AJOA 4I5DA 2UVDA 3WTCA 1LBEA 4F3YA 3OIGA 4KQWA 4RDHA 2HSDA 2VYVD 1HE2A 1LXCA 4CQLB 3E1KA 4CMHA 3M1AA 1Q7BA 2Z1MA 4FBGA 4DXHA 4GWGA 4CV1A 5COBA 3DO5A 2VHZA 3C1OA 5FYDA 3NAQA 1PJ2A 3DZHA 2X5JO 3V1TC 1I10A 5FFFA 5EINA 5IZCA 1E6EA 1DXYA 3TRIA 4BMVA 1M75A 4LSWA 4R5HA 4J16A 3WMWA 4W6ZA 3T4EA 1P44A 2D1YA 2C07A 3H6KA 4GWKA 1XHLA 3CSDA 3H4VA 4KWHA 3RBVA 3FR7A 1GFSA 1KBZA 1VL8A 1QP8A 2NACA 2JL1A 1H6CA 1SOVA 3IDSA 3WICA 4GMGA 1ZJZA 4GKVA 3INRA 1J4AA 4S3MA 3TPCA 2I67A 1ZXBA 4BO8A 2VT3A 5L4SA 3JYLA 3RU7A 1T2FA 3FWNA 3F5SA 4OIMA 1KVQA 4MKXA 2XXBA 3CMMA 3IUPA 1E6WA 2OHXA 3SJ7A 5L95A 1EMDA 2RH8A 3SC6A 1E3IA 1YOVA 2E82A 5CPFA 4PRLA 4U8GA 3K2EA 3UUWA 4YBZA 3RUDA 2OL4A 4MVJD 1VKOA 2EP5A 3ZV3A 1MC4A 5DP1A 4B8ZA 1DDOA 3OQ6A 4WCFA 1DSSG 3UOGA 3S2IA 4BV9A 3E5RA 1ISMA 1YS4A 3UFXA 5CEFA 3GK3A 1H2HA 2YV3A 1DC5A 4G2NA 4N5LA 2W2LA 1JTVA 2E4AA 2GZ3A 2GRAA 1VJ0A 1QYDA 4CMIA 2YHIA 2BFMA 3LT4A 4GX0A 4BHTA 3ZWXA 3PDJA 1B7GO 3Q2IA 1PZHA 4D44A 1GCOA 1Q1NA 1Y8QA 4O5OA 1R16A 1B8PA 4HNGA 3QV1A 3ADOA 4TROA 3DBRA 2NNLD 3QWHA 1PEDA 4FCCA 4IDCA 3OH8A 3OHSX 2WE8A 4CQLA 4PLGA 4LVUA 4GLLA 4KOAA 4R1TA 2PGJA 4WLFA 3WGIA 4MVJG 4OOEA 4UVGA 1LC0A 4M89A 5T5QA 4BGIA 1DIAA 1IB6A 3H7AA 1YL5A 4EUEA 1D7OA 5JSFA 3JD4A 5JMPA 2B5VA 4L73A 3LC2O 5KNLA 3DFUA 1IL0A 1JKJA 2VRCA 4D45A 1FMCA 4Z3KA 3C7DB 3OF2A 5CP8A 2C0CA 1QLJA 4NZ9A 3IJPA 1CYDA 4EUFA 1U4OA 3RUCA 2A94A 4RV9A 4BL5A 1OAAA 5JYDA 2GCGA 4IQ0A 4L0QA 2X86A 4HFJA 3DQPA 2LDBA 2VHWA 3G49A 3FNGA 4AJHA 4B3IA 4XQGA 5C5IA 1B14A 3D4NA 5C37A 3DC2A 3PP8A 4CMAA 3TWOA 1ZK2A 3E03A 1B0AA 4JJGA 2PZKA 2DPHA 1YJ8A 2ZB7A 4YRBA 1NX6A 1S6YA 1CF2O 5DDIP 2V7PA 4LK3A 2BKAA 2BD0A 4GMFA 4A73A 1C0KA 1I36A 3LT0A 3QVTA 3RD5A 3WGGA 5DBFA 4ITUA 5EERA 3UHAA 1YGYA 3AW9A 3GFBA 4AJLA 4YJGA 4D46A 4XEHA 1EZ4A 3QLJA 4B4WA 4MVJI 2NQTA 3TZ6A 4NFHA 3ITKA 3N7UA 3R1IA 1RM5A 2HKIA 5A05A 1C14A 1QV6A 4W4TA 2HQ1A 2HMTA 3CZMA 1KS9A 3ONEA 2DUWA 1HF3A 3LK7A 5DCWA 4GI2A 4ALNA 2NVBA 1MP0A 4N18A 1PZGA 4E4YA 3AU9A 4XJTA 4YAIA 1XA0A 1GAEO 4MO2A 1MA0A 2O3SA 2DU8A 3ENKA 3AI2A 4TRNA 5JFOA 2RCYA 2B4TO 1R66A 2R00C 1IHYA 4ZQGA 3TQHA 2XXJA 1NWCA 4CL8A 4MVJH 3KVOA 2GN8A 4WLEA 4HX5A 4YJDA 2WD7B 3JSAA 3E48A 1O89A 3PLRA 2QYTA 5IJZA 3B6ZA 5JCJD 1ZK1A 3JYQA 1P1FA 4BNVA 4BUCA 3GRPA 3K30A 1I01A 1I5RA 3AM3A 4BO5A 1E1LA 1XIVA 5TX7A 3KSDO 1LDEA 5GZ6A 3QWIA 1LQTA 1HDOA 3JQAB 1R12A 4E32A 3RSHA 4R1UA 1DRUA 2FR1A 2JCXA 1HDCA 2X4GA 1NBOA 4TVOA 2EG9A 2VZ8A 2UAGA 1LUAA 2OP0A 3RKRA 4DTIA 4MVJM 2OO5A 3S1LA 4IM7A 4CJXA 3ZV5A 1BW9B 1I3LA 1GYPA 1DC4A 2YZ7A 3DAPA 1ZFNA 4E3ZA 4RPLA 4E0BA 2IYOA 1YBVA 2YY7A 1I3MA 1AN9A 3VC7A 1EK5A 1VKNA 1KVSA 1A4UA 1PS9A 3JD1A 4FOSA 7MDHA 4OSOA 4JXKA 2YYYA 5EMHA 4II2A 3FR8A 6LDHA 2D8AA 3SX2A 3M6IA 4ZQBA 4DBZA 3NGLA 3MZ0A 1C1XB 1GUYA 1LDGA 1Y5MA 2V6MA 2Y1FA 1TT5A 5B37A 3DEYX 3ROPA 5LC1A 1KC1A 4QX6A 1GZ6A 4QFDA 2Y0EA 2PK3A 1I33A 4R4JA 1I2CA 3HNPA 5I7EA 4E31A 4CM9A 2AXQA 5GZ1A 4BNUA 3I9OA 4TWRA 5FEUA 3NTRA 3DMTC 5M6DA 2Y05A 3KXDA 1HYHA 3FNHA 2ZQZA 4BNNA 3VZPA 3WYEA 1MG5A 5T73A 9LDBA 4XQCA 3D64A 4EGFA 5L7WA 1E7YA 5BT9A 4BKRA 4PLTA 3WIDA 3QVSA 1B26A 2PKQP 2BF7A 1GUZA 4FJ2A 4FJ0A 4Y6RA 1MXHA 2J8ZA 3DFZA 4IGEA 1M76A 4RZIA 4XWYA 2VHVA 1E1KA 3C1TA 3R3JA 4GKBA 4E21A 4E33A 1R4NB 3JD3A 4E5KA 3AUAA 1PGOA 1NVTA 3HDHA 3VVCA 1SO8A 3TOZA 4MVJF 1WMBA 4XB2A 2DBRA 2PR2A 4E2WA 1Y7TA 3E9QA 3RKUA 4FGWA 3W8DA 5B4TA 2CMDA 2WJPA 2O48X 1PQWA 3SVTA 3FI9A 3PTZA 1BW9A 4YT2A 2AMFA 4HXYA 4BNMA 4BNXA 4MP8A 4HADA 1UUFA 2HMSA 4B7UA 1VL6A 5I7SA 3NRCA 3PEFA 4DLBA 3HN7A 3TDKA 2B35A 1PSDA 3U4IA 1T2CA 3F4LA 5B12A 4NBWA 1GV0A 2EP7A 4OXNA 2AQKA 1RJWA 3K6JA 5U9CA 3JYOA 4Y98A 3WTBA 5A5EA 3OA0A 3KETA 4M1QA 4DYDA 2ZKLA 3H2SA 1VPDA 4KUEA 1RKXA 2ZQYA 1BTOA 4GLOA 4WLVA 2Q2QA 3L6DA 1H0KA 2VOJA 4BNYA 4PG7A 4NBTA 2GGSA 2VHXA 3EK2A 3ZHYA 1AXGA 4UVEA 3L6OO 2O50A 4WUVA 4BNTA 5JYFA 4ZRMA 2C5AA 4CLXA 3V1UA 3C85A 4NG5A 4A2CA 2A92A 4UREA 4DC0A 4AJJA 4BKPA 2G17A 4DQXA 1V9LA 2H63A 4KZPA 1FDVA 4M86A 2EJWA 4PVCA 1R0SA 2RH4A 3MCVA 1C0PA 2NQ8A 4B8WA 1OMOA 2C2XA 4UEKA 4CQMB 1Z6ZA 4I5GA 2YQ5A 1DFGA 4HBGA 5THKA 1U7HA 2GDZA 2XAAA 1X7HA 3PWKA 1UXIA 2DBZA 5KKCA 5KVCA 1ENPA 2X23A 1ONOA 4PG5A 3DB2A 3WLEA 4DVJA 3ST7A 4UUOA 5TC4A 3TF5A 4IMPA 4LMPA 2P9GA 2DAPA 3E6AA 3B70A 1WDKA 5JW6A 4Y6PA 5JO9A 3S2GA 4Q3AA 4RF3A 4XD2A 4D3DA 2W2KB 2AG5A 2EIHA 1TXGA 5COAA 1HTBA 7ADHA 4D43A 4PG8A 5TIIA 1EQUA 2VRBA 2HMUA 2O3JA 3GDFA 3OM9A 5BSFA 1TI7A 2IZZA 1U8XX 4CODB 1H6BA 1M67A 4W7HA 1N9GB 4GX1A 1EBFA 4BNFA 4XRRA 1R0LA 5T8KC 3F1KA 5IDYA 4AJ1A 3EAGA 4OL9A 1LDNA 4FDAA 2BH9A 2HK9A 4DL9A 3VOSA 1UDBA 1IPEA 1GTMA 1QYCA 1DBVO 2VTEA 1LDYA 3AM5A 2EJVA 2PGDA 1WWKA 1M6HA 2JKVA 3DZGA 2EGGA 3PGXA 3ZWMA 1V8BA 3AJRA 3L4BA 4OXYA 3I9MA 4FFNA 4B4UA 1BDMA 1NQ5A 3PQDA 3JQBA 4J49A 4BS9A 5LDHA 2PZLA 1Z75A 4D42A 3GGPA 2DTXA 2BMAA 3KYDB 4OKNA 3PQEA 2J3JA 1EE2A 1VL0A 3SEFA 1IUKA 1TT7A 2AE1A 5TRTA 2B83A 4QSMA 5FI3A 4BO7A 2P9EA 3LU1A 3U3XA 1LI4A 5CEJA 5A02A 5ES3A 1QKIA 4U0JA 5CDTA 1GQ2A 5CDYA 1YO6A 2P68A 2IEDA 4UULA 2AEFA 3VH1A 3I9NA 4DBVO 1MGOA 2GNAA 3AUSA 5LCXA 3DBLA 3RC2A 3RUFA 3M2TA 4A0SA 1EFKA 2AEMA 4J7XA 4O63O 2Y0DA 2I3AA 4R68A 3L07A 5JAMA 4NDNE 3K9QO 1U9JA 2WM3A 5CFZA 3SBOA 2O4UX 4WE3A 3IAHA 5IFLA 3WYBA 2I66A 3WNVA 2E48A 4B7XA 3FF4A 2GN4A 3D5TA 1BG6A 1J5PA 5C7LO 3VHRA 4B7CA 1N5DA 5JYAA 4CM5A 3DAFA 5L45A 4DPKA 1I3KA 1P33A 4P38A 1H6DA 1E0DA 1QR6A 1RM0A 1IPFA 1OOEA 1SCUA 2AHRA 4LCJA 1UR5A 4G81A 3CMCO 5K6AA 4KMSA 4XX0A 1A7AA 3GNQA 3FTPA 2O3UA 1ADCA 3L0DA 4JP2A 3T7EA 3FPCA 3W8FA 4B3JA 1EBUA 1HSZA 4E2YA 1I0ZA 1E3JA 3H9EO 4RPKA 1UXJA 4NNJA 3Q6IA 4UVDA 2DVMA 3ZWYA 4BO6A 4Q3BA 4W99A 5L7YA 2XOXA 4CLOA 2I6TA 5L4NA 1M2WA 1O95A 5BSEA 2Q2WA 5JAIA 1V6AA 3R0IA 1O8CA 4YYZA 3KYDA 3ITDA 4GPD1 3MWDB 5J23A 3NTQA 3D1LA 5BR7A 4DREA 1ULUA 4LVCA 3EYWA 2WSBA 5G0SA 4WEOA 3SLGA 1G1AA 1P77A 4J4BA 2O2YA 2VYVA 3K2BA 1E3LA 1LX6A 3LT1A 3NGXA 3VKVA 3BMQB 5A9SA 2DUUA 2I5PO 3DZKA 1XGKA 3GEMA 1E6UA 4UAGA 5T64A 4EJMA 4ZD6A 4CMGA 4Z0HO 4PLWA 4FFLA 4FR5A 1P0CA 2QG4A 2D2IA 3PWZA 3E18A 3WXBA 4IY1A 3VH3A 4HWKA 1UDAA 2Q3EA 4QTZA 1VI2A 2R2GA 3V5NA 1YQDA 1U3UA 3PK0A 3RFVA 5IDWA 4L76A 3AUUA 3OIDA 1U3VA 3U4CA 1HWYA 1XU7A 3GEGA 4DA9A 2X1HA 4ZQFA 1X7GA 4R3NA 3DHYA 3A1NA 3TL3A 1SC6A 1QYVA 5CDSA 4FFMA 3GRKA 3ZN2A 5I7FA 2Z95A 3F1LA 1WXDA 1XG5A 3NEPX 1JWAB 4O6VA 5DBGA 3V8BA 3ONFA 1OFGA 2DQ4A 2FPIA 4RF5A 4J1NA 1NVMB 1UXKA 2FP4A 1ORRA 3BTOA 3EVTA 4MPDA 2IEBA 4B79A 4MVJA 4PIVA 4OMUA 4OJNA 1HRDA 1MG0A 4DMMA 3GC6A 5F1OA 3ZU5A 4YRDA 4JGBA 2A4KA 4ND1A 5JDIC 1UP6A 4XYEA 3ICCA 5JC1A 4NJMA 1ID1A 3X2FA 2CY0A 1A4IA 4EBFA 1YOVB 2EV9A 3EHEA 1WZIA 2P4QA 3OJ0A 2JFHA 3NKLA 4JNKA 3ZU3A 3PZRA 4X54A 1ADGA 2PD3A 2IODA 4WCFB 3WSWA 1YDEA 3GZNA 3EZLA 4FJ1A 3WG9A 2JCYA 1LDMA 1HDGO 1KEUA 1E7WA 2Y1OA 5JXWA 4RQTA 1CQIA 1N8KA 4CUJA 1EDOA 5A04A 4CMIB 3C24A 2YHIB 3PHIA 4XB1A 1CWUA 3EY4A 1HYGA 4IDFA 4URFA 4XR4A 5DBIA 3OFSA 1ZK3A 3SLKA 3UXYA 1KC3A 1U5CA 1Q0HA 3WS7A 1VJTA 2QIOA 4P4NA 1T1RA 3MTGA 1OI7A 2PH3A 5CDUA 5ILOA 4BKUA 3KB6A 3DBRB 1EVJA 1O0SA 5H81A 1QXSA 1ZO8A 2YV2A 2X0RA 3I52A 4EI2A 1IZ9A 4K1LA 4DIBA 3A4VA 1GPDG 1KEVA 2GASA 4MKRA 1JWBB 4RZHA 4LGVA 2FHSA 3IIEA 1IYZA 3AK4A 5IN5A 1LNQA 5BSGA 3H2ZA 1NPTO 1QMGA 2H9IA 2AEJA 1E7MA 3TOXA 2PH5A 5L40A 2PLAA 3WQRA 3ETGA 3QVOA 1IULA 1DHRA 4I5FA 3ZNNA 5BSHA 2X5KO 5G4LA 3VTFA 2GUGA 4F6CA 4S1VA 4Z3DA 3WMXA 2JHFA 1GDHA 3OETA 4QO8A 1K6IA 5IG2A 5DZSA 1K6XA 5HWSA 4R1NA 5JYEA 2DFVA 5G0TA 1HE4A 2J3HA 5ITWA 1NVGA 3QVXA 5KKAA 5G0WA 4YQYA 3I23A 2HJSA 3H8VA 1T25A 4DQUA 1EE9A 1ZCJA 1P9LA 3IP3A 1Z7BA 3O4RA 3ICPA 4EJ6A 3HDJA 3I6QA 4BNJA 3JQ7A 1SZJG 1AUPA 2FOIA 4M55A 3E8XA 4TQGA 5THQA 3AY3A 4PZDA 4YTEA 4NFSA 2G82A 3KLMX 5IDXA 1WNTA 4OAQA 2GN9A 2YFQA 1F8GA 4ZJUA 5KJFA 4YJGB 1QSGA 2YHUA 1LQUA 2Q4BA 3BAZA 4IDBA 4NJOA 4BKOA 1K0UA 3UF0A 2Y0CA 1N2SA 1LLCA 1V3TA 3H5AA 1DIGA 3LLVA 3W4JA 4RVDA 3WBFA 2IYPA 4DPLA 3PQFA 4CLEA 1P74A 3JQFA 3JQFC 5F3RA 1T2EA 2GLXA 4R3WA 3WJAA 3FWZA 4KWIA 1X15A 1ZW1A 3PZBA 1W6UA 5JCJA 1BHSA 1T1SA 1PJLA 1KY4A 2EEZA 3I3OA 1CEQA 4CM7A 3O03A 2OBYA 3OQ1A 3T7CA 1DLJA 2IE0A 1JQBA 2C54A 4DRYA 4QECA 3JCZA 2FMUA 3GDGA 4KDFA 3D5QA 4BB5A 4IQGA 3HE3A 3QHAA 4DIOA 3W1VA 5I9LA 5BNFA 4IXWA 1HKUA 4GAEA 1DOHA 4PVDA 3E5MA 3EC7A 5BNIA 4J1TA 1U3WA 3QRWA 4BMSA 1LTHR 4N5MA 4XZ3A 3RUAA 2J5KA 4MP6A 2G76A 3BMCA 2FZEA 3PHLA 3JQGB 3UN1A 2JHGA 4K26A 1K6JA 1VJ1A 1BXGA 3O26A 4XRGA 3PWSA 3HN2A 1HYEA 4FGSA 3ROKA 4D79A 4ESOA 1R15A 3OA2A 4J2HA 3WR5A 5KJ1A 2D5AA 3C7CB 2QHXA 1DIRA 9LDTA 5JCXA 3CTMA 3RVDA 1TVEA 2OMEA 3D7LA 3S55A 4B4OA 3H5RA 1C3VA 5G0UA 2UUPA 4AJ2A 3VPXA 1CETA 2WD8A 3H9QA 1JA9A 3OJEA 2QZ9A 4U7WA 1LC3A 4AJNA 5JMWA 5FWNA 4ZGWA 2AE2A 4DIFA 1R4MA 4YXFA 2G5CA 4YJHA 2TMDA 4HY3A 4CV0A 1L7EA 4A26A 2OFPA 2CFCA 1ZMOA 3EDMA 4CMEA 4CMEC 1X0VA 1UJMA 3ETDA 1GY8A 4MVJE 1UP7A 3COSA 2C29D 4GQAA 2Q1WA 3RBXA 3AUTA 3GNTA 1Z45A 3HB4X 5DN9A 5EPOA 3S2EA 3OBBA 3HWRA 2P2SA 3O9ZA 5AOVA 3KOUA 3TSCA 1ISJA 4U0KA 1YE3A 4NPCA 5AXBA 4J2OA 1TT5B 1P45A 4GSKA 3PFFA 1X1EA 2O3RA 4IXTA 1Q2XA 4GGOA 5MDHA 2I9PA 2PY6A 2FR8A 4Z0TA 1K5HA 2P5YA 5TGDA 4WLOA 3TZQA 2R00A 4OSPA 4XJSA 3WDSA 1SEVA 1HLDA 4D7AA 4CMBA 1GCUA 3FD8A 4QFCA 3BHIA 4CM6A 5BQFA 2BFOA 4ZRNA 2HMWA 3GUYA 3NUGA 3BA1A 4CR6A 1BXKA 1X14A 2W2LD 2NU9A 3ZCXA 3QA9A 3VPSA 8ADHA 1LSJA 4FC6A 4FC7A 5L9AA 4DPMA 1Y8RA 1V0JA 3AFMA 3AOEC 1QYXA 2JD2A 3GAZA 1DHTA 5CDGA 4R41A 2GYYA 3JQGA 2BFAA 4YA6A 1X7DA 2B0JA 2WTBA 4QXMA 3RUIA 3BMOA 3L4SO 2VTDA 4YRAA 5KVQA 3WWZA 2QQ5A 4Z9FA 3WLFA 5ILGA 1Q7CA 1X13A 3JQEA 1ENZA 3KLPX 1WAMA 2GN6A 4ZN6A 2Y93A 1JDJA 1NPDA 1CRWG 3ORFA 3GPIA 4IDGA 4MIEA 2RHCA 5A3JA 1Z82A 4YCAA 3ZWVA 1U2GA 4DLAA 4TRJA 1ZZEA 1FDWA 3I4CA 4DMLA 2O4CA 5DOVA 4AJIA 5CEEA 1P1KA 4EITA 3JQ8A 3Q3CA 2ZB4A 5A3VA 1Q7GA 1GEEA 1AHHA 1H2BA 3PIIA 1PTJA 1GZ4A 4EZBA 1J0XO 2DTEA 4TZKA 3DAGA 2P91A 3O8QA 3L6EA 3PJEA 3TNLA 4ID9A 1I2ZA 1KEWA 2V65A 3RUHA 3I5MA 2D0IA 1ISGA 3WIEA 1P1RA 2P5UA 2VWGA 4IJVA 2V6FA 2X9NA 3B1KA 3DHNA 4JBIA 4AFNA 4CM8A 2B4QA 2Q2VA 3K92A 3OJOA 3UKOA 4L4RA 3UCEA 4WNIA 4XDZA 1PGNA 4NMHA 1C1DB 4Q39A 2QZZA 2C7GA 3MJSA 4ALMA 1I8TA 3DMTA 1H9AA 3QE3A 2OBNA 3U5TA 2G0TA 3EZYA 3ULKA 1PR3A 4IINA 4XQ9A 5CG2A 2CSUA 4WCDA 5I8ZA 1CJCA 3RJ5A 3IJRA 5IXSA 1ML3A 5JE8A 3KBOA 3GVXA 1HETA 2FZWA 1U8FO 2PGLA 2JD1A 3CEAA 5KIAA 4BO4A 3OSUA 4JBHA 1IY8A 4EUHA 4RPGA 4JX8A 5A1TA 3EMKA 5EIOA 2GZ1A 3F3SA 3PVZA 3W6ZA 5IDQA 1E92A 1Y9AA 3M1LA 3IS3A 3WQSB 4AJ4A 4B3HA 3I9KA 3DDNA 2VNSA 3LSYA 3GPDG 1YVEI 3I6IA 3D3EA 3LYLA 4KDEA 5HRUA 1KIFA 4RF2A 3FNFA 4ND2A 5KVSA 3CXRA 3HJAA 1E7SA 4NQZA 1RPNA 1A9ZA 3FBTA 1LA2A 2XF8A 3WX0A 3BIOA 2C7VA 4JCOA 3RROA 4QT0A 2ZTVA 2EGHA 2H6EA 2ZCVA 3HHPA 1D8AA 1N7HA 3VZSA 3B1JA 5I7VA 4Y6SA 3N58A 3TZHA 3AI3A 3H3FA 1I3NA 1YB5A 3KSZO 1PGJA 1IHXA 3LC7O 1TB4A 5FI5A 1U28A 3JYNA 1ARZA 1E7QA 2J3IA 3GF4A 4CV2A 4D0SA 2B69A 4D3SA 2ZB3A 4ZU3A 1B16A 2VWPA 5LDGA 4BGUA 4CUKA 2AQ8A 1E5QA 1IE3A 4NK5A 2PTGA 1PU2A 3KHUA 1OBFO 5K0ZA 4ALKA 1C1DA 2Y99A 3RFTA 3ZHXA 2ZK7A 1PS8A 4L8VA 1O94A 4KUGA 3LLSA 2J3KA 4R16A 1WW8A 3GEDA 3HDYA 4TRRA 2X7HA 3ZWOA 3ZH2A 2DT5A 4CM3A 3WGQA 2HLPA 4UUNA 3PFWO 1KVRA 2X8LA 4KQXA 4WOJA 1D1TA 3PJGA 1UZMA 2P4HX 1E7RA 5IXYA 2I76A 4Z9XA 5I9MA 3G0OA 1JKIA 5GY7A 4YDRA 4D3FA 4L74A 4UVHA 2NWQA 3ANMA 1P0FA 4OXKA 3PIDA 2DC1A 2NM0A 3NJ4A 4IJWA 4J0EA 2TMGA 1BXZA 3ADPA 2VZ9A 3DBLB 3WYCA 1EUZA 2Y68A 2ZTLA 3R6DA 1ULSA 2GR9A 1QG6A 1YXMA 4HUJA 4YEDA 4OQYA 2Q1TA 4JBGA 3QP9A 3IKVA 2DBQA 5T57A 4G5HA 1NQAO 4NIMA 3DZFA 1F17A 4II3A 2Q99A 3S2FA 5KVVA 3HFSA 3ZWAA 1I30A 2EF1A 1MXFA 3FCOA 3F4BA 3WWYA 4ND4A 1GYQA 1NQOA 2PD6A 5A9TA 3VPHA 2GF2A 2WYWA 4MOWA 4J91A 2XPCA 4IDAA 4P22A 5T8KA 4IDEA 4YVFA 3PPIA 1JLLA 2ZB8A 1Z74A 4HP8A 3P2OA 3MJVA 4RLSA 1VLLA 4R69A 3JQAD 4F6LA 1QORA 4O0LA 2Q46A 1YL7A 2J6IA 3R3SA 4MP3A 1PR9A 1UP4A 4CLOB 3VTZA 1IZ0A 3VZQA 3K31A 4L9RA 2PKRA 3X2EA 5B4UA 3OICA 4NU6A 3GG9A 3ETEA 2Y67A 3INGA 1VC2A 5TJ9A 5KJ6A 3ENNA 3U0BA 1Y6JA 4WGGA 3Q11A 5DCUA 4Q3CA 5K9ZA 4RPHA 3RJ9A 3F46A 1PIWA 1FK8A 1JN0A 1ENOA 4DGSA 2HK8A 3ASVA 4K28A 1WDMA 1NAIA 2QRJA 3FSRA 5A9SB 4BMNA 3L77A 4IS2A 4KTTE 4TMFA 5JAQA 2PZMA 4YWJA 1Q0QA 1KYQA 1KVTA 4BNKA 4W9NA 3LQFA 4W9NC 4TZTA 4R54A 1W0CA 2I3GA 4GSLA 5G4KA 1YB4A 1YRLA 4CV3A 3GLQA 4U6SA 1DAPA 4YAJA 1N1EA 3Q9UA 1YB1A 3TFQA 2CD9A 3WFJA 4MVJP 4E30A 4E5NA 1I32A 1HE3A 1GADO 4JP3A 4JQCA 3VPGA 4UVIA 3HG7A 4I08A 1HL3A 2FRDA 3PHJA 4H15A 1VSVA 3Q2KA 3P5SA 1DC3A 1M66A 4JK3A 5TS3A 4CPDA 5EN4A 3JD2A 3BHMA 1AGNA 5C7IO 4P4GA 3GUCA 3KZVA 1PJTA 4H7PA 4HFMA 4W7IA 1NP3A 1SOWA 2ET6A 3EUWA 4ALIA 4FQ8A 3ZWNA 1HEUA 3HQ4O 2O7QA 3MEQA 3NT5A 4ZA2A 1A72A 1F8FA 2W8ZA 4MIOA 2OZPA 1NNUA 3AY6A 4IZHA 5F5NA 1BVRA 5F21A 2PV7A 2NU7A 2JAPA 4NJMB 2Q50A 4WKGA 2JJYA 1E3EA 2WYVA 1Y5RA 1XQ6A 2A35A 4GVXA 4J7UA 2VUUA 4KP7A 1F14A 3GY0A 4K9DA 2OGUA 1T26A 2W4QA 3FBGA 1B8UA 3RBZA 2AQIA 3GZNB 1R6DA 1EVIA 1JVBA 3TZKA 2Q45A 2BRUA 4YACA 1NFQA 1U7TA 3OMLA 3A28A 5L53A 3GA0A 2Z5LA 3RCBA 1PJSA 3VH4A 3NJ8A 5JC8A 5G0VA 2CNBA 2BGMA 5JDCC 3MOIA 3BMNB 4YT8A 3B20A 4I5EA 4Z9YA 2E37A 1BRMA 1ZMTA 2F1KA 4GL4A 3K73O 1NASA 4BO3A 2NVUB 3PDUA 4IDDA 4WASA 4FFRA 1SB8A 3GH3A 4OKIA 3V2GA 2J5QA 4NI5A 2JCVA 2VUTA 4QQRA 4IQ8A 4BNGA 3KEQA 1P1HA 3KYBA 1T4BA 1NR7A 4EW6A 2I99A 3KM0A 1X0XA 3LZ6A 3OJLA 4WPGA 1UH5A 4YT4A 4Q3DA 2HU2A 3DL2A 3MWEB 5T6BA 3JQ9C 3ONDA 3C7AA 1SEPA 2BI7A 4A10A 4E2ZA 1ISFA 4RLHA 4C4OA 3RC9A 3GVHA 5L51A 4CQMD 1PQUA 3GNSA 3CINA 1UXHA 5IZ4A 2HJRA 1P31A 5C3MA 1KY5A 5COQA 1NHGA 2C5EA 4ZICA 4RGBA 2NSDA 2CZCA 3CPSA 2G1UA 1MUUA 3WGZA 5ER6A 1J6UA 3MJTA 5JDIA 3AWDA 4LSMA 3ZHBA 3EGOA 5ITVA 3V2HA 4QO7A 4TSKA 1IOLA 3Q1LA 5EESA 2SCUA 3KYCB 3IQDB 5ER9A 1NM5A 4K6FA 1RYEA 3JQ7B 4YAGA 2VOEA 1VSUA 1T4DA 2ZYGA 3UGKA 3QVWA 3DZBA 2IDZA 3VPFA 4J4TA 5AQ1A 1KOLA 5EQFA 4L4SA 4EJ0A 2GSDA 5JO0A 2FWMX 3D4OA 1O6ZA 3BMNA 4GBJA 5KJEA 3PYXA 3DZJA 1Y1PA 4I9UA 4EEXA 3GAFA 2F00A 4CLHA 2NVUA 2X0JA 5CG1A 2X9GA 4DWVA 2ZJ1A 3CKYA 1SNYA 3WSVA 1PQPA 2E6UX 3ANLA 3KRTA 3UAGA 3DOCA 4Y67A 4YT5A 1WMAA 4JN6B 1GV1A 4IUYA 5JPIA 3S8MA 3HDQA 2EW8A 1BGVA 4BO9A 4XGIA 4W82A 1RM4A 2X22A 1VRWA 1DJNA 4YJFA 4MKZA 2WYUA 2PKQO 1DRVA 4XYMA 1LDBA 1DRWA 3TL2A 1UZNA 2X58A 5G2OA 4M49A 3BHJA 3ZV4A 3VVBA 1EEHA 4FIZA 4DLLA 1GR0A 1YBMA 1FDTA 1E5LA 3JYPA 3CH6A 1P1IA 2JFFA 4AJEA 2YDYA 3WFIA 3BMCB 4G65A 4Q3EA 4EYEA 1LRJA 3LT2A 4J6FA 2YDXA 1BXGB 1R0KA 5IZCC 1BWSA 3PRJA 3EW7A 4OHUA 4UEJA 1ZXLA 2X0NA 4ND3A 1UZLA 2HO5A 2ZYDA 2A9FA 2CVOA 1GPJA 1JAYA 4IMRA 4PLYA 1B3RA 2ZTUA 3OIFA 4PLHA 3HZZA 5L4LA 3KYCA 2NTNA 3GMDA 2FY8A 1FXSA 3OP4A 4AICA 4CLRB 3GFGA 1Z73A 4B4VA 1R4MB 4N54A 1O9BA 3E82A 1MFZA 4NBRA 4YJHB 4ZQHA 2NV6A 2Q1UA 2DBVO 4ILKA 4CM4A 5KJCA 1AE1A 2E49A 2YFHA 1NPYA 4OO3A 3QWBA 2ZATA 4AL4A 1NFFA 4XDYA 2CUKA 1OC2A 2ZCUA 4J4HA 2PD4A 3FHLA 3RQSA 5IN4A 1LRLA 1YH3A 3BXXA 4OM8A 4YAEA 3GG2A 1PZFA 5EQDA 5L7TA 4XYBA 3RIHA 4NHEA 2Y1GA 4JLWA 4P4LA 2NTVA 4E13A 1J49A 2V6BA 3ZNQA 4XGKA 4WCFC 2Q4EA 3ROMA 3EVNA 4J9VA 2VN8A 4WNCA 4XYLA 4RPJA 3BYZA 2PFGA 2RIRA 1PWZA 3DOOA 3H9GA 3G1TA 2ZIZA 1AHIA 4CLDA 3DBHA 1MC5A 4NBUA 3NV9A 1ZSVA 2VT2A 2O3QA 1C0IA 1VM6A 1SMKA 2B37A 1D1SA 2YUTA 1BDBA 2D4AA 1DC6A 1DPGA 3KEOA 2VYND 4J0FA 4IZIA 1EVYA 3VZRA 5F1KA 2IZ0A 1Y8RB 1YONA 2AA3A 5T67A 1ENYA 2NUAA 2AG8A 3TJRA 1LLUA 3GHYA 4P8RA 3QY9A 4PGFA 3BMOB 3K96A 3CZRA 4OYRA 3H5NA 3ZU2A 3GN1A 1A71A 3ZWWA 3AU8A 3RC7A 2VQ3A 4MJLA 3B1FA 4FS3A 2BFPA 2VUSA 3P19A 4PZCA 1SBYA 4HFRA 4CLRA 1TEHA 2D5CA 4LN1A 4XIYA 1XQ1A 2Y1EA 4ZHSA 1ZUD1 4OH1A 1BVUA 4A27A 3DTYA 3JQ8B 3NX4A 1ONPA 1NWHA 2NLOA 4GX2A 2X9VA 2CVQA 3H65A 1Y9EA 2CDAA 1C0LA 4MIYA 1ZNQO 3F47A 2YJZA 3AFNA 1ADBA 4PG4A 1GUFA 3O8QB 4BVAA 4WOKA 4UEOA 3IKTA 1HLPA 2UUOA 1N7GA 3ZWPA 4LRTB 4LISA 3ZHZA 3KUXA 3VKUA 2AQHA 4CMJA 2P9CA 3I83A 1ISHA 1D3AA 3SXPA 2DPGA 1SB9A 2VNAA 4CM8B 1WPQA 1EQ2A 3WGYA 1LU9A 3QWAA 1U2DA 1HE5A 1GZ3A 2RHRA 4IS3A 3MJ4A 1RWBA 3HUDA 3JQ6A 1TLTA 4FFPA 1SAYA 2HRBA 4BNLA 2Q22A 3LF1A 5TNXA 4I9HA 1K89A 3OEYA 2YQ4A 4J3FA 5DP2A 2EKQA 4A5OA 4H3VA 1SPXA 3A14A 2DFDA 3IUSA 1LLDA 5F5LA 3HSKA 1PJ4A 4CUZA 4CMKA 3QIVA 3JQCA 1TA4A 4I9NA 4AJKA 1H94A 3HADA 3AOEA 1Q0LA 1Z7EA 4N5NA 3I9LA 3QWFA 4K6CA 4RVUA 3MOGA 4NFYA 1PJQA 3HB5X 4XQEA 2B4RO 4GH5A 1B2LA 4ROSA 1PL6A 4L75A 1F0YA 1ZIDA 1D4FA 1U5AA 1YJQA 4Z6KA 1QRRA 1MLDA 3NT4A 5DF1A 3VDRA 4O1MA 3U9LA 4IGFA 1GQQA 3ZI0A 4E12A 3RWBA 5AXCA 1L1FA 1E3WB 4PLFA 3U4HA 5DOZA 4PG6A 2NADA 4MINA 2EERA 1HDRA 4XYGA 4C7KA 1B15A 2Y1CA 1K2WA 3DR3A 2CDCA 4R9RA 1JVSA 2VRCD 2NU6A 4PFJA 4WLNA 3WJ7A 1HT0A 5DULA 1NTOA 4NU5A 1G6KA 2YW9A 1WLYA 1PJ3A 4NR0A 3GN2A 5H82A 4RQUA 5U1PA 2V6GA 4BNZA 4IJUA 4JJFA 1NHWA 2DM6A 4BO1A 5H83A 2OP1A 3RUEA 5GMOA 4UUMA 2GD1O 2BLLA 1XDWA 2QYSA 4GX5A 4FN4A 1W8DA 4J90A 2X6TA 2W98A 1EUCA 3KSUA 1DB3A 1UXGA 2O7SA 5JLAA 5HS4A 1G0NA 4BGEA 4JROA 4CM1A 3UCXA 3ZU4A 1F06A 1XR3A 2GO1A 5AXDA 4BIIA 5JBIA 4WECA 3WQQA 3OQBA 2PWZA 4D41A 1N1GA 1NQTA 1PWXA 3BTUA 2H1SA 1MV8A 3DBVO 1ZK0A 2EW2A 2I65A 2PZJA 2C2YA 4M54A 4OOFA 1HDYA 2DTDA 3G1UA 4RJTA 4AG3A 1UAYA 1ZKMA 3ASUA 3JD0A 4XCVA 1LJ8A 4IPTA 3ZNPA 1X1TA 3I1JA 3WGHA 4FOOA 2IRWA 5KTKA 1PL8A 2WDZA 3JQDA 4BNIA 1NAHA 5CHEA 5B4VA 4LMRA 1XSEA 2PA3A 4XA8A 1GD1O 2D59A 4YR9A 5L3ZA 2WD7A 2B5WA 1QV7A 3DHEA 1H6AA 1U3TA 1LRKA 5TQVA 2X5OA 4YB8A 3H3JA 1NR1A 3CIFA 1GEGA 1UDCA 4MDHA 2BELA 1E3WA 1NFRA 1PL7A 3INTA 2RAFA 2EWMA 1GU7A 4U6QA 1E1MA 2EXXA 3MJCA 5F1PA 4RF4A 4NBVA 1KETA 4RVSA 5IAAA 3ON5A 3VH2A 3JQAA 3WOHA 4CL3A 2CVZA 2VWQA 3NT2A 3LDHA 2YV1A 4J1QA 2FN7A 1XCBA 3NDRA 2HCTA 2GERA 4ZQEA 4BV8A 2J5RA 1DFIA 4ONEA 1RM3A 4BGVA 1EUDA 3GGGA 5TJHA 3SC4A 3GOHA 1R37A 5IF3A 3ZDFA 2W90A 3SJUA 3RFXA 1CQJA 1XELA 5AVOA 4H16A 2JD0A 3N74A 3U09A 3VAZA 1EFLA 3ZNOA 4RL6A 3KV3O 3WGTA 1V3UA 3TFOA 3RI3A 3MJEA 3KO8A 4XR9A 4C7JA 4Q3NA 5FF9A 3H9JA 1P1JA 3DONA 4RVGA 2NU8A 4TKLA 4IIUA 3UCFA 4BQPA 1ZSNA 4DC1A 1FDSA 4BO0A 1C1XA 3PHGA 2O3TA 1GQYA 4WK6A 2VHYA 1I24A 3W8EA 2FPGA 2HDHA 2UV8A 3QW2A 2QX7A 1EK6A 1WP4A 5I9NA 1B3BA 4D0RA 5EJ2A 4FB5A 2ZJ0A 3FTNA 3QJ5A 5HS6A 3U49A 5C7OO 3ABIA 1YL6A 1S7CA 5DCYA 3VDQA 3JV7A 3OJFA 4PLVA 5KOIA 5JY1A 1WZEA 4WLUA 1OC4A 2OORA 1YKFA 2Q1SA 2X0IA 4KTVE 3PYMA 4AVYA 3NTOA 1U4SA 2C20A 4J9UE 1AXEA 5G4KB 2HAEA 3ZW8A 3GVIA 5EL0A 5A4DA 3ZWCA 4NK4A 4DUPA 4UUPA 3LF2A 3GR6A 4U5QA 4WJZA 4E5YA 4CM9D 3I9JA 1WDLA 2O23A 3IMFA 4IBOA 4M87A 5HM8A 3H9UA 1QLHA 5JY6A 4ND5A 2C59A 3FPLA 2JFGA 1R4NA 3RU9A 4XIJA 4IIVA 4J43A 4TKMA 1A9YA 4O59O 2CDBA 1E77A 3PGJA 3PLNA 3QSGA 2FPPA 3V1YA 1DLIA 1T2DA 1KVUA 1V3VA 2PNFA 4XKJA 1ISIA 1DIHA 1V35A 2B36A 4M8SA 2NVWA 1UAGA 3GQVA 4R9SA 3T4XA 1T2AA 3F9IA 5ADHA 3GHHA 1ZK4A 5ICSA 3PJFA 4PN3A 2LDXA 1DO8A 1B8VA 1YQXA 2VZ0A 3G79A 1A27A 1Y81A 1O5IA 5JAZA 5DT9A 3IL2A 4QEDA 5KWEA 5JNLA 1OZAA 2IXBA 2EKPA 5TT0A 4JIGA 3WBBA 4BNHA 4RO0A 1LSSA 2D3TA 4IJKA 1H93A 2QRLA 1ZEMA 4Z0PA 1ZSYA 3ZZNA 3E9MA 3V2UA 3AM4A 4DYVA 3L4BC 3AOGA 3JQBC 4FSHA 4BQRA 1ONNA 4F46A 1L7DA 1ZH8A 3G17A 3IC5A 4PLCA 5DNAA 3ZWBA 4LRSB 2BGLA 4FPXA 5TLSA 2ILTA 4AJPA 3ZV6A 4ALJA 1LLQA 3L9WA 4R1SA 1PX0A 4XGNA 1NXQA 1F12A 1PZEA 2R6JA 3HFGA 1LSOA 1PGQA 3DTTA 4A03A 3JTMA 3FNEA 3PHHA 2UYYA 4GGPA 4R5MA 1ZBQA 4F45A 1FJHA 4HNHA 3TN7A 3Q9NA 4I8XA 1XKQA 3TZCA 4CQMA 3U4DA 3ZW9A 4PLZA 4JJIA 3UICA 1JW9B 3BTSA 3RASA 4RORA 2DLDA 3DWFA 1LSUA 3NDIA 3O38A 3K8ZA 2Q49A 2NTJA 3D4PA 2EHDA 4Q9NA 2HMVA 5AYVA 5TSDA 4FD3A 2HK7A 4DQVA 5KCZA 3OECA 3CUKA 2VCYA 3FN4A 1JKFA 1ZVMA 3P7MA 4PRKA 1BSVA 2W2KA 5A06A 3BZUA 3GVPA 1XWFA 2OUIA 3W4IA 8LDHA 5I8WA 1YWGO 2FR0A 1ADFA 2BGKA 1GL3A 4QUKA 3U62A 4CR7A 1ZEJA 4NH4A 3M2PA 3GVCA 2CF5A 2Y66A 2UDPA 4RVFA 1P3DA 3A06A 2GZ2A 3ZGYA 1KERA 4PZEA 1H5QA 4HFNA 1HXHA 1N9GA 1MFPA 2Z1NA 3DOJA 2OXIA 5K6AC 4BKQA 3Q0EA 2WWRA 2BI8A 2HRZA 3C1AA 3D3WB 4J1SA 1T24A 1A7KA 1K3TA 1HDXA 4R01A 2C82A 3LVFO 1EVZA 5A9RA 3STHA 1W73A 3PI7A 3DMYA 4INAA 3GGOA 4N7RA 4J7CA 2CF6A 1JAXA 1PGPA 5JDCA 4E5PA 1YDWA 1HZZA 2ZTMA 2VWHA 2FSVA 4BB6A 3UVEA 3RC1A 2O2SA 1DAOA 3GMSA 1G0OA 1MX3A 3ROQA 2H5LA 3MTJA 1YBAA 2JAHA 1M6WA 5CPBA 3NDJA 5ICMA 3AY7A 3W6UA 4BOYA 2WMDA 4L4XA 4E6PA 5TT1A 4OGWA 1FDUA 4LW8A 3AI1A 1ZJYA 1KEPA 3E9NA 2GPTA 3RAJA 4RCVA 1W4ZA 3PXXA 1E3SA 4YPOA 4E2XA 1N92A 2POQX 4YJFB 3GT0A 1HDZA 5HBRA 3JQ9A 1WVGA 1A5ZA 2QRKA 1U1IA 4WEQA 5B1YA 3PJDA 3IOYA 1MB4A 1XLTA 1QYWA 5JS6A 1EDZA 3P2YA 3DZIA 4RDIA 3WB9A 5J9GA 3GDOA 1PS0A 3A9WA 4CMCA 3CE6A 4Y9DA 3IP1A 2Y1DA 4FFOA 4I1IA 1BMDA 1NYTA 1LEHA 2ZYAA 5ENVA 3UH1A 4HKTA 3ANNA 4TRMA 1YQGA 3KTDA 2HUNA 6ADHA 3DXFA 1XEAA 2RBEA 3W4KA 1H9BA 4R51A 3F5QA 5TF4A 1XU9A 2EKLA 3C8MA 1CERA 5A5FA 5A03A 1VE9A 3L9XA 4KUHA 1PJCA 1XYGA 1I2BA 3D3WA 2WE7A 4PLPA 1CDOA 4YAKA 2QW8A 3OEWA 3QQPA 4A7PA 3I4FA 2IXAA 3WNQA 1RYDA 1DJQA 5AXAA 4CM4B 4OQZA 4Y8VA 4TVBA 3BTVA 2AW5A 4GVLA 4YQZA 2BHLA 1DFHA 4HV4A 3LC1O 1DIBA 5U4QA 3UW3A 1PJBA 3D0OA 4BO2A 3FRJA 5BNTA 2OOSA 3K5PA 2FSSA 1CIVA 5ENDA 4PCVA 5CAEA 5HTOA 2IZ1A 4ZVVA 4E5MA 4FW8A 4EEZA 5MGBA 4LCEA 3NYWA 3WGOA 1HSOA 4BNWA 3G3EA 1FF9A 5GZ3A 2VYNA 3GZ4A 4CR8A 1DEHA 3BMQA 4ALLA 1E1NA 3DBHB 4EDFA 2DKNA 3PYLA 1GYRA 2WEKA 1HZJA 1JU9A
chains in the Genus database with same CATH superfamily
4ZGBA 1RYMA 1PFKA 4L8FA 1TIPA 3R6GA 3U3OA 3FTFA 3I6MA 3WTCA 3H0VB 4F3YA 2PEZA 3OIGA 5C8XA 3LCRA 3OLZA 3PQ4A 1M1YE 2ZSFA 5FA8A 4GDMA 3OZDA 2A59A 2VYVD 1HE2A 5DYTA 2WJ6A 5D1HA 2H5IA 1Y7LA 4QC2A 1YR1A 3E1KA 3DTNA 2YXNA 4UNIA 1FDOA 3GEBA 1CEEA 3ILSA 5ALLA 5FP0A 3E35A 2NT4A 3B85A 4NQRA 5LQSA 3CRNA 4KL8S 4NAHA 3UMGA 4EG5A 3RUPA 1ZNYA 3NAQA 1BGXT 2X5JO 1C9EA 3V1TC 2QPTA 5EE3A 4HQRA 5IZCA 4HHEA 5FL3A 2G07A 5TDHA 1MMFB 3TRIA 1TMOA 3OM1A 4BMVA 2WP8J 4IO1A 1BD4A 1UADA 4J16A 1JKJB 2D1YA 3LZCA 3T4EA 4AY4A 2CK3A 3BFXA 1KI9A 2R1VB 5HK8A 2HLDA 2BOVA 2QSZA 1JRLA 2QUAA 3N7TA 3W78A 5I3CA 2BFWA 2Q8NA 3H9BA 3CX7A 3KQVA 4H4CA 4ASUD 2NACA 2WA2A 5LQUA 3OM8A 3EXFB 1UK7A 1Z29A 3CUEF 2C78A 1R9JA 1ZJZA 4XWWA 5LMZA 4RESA 5E0KB 5DM70 2SKCA 4GZ6A 2BC9A 1RXIA 1ZXBA 3MGGA 4BLUA 2ZUTA 3JTEA 4OI4A 1Y9JA 2FG7C 4R1PA 1KPHA 3FWNA 4M4SA 1OXVA 4OIMA 1RWWA 2ERYA 2NYRA 4MKXA 2HHCA 2JZCA 3IUPA 1E6WA 3K0SA 5GOTA 3SJ7A 1OH5A 2BGJA 1CR4A 1E6KA 3FYCA 5AOBA 3C3AA 1QNLA 3F8SA 3RUDA 4GLJA 4D0LB 4QUHA 1VJCA 1VKOA 2EP5A 3ZV3A 4B8ZA 5JQGF 3OQ6A 1Z56C 2FMXA 1ISMA 1J97A 3ZY4A 2F3TA 5DM0A 3GK3A 1WCIB 2YV3A 1QZTA 1Z0UA 4OYLA 1DC5A 3NASA 4TTQA 3EUAA 3R3YA 4TWZA 3B6KA 4A91A 2GRAA 3P45A 3ZHRA 3BC1A 4DJFC 3N0XA 4FYKA 2FWRA 2YHIA 3EAFA 4FVTA 3ZWXA 1VHQA 4AYTA 3KBBA 2YJ3A 3FKSD 4HGYA 4UFNA 2GN2A 5DGTA 1KU0A 4O5OA 3EJ6A 4ADSG 4EFKA 3HO8A 3ANXA 3CX4A 3WDMA 1F3LA 2R68A 4F11A 1N34B 1PE0A 5JWRA 5B2FA 4TROA 4IUDS 3S8EA 5ERYA 3D3KA 1PEDA 2CNOA 1KJYA 3IEXA 4FCCA 3UG7A 3W79A 3RGGA 3OHSX 2WE8A 2OYCA 4XLZA 1GSOA 4ZT4A 2VF4X 3GXBA 3LO8A 4R1TA 2AOTB 4JB0A 1RYBA 4J03A 1G5RA 2PDAA 3FNRA 2HDOA 3S68A 4BYGA 4MA0A 4M7WA 4RIEA 2YMPA 1IB6A 4EUEA 5JSFA 4KO4S 2JH8A 4JXZA 3W2IA 3P0JA 4LX0A 3D8RA 3FIJA 4ZAGA 2BBTA 3X1JA 2B5VA 2QXUA 4MRRA 2CZGA 1NIPA 2JBWA 3KZMA 2JI4A 5KNLA 1MO3A 2OCGA 5SYAA 1JKJA 1ZU4A 5B36A 4X92A 4FOPA 4FB4A 4ZCTA 1W94A 2R1VA 4Z3KA 2H2DA 3OF2A 3OX4A 5CP8A 1KOGA 4TLAA 1H05A 5IH3A 1MIOB 1QFJA 1PFYA 1QHSA 1TZKA 2O1SA 4IFBA 2C0CA 3F6CA 1CHNA 4J1TC 1C3LA 4HVTA 1H22A 2A94A 2IW1A 2X2FA 1Y6GA 4XAQA 3HYSA 2ZR0A 4H59A 3UAZA 4JVSB 4ZVPA 4F3CA 2GCGA 5BR1A 3EG9B 2X86A 4HFJA 1PZNA 1AM4D 2NU6B 5KPJA 2VHWA 3FHOA 3G49A 3NHZA 4Z4GA 2KLHA 2CFRA 3LY7A 3DLPX 1NR5A 2W43A 3P97A 4TMWA 4TQ9A 3SHTA 3JS5A 5C37A 5J4VA 2A7QA 4FNGA 2V6JA 3TRDA 3TWOA 4DNOA 1GQSA 2P3OA 1B0AA 2WNHA 2GQ0A 4Q6BA 2PZKA 1G8HA 4IKEA 4BP1A 1T6ZA 2R5WA 4UNPA 4KMMA 4POOA 1YJ8A 2ZB7A 1MB0A 4YRBA 3KQLA 1EWRA 3C3JA 5T4EA 1EUYA 4BX2A 4C43A 2CNLA 1PVOA 3O4GA 3S2SA 1WUIS 4NG4A 1GNTA 3JW8A 1QU3A 4C01A 3PQ3A 3GEEA 3QVTA 1EUCB 4MK4A 4AMVA 4C6TB 1RBQA 1WCIA 4ITUA 2D5LA 4B5LA 1QHHA 1CU1A 1MAUA 3QUCA 1IU9A 4XLLA 3GFBA 2XMGA 3RB8A 4AJLA 4B35A 1AV7A 1HV8A 4FZJA 1T3HA 2MHCA 5L3SA 4MVJI 2NQTA 1BWRA 2WFLA 3FOCA 3ONNA 1E1RD 1PRYA 3EZFA 3R1IA 1RM5A 2HKIA 1U9IA 5A05A 4R9UC 5ERGB 4ZMRA 4K0KB 4FYMA 3H8JA 1KS9A 4L9WA 1GPLA 4AD8A 2DUWA 2DP4E 3PUVA 4XGQA 3L7LA 3SJBA 1L3BA 3F96A 3RO7A 4L02A 1YTUA 3AU9A 2R65A 5AKKA 1I5OA 1MA0A 2DU8A 2R00C 2JIRA 2ATCA 3FYHA 4QYSA 3DE7X 1NWCA 1R1DA 2FJUA 1FTQA 4Q24A 4XUDA 4CL8A 4MVJH 4EPYA 5BY2A 4P4TA 4WLEA 4I1OA 1N9ZA 4HB0A 2WD7B 3JSAA 3AVOA 3E48A 3JZAA 1O89A 4W1SA 3VV2A 3LH5A 1W581 1VJDA 1SUPA 3IIKA 2QYTA 5IJZA 4H31A 3OU6A 1MIOA 3LCVB 4UQLA 2JC3A 5LM3A 1JEOA 1TIKA 1U2PA 2XTMA 1RTTA 4PO9A 3TB6A 1AZWA 1GAJA 1XIVA 2J6HA 3GLKA 3HUUA 3Q9LA 4KXXA 3KSDO 5TX7A 2VP0A 3RJTA 3T5AA 4DUZB 4MH0R 4MITA 3R77A 5A71A 1FMFA 2VLIA 2ESRA 4MW0A 1HDOA 1ZXXA 1R12A 2QJTA 1XTZA 2JW5A 3PVCA 4E32A 2HHLA 2WKPA 2P6UA 1QO9A 2QAGB 1DRUA 3OE7A 1MJGA 2J0VA 3QBTA 4GC9A 4KACA 4MV5A 4TVOA 2G9RA 4KOEC 1XDZA 2V58A 2ORED 2OP0A 4IJMA 3R5KA 4C4PA 1WB6A 3MAGA 5JJCA 1WCYA 2BR5A 1IRXA 2MSKA 1V7PC 3W1WA 1U2GC 2OO5A 4WDQA 1GWNA 3IAS1 4IM7A 3S1LA 4CJXA 3ZV5A 5LZ8A 1BW9B 1KYIA 2QR3A 5DH9A 4C6TA 1E63A 3EXHC 1G8AA 2YZ7A 1ZFNA 4YALA 2BJVA 4RPLA 4B7AA 1A8QA 2YVLA 1JXOA 3QYFA 5CVCA 3TJZA 1IAVA 3HGTA 1RZ3A 4EECA 1SKMA 1I2DA 1X6VA 2NP6A 1VKNA 5BQ3A 1A4UA 4HGQA 4K8OA 4NYJR 1XFAA 5AW2A 4OSOA 1PTJC 3QVMA 2V74B 7GPBA 3HXOA 4J0CA 1YV9A 1TCCA 3AW8A 3SQWA 1Y6FA 2GAFA 2D8AA 4HYEA 1T6BY 5DRTA 1L4YA 1VGQA 1IDN1 3NGLA 4RZSA 4K86A 1KDPA 1Y5MA 3NUZA 4IXNA 4KFSA 1J90A 1F8XA 2DF8A 4ZO4A 5HTKA 4BX3A 4X60A 4F71A 3H0EA 5LC1A 1KC1A 2WZDA 2V4MA 2J7PA 1ACMA 2HMYB 2PK3A 1I33A 3CLSC 3NBKA 4LDRA 4QFDA 1NUTA 3R7WB 1FXWF 3HNPA 1I2CA 2QMUA 3PUHA 4Q34A 3RR2A 2XYPA 4DRXA 2GBGA 5JVDB 3PEYA 2KBEA 1R88A 4G63A 2AZTA 3IAUA 3AR7A 2DUMA 3I32A 4F2PA 4M36A 1EKXA 3I5YA 5IABA 1NZFA 2DMRA 3W9YA 1Y3HA 1MG5A 3U1BA 2IXFA 3D64A 5ALJA 1E7YA 5BT9A 2AC2A 2DETA 1L5LA 2AKYA 3HVUA 5LZ4A 4PLTA 3N39C 3WIDA 3OPNA 1OT3A 4PANA 3V8PA 4FJ2A 5JUWA 1FFAA 4QEKA 1MXHA 4ETIA 1OX5A 5AJWA 1O3YA 2GXAA 4MAMA 5E4FA 2PTHA 3FZGA 5BOSB 1SBZA 2MYUA 4TL6A 4E21A 4R2KA 2BMEA 2OCAA 4YMSA 1RI1A 4MS3B 1HGXA 2ZSIA 4RXUA 4E5KA 2HN9A 4A16A 1W5SA 2AFHB 1RQRA 3ILYA 4OXRA 2WU1A 1PUJA 3CPEA 4UOEA 5CCEA 1QG2A 4DYHA 2Y0PA 4XB2A 2C4HA 2DBRA 4OJYA 1M2HA 2ZI3A 1JT2A 2EFJA 4L8LA 4N0EA 3UGTA 2W42A 2P6RA 1J2EA 2HT1A 3KLBA 3MLEA 1KJ8A 3RKUA 3S99A 2CMDA 3ERCA 1DO2A 1PQWA 2Q9AA 4DJ5X 4YMUA 2XECA 1ZESA 2H57A 2PKYX 4Y1RB 3SVTA 4KDCA 3PTZA 1BW9A 5K99A 1SBHA 4HXYA 3LBNA 4LZOA 4A3SA 4BNXA 1U2TA 1FBTA 2XLCA 4MP8A 2XMPA 4ARUA 4HADA 2GAIA 2WMYA 3O83A 1EPUA 3SQNA 1H2ZA 3W7AA 1Y6RA 3NRCA 5D84A 5TQ0A 1S2DA 3VBEA 3TDKA 4M1EA 3D0QA 1SC4A 3U4IA 4LDJA 2IC5A 1XFDA 2FGJA 3CUSA 1GPBA 4NBWA 5B12A 3CYFA 4RFSB 3ZE0B 5JSHA 3DLAA 4DRZA 3TD9A 1RJWA 3K6JA 3JYOA 4Y98A 3HXKA 4HBZA 4C87A 5EI5A 2IZ7A 4DLBA 1NI4B 1BROA 5FBZA 2VNJA 3M3PA 4DYDA 5B7QA 4NTZA 4P7KA 1CY6A 3UJDA 4KUEA 2ZQYA 3LP5A 1YC5A 1XWIA 4GWLA 1SXJE 2Q2QA 2R4UA 1H0KA 2XYRA 3FB1A 4PG7A 5EJ5A 2C97A 2CNDA 2MSCB 4B5KA 3DEFA 3IA2A 5JVDA 2QGNA 4WUVA 5JR3A 3G2IA 2WJIA 4FLEA 3C85A 1DKUA 3C97A 4RHUA 4A2CA 1FE8A 2A92A 3QUBA 2H1HA 5KS2A 4LXTA 1D9XA 2G17A 5EP1A 1FNSA 1KGDA 2GTPA 3DCJA 2H63A 4KZPA 1ZH0A 1FDVA 2P75A 3GB9A 4UU8A 4V3CA 5IM4F 1ZIPA 1AZTA 2CJWA 2OPBA 4PVCA 1M8PA 4RANA 5B1IA 2W4MA 5KOJA 4DA8A 2GETA 1YMQA 3EIQA 4IG9A 4B8WA 1YR2A 1V6SA 4UEKA 3JWGA 5GV7A 4BZWA 1Y9ZA 2YQ5A 3A9TA 2VXCA 1U7HA 2B9EA 5EJGA 1MX9A 1X7HA 2P4UA 5EMNA 5B1SA 5KBYA 3DDZX 1ENPA 2EX4A 3ZQUA 4ZIRB 5DMXA 2PKEA 1G3RA 5ALFA 2O7VA 2XGGA 3FGPA 3KVYA 3U2QA 2PUCA 4DVJA 2NXEA 1DG3A 4NARA 3P2JA 3EZ7A 4IMPA 4LMPA 1I2MA 4B83A 2OK7A 5K0NA 3ETLA 3K6RA 2ILVA 3QK7A 1WDKA 1OPXA 1ZQ1A 4Y6PA 5AQEA 4Q3AA 4RF3A 2PU5A 2Y9PB 1D6JA 3BOSA 4D3DA 1DKRA 3T3NA 2XMZA 3KL2A 4L78A 4HGOA 4EG3A 1UK8A 2PX0A 3H05A 5COAA 3FJ1A 1SU6A 3NW9A 4L27A 4PX5A 3IEKA 1KEEB 4D43A 5TIIA 3I2JA 3N2IA 4C2AA 3TQQA 2HMUA 2O3JA 2LV8A 2W37A 2OV3A 3AZOA 2IZZA 3LIPA 3MS7A 4HX9A 2A1UB 4Z7QB 4KQ1A 4W7HA 1CUZA 2AT1A 1N9GB 1W52X 5IAGA 3RE1A 3T8YA 2HRRA 3QUQA 1EBFA 1CIJA 3G23A 3IBTA 4RFSA 4XRRA 1O96B 3RF6A 3RYCA 3SNHA 5EUBA 1MPTA 3S40A 4AJ1A 4PINA 4OL9A 1LDNA 5BSMA 2I6QA 3L1KA 1S96A 3VOSA 1E69A 1QX3A 3QI2A 2CCJA 5AM0A 1YUBA 4OBWA 5BVGB 4RY0A 3DKPA 3P32A 2VTEA 1LDYA 4JA0A 3L4KA 1WWKA 2GBIA 3KDSE 2AW3A 1KAHA 3BK2A 3PUJA 3AJRA 3L4BA 4PSUA 5I7OA 4DB4A 3PNKA 4TS1A 5BV8A 4PU0A 5SY9A 5DYWA 4MQ4A 5BSRA 4JYAB 2IHUA 4PPQA 1Z75A 4D42A 4DJEC 3GGPA 5BV1A 2DTXA 1JV2B 3SHVA 3HJBA 4OKNA 3VO2A 1JIVA 3FGZA 3QKWA 1VL0A 1N0UA 5IVKA 4QDTA 4QSMA 4BO7A 5JRJA 2PUBA 1RE0A 5FPHA 2G72A 4RK4A 2PWPA 2OT3B 3ZTWA 5A02A 4Y0AA 5H9WA 2A0YA 5ES3A 2BFEB 3KSMA 1GQ2A 4QU8A 3BRCA 2C9ZA 4NNOA 3V2IA 4CFZA 2P68A 1CQXA 3WLTA 4ZIRA 3AHDA 1G63A 1Y4DE 1L7OA 3GEHA 1GRVA 1MGOA 3AUSA 3O92A 2UUAB 4FHEA 3BWVA 4B33A 4A0SA 4TN1A 2ASVA 1O8BA 4GXNA 3ZZTA 2VK1A 2YMLA 4R68A 1X8LA 5ADVA 2YRXA 3FLAA 4NDNE 3PE3A 2XIQA 2O4UX 4PCAA 3IKJA 1E2UA 2Z98A 3IAHA 3KEGA 4R9NA 2REXB 2X5NA 3Q6NA 3FF4A 3RVJA 5C7LO 5P8WA 1VIVA 4RKQA 2EKBA 2IDKA 3NHRA 4LKOA 3VNQA 4AO7A 4B6RA 1H6DA 4QOEA 1RIFA 3QOFA 5FWXB 4AZWA 2HZBA 1IPFA 2QLBA 3NP7A 5K3EA 5J2UF 1R9NA 1OOEA 3ZZ0A 2X4LA 2PPLA 3KXPA 2CYCA 4M1WA 1Z4OA 4QUIA 5B3JA 1UR5A 4G81A 4TKZA 3CMCO 2C2OA 1A2BA 3G2KA 3MGAA 1A7AA 5K6AA 1JXMA 1AKEA 2FPIB 4MRPA 2O3UA 3STXA 2GHTA 2WTEA 4MMXB 4YRQA 3T7EA 3LPMA 4NZPA 4DBLE 1SD2A 2FVYA 1HMPA 2JLSA 3LQ4A 1EBUA 3Q3GE 3UK6A 4OSEA 1EWYA 1ZC4A 1BZYA 5JAOA 4P4SA 2GJ9A 3Q6IA 4ZO8A 3R6WA 4BEJA 3AVUA 5K0LA 5L7YA 4EB0A 3W8RA 1O77A 3A3KA 3TW3A 3FOFC 1FU7A 4JLDA 5L4NA 2E4ZA 3P4YA 1VHTA 2XV1A 1CFJA 1GXSA 5CTAA 1USKA 1NL3A 3C5HA 4N0QA 4ABYA 4W5WA 1JENB 1V6AA 2I2DA 1NJ6A 3A1CA 3A25A 2GCOA 4GOXA 3TAHA 4GPD1 3CURA 5DNDA 5J23A 5BR7A 5DIFA 3TAXA 4NATA 4I5IA 1Z39A 3EUEA 4GECA 1GVHA 2XWJI 3IT3A 2NSYA 4DLYA 1NLYA 2E6KA 3CZ4A 3PXAA 3L93A 2G80A 3AFHA 1UF9A 3MYRA 1HLFA 1C50A 3K2BA 1E3LA 1LX6A 1T9GR 2D7CA 3KT0A 2A14A 1VLJA 3BMQB 2DUUA 3KYJB 2I5PO 3NGXA 4HTAA 3DZKA 4LRWA 4RW0A 4XSVA 3ICEA 5I45A 1QGZA 3GEMA 4R8MA 4NLLA 2DCUA 4UAGA 4YPVA 1KRXA 2AEEA 4CMGA 1SC3A 1CG6A 5IAKA 1UM9B 4EOGA 1ZOOA 2QG4A 3TTWA 2IYTA 4OQXA 1QO0D 1PD0A 4X61A 2D1QA 3T61A 3E18A 1EFDN 2VS1A 3MS4A 3WXBA 1E4VA 4IY1A 1TPZA 1DCTA 2V1XA 1NZJA 2VZEA 2XUDA 3TKAA 5JMOA 4OBBA 1VI2A 3ZLTA 3BIFA 5IDWA 1PQ4A 4L76A 3AUUA 4TUYB 2DX7A 2EG5A 3GEGA 2BFCA 3GLSA 4GKAA 4DA9A 1OXXK 4ZQFA 1Y37A 4R3NA 3BL6A 2GZDA 4OA8A 1IIRA 3EWAA 4N12A 1PHPA 3TL3A 5CDSA 1WZ2A 3KD2A 3L92A 3NBQA 1NMSA 2QP3A 3GRKA 3ZN2A 3I0MA 4PXSA 5FWXA 2Z95A 3F1LA 3LD9A 3T1OA 4Z51A 3CVXA 1M8KA 3TQCA 3FFAA 4FGJA 1KXZA 1JILA 2ZRMA 3QITA 3JVDA 3DVRX 3NEPX 3CNOA 4FHFA 4EY6A 1QBGA 3O1JC 1CXZA 3AINA 3GUVA 4XCQA 1J39A 4XM2A 1J56A 2FPIA 3CKMA 3LX5A 4NPHA 1EVEA 4RF5A 1V1MB 3GFQA 3T34A 4J1NA 1NVMB 4MPDA 4X8MA 1ORRA 4BC0A 5A4KA 3EPRA 2I22A 3C8HA 5CJ2A 2OA0A 1EWQA 3SS9X 1NNSA 1UPCA 3DMGA 4OJNA 4DLTA 4DMMA 4FINA 4K46A 1P7WA 5F1OA 1YTLA 4L16A 4CFSA 1G3IA 4LI3X 2A4KA 1I79B 2Z56A 5CBPB 5JDIC 3V00A 1PG0A 1QUFA 1U7PA 3A4LA 4RIGA 3DO6A 1BCRB 1G2QA 1TKCA 3GJ4A 3N3AC 4LZLA 1ZKDA 4FD2A 1OZGA 1GDDA 1YOVB 5EE0A 4KXYA 3E22B 1Y4UA 4JR2A 2EV9A 3RFVA 3NKLA 5J1TB 3U16A 2ZS8A 3MA0A 3C39A 2WT9A 3Q41A 2VQ6A 4BX9A 3PZRA 1UPXA 3M89A 1L5KA 4BU1A 5BN3B 2VK2A 4WCFB 4LY0A 4R7ZA 5LOVF 4RHXA 2XCOA 1Y1QA 4RA9A 2JFPA 3F90A 4CUJA 4GZLA 5BNWA 4BAUA 1G20A 2I2CA 2DZDA 3FOEC 1CBUA 1CUDA 1B6RA 3EY4A 3SLKA 3UXYA 3DE2X 1ZK3A 3O3NB 1R74A 1KC3A 1UJCA 3H8WA 2ZVPX 3Q2OA 2QIOA 3G9XA 5CDUA 1CR0A 3BEOA 3PSHA 4BKUA 5LWQA 5LIRA 3EIHA 1P4JA 2FN3A 1RXWA 5L3VA 1RQ2A 1RZVA 1EVJA 3K9GA 2IHVA 3IA7A 5H81A 1RJ9A 1W1WA 1ZO8A 4ARZA 2ZRBA 2VDVE 3BK1A 3F3YA 3KJNA 1V7CA 4EIWA 4BV2A 3I52A 2QRZA 1IZ9A 3P9CA 4S2EA 3WC4A 4TOIA 2WOJA 4X95A 5AHOA 1YVDA 3C5WP 2DFLA 5IKPA 2GEFA 2B8EA 1RAHA 1Z47A 1XTUA 3P9RA 1FSSA 4YASA 4MKRA 3LIIA 2RSLA 4C4TA 4B80A 1ETHA 4GYKA 2ORYA 5IN5A 5AK0A 4AKGA 2WPNA 1CEXA 3E4CA 4NV1A 4QXAA 4G0OA 3H2ZA 1NPTO 1XA4A 2X0KA 2G71A 3X44A 3MWEA 3TEJA 2WD9A 2IV3A 3I5XA 3AIKA 2OHFA 2PH5A 1H69A 2BM1A 3ETGA 3BDVA 3I6BA 3R0QA 4I5FA 4LWQA 2GWRA 3MGBA 2X5KO 3TZLA 5GM2A 3WK9A 1K8RA 2AJDA 2C00A 2GUGA 5E7JA 2B4AA 1HMYA 4I9GA 5K8JB 5IG2A 4QO8A 2HREA 4GBMA 1RI3A 1LB1B 3WB2A 1IM2A 3H2BA 3NYIA 1S8OA 3MAJA 2CEKA 4C7OB 1NVGA 2JLUA 1P75A 5AKIA 1YS2X 4DMRA 1AKTA 2R85A 1FZQA 1NVXQ 1HDEA 3LNCA 3ZDZB 1ORDA 3QLUA 3SE0A 4PNEA 2ZIFA 3HH8A 3VR3D 1C5KA 2XT0A 3JAKB 3OUZA 1P9LA 3P5BA 2LR0A 1K7SN 1BCRA 4RMJA 2AFRA 3T95A 5LMUB 4LTMA 5DSXA 3ICPA 3W90A 2RGEA 4KU4A 4I50A 1WUKS 1GGJA 2JFQA 3FW1A 4D97A 1SU4A 1I4OA 2DQSA 4J2TA 3PC7A 3Q7PA 4M9CA 5DNEA 1DAEA 1U3DA 3Q3EA 1L7PA 5THQA 4UNRA 4PZDA 1JZSA 1QG0A 2WI8A 4DJDC 2IH5A 3EPAB 2P79A 3SIWA 1PWEA 1RJFA 4UBMA 3KLMX 3MG9A 4OAQA 4HUTA 1UK6A 2YFQA 4PHCA 4HTFA 3P20A 1JFRA 2C61A 3HA7A 2XQIA 2E9SA 2YHUA 4WMLA 5F2EA 2H65A 4EUNA 2Q4BA 4IDBA 3HXLA 1K0UA 3N28A 1WUTA 1C3OA 3KG2A 3O8DA 2H9YA 3Q87B 3REQA 3UF0A 4W8GA 1ACJA 1R0XA 1V3TA 3B1YA 3ELDA 3PDIB 4JYPA 3W4JA 2W2OA 4DCGA 3PQFA 4IIJF 4DPLA 2NX2A 4CLEA 1P74A 1VI5A 1YVRA 2W6MA 3JQFC 4I9FA 5F3RA 4ZCQA 2GLXA 2P62A 4RNCA 3GRVA 4V1CB 5IVHA 2BR3A 3PZBA 1W6UA 1N2XA 2W6JA 3A04A 1FMLA 4W9MC 4Q9KA 3TTXA 1BHSA 3P52A 3SX0A 4ZYWA 1HRKA 1AJEA 5IVDA 1M34B 1GZHB 1PJLA 3A1UA 3X1DA 1XXHB 4CM7A 2CHGA 5DHAA 2GFIA 2JK0A 3T7CA 1Z25A 1DLJA 4DV4B 1NBAA 1UBKS 4Q1AA 4CIYA 2AIRA 1RYYA 3DNPA 3E7FA 2FMUA 4F9FA 4MA4A 1UZAA 4XQ0A 4LXQA 4CTOA 5I4KA 5KDOA 1R4AA 4IIEA 4NCJA 5SV2A 4BB5A 1EG2A 1T1GA 4IQGA 1ECJA 1FP4A 2QRVB 5AJUA 4M8IA 5A5GA 4EW3A 1SVLA 1DOHA 4FDTA 1LVGA 2XZPA 3ZZUA 1Z5NA 2PS0A 1U3WA 2AKAB 4TXNA 2NO6A 2QK4A 1ILEA 3ZIAD 4XZ3A 4U2BA 4E5UA 4XE5A 1VCOA 4C7OA 3PHLA 2JHGA 2H0AA 2O19A 4RXMA 3B3GA 3OCYA 3IMCA 3O26A 4ZGGA 3A1SA 4X41A 2FOLA 4FGSA 1LWNA 4JSRA 1YA4A 1LF0A 3HCPA 4FUTA 3ROKA 3UA4A 3OA2A 4JUDX 1G8YA 4J2HA 4RS4A 5FOTA 3DPUA 2QHXA 2CLSA 3T35A 2H4HA 1Z8FA 5A5VA 3C7KA 3D7LA 3SQDA 4EO7A 4LYHA 5G0UA 4LMBA 4P36A 1EJ2A 2UUPA 4EYGA 2G4VA 2G9UA 1XQ9A 1JA9A 1C4OA 3OJEA 2QZ9A 4M8NE 1ZD1A 1D0IA 3JZIA 2DWPA 4WJKB 4LE1A 4F4CA 4ZJYA 4YXFA 2J30A 3CWCA 4HT3B 2OWDA 3WWCA 1OLUB 3BFJA 5EQTA 1M2KA 5HE9A 1ZIYA 4CMEC 1X0VA 8AT1A 1GY8A 1CDEA 3ZD9A 2C29D 4B45A 3TQFA 3N86A 1TIBA 5IDVA 2Z08A 2A78A 3PI6A 4KODA 3HCWA 4D8WA 1GGNA 3PDIA 1ISJA 4PZZA 4PC3A 1R8XA 5E3HA 5KQLA 1T6NA 1J21A 1NVVR 3BWCA 3ZWDA 4G86A 5AXBA 4BP3A 1RS0A 1QVWA 1TT5B 4DSOA 3IV7A 2VRNA 3IP5A 3FYDA 5C4IA 1VHJA 2I9PA 4C7BA 1M34A 5TGDA 1TEZA 2A3RA 3QXHA 4CHTA 4XJSA 4X84A 4N8SA 4C7MA 2YC4C 4QVGA 1FFWA 2Q5CA 5IULC 4D7AA 3LFHA 3GPBA 4JVLA 7REQA 1NMQA 3BHIA 3R20A 5KNDA 2BFOA 2VA8A 3QMMA 2WTMA 1N6HA 1QFXA 1ZHHA 5FAXA 1JG2A 4LZZA 2CJYA 2QRVA 1X14A 4OIFA 4ACBA 5JHHB 3ZCXA 3OZWA 8ADHA 3NTUA 2ECPA 1BJTA 1JYEA 4YIKA 4FC6A 4FC7A 4GPTA 3B5JA 2FDCA 3ZDYB 3KTAA 1J1UA 2PXXA 3AFMA 5CDFA 4OB7A 1QYXA 3GAZA 4JEIA 1DHTA 4PN7A 3SSOA 1DMSA 4LJ5A 4YA6A 4DQDA 3SOZA 1WIWA 2LGJA 5D5PA 3VYTB 5JISA 5UKDA 4KN5A 4QXMA 3RUIA 2UXCB 4IDOA 4K9SA 1XCOA 2WW8A 3CNEA 3T4PA 2OXCA 1DGQA 2ZTHA 5C3UA 1PWYE 1Y1TA 2HO4A 2QQ5A 2WKWA 5EIAA 5ILGA 1JTFA 1Q7CA 2P4EA 1RCUA 3GFFA 1R5NA 1RPJA 3JQEA 4FYPA 1ENZA 4QYMA 2PLFA 3EWNA 3JAWB 2PS9A 3O31A 5A3JA 2RHCA 2CDNA 3LGAA 2B2CA 2HIGA 3QX7A 4RTOA 1EP2B 1MAVA 4ZOEA 4U3JA 4NCXA 3ORSA 3V34A 2XB2A 5A0VA 1FDWA 2PRYA 3I4CA 4AKSA 1ID8A 3I0ZA 1IN6A 2ZJ8A 1P1KA 4CRWB 4PWYA 3DNMA 5AVQA 3VA7A 3PHBE 5A3VA 3SBXA 1E1YA 5AP9A 3UWKA 1GEEA 3OPYB 3K1ZA 1HDIA 1GKUB 1KI7A 1GZ4A 3KC2A 2DTEA 1H2XA 3ETNA 3F74A 3W5VA 2JLRA 2DB3A 2RD2A 3L6EA 2GYWA 3PJEA 4KKVA 2YY6A 1KEWA 3H84A 1J0DA 2IYRA 4MMYB 3KAQA 4NBKA 5ENZA 3RUHA 3WIEA 5FUVA 3HP4A 3J81k 1P1RA 4KYTA 2IJGX 2X9NA 3PD1A 1OXSC 4JBIA 3T1TA 3U4MA 4D82A 1PJAA 2HCBA 4QXOA 1AURA 1YI0A 2YWDA 4EHIA 2AUMA 1V47A 1HO3A 3JYHA 4XCXA 2Z09A 4ZVUA 3V42A 1PT9A 4WNIA 4XDZA 5GWXA 2ZSKA 4LRYA 1L7AA 5C8YF 3K4HA 2Z4RA 2IPNA 5AVJA 4EH1A 5HIKA 3QVKA 1QE5A 2W6ID 2OBNA 2GK3A 5CXSA 2H4YA 1T43A 2PSEA 5EAIA 1PR3A 3L0BA 5HVNA 3ZHQA 1FJGB 1IVNA 3I2FA 5DASA 1XK6A 4DOMA 2Z83A 2WC1A 4V2UA 3JWHA 5FAKA 2O8EA 1VE3A 3E3LA 3GVXA 3MXTA 1HE1C 1U8FO 1H2YA 2FZWA 3A7EA 2YICA 3F78A 1XAIA 4KE7A 4MQFB 3VJLA 2JFWA 2L69A 2W2QA 4JBHA 4OYYA 2QAIA 4QQNA 4BO4A 4OI0A 1IY8A 5LD2C 5KEIA 3EMKA 5EIOA 1MW9X 3S8YA 3CZCA 4LKRA 3DGFC 3R8CA 1Y9AA 1Z2PX 2J08A 1TL7C 3EOZA 1AY0A 1SG6A 1VE6A 3Q7TA 1NU6A 4WINA 5HIMA 4WXMA 3WJ2A 1N2BA 3I9KA 3UJCA 3D3QA 3VR0A 1Z2AA 4LYJA 3JAWA 1WZUA 1BFKA 5BUCA 5HE8A 1MW8X 1FQJA 5JH7F 4DHWA 1C29B 3BD6A 1RMQA 4LECA 5KVSA 4QYWA 1S2IA 3RRNA 1AOXA 3QEJA 3NHLA 1E7SA 3ROZA 1RPNA 3CNQS 1BA2A 1LA2A 3PLAE 2C7VA 1YCDA 1SXIA 2XTZA 3R5XA 2FEOA 3HB7A 4LPSA 1QZZA 4PONA 3JVUA 1U8YA 2H6EA 3S70A 5CA0B 3VZSA 3TLMA 2GN0A 2IPOA 3LK6A 4RK7A 2OB1A 1TGVA 3X3HA 4CKCB 3U7FB 2A84A 3H3FA 5JPDA 3KSZO 1KA9H 4A8PA 1IXSB 1WZNA 4CZ2A 1YU6A 2I2BA 1GNSA 2HADA 3DEAA 2FW6A 1LW7A 3NVDA 3QLEA 3GF4A 2QTFA 1E2HA 4D0SA 1GUAA 2ZBVA 4D3SA 3VU0A 2YIDA 1JLLB 2ID8A 3TBHA 1VQ1A 5KTOA 1X3LA 1E2MA 3RYIB 4M2LA 1KOFA 3RLIA 1X9IA 3OHMA 1XMQB 3SHFA 3OD1A 2GZSA 3ILHA 3OKFA 2ZDGA 3P2EA 1NKSA 1ZHOA 1WL8A 1TMKA 1N5RA 1P5HA 1FDRA 2GM5A 2M6SA 2VJKA 3ASYA 5DX8A 5EEGA 1K98A 3IUMA 3PCRB 5K0ZA 2GO7A 2BMJA 2WHYA 2IUYA 4ALKA 3RFTA 3ZHXA 3VXKA 3PEUA 2WTUA 2OAQ1 2XX3A 1W93A 4PRZA 1Z4MA 4B73A 4DEVA 3G7SA 4ZCLA 3P9XA 3PFCA 4HGRA 2MTBA 3LLSA 3PT5A 1GG2A 1P8JA 2IUEA 1YIAA 3ZE7A 4TLMB 2HLPA 2UUBB 3O93A 3DM9B 2YJGA 5GONB 4OLBA 2DWUA 1IRIA 2WAOA 1D1TA 3P2KA 5IBRA 2P4HX 3IERA 3AP3A 4MQFA 4D5GA 4RFLA 2EGUA 3HEBA 1FMJA 3O2SB 5IXYA 1CVRA 5I9MA 4TKVB 3O94A 5GY7A 1V9CA 4MS4A 3Q7RA 4UVHA 3MGKA 4C76A 4RGQA 3V8RA 2NM0A 4QLAA 2Q8PA 3KLNA 3NJ4A 4J0EA 3K9BA 2YOGA 1XTJA 5F4BA 2CLIB 1BXZA 5GV8A 2XYQA 1JKXA 3R6DA 2ZTLA 2Y68A 4INOA 1YQEA 5DNVA 4BEWA 2E4UA 3C6ZA 1JBQA 4YEDA 3VYVA 1UBUS 4OQYA 5ALQA 5EQJB 4BATA 2OAEA 2IY9A 4O4IB 4JBGA 1S1CA 2WUDA 3IKVA 1LV7A 1VPTA 1CJSA 1TQHA 1D2GA 2OFWA 4FZVA 4HNAB 4P3NA 5FPPA 1II8B 3T52A 4MDFA 2Q0XA 3SYNA 2A67A 3KHSA 1NQAO 4BPRA 1H2EA 4XLTA 4II3A 1E3QA 2G06A 5K4AA 1Y80A 4O0MA 3HFSA 5CA0A 5D8DA 1FC0A 1E0JA 1WJGA 1E3MA 3S1AB 4U2KA 4CKCA 1BKYA 1JIXA 4GICA 2D2XA 2B8NA 2I4NA 3F4BA 3KVNA 5DYGA 4R1LA 1XZLA 1EX7A 1S9HA 2R6DA 5A9TA 1AGPA 3SCZA 4C7XA 5M7EA 4J91A 3HV2A 5KNCD 5LZ2A 4GZ3A 1VRCA 4JXXA 1SCKA 2DLCX 1SVWA 4ZCPA 1JLLA 3JX9A 3P2OA 3MJVA 4RGVA 1VLLA 1P4AA 1XZFA 2WWXA 1QKKA 3L8GA 5ALGA 3RYIA 5DRYA 3WMFA 4DCCA 3QEMB 4UASA 2VDLB 3VR4A 5F7JA 2OC4A 2WHEA 3T94A 3RS8A 1YL7A 3R3SA 3I1YA 4IFEA 4CLOB 4RJLA 3AO0B 4LWPA 3VZQA 4EKNB 4L9RA 4CG0A 4EGAA 3U17A 3BM5A 5ICFA 3OICA 1BQ3A 4MUXA 2FSFA 4MUAA 1CF9A 3T7TA 2JHPA 2NZ2A 4JQYA 1LK7A 2PX2A 3ENNA 4P7GA 3TIIA 3U0BA 4EA6A 3VHQA 2YWBA 2A5FA 2Q41A 4PSVA 4WGGA 3VU8A 3ZCRA 2IP1A 5KWIA 4ENWA 4F93B 1FK8A 1JN0A 1P4GA 2PUJA 4MARA 4WZAE 5JTUA 5I7HA 1BGWA 2OXEA 3P9NA 4B71A 4MRMB 3RFCA 4F4HA 1LBIA 4UOQA 2WU8A 2HCFA 3O0TA 5JAQA 4COOA 3GLIB 3A6FA 3DG9A 2HX1A 2QJWA 1NXSA 1IAQA 1Z3IX 1KAQA 2F9FA 4ZJZA 3W6NA 1YZUA 2X1MA 2ATEA 4IUBS 5C9ZA 1LPMA 5JCZA 1TTQB 2V0CA 1CZRA 4DDVA 3KPUA 2ONJA 3VNRA 1R2QA 2J3LA 2JF0A 3MNFA 4IQ4A 3A6PC 3IQHX 4O4HA 3ZYCA 5KNBD 4M8KA 2I6UA 1YB4A 3U5ZB 3F7MA 4CV3A 2V7BA 1NY6A 1DAPA 4OQ4A 2Y1WA 4E30A 2CD9A 4O4IA 1ANKA 2HF7A 2IXEA 4QRHA 4HNAA 4UVIA 3ZQ4A 4KFTA 3JY6A 4LE2A 2JIOA 4PNZA 5AD1A 1HL3A 1MA3A 2WNSA 3PHJA 4BWVA 1P4HA 1CULC 1VSVA 1C7QA 4U6NA 3A4NA 1WBBA 1DC3A 1M66A 4JK3A 3AG6A 2PBRA 3R0JA 1QPBA 5AIAA 3BHMA 4AULA 1A9XA 3FM9A 3RLFA 3GUCA 3GQBB 4FK8A 4QNRA 3UV7A 1ESDA 2C88A 3VPCA 1TX4B 3V8VA 1SOWA 4HXFB 3VBCA 1L5WA 4AK1A 1QQ6A 4EHJA 4AP6A 3ZWNA 3D6JA 1M6YA 1W35A 2FP4B 3DVAB 3VVLA 3EHDA 1C3XA 1QH8B 2ZWOA 3QEMA 4RYLA 3TJMA 1T3TA 4PYIA 3H4MA 3R7LA 2E1PA 3WJ1A 5BPHA 3HKEA 5REQB 3HBMA 5CYGA 2BGWA 2KX7A 1ZRNA 5F21A 3KU1A 3CY6A 1P19A 2GYUA 1NDQA 1GR1A 2FU5C 3RTDA 2JJYA 1E3EA 5LUAA 2CYBA 4K7JA 4Y2QA 4MX8A 4OXXA 3BRQA 5DN6A 1T36A 2ZYSA 1EI9A 3WRYA 1F14A 3PENA 1LVUA 4JJEA 4Y2XA 2FW8A 3QJYA 3RBZA 2AQIA 3GZNB 1CQZA 1EVIA 1SVOA 3KZCA 4GZMA 1M2EA 4ZV4A 1SBNE 2BRUC 5IJAA 3K3PA 4Y0VA 1TU4A 3DB1A 3GRZA 1TRHA 3RHSA 4BRSA 1XE3A 5E7IA 1D2AA 4F3NA 4MRMA 3AQ4A 5JZVA 3ROTA 1DCFA 3R4CA 3VH4A 2ANBA 2FW7A 5JC8A 1Q6YA 2KMLA 3G7NA 3HPRA 1RC0A 4REMA 1V48A 2QN1A 3MOIA 2BE7A 1OAOC 2ZVJA 4GL4A 2Y9MB 3ISJA 4DUGA 5CW1A 1T5OA 3QBEA 4QYXA 3S29A 2NVUB 4BO3A 1X8KA 3PDUA 4I36A 4KXMA 4LA4A 4FFRA 4M6WA 1EBBA 1NTRA 2XWSA 3QGMA 4HUQB 3C3EA 2DHCA 3MUOA 4L28A 3EVAA 2QN9A 3GH3A 2AMVA 3FYUB 4G5FA 4H7EA 2DCMA 2QTLA 3V2GA 2J5QA 4HAVA 5EXDA 4QXPA 1VA5A 2R8OA 1RXSA 1QOPB 5JCOA 3N2EA 4NYIQ 1D5WA 4QQRA 3S4YA 3ZHVA 3NTLA 3E61A 4MV7A 3NOVA 3KEQA 4UD2A 1E60A 4JJKA 4O3FA 4HDCA 4HWRA 3KM0A 1X0XA 3LZ6A 3OJLA 1TZCA 2CGEA 3KEMA 2G6TA 3IIJA 2C9YA