3BTTE

The crystal structures of the complexes between bovine beta-trypsin and ten p1 variants of bpti
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
222
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (TRYPSIN)
publication title The crystal structures of the complexes between bovine beta-trypsin and ten P1 variants of BPTI.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 52
structure length 222
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3bttE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3bttE02
1C5RA 2SGQE 3PLBA 1MQ6A 1ZPCA 1EATA 2SGDE 2XNIA 3SV9A 3MU1A 1HAZB 3UFAA 4O3UA 3QWCH 1YLDA 2GCHF 1GI4A 1PPBH 3RXVA 1E34B 4XBBA 3MWIU 2JH0D 3ODDA 3SJ8A 4CRFA 1MBMA 1O3OA 3ODFA 1W14U 4Y7AA 1C5NH 2ZFRH 4WH8A 4A5TS 1DXPA 5C5NA 1YCPM 3RXKA 5C67A 2BY9X 4KTCA 2ZP0H 1EZQA 1FY4A 1DITH 4X8UH 3S7KB 4BAKB 2HNTE 8LPRA 1G30B 3ZVDA 1VCPA 2ZHWH 2FOEA 2GKVE 5A8XA 4FVBA 2A32A 2J34A 1NROH 2ZHFH 3P70B 2G52A 2WUBA 4F4OC 1Z6EA 1U6QA 1C1TA 2XBYA 3D49H 2DE9A 5G4BA 3TITA 1FY8E 5FPTA 1G2LA 1GMCF 2R0KA 1CGJE 3V13A 5CE1A 1LHFH 2BY7X 3SU1A 5EODA 1NM6A 1IQJA 3K2UA 2ODYB 2VIVA 4Q7ZA 4AZ2B 1C4U2 3TVJB 1CT0E 1AFQB 2IN2A 2Z9GA 3AVZA 5JB9S 4OS2A 3RC6A 1V6DA 1BRBE 3GCHC 2PTNA 1HAHH 4GLYA 3RUOA 3A8AA 3URDA 4AYYB 4UFGH 2Y7XA 2EEKA 3M7UA 3V3MA 1QJ1B 2VH6A 2ALPA 2CHAC 1HYLA 2QXGA 2XC4A 1C5YB 3AAVA 5I25A 1QQUA 3E16B 4IMZA 1LPGB 2Z3EA 4WJG2 3RMNH 2BDCA 1L1NA 1GCTC 1NRSH 3UOPA 5DP9A 1XUJA 2ZGJA 1YPKH 2TPIZ 1NRPH 3RU4E 4VGCB 4ABFA 1TQ0B 1UJ1A 5A2MH 2OCVB 3Q3KA 2AERH 1J14A 1VGCC 4WXIA 1F2SE 1RD3B 4Y7BA 4DY7B 1P2NA 1OWHA 1C2HA 3A87A 5A0CA 2W7SA 1O2JA 1OP0A 1K22H 4D7FA 2SGPE 1MZDA 1QL8A 1SGCA 1SOZA 4ABHA 4LZ4B 1V2OT 1O3JA 1HAIH 2QXHA 3BTHE 3S69A 2PSYA 4X1NU 1UO6A 2BDGA 1RTLA 1V2WT 1EPTC 1P09A 4GHQA 3TPIZ 3NWUA 2C8XB 2G51A 1BTPA 1LKAA 3RMMH 1Q2WA 3ZVEA 2GV7A 4NG9H 1D4PB 2ZF0H 4NZQA 4NA8A 2VH0A 1P3CA 2F9VA 1C5TA 1A5HA 4H6TA 1IAUA 5E2PA 1GI3A 1QQ4A 1W10U 2V3HH 4OS5A 5EOKA 2ZEBA 2ZHDA 3RXRA 2PKAB 3KQCA 3A7WA 4ISIH 3HGPA 2FZZA 1TMBH 2O8MA 1BT7A 4DVAU 3VB6A 1P2OA 4RKOB 1HJAC 3PYHA 4UFDH 2BY5X 3QX5H 1ELBA 1ORFA 5EQSA 5EXLA 3S9BA 1C5PA 1NO9H 1SFQB 1MCTA 1SLUB 1O2VA 2VIOA 1Q3XA 1QJ6B 1CBWB 1P2KA 1NTPA 4ISLA 2C93B 3Q3XA 3SO3A 2XCFA 3AAUA 1DPOA 4I33A 2C4FH 4AOQA 4KKDA 3BG8A 5T3HA 1WTGH 2PKSB 4MPUA 2Y80A 1IQKA 1FIWA 1O3HA 2QCYA 3S7HB 2YNBA 3BTTE 4ABBA 1AGJA 5F8XA 3OY6U 1FAXA 4DIIH 1B0FA 1BMMH 5JBBS 1DOJA 2C3SA 2HNTF 1ZRBA 3OTJE 4WXVA 3RP2A 4JZFH 3VXFH 1O3BA 3ATKA 3BIVH 1GI0A 1P9SA 3P17H 1O3NA 5DGJA 4MG3A 4MLFB 4ABEA 5F6MA 1RXPA 3GCTF 4K2YA 5EPYA 1A3EH 1WQVH 2BOHB 4NA9H 3URCA 4NA7A 4YTAA 3TU7H 5A09A 1Q31A 1FY3A 4K8BA 4QT8C 1YP9A 3U69H 1BRUP 2O8UA 3UPEA 3PTBA 3P8NA 2AEIH 1BTXA 1GCDA 2OLGA 2FS9A 1RIWB 4Y8YA 2B9LA 2Z3CA 1SI5H 5DP5A 1EOJA 1GGDB 4BXSA 2HVXA 3SZNA 2PHBA 3M61U 4CH2B 3RXSA 2FS8A 5AFZH 1P2JA 3TNTA 3FFGA 2AMDA 6ESTA 4GPGA 1O0DH 2W5EA 4NIYA 1TRNA 2FOCA 1VR1H 2J38A 1THSH 1VJAU 3SQHE 2AFQB 3KNXA 1O3AA 3P8FA 1K1PA 2A5IA 2A4OA 5ESBA 3VB4A 1EX3A 3I29A 2GCHG 2AYWA 2A4QA 2Z9IA 5C1YA 3JZ1B 4U32A 1HPGA 1SL3A 4JK6A 1D3TB 1EPTA 3GY4A 1OYTH 4A1TA 1FMGA 1IHSH 2H9HA 3GYLB 4YLUA 2EI7A 1EXFA 2GMTB 1A5IA 1C5LH 3M7QA 4AG1A 1TGTA 3LJOA 4UFFH 2ZU1A 3A88A 4K1TA 2WPHS 3BN9A 3KIDU 1V2VT 2VIQA 4BANB 3UOUA 1A7SA 1GL0E 2WPJS 3SI4H 1C1PA 1BTUA 3VB5A 4Y71A 2G4TA 2B0FA 1LHEH 3T29A 1FI8A 9ESTA 5C20A 2W3IA 3GCNA 2FI4E 3R3GB 1C5WB 1Y3UA 1DANH 4MTBA 3KL6A 4GSOA 2FI5E 3Q76A 1O2XA 1TWXB 2A0QB 2BYAX 3PM3A 1MD7A 1DLKB 3KF2A 3B9FH 3KN2A 1HUTH 4TPIZ 1W13U 1F7ZA 4DGJA 5GDSH 1XXFA 1QURH 4AGKA 4XSKU 1GI1A 1E38B 1O2UA 4RN6A 3Q3YA 1DDJA 1GBIA 3SJIA 1QB9A 1O5FH 1ETSH 2GVFA 2WV4A 1C4V2 2J9NA 1BBRK 1D3QB 1NESE 5L30H 4UD9H 1AB9B 1P57B 2PUQH 3ZVFA 1OXGA 2Z9LA 1UHBB 1TALA 2O8WA 1W0ZU 3DUXH 2TRMA 3A7TA 2AS9A 3BIUH 1N6YA 2OBOA 1JRTA 5F8ZA 4LK4A 3M3VA 1HIAB 1BMNH 2YOLA 1AVXA 1ESAA 2PSXA 5EW2H 1C1WH 3CENA 1ARBA 2XBVA 1X7AC 2HNTC 1ELDE 3SU0A 1B5GH 3MU5A 3PV4A 2NU0E 4Q7YA 4XDEA 1ANBA 1MAYA 1DWBH 3PO1C 2J95A 1ZHRA 3MH4A 4E7RG 3DFLA 3E0PB 1Y5BT 5EW1H 3RU4T 1DWDH 1N1LA 1G3EA 1ANDA 4XFQA 5GCHF 2Q6GA 1C2KA 2CF8H 2GV6A 5DPAA 3QZRA 1Y5AT 4JMYA 2A7CA 2BVXH 1BHXB 1TRYA 1EB1H 1FN8A 1QL9A 2HWLB 2P3FH 4JZDH 1OPHB 1V2RT 4INLA 1GBDA 1ZSLA 3KEEA 2XC0A 3TK5A 1GJ6A 1ZTJA 1A3BH 3V0XA 1CHOF 1TRMA 1MTNB 1S85A 1C5SA 2ZFSA 2Z6BD 4AORA 2ZI2H 2P8OB 2ZIQH 4BOHA 2FDAA 1SFIA 3SNBA 2EC9H 1DS2E 3RXJA 3SGQE 5CHAC 3PWCA 1FONA 1KLIH 2THFB 2XTTB 3T28A 1MZAA 1BOQA 5E2OA 1V2MT 1CVWH 3ELAH 2BDYA 1DT2A 2VVVA 1C1QA 2R0LA 2J92A 1DVAH 1CT2E 4X1PU 1XXDA 1AUTC 1G9IE 1DM4B 1GJBB 1KSNA 2AGIX 2AMQA 5C2ZA 1F0SA 1D9IA 1BDAA 3VPKA 1P11E 1KTTB 4FXGH 1NFYA 1SVPA 2OUAA 2GX4A 3LH3A 1A2CH 5FHTA 3C27B 3SJ9A 7KMEH 1HAYB 1MCVA 1INCA 1KXFA 4CRCA 1T4VH 5LPRA 4D9QA 1ABIH 2BY8X 1PPEE 2A4GA 4NSVA 1OWJA 4K1EA 3WY8A 3ESTA 1LVYA 1O2MA 1S82A 1LTOA 2PTCE 2ZPRA 1LKBA 2WYJA 2ZWLH 3LGWA 3BTDE 7ESTE 5E0JA 3CP7A 1DWCH 1GJ5H 1MKXK 1TPAE 3TGJE 4NWKA 1W12U 4E06H 1XX9A 1QFKH 2LPRA 2GP9B 3MU8A 2OTVA 4B76A 5JBCS 1OWIA 1QA0A 3TGIE 3K9XB 2R3YA 4BAQB 3F6UH 1K1NA 3GCOA 1GHAG 5DP3A 2F9NA 4KELA 1HB0B 1ZSKA 3A85A 4K1SA 3RLYH 4GVUA 1EASA 1PQAA 1O5BB 5HMAA 3TIUA 3QDZB 5EG4A 4ZH8A 1CA0C 1Z8RA 4J2YB 1EAIA 1OWKA 1QRXA 2A2QH 1HRTH 1HJ9A 1HAOH 2G5VA 2ALVA 1OSSA 1P2MA 3A86A 1JOUB 2ZFPH 2VGCB 1MKWH 2FEQH 4DT7B 4FUHA 1SQTA 3LOXA 3SV7A 1SSXA 3G01A 1TE0A 4NGAH 3JZ2B 1KDQA 2PUXB 3RXBA 1O3MA 1BBRE 4WMEA 3DA9B 2WV5A 4X8SH 5ETXA 3RXAA 4ZHAA 3RMOH 4A92A 3LPRA 2A5KA 3SN8A 4OS1A 1EZXC 1O34A 1JXPA 2QY0B 1SGRE 1XUFA 1ELTA 1NRQH 2ZZUH 3BEIB 1ZTLA 1IQNA 2BB4A 6CHAC 2XW9A 1KXCA 1AN1E 1UVSH 5F8TA 4B75A 2JETC 3P92A 3U9AH 2CV3A 2H9TH 2BVSH 2Y7ZA 1TFXA 4ESTE 3EGKH 1HAGE 1ZRKA 2QA9E 2RDLA 4O3TA 1ZTKA 1DSTA 1RGQA 3VGCC 1Z7KA 1MMJN 1PPZA 3LT3A 3MU4A 1T8NA 2PR3A 1SR5C 9LPRA 1GMHG 3M7TA 3QTOH 4TWYA 1WQSA 4FU7A 3MU0A 1AE8H 1G3BA 2A1DB 2FTMA 2OQ5A 1BIOA 4JCNA 1GBLA 2GCTC 5LPEA 2ZU4A 1K21H 2IOTA 2V0BA 1WYKA 4FUGA 3SI3H 5PTPA 5K7RA 4MDSA 3RC4A 1QBVH 1W2KH 1G32B 2D2DA 4UEHH 1UTMA 2GTBA 2ZECA 4IBLH 3KGPA 3M37A 1GL1A 1QR3E 3RLWH 4TPYA 3GY3A 1HV7A 4CH8B 4CHAC 5JPMH 3FP7E 4A1XA 2OQUA 1C1RA 1SG8B 1GVZA 2H6MA 1GJ7B 1P2IA 3SUFA 2B5TB 1LQDB 2ZC9H 1NFWA 1SGIB 1C2MA 5AHGH 1TMUH 4IMQA 3C1KA 2FOAA 2SGAA 1O2SA 1XVOA 4INHA 4WMDA 5A0AE 3W94A 1O2GH 3GICB 3MFJA 5FX6A 5GCHG 3BSQA 3PROA 3F9GA 3MH5A 1NZQH 1OOKB 1FPHH 3HGNA 1T4UH 2BX3A 3SU5A 1KLTA 5GWZA 1Z8JB 4ZHLU 1F0RA 1Z71A 1PQ7A 1S6HA 1ZHPA 1J8AA 1ZR0A 4AG2A 1CHOG 1UK2A 5HXFA 1BA8B 1SC8U 1IHTH 3KHVA 5E8EH 5L2YH 1SLVB 4E05H 2BXUH 4YOGA 1F5RA 2F83A 1GBEA 1O2NA 1P12E 3S9AA 3GY2A 3KQDA 3PLKA 3FZDA 1EZSC 4JYUH 5K0HA 3TJOA 1F5LA 2Y81A 2GGVB 3UY9A 2Y5GA 1LPKB 1GBMA 4ZKNU 1UVPA 1N8OC 4CBNA 2O8LA 5HGGA 4D9RA 8KME2 3EA7A 1BB0B 1UMAH 3FP8E 5TJXA 1VCQA 2UUJB 3EA8A 3A7YA 3LDXH 4I8LA 1XKBC 5EGMA 2VWNA 3D62A 3W95A 3RXUA 3UWIA 3I78A 3EDXB 1FPCH 2ZTXA 1OP2A 4BXWA 2ZU3A 1Y3WA 2NWNA 5DP6A 3ZVAA 2WPMS 1S0QA 2FM2A 1CO7E 1S5SA 1BJUA 1NS3A 1P03A 1XKAC 4DIHH 3ZZ8A 2J4IA 4UFEH 1V2UT 1CU1A 5AF9H 3H7TA 2Z7FE 4SGBE 4GUXA 1K2I1 2IPHA 1HBTH 1WCZA 3A89A 5DG6A 4HI3A 3NPSA 1PYTC 1QB1A 2H9EH 2QXJA 1VJ9U 3MHWU 1C2IA 4I8GA 4JZEH 1LMWB 1L2EA 3U1JB 1IQMA 1SGTA 3DD2H 2UUFB 1GJ9B 1O5EH 3NUMA 2HGTH 4BTTB 3LU9B 1QRWA 1DUAA 1EJNA 3VB3A 2NU3E 1PPHE 1K1IA 5DK1A 3VB7A 1O2TA 3MO9A 1V2NT 1AHTH 1AQ7A 1A0JA 4M7GA 1P9UA 1TYNA 2RA0A 3VEQB 4OGXA 5BPEA 3UR6A 5A0BA 2R2MB 4B2AA 1Z1IA 8ESTE 2ZG0H 1YCPK 4TY7A 1GBFA 4OGYA 4NIWA 1B7XB 1RRKA 1UVOA 3QK1A 3AW1A 5AFYH 3BG4B 2AGGX 1L0ZA 4NIVA 1W8BH 1DY9A 3RXTA 4FVDA 4AFZA 1GHVH 3ZVGA 4B1TA 2ZFFH 2C8YB 1ESBA 1PYTD 5L2ZH 2WINI 2ZQ1A 2F91A 1YPHE 1TNLA 4RKJB 1BRCE 1FNIA 3TK6A 3ZZDA 4CR5A 2FI3E 2F3CE 1VITF 1GVLA 1T8LA 3HKJB 1J16A 1TA2A 1PFXC 1TNGA 1ANCA 1O3IA 1GI8B 1CGIE 2ANWA 5ABWA 2ZDKA 1FJSA 3ZVBA 3MNBA 2O8TA 1LHGH 4H6SB 4A1VA 1NRNH 1S84A 3S9CA 5DP7A 4BTUB 1IQLA 3LC3A 3A7XA 1O35A 5I46H 1IOEA 3BTEE 3SUEA 5EXNA 1D3DB 3ZV8A 1ELGA 4ABAA 1D6WA 1TGCA 2G00A 2Q6FA 1PQ5A 2FLRH 5DP8A 2H1UA 5ESTE 4DURA 1ELEE 1EQ9A 4X8TH 4Z0KA 1G2MA 2CXVA 1LPZB 4WF8A 1GJ8B 4AFUA 4YESB 2BOKA 3BTME 3STJA 1ZGVA 1WAYB 3FVFB 4LOYH 2AIPA 2XBWA 3A83A 4BNRA 1CSOE 1SHYA 2BHGA 6GCHF 3PWBA 1O32A 2A7JA 2BM2A 4BAHB 3SW2B 1GI2A 4D76A 3E6PH 5EU8A 3DHKH 1TQ7B 4FUEA 3UIRA 4H4FA 1UTQA 2FIRH 1ELFA 3T27A 2PV9B 3A8CA 4IGDA 3MNCA 3M3SA 2Y5HA 4FUCA 1NC6A 3GCHB 2BDIA 1CGHA 3MH7A 3LGIA 2UWOA 4X6PA 3GYMA 4MPVA 5FPSA 3VFEA 3LGUA 2IJOB 1GMCG 1MD8A 1ZGIA 3SGBE 3LH1A 3ZZ3A 2BD9A 3PMAB 2CHAB 5TCCA 1ELCA 1H8DH 1GI6A 1JBUH 1EAXA 4ZAEA 3RXEA 1O3PB 1F5KU 1T31A 5T6DA 3PMBB 1FN6A 1GCTB 2WPKS 1Y8TA 1KXEA 2BDAA 2HPPH 1GDUA 4MNYA 3AW0A 1FAKH 2QIQA 3T26A 3TJVA 3RXGA 1VGCB 3MO6A 1C1MA 3HKIB 4XE4A 4Z6AH 4Q7XA 5FPYA 5C1UA 1MTSA 5C1XA 3RXDA 1GG6C 1CQQA 1WTHD 1GHZA 1GBBA 5C5OA 1CA8B 2GT7A 4PROA 1SGNE 1EAUA 1XUKA 1PPCE 1EPTB 4NZLA 3L33A 3NZIA 1TOCB 1KYNA 2P16A 3RC5A 2FOHA 3F9FA 1FUJA 1BTWA 1A61H 2QC2A 1TPPA 3E8LA 3MI4A 1LCYA 1LVOA 3OX7U 4ZROA 1TBRH 4B74A 2QF0A 2FOFA 3EYDA 1J9CH 5J4SA 3PTNA 2RCEA 3V7TA 1WU1A 2A45B 4OS7A 3SGAE 3SU4A 2I6SA 1W7XH 1HJAB 1ZPBA 3QGNB 3RXHA 4BTIB 2UUYA 4NSYA 2BLVA 3ZZ6A 1KXDA 1Y3XA 2XYAA 2Y6TA 3TGKE 3HPTB 4O97A 4O9VA 1ZZZA 4D8NA 1JIMA 1HAVA 3TJUA 1T8MA 2OC8A 4B73A 1E0FD 2VWLA 5C3NA 1L1GA 3H5CB 1O38A 3FANA 1LHDH 2Y5FA 1ZOMA 3M36A 3RXCA 1AWHB 5CMXH 2Z9JA 3ATMA 1YPGH 2K1QA 1THRH 3M5NA 2VU8E 1C1VH 2OC1A 1MH0A 1OKXA 1AU8A 3PLPA 1FIZA 5EPNA 1EZUC 1H8IH 4X2YA 1C2EA 1LHCH 3KQEA 2BQ6B 3DFJA 4E7NA 5HM9A 1YLCA 1GJDB 3P8GA 1BJVA 1BUIA 1TGNA 1HAXB 3UQOA 1AFQC 4DG4A 2J94A 4Y0ZE 3LGVA 4X0WU 3SNEA 2FPZA 1VZQH 1K1LA 4YLQH 2SGEE 4THNH 2BD5A 1YC0A 1QA7A 4X6NA 1VITG 3GCTG 4GAWA 4Y0YE 1QHRB 3HATH 1MU6B 3SHCH 2BD8A 4TY6A 1ESTA 1G36A 4ABGA 1TNKA 3OU0A 3L3TA 4KTUA 4ASHA 1YKTA 1LO6A 1Y3VA 3TK9A 1Z8GA 1TBQH 3ZZ5A 4X1QU 1W0YH 2SNWA 4K8YA 3PMHB 1XM1A 2FTLE 3SU2A 1OS8A 4IW4E 4VGCC 4JYVH 1XUIA 1SB1H 2A4RA 4Y6DA 1DFPA 1HAVB 2TGAA 3H7OA 4WVPE 1ZSJA 3U8RH 3RU4D 1FY5A 1QB6A 3MTYA 3ZZBA 1UCYH 1CE5A 2KAIA 1ETRH 3IWMA 4Y8ZA 1F0UA 4Y79A 3EQ0H 2XWAA 4NFEA 4YM9A 1O2PA 2PWXA 2XCNA 3CS7A 4CRBA 3S0NA 1A1RA 2QV1A 2QAAA 4JZIA 2TIOA 5L6NH 4J1YA 1Y59T 1AVWA 2O9QA 4R8TB 1T32A 1SBWA 3MNSA 2ILNA 4MVNA 6GCHG 1DWEH 4X2WA 3KQBA 4NIXA 2XC5A 2SNVA 4HFPB 2ZCHP 1O2KA 2R9PA 1O2YA 1SHHB 2P94A 1GBTA 2HLCA 2QN5T 1GI7B 2H5DA 3SBKA 3RXPA 1GHXH 4AB9A 6LPRA 1TX6A 2ZO3H 3MO3A 2ODQA 1C5ZB 2GDEH 4CBOA 4FUJA 2ZNKH 3UNRA 2VWMA 3GY6A 3UREA 3RMLH 1V2PT 2PGQB 3T5FH 2R3UA 1O2QA 1AVGH 4IN2A 1QL7A 3E1XB 2VINA 2FESH 1C2GA 1C2LA 2Z3DA 5DO4H 1O3CA 4AFQA 5LPFA 1EUFA 4X1SU 1O5DH 1P0SH 2FX4A 1NY22 2ODPA 3TH3H 4Y10E 3U98H 1G3CA 4AB8A 1CBWC 3TH2H 2D26C 5GXPA 1KLJH 1P01A 1HAPH 2V3OH 1BTHH 2DUCA 2WPLS 1A46H 1K1OA 2ZKSA 1HJ8A 3SNCA 2PKSC 1K28D 2AIQA 1AIXH 4FUIA 3AASA 1O2HA 3HK6B 3LKWA 2FO9A 3MMGA 1BQYA 1WV7H 1MKXH 4AFSA 1TMTH 3QN7A 3NCLA 1RFNA 5A8ZA 1LVBA 2BD3A 5J4QA 5FXLA 3PO1B 5BRRE 2Q6DA 3LONA 2ANKH 1P04A 2PLXA 3F1SB 3M5OA 3ZVCA 1BMLA 1E37B 4GHTA 5HYOA 1DX5M 1BHXF 2V6NA 4BAOB 4A7IB 1RJXB 3K65B 2NU2E 2BLOA 3OY5U 1RIWC 1KDQB 1Z8IB 1DE7H 2Y82A 3O8BA 1JWTA 1GGDC 1O39A 3IG6B 1L1JA 1O3KA 3QZQA 1TBZH 3O8CA 2FWWA 1WOFA 1RS0A 1SQOA 3EE0B 2BTCE 2A7HA 5EQQA 5H4IB 4OS4A 2ESTE 2CN0H 3P6ZB 1W11U 2G5NA 5CHAB 4ZUHA 3E3TA 1O31A 1AO5A 2JH5D 2ZPQA 2CGAA 1AZZA 1AKSA 1A5GH 4JK5A 1TA6A 1BZXE 4AYVB 2SGFE 1V2LT 2STBE 1GPZA 1SGYE 4LZ1H 3PB1E 1M9UA 1Y5UT 3T62A 3UTUH 1GDQA 2JKHA 1RTFB 1V3XA 3R0FA 1NPMA 2RA3A 1UVUH 1SLXB 1OP8A 1GJCB 2G8TA 2GMTC 1TAWA 1HXFH 4SGAE 2W26A 2GZ7A 1P02A 4WMFA 4IS5A 4XOJA 3SOSA 3ZZ9A 1IQIA 1AD8H 3NXPA 5E0GA 4K69A 4X8VH 4IC6A 4BAMB 2QGRA 4O03A 1DSUA 3RXLA 4DOQA 2UWPA 2PKAA 1KIGH 2ZDVH 1P10A 1TNJA 1QTFA 4YZUA 3U8TH 1GHWH 3B8JA 1C4Y2 1GJAB 2ZU5A 1BRAA 1O33A 3U8OH 4NFFA 3SV6A 3UQVA 3F9HA 4AX9H 3SQEE 1JIRA 5FCRA 3E0NB 3RM0H 3I77A 1T7CA 1D3PB 1QGFA 2FOGA 3F9EA 1HXEH 2UWLA 2ZDMA 1DY8A 1MBQA 4UONA 7GCHF 4MNXA 1UTJA 1O5AB 2GT8A 1GHBF 2ZHQH 2CF9H 2ANMH 3RXFA 2OC7A 1YYY1 3P8OA 3T2NA 1O3DA 3K6ZA 3QUMP 2ULLA 1TX8A 1MAXA 3Q00A 4ZXYH 2QF3A 1YGCH 4D7GA 1C1OA 2M5TA 1C1SA 3A84A 2OXSA 4INKA 3LIWA 2ZGCA 1CA0B 2HRVA 1AKSB 1ZYOA 1PPGE 5FCKA 2Z94A 3MNXA 1QY6A 3MH6A 4IN1A 1NU9A 3FP6E 1GHYH 1AB9C 5GIBA 3M5LA 2WUCA 4B2CA 1YM0A 1S83A 2HPQH 3A8DA 1UTPA 4NCYA 3U1IB 4FUDA 3TJNA 1V2KT 1ZMJA 2PFEA 2A31A 1QBNA 3BEFB 5HM2A 1AUJA 2BDBA 1V2TT 3TNSA 1K9OE 1ELVA 2J2UA 3A81A 4I8KA 4CRDA 2P95A 4FU9A 3A7VA 2EI6A 4WWYA 1CHGA 3QGJA 1UTKA 2FOBA 4RSPA 3P95A 2ZCLP 3DT0H 1HCGA 4DCDA 4DW2U 3FAOA 3B23B 2GDDA 3LGTA 1S0RA 1PPFE 1KY9A 2BLWA 6CHAB 2ZPSA 1KXBA 1FZZA 2C8ZB 2BX4A 1NN6A 5JYIA 1W7GH 4B2BA 2TGDA 4I7YH 2JETB 2WYGA 1SGQE 3SUGA 4YOIA 5JB8S 3RM2H 1MTNC 4X2XA 1YPMH 3GY8A 1S6FA 2P8OC 3GDUA 2P59A 1YPEH 1LVMA 4ZXXH 2P93A 3BTKE 1NFUA 2ZDAH 5F03A 2STAE 3VGCB 1LDTT 4UE7H 2VIDA 3GISB 4WH6A 4HGCA 4DJZB 1C5XB 1O3LA 5LH8A 4ISOA 5FX5A 4U30A 4MPXA 4LXBH 3ZYDA 1SPJA 3ATWA 2GCTB 5JDUB 1UK4A 3V12A 1WSSH 1J15A 1O2LA 1C5VA 2FOMB 3EAJA 1D6RA 2GZ8A 1ZJKA 3BTFE 4A6LA 5FAHA 3BEUA 3TH4H 1B0EA 1YPLH 1F92A 1AMHA 4ABDA 2A2XH 5TCAA 1NRRH 2VVCA 3KCGH 2PW8H 2HOBA 2ZDLA 3UUZA 4CHAB 2P3UB 2H2ZA 2XRCA 1FDPA 1TONA 1O30A 2ZCKP 4MPWA 1RTKA 1J17T 1EKBB 3VXEH 2AMPA 3GDVA 1TPSA 2ASUB 2Z9KA 1O2OA 1FV9A 1GHAF 4TWWA 2ZTYA 3RXOA 8GCHF 3ZYEA 4K5ZA 1NT1A 3SU3A 3SV2H 1G37A 4JYTA 2GZ9A 1HFDA 1C2FA 1MTUA 1O5GH 2XWBI 1GBHA 1GWAA 2FODA 2ZGHA 1H9LB 2TGTA 1FY1A 4JZ1A 1AFEH 1ETTH 4FU8A 3E91A 5B6OA 1GMDF 3MYWA 1C1UH 2AGEX 1GI9B 4GCHF 3QLPH 4HTCH 1UHBA 1SLWB 1YCPH 1EAWA 4ABIA 3QTVH 5E0HA 1HIAA 1TLDA 1W3CA 4I8HA 2FMJA 1T8OA 3SU6A 3ZZ4A 4OS6A 2W7UA 1ANEA 4Y8XA 2LNCA 1JRSA 1Y3YA 4IC5A 1O2ZA 3SJOA 4TYDA 3SUDA 1UTNA 2ZDNA 1EOLA 1C5QA 2CJIA 3SHAH 1AWFH 4UDWH 2H5CA 1N8OB 2FYQA 1P2QA 1IQGA 2VGCC 2PGBB 1QCPA 2BY6X 2ZTZA 4K3JA 3F68H 5GJ4B 1GI5A 1YPJH 1TB6H 2TBSA 2VB0A 1ZLRA 2OD3B 1C9PA 1F0TA 3TLOA 1XUGA 4YO9A 1ACBE 2OC0A 1UTLM 2TGPZ 2P3TB 3A80A 3K6YA 1V2JT 5FBEA 3RDZA 1FXYA 3IITA 1TNIA 1Z1JA 1S81A 3ZZAA 1ZMLA 1TGBA 3ENSB 4MQAA 5DP4A 4CREA 1QJ7B 1A0LA 1SOTA 3A8BA 1K1MA 1GMHF 2UUKB 1P3EA 1AE5A 1E35B 2BZAA 4U01A 3UNSA 1DICA 1XMNB 5JBAS 3RXMA 3SORA 1TOMH 1GDNA 3N7OA 7GCHG 1ELAA 5DKMA 4CRGA 3FZZA 1C9TA 5GPIB 2G81E 1GHBG 1IQHA 2DE8A 3T25A 1YBWA 1HLTH 4R0IA 1UTOA 1TABE 2BQWB 5IDKA 2G4UA 4CRAA 1SMFE 4ZMAH 1HDTH 1O3GA 1MTWA 3LGYA 2ZA5A 1XUHA 3LC5A 3L6PA 2B8OH 5LGOA 1C2JA 1WUNH 2XXLA 3D23A 2VJ1A 2VIWA 4H42U 5FBIA 2OBQA 3BTGE 2BMGB 2FXRA 1G3DA 1H1BA 1VCWA 3A7ZA 1UCYK 2C90B 4ZKOU 1P05A 1MTVA 2VNTA 1LQEA 1OWEA 4X6OA 1GVKB 2F9PA 5EXMA 4FUBA 2ZQ2A 5T6FA 1PJPA 2BD2A 1C5UA 2BD4A 2Q1JA 2W3KA 1QNJA 1FQ3A 1V2QT 1XVMA 2ZGXH 2ZU2A 3ZV9A 4ZKSU 5IYTA 4HZHA 3EA9A 4ISHH 5T6GA 2BXTH 4AN7A 5SGAE 2F9OA 3BTWE 2EI8A 1KXAA 1BTZA 1MKWK 1ZJDA 1P8VC 3BF6H 2B7DH 3NKKA 2XBXA 5A8YA 3GOVB 1YF4A 3M3TA 2A5AA 4AGJA 4KP0A 3STIA 1ABJH 1A0HB 1C5MD 1KTSB 1SQAA 1BMAA 3GY5A 1O3FA 2ZGBH 2YNAA 4X6MA 1O36A 2BDHA 1O2RA 3UNQA 1HGTH 1BBRH 4KGAA 4B71A 1AZ8A 4X2VA 2V35A 2CMYA 2JH6D 2FYRA 1MQ5A 1AI8H 2VIPA 4I8JA 5AVDA 1GBJA 4MNWA 3RXQA 2F9UA 3RXIA 3SNDA 1THPB 1TX7A 4X1RU 2BZ6H 2NU1E 2R2WU 3D65E 4XBDA 1ARCA 2BQ7B 1DUEA 3M5MA 2GD4B 1PQ8A 3ATIA 2HALA 3MOCA 1GJ4H 4ABJA 3BV9B 3PMJA 1NFXA 4Y76A 3A82A 4FUFA 4NWLA 1SGEE 3ATLA 2F9BH 1QIXB 1TNHA 1NU7B 1EP6A 1DLEA 2RG3A 3ZZ7A 1EJMA 4F49A 1SGDE 4XBCA 4WY3A 1SGFG 1GBCA 3CS0A 3ITIA 3OYPA 3BTQE 2QYIA 1AY6H 1UK3A 7LPRA 1GBKA 1C1NA 4YT6H 1L4ZA 1V2ST 1ZMNA 1O3EA 8GCHG 2EA3A 2FP7B 3Q77A 1TIOA 2D8WA 2OINA 1ZHMA 1WBGB 1CT4E 1K1JA 2VWOA 2D1JA 2VVUA 3ZZCA 2ZFTA 2AH4X 2C8WB 3NK8A 3QO6A 4KTSA 4Q80A 1YPHC 1GMDG 4I31A 1H9IE 1IQFA 1H9HE 1C2DA 4GCHG 1O37A 3O8RA 1JMOH 2BD7A 3M35A 1VITH 1E36B 3GY7A 3SV8A 3GDSA 1EJAA 1O2WA 1A4WH 1TGSZ 1DXWA 3SNAA 5JBTA 1SGPE 2OP9A 1O2IA 4YT7H 2BVRH 1EP5A 1SGFA 1OX1A 2FX6A 4ISNA 4ZKRU 1EB2A 3E90B 1GG6B 1IQEA 1BCUH 3UR9A 1TPOA 1C5OH 1L4DA 4ZHMU 1ID5H 2G55A 4Y11E 5DJ7A 1MUEB 2FLBH 1GBAA 5EQRA 1O5CB 3BG4C 2ZFQH 2ANYA 2SFAA 4K60A 1MU8B 1BTYA 1BITA 2I6QA 4YOJA 1P06A 3OSYA 2KAIB 2QXIA 1Z6JH 2NU4E 1OWDA 1QBOA 1QRZA 2WPIS 4Q2KA 4I32A 4MNVA 1OYQA 3SJKA 1FLEE 1H4WA 3LJJA 4U2WA 1ZPZA 1HNEE 1UCYE 1N6XA 3HK3B 3UWJH 1UVTH 4CR9A 2ZHEH 3O8DA 2BLQA
chains in the Genus database with same CATH superfamily
1C5RA 2SGQE 3PLBA 1MQ6A 1ZPCA 1EATA 2SGDE 2XNIA 3SV9A 3MU1A 1HAZB 3UFAA 4O3UA 3QWCH 1YLDA 2GCHF 1GI4A 1PPBH 3RXVA 1E34B 4XBBA 3MWIU 2JH0D 3ODDA 3SJ8A 4CRFA 1MBMA 1O3OA 3ODFA 1W14U 4Y7AA 4ZCNA 1C5NH 2ZFRH 4WH8A 4A5TS 1DXPA 5C5NA 1YCPM 3RXKA 5C67A 1BMFD 2BY9X 4KTCA 2ZP0H 1EZQA 1FY4A 1DITH 4X8UH 3S7KB 4BAKB 2HNTE 8LPRA 1G30B 3ZVDA 1VCPA 2ZHWH 2FOEA 2GKVE 5A8XA 4FVBA 2A32A 2J34A 1NROH 2ZHFH 3P70B 2G52A 2WUBA 4F4OC 1Z6EA 1U6QA 1C1TA 2XBYA 3D49H 2DE9A 5G4BA 3TITA 1FY8E 5FPTA 1G2LA 1GMCF 2R0KA 1CGJE 3V13A 5CE1A 1LHFH 2BY7X 3SU1A 5EODA 1NM6A 1IQJA 3K2UA 2ODYB 2VIVA 3ZIAD 4Q7ZA 4AZ2B 1C4U2 3TVJB 1CT0E 1AFQB 2IN2A 2Z9GA 3AVZA 5JB9S 4OS2A 3RC6A 1V6DA 1BRBE 3GCHC 2PTNA 1HAHH 4GLYA 3RUOA 3A8AA 3URDA 4AYYB 4Q4LA 4UFGH 2Y7XA 2EEKA 3M7UA 3V3MA 1QJ1B 2VH6A 2ALPA 2CHAC 1HYLA 2V7QD 2QXGA 2XC4A 1C5YB 3AAVA 3VG8A 5I25A 1QQUA 3E16B 4IMZA 1LPGB 2Z3EA 4WJG2 3RMNH 2BDCA 1L1NA 1GCTC 1NRSH 3UOPA 5DP9A 1XUJA 2ZGJA 1YPKH 2TPIZ 1NRPH 3RU4E 2JJ1D 4VGCB 4ABFA 1TQ0B 1UJ1A 5A2MH 2OCVB 3Q3KA 2AERH 1J14A 1VGCC 4WXIA 1F2SE 1RD3B 4Y7BA 4DY7B 1P2NA 1OWHA 1C2HA 3A87A 5A0CA 2W7SA 1O2JA 1OP0A 1K22H 4D7FA 2SGPE 1MZDA 1QL8A 1SGCA 1SOZA 2M2AA 4ABHA 4LZ4B 2L6OA 1V2OT 1O3JA 1HAIH 2QXHA 3BTHE 3S69A 2PSYA 4X1NU 1UO6A 2BDGA 1RTLA 1V2WT 1EPTC 1P09A 4GHQA 3TPIZ 3NWUA 2C8XB 2G51A 1BTPA 1LKAA 3RMMH 1Q2WA 3ZVEA 2GV7A 4NG9H 1D4PB 2ZF0H 4NZQA 4NA8A 2VH0A 1P3CA 2J5UA 2F9VA 1C5TA 1A5HA 4H6TA 1IAUA 5E2PA 1GI3A 1QQ4A 1W10U 5FL7D 2V3HH 4OS5A 5EOKA 2ZEBA 1WXRA 2ZHDA 5CDFE 3PRBA 3RXRA 2PKAB 3KQCA 3A7WA 4ISIH 3HGPA 2FZZA 1TMBH 2O8MA 1BT7A 4DVAU 4YXWD 3VB6A 3UAIC 1P2OA 4RKOB 1HJAC 3PYHA 4UFDH 2BY5X 3QX5H 1ELBA 1ORFA 5EQSA 5EXLA 3S9BA 1C5PA 1NO9H 1SFQB 3NRLA 1MCTA 4FETA 1SLUB 1O2VA 2VIOA 1Q3XA 1QJ6B 1CBWB 1P2KA 1NTPA 4ISLA 2C93B 3Q3XA 3SO3A 2XCFA 3AAUA 1DPOA 4I33A 2C4FH 4AOQA 4KKDA 3BG8A 5T3HA 1WTGH 2PKSB 1WDIA 4MPUA 2Y80A 1IQKA 1FIWA 1O3HA 2QCYA 3S7HB 2YNBA 3BTTE 4ABBA 1AGJA 5F8XA 3OY6U 1FAXA 4DIIH 1B0FA 1BMMH 5JBBS 1DOJA 3DSPA 2C3SA 2HNTF 1ZRBA 3OTJE 4WXVA 3RP2A 4JZFH 3VXFH 1O3BA 3ATKA 3BIVH 1GI0A 1P9SA 3P17H 1O3NA 5DGJA 4MG3A 4MLFB 4ABEA 5F6MA 1RXPA 3GCTF 4K2YA 5EPYA 1A3EH 1WQVH 2BOHB 4NA9H 3URCA 4NA7A 4YTAA 3TU7H 5A09A 1Q31A 2JDID 1FY3A 4K8BA 4QT8C 1YP9A 3U69H 1BRUP 2O8UA 3UPEA 3PTBA 3P8NA 2AEIH 1BTXA 1GCDA 2OLGA 2FS9A 1RIWB 4Y8YA 2B9LA 2Z3CA 1SI5H 5DP5A 1EOJA 1GGDB 4BXSA 2HVXA 3SZNA 2PHBA 3M61U 4CH2B 3RXSA 2FS8A 5AFZH 1P2JA 3TNTA 3FFGA 2AMDA 6ESTA 1NBMD 3DSOA 4GPGA 1O0DH 3MQKC 2W5EA 4NIYA 1TRNA 2FOCA 1VR1H 3OEED 2J38A 1THSH 1VJAU 3SQHE 2AFQB 3KNXA 1O3AA 3P8FA 1K1PA 2A5IA 2A4OA 5ESBA 3VB4A 1EX3A 3I29A 2GCHG 4OM9A 2AYWA 2A4QA 2Z9IA 5C1YA 3JZ1B 4U32A 5EJLA 1HPGA 1SL3A 4JK6A 1D3TB 1EPTA 3SZEA 3GY4A 1OYTH 4A1TA 1FMGA 1IHSH 2H9HA 3GYLB 4YLUA 2EI7A 1EXFA 2GMTB 1A5IA 1C5LH 3M7QA 4AG1A 4P02A 1TGTA 3LJOA 3FN8A 4UFFH 2ZU1A 3A88A 4K1TA 2WPHS 3DSGA 1H8ED 3BN9A 3KIDU 1V2VT 2VIQA 4BANB 3UOUA 1A7SA 1GL0E 2WPJS 3SI4H 1C1PA 1BTUA 3VB5A 4Y71A 2G4TA 2B0FA 1LHEH 4Q63A 3T29A 1FI8A 9ESTA 5C20A 3F3BA 2W3IA 4XRNA 3GCNA 2FI4E 3R3GB 1C5WB 1Y3UA 1DANH 4MTBA 3KL6A 5KECA 4GSOA 2FI5E 3F0PA 3Q76A 1O2XA 1TWXB 2A0QB 2BYAX 3PM3A 1MD7A 1KMHB 1OHHD 1DLKB 3KF2A 3B9FH 3KN2A 1HUTH 2HVYB 4TPIZ 1W13U 1F7ZA 4DGJA 5GDSH 1XXFA 1QURH 4AGKA 4XSKU 1GI1A 1E38B 1O2UA 4RN6A 3Q3YA 1DDJA 1GBIA 3SJIA 1QB9A 2RFKC 1O5FH 1ETSH 2GVFA 2WV4A 1C4V2 2J9NA 1BBRK 1D3QB 1NESE 5L30H 4UD9H 1AB9B 1P57B 2PUQH 3ZVFA 1OXGA 2Z9LA 1UHBB 1TALA 1W0ZU 2O8WA 3DUXH 2TRMA 3A7TA 2AS9A 3BIUH 1N6YA 2OBOA 1JRTA 5F8ZA 4LK4A 3M3VA 1HIAB 1BMNH 2YOLA 1AVXA 1ESAA 2PSXA 5EW2H 5C0TA 1C1WH 3CENA 1ARBA 2XBVA 1X7AC 3UB0A 2HNTC 1ELDE 3SU0A 1B5GH 3MU5A 3PV4A 2NU0E 4Q7YA 4XDEA 1ANBA 1MAYA 1DWBH 3PO1C 2J95A 1ZHRA 3MH4A 4E7RG 3DFLA 3E0PB 1Y5BT 5EW1H 3RU4T 1DWDH 1N1LA 1G3EA 1ANDA 4XFQA 5GCHF 2Q6GA 1C2KA 2CF8H 2GV6A 5DPAA 4RT1A 3QZRA 1Y5AT 5HKKD 4JMYA 2A7CA 2BVXH 1BHXB 1TRYA 1EB1H 2HWLB 1FN8A 1QL9A 2P3FH 4JZDH 1OPHB 1V2RT 4INLA 1GBDA 1ZSLA 3KEEA 2XC0A 3TK5A 1GJ6A 1ZTJA 1A3BH 3H09A 1CHOF 1TRMA 1MTNB 3V0XA 3FKSD 1S85A 1C5SA 2ZFSA 2Z6BD 4AORA 2ZI2H 2P8OB 2ZIQH 4BOHA 2FDAA 1SFIA 3SNBA 2EC9H 1DS2E 3RXJA 3SGQE 4DT4A 5CHAC 3PWCA 1FONA 1KLIH 2THFB 2XTTB 3T28A 1MZAA 1BOQA 5E2OA 1V2MT 1CVWH 3ELAH 2BDYA 1DT2A 2VVVA 1C1QA 2R0LA 2J92A 1DVAH 1CT2E 4X1PU 1XXDA 1AUTC 1G9IE 1DM4B 1GJBB 1KSNA 2AGIX 2AMQA 5C2ZA 1F0SA 1D9IA 1BDAA 3VPKA 1P11E 1KTTB 4FXGH 1NFYA 1SVPA 2OUAA 5C0UA 2GX4A 3LH3A 1A2CH 5FHTA 3C27B 3SJ9A 7KMEH 1HAYB 1MCVA 1INCA 4M9FA 1KXFA 4CRCA 1T4VH 5LPRA 4D9QA 1ABIH 2BY8X 1PPEE 2A4GA 4NSVA 1OWJA 4K1EA 2WPDD 3WY8A 3ESTA 1LVYA 1O2MA 1S82A 1LTOA 2PTCE 2ZPRA 1LKBA 2WYJA 2ZWLH 3LGWA 3BTDE 7ESTE 5E0JA 3CP7A 1DWCH 1GJ5H 1MKXK 1TPAE 3TGJE 4NWKA 1W12U 4E06H 5DN6D 1XX9A 1QFKH 2LPRA 2GP9B 3MU8A 2OTVA 4B76A 5JBCS 1OWIA 1QA0A 3TGIE 3K9XB 2R3YA 4BAQB 3F6UH 1K1NA 3GCOA 1GHAG 4ASUD 5DP3A 2F9NA 4KELA 1S6LA 1HB0B 1ZSKA 3A85A 2W6ID 4K1SA 3RLYH 4GVUA 1EASA 1PQAA 1O5BB 5HMAA 3TIUA 3QDZB 5EG4A 4ZH8A 1CA0C 1Z8RA 4J2YB 1EAIA 1OWKA 1QRXA 1UW7A 2A2QH 1HRTH 1HJ9A 1HAOH 2G5VA 2QF4A 2ALVA 1OSSA 1P2MA 3EE7A 3A86A 1JOUB 2ZFPH 2VGCB 4ACBA 1MKWH 2FEQH 4DT7B 4FUHA 1SQTA 3LOXA 3SV7A 1SSXA 3G01A 1TE0A 4NGAH 5IK2D 3JZ2B 1KDQA 2PUXB 3RXBA 1O3MA 1BBRE 4WMEA 3DA9B 2WV5A 4X8SH 5ETXA 3RXAA 4ZHAA 3RMOH 4A92A 3LPRA 5EJ1A 2A5KA 3SN8A 4OS1A 1EZXC 1O34A 1JXPA 2QY0B 1SGRE 1XUFA 2GJGA 1ELTA 1NRQH 5C17A 2ZZUH 3BEIB 1ZTLA 1IQNA 2BB4A 6CHAC 2XW9A 1KXCA 3DCLA 1AN1E 1UVSH 5F8TA 4B75A 3FOAA 2JETC 3P92A 3U9AH 2CV3A 2H9TH 2BVSH 2Y7ZA 1TFXA 4ESTE 2V3MA 3EGKH 1HAGE 1ZRKA 2QA9E 2QF5A 2RDLA 4O3TA 1ZTKA 1DSTA 1RGQA 3VGCC 1Z7KA 1MMJN 1PPZA 3LT3A 3MU4A 1T8NA 2PR3A 3F2GA 3SYJA 1SR5C 9LPRA 4HG6A 1GMHG 3M7TA 3WWBA 3QTOH 4TWYA 1WQSA 4FU7A 3MU0A 1AE8H 1G3BA 2A1DB 2FTMA 2OQ5A 1BIOA 4JCNA 1GBLA 2GCTC 5LPEA 2ZU4A 1K21H 2IOTA 2V0BA 1WYKA 4FUGA 3SI3H 5PTPA 5K7RA 2PP6A 4MDSA 3RC4A 1QBVH 1W2KH 1G32B 2D2DA 4UEHH 1UTMA 2GTBA 2J98B 2ZECA 4IBLH 3KGPA 3M37A 1GL1A 1QR3E 3RLWH 4TPYA 3GY3A 2VBCA 1HV7A 4CH8B 4CHAC 5JPMH 3FP7E 4A1XA 2OQUA 1C1RA 1SG8B 1GVZA 2H6MA 1GJ7B 1P2IA 3SUFA 2B5TB 1LQDB 2ZC9H 1NFWA 1SGIB 1C2MA 5AHGH 1TMUH 4IMQA 3C1KA 2FOAA 2SGAA 1O2SA 1XVOA 4INHA 4WMDA 5A0AE 3W94A 1O2GH 3GICB 3MFJA 5FX6A 5GCHG 3BSQA 3PROA 3F9GA 3MH5A 1NZQH 1OOKB 1FPHH 3HGNA 1T4UH 2BX3A 3SU5A 1KLTA 5GWZA 1Z8JB 4I86A 4ZHLU 1F0RA 1W0JD 1Z71A 1PQ7A 1S6HA 1ZHPA 1J8AA 1ZR0A 4AG2A 1CHOG 1UK2A 5HXFA 1BA8B 1SC8U 1IHTH 3KHVA 5E8EH 4F55A 5L2YH 1SLVB 4E05H 2BXUH 4YOGA 1F5RA 2F83A 1GBEA 1O2NA 1P12E 3S9AA 3GY2A 3KQDA 3PLKA 3FZDA 1EZSC 4JYUH 5K0HA 3TJOA 1F5LA 2Y81A 2GGVB 3UY9A 2Y5GA 1LPKB 1GBMA 4ZKNU 1UVPA 1N8OC 4CBNA 2O8LA 5HGGA 4D9RA 8KME2 3EA7A 1BB0B 1UMAH 3FP8E 5TJXA 1VCQA 2UUJB 3EA8A 3A7YA 3LDXH 4I8LA 1XKBC 5EGMA 2VWNA 3D62A 3W95A 3RXUA 3UWIA 4AC9A 1H8HD 3I78A 3EDXB 1FPCH 2ZTXA 1OP2A 4BXWA 2ZU3A 1Y3WA 1YLNA 2NWNA 5DP6A 3ZVAA 2WPMS 1S0QA 2FM2A 1CO7E 1S5SA 1BJUA 1NS3A 1P03A 1XKAC 4DIHH 3ZZ8A 2J4IA 4UFEH 1V2UT 1CU1A 5AF9H 3H7TA 2Z7FE 4SGBE 4GUXA 1K2I1 2IPHA 1HBTH 1E1QD 1WCZA 3A89A 5DG6A 4HI3A 3NPSA 1PYTC 1QB1A 2H9EH 2QXJA 2IPQX 1VJ9U 3MHWU 1C2IA 4I8GA 4JZEH 1LMWB 1L2EA 3U1JB 1IQMA 1SGTA 2EQNA 3DD2H 2UUFB 1GJ9B 1O5EH 3NUMA 2HGTH 4BTTB 3LU9B 1QRWA 1DUAA 1EJNA 3VB3A 2NU3E 1PPHE 1K1IA 5DK1A 3VB7A 1O2TA 3MO9A 1V2NT 1AHTH 1AQ7A 1A0JA 4M7GA 1P9UA 1TYNA 2RA0A 3VEQB 4OGXA 5BPEA 3UR6A 5A0BA 2R2MB 4B2AA 1Z1IA 8ESTE 2ZG0H 1YCPK 4TY7A 1GBFA 4OGYA 4NIWA 1B7XB 1RRKA 3PRDA 1UVOA 3QK1A 3AW1A 5AFYH 3BG4B 2AGGX 1L0ZA 4NIVA 1W8BH 1DY9A 3RXTA 4FVDA 4AFZA 5B6LA 1GHVH 3ZVGA 4B1TA 2ZFFH 2C8YB 1ESBA 1PYTD 5L2ZH 2WINI 2ZQ1A 2F91A 1YPHE 1TNLA 4RKJB 1BRCE 1FNIA 3TK6A 3ZZDA 4CR5A 2FI3E 2F3CE 1W0KD 1VITF 1GVLA 1T8LA 3HKJB 1J16A 1TA2A 1PFXC 1TNGA 1ANCA 1O3IA 1GI8B 1CGIE 2ANWA 5ABWA 2ZDKA 1FJSA 3ZVBA 3MNBA 2O8TA 1LHGH 4H6SB 4A1VA 1NRNH 1S84A 3S9CA 5DP7A 4BTUB 1IQLA 3LC3A 1VKYA 3A7XA 5EIYA 1O35A 5I46H 3N99A 1IOEA 3BTEE 3SUEA 5EXNA 1D3DB 3ZV8A 1ELGA 4ABAA 1D6WA 1TGCA 2G00A 2Q6FA 1PQ5A 2FLRH 5DP8A 2H1UA 5ESTE 4DURA 1ELEE 1EQ9A 4X8TH 4Z0KA 1G2MA 2CXVA 1LPZB 4WF8A 5KGOA 1GJ8B 4AFUA 4YESB 2BOKA 3BTME 2QE7D 3STJA 2YMSC 1ZGVA 1WAYB 3FVFB 4LOYH 2AIPA 2XBWA 3A83A 4BNRA 1CSOE 1SHYA 2BHGA 6GCHF 3PWBA 3CNRA 1O32A 2A7JA 2BM2A 4BAHB 3SW2B 1GI2A 4D76A 3E6PH 5EU8A 3DHKH 1TQ7B 4FUEA 3UIRA 4H4FA 1UTQA 2FIRH 1ELFA 3T27A 2PV9B 3A8CA 4IGDA 3MNCA 3M3SA 2Y5HA 4FUCA 1NC6A 3GCHB 2BDIA 1CGHA 3MH7A 3LGIA 2UWOA 2KR7A 4X6PA 3GYMA 4MPVA 5FPSA 3VFEA 3LGUA 2IJOB 1GMCG 1MD8A 1ZGIA 3SGBE 3LH1A 5HIYA 5C94A 3ZZ3A 2BD9A 3PMAB 2CHAB 5TCCA 1ELCA 1H8DH 1GI6A 1JBUH 1EAXA 4ZAEA 3GS9A 1O3PB 3RXEA 1F5KU 1T31A 5T6DA 3PMBB 1FN6A 1GCTB 2WPKS 1Y8TA 1KXEA 3KYGA 2BDAA 2KCAA 2HPPH 1GDUA 4MNYA 3AW0A 1FAKH 2QIQA 2KCPA 3T26A 3TJVA 3RXGA 1VGCB 3MO6A 1C1MA 3HKIB 4XE4A 4Z6AH 4TSFD 4Q7XA 5FPYA 5C1UA 1MTSA 5C1XA 3RXDA 1GG6C 1CQQA 1WTHD 1GHZA 1GBBA 5C5OA 4P00A 1CA8B 2GT7A 4PROA 1SGNE 1EAUA 5HIZA 1XUKA 1PPCE 2WHXA 1EPTB 4NZLA 3L33A 3NZIA 1TOCB 1KYNA 2P16A 3RC5A 2FOHA 3F9FA 1FUJA 1BTWA 1A61H 2QC2A 1TPPA 3E8LA 3MI4A 1LCYA 1LVOA 3OX7U 4ZROA 1TBRH 4B74A 2QF0A 2FOFA 3EYDA 3F2HA 1J9CH 5J4SA 3PTNA 2RCEA 3V7TA 1WU1A 2A45B 4OS7A 3SGAE 3SU4A 2I6SA 1W7XH 1HJAB 1ZPBA 3QGNB 3RXHA 4BTIB 2UUYA 4NSYA 2BLVA 3ZZ6A 1KXDA 2AHME 4Z1MD 1Y3XA 2XYAA 2Y6TA 3TGKE 3HPTB 4O97A 4O9VA 1ZZZA 4D8NA 1JIMA 1HAVA 3TJUA 1T8MA 2OC8A 4B73A 1E0FD 2VWLA 5C3NA 1L1GA 3H5CB 1O38A 3FANA 1LHDH 2Y5FA 1ZOMA 3M36A 3RXCA 1AWHB 4B6FA 5CMXH 2Z9JA 3ATMA 1YY3A 1YPGH 2K1QA 3KYFA 1THRH 3M5NA 2VU8E 1C1VH 2OC1A 1MH0A 1OKXA 1AU8A 3PLPA 1FIZA 5EPNA 1EZUC 1H8IH 4X2YA 1C2EA 1LHCH 3KQEA 2BQ6B 3DFJA 4E7NA 5HM9A 1YLCA 1GJDB 3P8GA 1BJVA 1BUIA 1TGNA 1HAXB 3UQOA 1AFQC 4DG4A 2J94A 4Y0ZE 3LGVA 4X0WU 3SNEA 2FPZA 1VZQH 1K1LA 4YLQH 2SGEE 4THNH 2BD5A 1YC0A 1QA7A 1NBME 4X6NA 1VITG 3GCTG 4GAWA 4Y0YE 1QHRB 3HATH 1MU6B 3SHCH 2BD8A 4TY6A 1ESTA 1G36A 3WW7A 4ABGA 1TNKA 3OU0A 3L3TA 4KTUA 4ASHA 1YKTA 1LO6A 1Y3VA 3TK9A 1Z8GA 1TBQH 3ZZ5A 3F2FA 5CHBA 4X1QU 1W0YH 2SNWA 4K8YA 3PMHB 1XM1A 2FTLE 3SU2A 1OS8A 4IW4E 4VGCC 4JYVH 1XUIA 1SB1H 2A4RA 4Y6DA 1DFPA 1FX0B 1HAVB 2TGAA 3H7OA 4WVPE 1ZSJA 3U8RH 3RU4D 1FY5A 1QB6A 3MTYA 3ZZBA 1UCYH 1CE5A 2KAIA 1ETRH 3IWMA 4Y8ZA 1F0UA 4Y79A 3EQ0H 2XWAA 4NFEA 4YM9A 1O2PA 2PWXA 2XCNA 3CS7A 4CRBA 3S0NA 1A1RA 1E79D 2QV1A 2QAAA 4JZIA 2TIOA 5L6NH 4J1YA 1Y59T 1AVWA 2WZQA 2O9QA 4R8TB 1T32A 1SBWA 3MNSA 2ILNA 4MVNA 6GCHG 1DWEH 1EFRD 4X2WA 3KQBA 4NIXA 2XC5A 2SNVA 4HFPB 2ZCHP 1O2KA 2R9PA 1O2YA 1SHHB 2P94A 1GBTA 2HLCA 2QN5T 1GI7B 2H5DA 3SBKA 3RXPA 1GHXH 4AB9A 6LPRA 1TX6A 2ZO3H 3MO3A 2ODQA 1C5ZB 2GDEH 4CBOA 4FUJA 2ZNKH 3UNRA 2VWMA 3GY6A 3UREA 3RMLH 1V2PT 2PGQB 3T5FH 2R3UA 1O2QA 1AVGH 4IN2A 2KCYA 1QL7A 3E1XB 2VINA 2FESH 1C2GA 1C2LA 2Z3DA 5DO4H 1O3CA 4AFQA 5LPFA 1EUFA 2KFWA 4X1SU 1O5DH 1P0SH 2FX4A 1NY22 2ODPA 3TH3H 4Y10E 3U98H 1G3CA 5DSFA 1CBWC 3TH2H 4AB8A 2D26C 5GXPA 1KLJH 1P01A 1HAPH 2V3OH 1BTHH 2DUCA 2WPLS 1A46H 1K1OA 2ZKSA 1HJ8A 3SNCA 2PKSC 1K28D 2AIQA 1AIXH 4FUIA 3AASA 1O2HA 3HK6B 3LKWA 2FO9A 3MMGA 1BQYA 1WV7H 1MKXH 4AFSA 1TMTH 3QN7A 3NCLA 1RFNA 5A8ZA 1LVBA 2BD3A 5J4QA 5FXLA 3PO1B 5BRRE 2Q6DA 3LONA 2ANKH 1P04A 2PLXA 3F1SB 3M5OA 3WWFA 1BMLA 3ZVCA 1E37B 4GHTA 5HYOA 1DX5M 4FOUC 1BHXF 2V6NA 4BAOB 4A7IB 1RJXB 3K65B 2NU2E 2BLOA 3OY5U 1RIWC 1KDQB 1Z8IB 1DE7H 2Y82A 3O8BA 3KQ5A 1JWTA 1GGDC 1O39A 3IG6B 1L1JA 1O3KA 3QZQA 1TBZH 3O8CA 2FWWA 1WOFA 1RS0A 1SQOA 3EE0B 2BTCE 2A7HA 5EQQA 5H4IB 4OS4A 2ESTE 2CN0H 3P6ZB 1W11U 2G5NA 5CHAB 4ZUHA 3E3TA 1O31A 1AO5A 2JH5D 2ZPQA 2CGAA 1AZZA 1AKSA 1A5GH 4JK5A 1TA6A 1BZXE 4AYVB 2SGFE 1V2LT 2STBE 1GPZA 1SGYE 4LZ1H 3PB1E 1M9UA 1Y5UT 3T62A 3UTUH 1GDQA 2JKHA 1RTFB 1V3XA 3R0FA 1NPMA 2RA3A 1UVUH 1SLXB 1OP8A 1GJCB 2G8TA 2GMTC 1TAWA 1HXFH 4SGAE 2W26A 2GZ7A 1P02A 4WMFA 4IS5A 4XOJA 3SOSA 3ZZ9A 1IQIA 1AD8H 3NXPA 5E0GA 4K69A 2F4LA 4X8VH 4IC6A 4BAMB 2QGRA 4O03A 1DSUA 3RXLA 4DOQA 2UWPA 3PV2A 2PKAA 1KIGH 2ZDVH 1P10A 1TNJA 5GNDA 1QTFA 2KM0A 4YZUA 3U8TH 1GHWH 3B8JA 1C4Y2 1GJAB 2ZU5A 1BRAA 1O33A 3U8OH 3N7DA 4NFFA 3SV6A 3UQVA 3F9HA 4AX9H 3SQEE 1JIRA 5FCRA 3E0NB 3RM0H 3I77A 1T7CA 1D3PB 2HLDD 1QGFA 2FOGA 3F9EA 1HXEH 2UWLA 2ZDMA 1DY8A 1MBQA 2KZ4A 4UONA 7GCHF 4MNXA 1UTJA 1O5AB 2GT8A 1GHBF 2ZHQH 2CF9H 2ANMH 3RXFA 2OC7A 1YYY1 3P8OA 3T2NA 1O3DA 3K6ZA 3QUMP 2ULLA 1TX8A 1MAXA 3Q00A 4ZXYH 2QF3A 1YGCH 4D7GA 1C1OA 2M5TA 1C1SA 3A84A 2OXSA 4INKA 3LIWA 4XD7D 2ZGCA 1CA0B 2HRVA 1AKSB 1ZYOA 1PPGE 5FCKA 2Z94A 3MNXA 1QY6A 3MH6A 4IN1A 1NU9A 3FP6E 1GHYH 1AB9C 3PV5A 3AK5A 5GIBA 3M5LA 2WUCA 4B2CA 1YM0A 1S83A 2HPQH 4RT0A 3A8DA 1UTPA 4NCYA 3U1IB 4FUDA 2JJ2D 3TJNA 1V2KT 1ZMJA 2PFEA 2A31A 1QBNA 3BEFB 5HM2A 1AUJA 2BDBA 1V2TT 3TNSA 1K9OE 1ELVA 2J2UA 3A81A 4I8KA 4CRDA 2P95A 4FU9A 3A7VA 2EI6A 4WWYA 1CHGA 3QGJA 1UTKA 2FOBA 4RSPA 3P95A 2ZCLP 3DT0H 1HCGA 2W6JD 4DCDA 4DW2U 3FAOA 3B23B 2GDDA 3LGTA 1S0RA 1PPFE 1KY9A 2BLWA 6CHAB 2ZPSA 1KXBA 1FZZA 2C8ZB 2BX4A 1NN6A 5JYIA 1W7GH 4B2BA 2JIZD 2TGDA 4I7YH 2XNDD 2JETB 2WYGA 1SGQE 3SUGA 4YOIA 5JB8S 3RM2H 1MTNC 4X2XA 1YPMH 3GY8A 1S6FA 2K0QA 2P8OC 3GDUA 1YWUA 2P59A 1YPEH 1LVMA 4ZXXH 2P93A 2LP6A 3BTKE 1NFUA 2ZDAH 5F03A 2STAE 3VGCB 1LDTT 4UE7H 2VIDA 3GISB 2KCOA 2CK3D 4WH6A 4HGCA 4DJZB 4B6EA 1C5XB 1O3LA 5LH8A 4ISOA 5FX5A 4U30A 4MPXA 4LXBH 3N7EA 3ZYDA 1COWD 1SPJA 3ATWA 2GCTB 5JDUB 1UK4A 3V12A 1WSSH 1J15A 1O2LA 1C5VA 2FOMB 3EAJA 1D6RA 4TT3D 2GZ8A 1ZJKA 3BTFE 4A6LA 5FAHA 3BEUA 3TH4H 1B0EA 1YPLH 1F92A 1AMHA 5KEDA 4ABDA 2A2XH 5TCAA 1NRRH 2VVCA 3KCGH 2PW8H 2HOBA 2ZDLA 3UUZA 3OAAD 4CHAB 2P3UB 1QZ8A 2H2ZA 2XRCA 1FDPA 1TONA 1O30A 2ZCKP 4MPWA 1RTKA 1J17T 1EKBB 3VXEH 2AMPA 3GDVA 1TPSA 2ASUB 5EJZA 2Z9KA 1O2OA 1FV9A 1GHAF 4TWWA 2ZTYA 3RXOA 2J97A 8GCHF 3ZYEA 4K5ZA 1NT1A 3SU3A 3SV2H 1G37A 4JYTA 2GZ9A 1HFDA 1C2FA 1MTUA 1O5GH 2XWBI 1GBHA 1GWAA 2FODA 2ZGHA 3F0OA 1H9LB 2TGTA 1FY1A 4JZ1A 1AFEH 1ETTH 4FU8A 3E91A 5B6OA 1GMDF 3MYWA 1C1UH 2AGEX 2XOKD 1GI9B 4GCHF 3QLPH 4HTCH 1UHBA 1SLWB 1YCPH 1EAWA 4ABIA 3QTVH 4F48B 5E0HA 1HIAA 1TLDA 1W3CA 4I8HA 2FMJA 4ACAA 1SKYE 1T8OA 3SU6A 3ZZ4A 2LELA 4OS6A 2W7UA 1ANEA 4Y8XA 2LNCA 1JRSA 1Y3YA 4IC5A 3OTPA 1O2ZA 3SJOA 4TYDA 3SUDA 1UTNA 2ZDNA 1EOLA 1C5QA 2CJIA 2YMSD 1AWFH 4UDWH 3SHAH 2H5CA 1N8OB 2FYQA 1P2QA 1IQGA 3FO8D 2VGCC 2PGBB 1QCPA 2BY6X 2ZTZA 4K3JA 1SQRA 3F68H 5GJ4B 1GI5A 1YPJH 1TB6H 2TBSA 2VB0A 1ZLRA 2OD3B 1C9PA 1F0TA 3TLOA 1XUGA 4YO9A 1ACBE 2OC0A 1UTLM 2TGPZ 2P3TB 3A80A 3K6YA 1V2JT 5FBEA 3RDZA 1FXYA 3IITA 1TNIA 1Z1JA 1S81A 3ZZAA 1ZMLA 1TGBA 3ENSB 4MQAA 5DP4A 4CREA 1QJ7B 1A0LA 1SOTA 3A8BA 1K1MA 1GMHF 2UUKB 1P3EA 3OEHD 1AE5A 2EY4C 1E35B 2BZAA 4U01A 3UNSA 1DICA 1XMNB 5JBAS 3RXMA 3SORA 1TOMH 1GDNA 3N7OA 7GCHG 1ELAA 5DKMA 4CRGA 3FZZA 1C9TA 5GPIB 2G81E 1GHBG 1IQHA 2DE8A 3T25A 1YBWA 1HLTH 4R0IA 1UTOA 1TABE 2BQWB 5IDKA 2G4UA 4CRAA 1SMFE 4ZMAH 1HDTH 1O3GA 1MTWA 3LGYA 2ZA5A 1XUHA 3LC5A 3L6PA 2B8OH 5LGOA 1C2JA 1WUNH 2XXLA 3D23A 2VJ1A 2VIWA 4H42U 5FBIA 2OBQA 3BTGE 2BMGB 2FXRA 1G3DA 1H1BA 1VCWA 3A7ZA 1UCYK 2C90B 4ZKOU 1P05A 1MTVA 2VNTA 1LQEA 1OWEA 2IJD1 4X6OA 1GVKB 2F9PA 5EXMA 4FUBA 2ZQ2A 5T6FA 1PJPA 2BD2A 1C5UA 2BD4A 2Q1JA 2W3KA 1QNJA 1FQ3A 1V2QT 1XVMA 2ZGXH 2ZU2A 3ZV9A 4ZKSU 5IYTA 4HZHA 3EA9A 4ISHH 5T6GA 2BXTH 4AN7A 5SGAE 2F9OA 3BTWE 2EI8A 1KXAA 1BTZA 1MKWK 1ZJDA 2WSSD 1P8VC 3BF6H 2B7DH 3NKKA 2XBXA 5A8YA 3GOVB 1YF4A 2WV9A 3M3TA 2RDEA 2A5AA 4AGJA 4KP0A 2L74A 3STIA 1ABJH 1A0HB 1C5MD 1KTSB 1SQAA 1BMAA 3GY5A 1O3FA 2ZGBH 2YNAA 2OK5A 4X6MA 3U28C 1O36A 2BDHA 1O2RA 3UNQA 1HGTH 1BBRH 4KGAA 4B71A 1AZ8A 4X2VA 3W1EA 2V35A 2CMYA 2JH6D 2FYRA 1MQ5A 1AI8H 2VIPA 4I8JA 5AVDA 1GBJA 4MNWA 3RXQA 2F9UA 3RXIA 3SNDA 4RI0A 1THPB 1TX7A 4X1RU 2BZ6H 1MABB 2NU1E 2R2WU 3D65E 4XBDA 1K0HA 1ARCA 2BQ7B 1DUEA 3M5MA 2GD4B 1PQ8A 2YMSB 3ATIA 2HALA 3MOCA 1GJ4H 4ABJA 3BV9B 3PMJA 1NFXA 4Y76A 3A82A 4FUFA 4NWLA 1SGEE 3ATLA 2F9BH 1QIXB 1TNHA 1NU7B 1EP6A 1DLEA 2RG3A 3ZZ7A 1EJMA 4F49A 1SGDE 4XBCA 4WY3A 1SGFG 1GBCA 3CS0A 3ITIA 3OFND 3OYPA 3BTQE 2QYIA 1AY6H 1UK3A 7LPRA 1GBKA 1C1NA 4YT6H 1L4ZA 1V2ST 1ZMNA 1O3EA 8GCHG 2EA3A 2FP7B 3Q77A 1TIOA 3OE7D 2D8WA 2OINA 1ZHMA 1WBGB 1CT4E 1K1JA 2VWOA 2D1JA 2VVUA 3ZZCA 2KX4A 2ZFTA 2AH4X 2C8WB 3NK8A 3QO6A 4KTSA 4Q80A 1YPHC 1GMDG 2F43B 4I31A 1H9IE 1IQFA 2K8IA 1H9HE 1C2DA 4GCHG 2J98A 1O37A 3O8RA 1JMOH 2BD7A 3M35A 1VITH 1E36B 5T1VA 3GY7A 3SV8A 3GDSA 1EJAA 1O2WA 1A4WH 1TGSZ 1DXWA 3SNAA 5JBTA 1SGPE 2OP9A 1O2IA 4YT7H 2BVRH 1EP5A 1SGFA 1OX1A 2FX6A 4ISNA 4ZKRU 1EB2A 3E90B 1GG6B 1IQEA 1BCUH 3UR9A 1TPOA 1C5OH 1L4DA 4ZHMU 1ID5H 2G55A 4Y11E 5DJ7A 1MUEB 2FLBH 1GBAA 5EQRA 1O5CB 3BG4C 2ZFQH 2ANYA 2SFAA 4K60A 1MU8B 1BTYA 1BITA 2I6QA 4YOJA 1P06A 3OSYA 2KAIB 5F53A 2QXIA 1Z6JH 2NU4E 1OWDA 1QBOA 1QRZA 1E1RD 2WPIS 4Q2KA 4I32A 4MNVA 1OYQA 3SJKA 1FLEE 1H4WA 3LJJA 4U2WA 1ZPZA 1HNEE 1UCYE 1N6XA 3HK3B 3UWJH 1UVTH 4CR9A 2ZHEH 3O8DA 2BLQA
chains in the Genus database with same CATH topology
1C5RA 2SGQE 3PLBA 1MQ6A 1ZPCA 1EATA 2SGDE 2XNIA 3SV9A 3MU1A 1HAZB 3UFAA 4O3UA 3QWCH 1YLDA 2GCHF 1GI4A 1PPBH 3RXVA 1E34B 4XBBA 3MWIU 2JH0D 3ODDA 3SJ8A 4CRFA 1MBMA 1O3OA 3ODFA 1W14U 4Y7AA 1C5NH 2ZFRH 4WH8A 4A5TS 1DXPA 5C5NA 1YCPM 3RXKA 5C67A 2BY9X 4KTCA 2ZP0H 1EZQA 1FY4A 1DITH 4X8UH 3S7KB 4BAKB 2HNTE 8LPRA 1G30B 3ZVDA 1VCPA 2ZHWH 2FOEA 2GKVE 5A8XA 4FVBA 2A32A 2J34A 1NROH 2ZHFH 3P70B 2G52A 2WUBA 4F4OC 1Z6EA 1U6QA 1C1TA 2XBYA 3D49H 2DE9A 5G4BA 3TITA 1FY8E 5FPTA 1G2LA 1GMCF 2R0KA 1CGJE 3V13A 5CE1A 1LHFH 2BY7X 3SU1A 5EODA 1NM6A 1IQJA 3K2UA 2ODYB 2VIVA 4Q7ZA 4AZ2B 1C4U2 3TVJB 1CT0E 1AFQB 2IN2A 2Z9GA 3AVZA 5JB9S 4OS2A 3RC6A 1V6DA 1BRBE 3GCHC 2PTNA 1HAHH 4GLYA 3RUOA 3A8AA 3URDA 4AYYB 4UFGH 2Y7XA 2EEKA 3M7UA 3V3MA 1QJ1B 2VH6A 2ALPA 2CHAC 1HYLA 2QXGA 2XC4A 1C5YB 3AAVA 5I25A 1QQUA 3E16B 4IMZA 1LPGB 2Z3EA 4WJG2 3RMNH 2BDCA 1L1NA 1GCTC 1NRSH 3UOPA 5DP9A 1XUJA 2ZGJA 1YPKH 2TPIZ 1NRPH 3RU4E 4VGCB 4ABFA 1TQ0B 1UJ1A 5A2MH 2OCVB 3Q3KA 2AERH 1J14A 1VGCC 4WXIA 1F2SE 1RD3B 4Y7BA 4DY7B 1P2NA 1OWHA 1C2HA 3A87A 5A0CA 2W7SA 1O2JA 1OP0A 1K22H 4D7FA 2SGPE 1MZDA 1QL8A 1SGCA 1SOZA 4ABHA 4LZ4B 1V2OT 1O3JA 1HAIH 2QXHA 3BTHE 3S69A 2PSYA 4X1NU 1UO6A 2BDGA 1RTLA 1V2WT 1EPTC 1P09A 4GHQA 3TPIZ 3NWUA 2C8XB 2G51A 1BTPA 1LKAA 3RMMH 1Q2WA 3ZVEA 2GV7A 4NG9H 1D4PB 2ZF0H 4NZQA 4NA8A 2VH0A 1P3CA 2F9VA 1C5TA 1A5HA 4H6TA 1IAUA 5E2PA 1GI3A 1QQ4A 1W10U 2V3HH 4OS5A 5EOKA 2ZEBA 2ZHDA 3RXRA 2PKAB 3KQCA 3A7WA 4ISIH 3HGPA 2FZZA 1TMBH 2O8MA 1BT7A 4DVAU 3VB6A 1P2OA 4RKOB 1HJAC 3PYHA 4UFDH 2BY5X 3QX5H 1ELBA 1ORFA 5EQSA 5EXLA 3S9BA 1C5PA 1NO9H 1SFQB 1MCTA 1SLUB 1O2VA 2VIOA 1Q3XA 1QJ6B 1CBWB 1P2KA 1NTPA 4ISLA 2C93B 3Q3XA 3SO3A 2XCFA 3AAUA 1DPOA 4I33A 2C4FH 4AOQA 4KKDA 3BG8A 5T3HA 1WTGH 2PKSB 4MPUA 2Y80A 1IQKA 1FIWA 1O3HA 2QCYA 3S7HB 2YNBA 3BTTE 4ABBA 1AGJA 5F8XA 3OY6U 1FAXA 4DIIH 1B0FA 1BMMH 5JBBS 1DOJA 2C3SA 2HNTF 1ZRBA 3OTJE 4WXVA 3RP2A 4JZFH 3VXFH 1O3BA 3ATKA 3BIVH 1GI0A 1P9SA 3P17H 1O3NA 5DGJA 4MG3A 4MLFB 4ABEA 5F6MA 1RXPA 3GCTF 4K2YA 5EPYA 1A3EH 1WQVH 2BOHB 4NA9H 3URCA 4NA7A 4YTAA 3TU7H 5A09A 1Q31A 1FY3A 4K8BA 4QT8C 1YP9A 3U69H 1BRUP 2O8UA 3UPEA 3PTBA 3P8NA 2AEIH 1BTXA 1GCDA 2OLGA 2FS9A 1RIWB 4Y8YA 2B9LA 2Z3CA 1SI5H 5DP5A 1EOJA 1GGDB 4BXSA 2HVXA 3SZNA 2PHBA 3M61U 4CH2B 3RXSA 2FS8A 5AFZH 1P2JA 3TNTA 3FFGA 2AMDA 6ESTA 4GPGA 1O0DH 2W5EA 4NIYA 1TRNA 2FOCA 1VR1H 2J38A 1THSH 1VJAU 3SQHE 2AFQB 3KNXA 1O3AA 3P8FA 1K1PA 2A5IA 2A4OA 5ESBA 3VB4A 1EX3A 3I29A 2GCHG 2AYWA 2A4QA 2Z9IA 5C1YA 3JZ1B 4U32A 1HPGA 1SL3A 4JK6A 1D3TB 1EPTA 3GY4A 1OYTH 4A1TA 1FMGA 1IHSH 2H9HA 3GYLB 4YLUA 2EI7A 1EXFA 2GMTB 1A5IA 1C5LH 3M7QA 4AG1A 1TGTA 3LJOA 4UFFH 2ZU1A 3A88A 4K1TA 2WPHS 3BN9A 3KIDU 1V2VT 2VIQA 4BANB 3UOUA 1A7SA 1GL0E 2WPJS 3SI4H 1C1PA 1BTUA 3VB5A 4Y71A 2G4TA 2B0FA 1LHEH 3T29A 1FI8A 9ESTA 5C20A 2W3IA 3GCNA 2FI4E 3R3GB 1C5WB 1Y3UA 1DANH 4MTBA 3KL6A 4GSOA 2FI5E 3Q76A 1O2XA 1TWXB 2A0QB 2BYAX 3PM3A 1MD7A 1DLKB 3KF2A 3B9FH 3KN2A 1HUTH 4TPIZ 1W13U 1F7ZA 4DGJA 5GDSH 1XXFA 1QURH 4AGKA 4XSKU 1GI1A 1E38B 1O2UA 4RN6A 3Q3YA 1DDJA 1GBIA 3SJIA 1QB9A 1O5FH 1ETSH 2GVFA 2WV4A 1C4V2 2J9NA 1BBRK 1D3QB 1NESE 5L30H 4UD9H 1AB9B 1P57B 2PUQH 3ZVFA 1OXGA 2Z9LA 1UHBB 1TALA 2O8WA 1W0ZU 3DUXH 2TRMA 3A7TA 2AS9A 3BIUH 1N6YA 2OBOA 1JRTA 5F8ZA 4LK4A 3M3VA 1HIAB 1BMNH 2YOLA 1AVXA 1ESAA 2PSXA 5EW2H 1C1WH 3CENA 1ARBA 2XBVA 1X7AC 2HNTC 1ELDE 3SU0A 1B5GH 3MU5A 3PV4A 2NU0E 4Q7YA 4XDEA 1ANBA 1MAYA 1DWBH 3PO1C 2J95A 1ZHRA 3MH4A 4E7RG 3DFLA 3E0PB 1Y5BT 5EW1H 3RU4T 1DWDH 1N1LA 1G3EA 1ANDA 4XFQA 5GCHF 2Q6GA 1C2KA 2CF8H 2GV6A 5DPAA 3QZRA 1Y5AT 4JMYA 2A7CA 2BVXH 1BHXB 1TRYA 1EB1H 1FN8A 1QL9A 2HWLB 2P3FH 4JZDH 1OPHB 1V2RT 4INLA 1GBDA 1ZSLA 3KEEA 2XC0A 3TK5A 1GJ6A 1ZTJA 1A3BH 3V0XA 1CHOF 1TRMA 1MTNB 1S85A 1C5SA 2ZFSA 2Z6BD 4AORA 2ZI2H 2P8OB 2ZIQH 4BOHA 2FDAA 1SFIA 3SNBA 2EC9H 1DS2E 3RXJA 3SGQE 5CHAC 3PWCA 1FONA 1KLIH 2THFB 2XTTB 3T28A 1MZAA 1BOQA 5E2OA 1V2MT 1CVWH 3ELAH 2BDYA 1DT2A 2VVVA 1C1QA 2R0LA 2J92A 1DVAH 1CT2E 4X1PU 1XXDA 1AUTC 1G9IE 1DM4B 1GJBB 1KSNA 2AGIX 2AMQA 5C2ZA 1F0SA 1D9IA 1BDAA 3VPKA 1P11E 1KTTB 4FXGH 1NFYA 1SVPA 2OUAA 2GX4A 3LH3A 1A2CH 5FHTA 3C27B 3SJ9A 7KMEH 1HAYB 1MCVA 1INCA 1KXFA 4CRCA 1T4VH 5LPRA 4D9QA 1ABIH 2BY8X 1PPEE 2A4GA 4NSVA 1OWJA 4K1EA 3WY8A 3ESTA 1LVYA 1O2MA 1S82A 1LTOA 2PTCE 2ZPRA 1LKBA 2WYJA 2ZWLH 3LGWA 3BTDE 7ESTE 5E0JA 3CP7A 1DWCH 1GJ5H 1MKXK 1TPAE 3TGJE 4NWKA 1W12U 4E06H 1XX9A 1QFKH 2LPRA 2GP9B 3MU8A 2OTVA 4B76A 5JBCS 1OWIA 1QA0A 3TGIE 3K9XB 2R3YA 4BAQB 3F6UH 1K1NA 3GCOA 1GHAG 5DP3A 2F9NA 4KELA 1HB0B 1ZSKA 3A85A 4K1SA 3RLYH 4GVUA 1EASA 1PQAA 1O5BB 5HMAA 3TIUA 3QDZB 5EG4A 4ZH8A 1CA0C 1Z8RA 4J2YB 1EAIA 1OWKA 1QRXA 2A2QH 1HRTH 1HJ9A 1HAOH 2G5VA 2ALVA 1OSSA 1P2MA 3A86A 1JOUB 2ZFPH 2VGCB 1MKWH 2FEQH 4DT7B 4FUHA 1SQTA 3LOXA 3SV7A 1SSXA 3G01A 1TE0A 4NGAH 3JZ2B 1KDQA 2PUXB 3RXBA 1O3MA 1BBRE 4WMEA 3DA9B 2WV5A 4X8SH 5ETXA 3RXAA 4ZHAA 3RMOH 4A92A 3LPRA 2A5KA 3SN8A 4OS1A 1EZXC 1O34A 1JXPA 2QY0B 1SGRE 1XUFA 1ELTA 1NRQH 2ZZUH 3BEIB 1ZTLA 1IQNA 2BB4A 6CHAC 2XW9A 1KXCA 1AN1E 1UVSH 5F8TA 4B75A 2JETC 3P92A 3U9AH 2CV3A 2H9TH 2BVSH 2Y7ZA 1TFXA 4ESTE 3EGKH 1HAGE 1ZRKA 2QA9E 2RDLA 4O3TA 1ZTKA 1DSTA 1RGQA 3VGCC 1Z7KA 1MMJN 1PPZA 3LT3A 3MU4A 1T8NA 2PR3A 1SR5C 9LPRA 1GMHG 3M7TA 3QTOH 4TWYA 1WQSA 4FU7A 3MU0A 1AE8H 1G3BA 2A1DB 2FTMA 2OQ5A 1BIOA 4JCNA 1GBLA 2GCTC 5LPEA 2ZU4A 1K21H 2IOTA 2V0BA 1WYKA 4FUGA 3SI3H 5PTPA 5K7RA 4MDSA 3RC4A 1QBVH 1W2KH 1G32B 2D2DA 4UEHH 1UTMA 2GTBA 2ZECA 4IBLH 3KGPA 3M37A 1GL1A 1QR3E 3RLWH 4TPYA 3GY3A 1HV7A 4CH8B 4CHAC 5JPMH 3FP7E 4A1XA 2OQUA 1C1RA 1SG8B 1GVZA 2H6MA 1GJ7B 1P2IA 3SUFA 2B5TB 1LQDB 2ZC9H 1NFWA 1SGIB 1C2MA 5AHGH 1TMUH 4IMQA 3C1KA 2FOAA 2SGAA 1O2SA 1XVOA 4INHA 4WMDA 5A0AE 3W94A 1O2GH 3GICB 3MFJA 5FX6A 5GCHG 3BSQA 3PROA 3F9GA 3MH5A 1NZQH 1OOKB 1FPHH 3HGNA 1T4UH 2BX3A 3SU5A 1KLTA 5GWZA 1Z8JB 4ZHLU 1F0RA 1Z71A 1PQ7A 1S6HA 1ZHPA 1J8AA 1ZR0A 4AG2A 1CHOG 1UK2A 5HXFA 1BA8B 1SC8U 1IHTH 3KHVA 5E8EH 5L2YH 1SLVB 4E05H 2BXUH 4YOGA 1F5RA 2F83A 1GBEA 1O2NA 1P12E 3S9AA 3GY2A 3KQDA 3PLKA 3FZDA 1EZSC 4JYUH 5K0HA 3TJOA 1F5LA 2Y81A 2GGVB 3UY9A 2Y5GA 1LPKB 1GBMA 4ZKNU 1UVPA 1N8OC 4CBNA 2O8LA 5HGGA 4D9RA 8KME2 3EA7A 1BB0B 1UMAH 3FP8E 5TJXA 1VCQA 2UUJB 3EA8A 3A7YA 3LDXH 4I8LA 1XKBC 5EGMA 2VWNA 3D62A 3W95A 3RXUA 3UWIA 3I78A 3EDXB 1FPCH 2ZTXA 1OP2A 4BXWA 2ZU3A 1Y3WA 2NWNA 5DP6A 3ZVAA 2WPMS 1S0QA 2FM2A 1CO7E 1S5SA 1BJUA 1NS3A 1P03A 1XKAC 4DIHH 3ZZ8A 2J4IA 4UFEH 1V2UT 1CU1A 5AF9H 3H7TA 2Z7FE 4SGBE 4GUXA 1K2I1 2IPHA 1HBTH 1WCZA 3A89A 5DG6A 4HI3A 3NPSA 1PYTC 1QB1A 2H9EH 2QXJA 1VJ9U 3MHWU 1C2IA 4I8GA 4JZEH 1LMWB 1L2EA 3U1JB 1IQMA 1SGTA 3DD2H 2UUFB 1GJ9B 1O5EH 3NUMA 2HGTH 4BTTB 3LU9B 1QRWA 1DUAA 1EJNA 3VB3A 2NU3E 1PPHE 1K1IA 5DK1A 3VB7A 1O2TA 3MO9A 1V2NT 1AHTH 1AQ7A 1A0JA 4M7GA 1P9UA 1TYNA 2RA0A 3VEQB 4OGXA 5BPEA 3UR6A 5A0BA 2R2MB 4B2AA 1Z1IA 8ESTE 2ZG0H 1YCPK 4TY7A 1GBFA 4OGYA 4NIWA 1B7XB 1RRKA 1UVOA 3QK1A 3AW1A 5AFYH 3BG4B 2AGGX 1L0ZA 4NIVA 1W8BH 1DY9A 3RXTA 4FVDA 4AFZA 1GHVH 3ZVGA 4B1TA 2ZFFH 2C8YB 1ESBA 1PYTD 5L2ZH 2WINI 2ZQ1A 2F91A 1YPHE 1TNLA 4RKJB 1BRCE 1FNIA 3TK6A 3ZZDA 4CR5A 2FI3E 2F3CE 1VITF 1GVLA 1T8LA 3HKJB 1J16A 1TA2A 1PFXC 1TNGA 1ANCA 1O3IA 1GI8B 1CGIE 2ANWA 5ABWA 2ZDKA 1FJSA 3ZVBA 3MNBA 2O8TA 1LHGH 4H6SB 4A1VA 1NRNH 1S84A 3S9CA 5DP7A 4BTUB 1IQLA 3LC3A 3A7XA 1O35A 5I46H 1IOEA 3BTEE 3SUEA 5EXNA 1D3DB 3ZV8A 1ELGA 4ABAA 1D6WA 1TGCA 2G00A 2Q6FA 1PQ5A 2FLRH 5DP8A 2H1UA 5ESTE 4DURA 1ELEE 1EQ9A 4X8TH 4Z0KA 1G2MA 2CXVA 1LPZB 4WF8A 1GJ8B 4AFUA 4YESB 2BOKA 3BTME 3STJA 1ZGVA 1WAYB 3FVFB 4LOYH 2AIPA 2XBWA 3A83A 4BNRA 1CSOE 1SHYA 2BHGA 6GCHF 3PWBA 1O32A 2A7JA 2BM2A 4BAHB 3SW2B 1GI2A 4D76A 3E6PH 5EU8A 3DHKH 1TQ7B 4FUEA 3UIRA 4H4FA 1UTQA 2FIRH 1ELFA 3T27A 2PV9B 3A8CA 4IGDA 3MNCA 3M3SA 2Y5HA 4FUCA 1NC6A 3GCHB 2BDIA 1CGHA 3MH7A 3LGIA 2UWOA 4X6PA 3GYMA 4MPVA 5FPSA 3VFEA 3LGUA 2IJOB 1GMCG 1MD8A 1ZGIA 3SGBE 3LH1A 3ZZ3A 2BD9A 3PMAB 2CHAB 5TCCA 1ELCA 1H8DH 1GI6A