3BTTE

The crystal structures of the complexes between bovine beta-trypsin and ten p1 variants of bpti
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
222
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structures of the complexes between bovine beta-trypsin and ten P1 variants of BPTI.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PROTEIN (TRYPSIN)
total genus 52
structure length 222
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3bttE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3bttE02
3KCGH 5IDKA 2R2WU 1O3NA 1NO9H 3UOPA 3KIDU 1GBMA 1OS8A 1QRZA 1VITF 2BHGA 2Y7ZA 4XBBA 1HBTH 2SGPE 4BAQB 3U1JB 4ZKRU 3BF6H 1P09A 4UD9H 1OP0A 2BY9X 1N8OC 3GDSA 4BAMB 2VIWA 5A0AE 1AUJA 1NFWA 1HAVB 1UMAH 3PB1E 1BTZA 1MAXA 1MD8A 1C2KA 4FUGA 3UR6A 1FQ3A 1SGYE 3ZZBA 1O5AB 1OX1A 2BM2A 2VVVA 1NS3A 2ZQ2A 4YESB 1RIWB 1ELVA 2VVUA 1V2MT 1BTPA 1HAOH 2GV6A 1P06A 3D62A 4D7FA 1AZZA 5GCHG 3RMNH 2P93A 2RG3A 2XXLA 1T4VH 2C8XB 1WOFA 5EW1H 1XXDA 3F9HA 1DXPA 1SR5C 5E8EH 3SUGA 4K8YA 2J38A 3BEUA 1NY22 4BTIB 6LPRA 3JZ2B 1P11E 4FU9A 3C1KA 4OGXA 4X2YA 1VGCC 2XC0A 1BJVA 2NU0E 4WVPE 3SNDA 2QV1A 1HDTH 3SV2H 2KAIA 1BHXB 1C1WH 1GMDF 4GSOA 1HAZB 1J16A 1GDUA 1GHAG 3TGKE 4GHTA 1G2MA 1K1OA 1GPZA 1C5OH 4B74A 1AWHB 2ZZUH 2W26A 3F1SB 4E7NA 5LPEA 2ZG0H 1O3JA 2BOHB 1ABJH 2WYJA 4MVNA 3QTOH 5AF9H 2SNWA 3MU1A 2PW8H 2W7UA 2PTCE 2BDGA 5JB9S 4X6MA 1LKAA 1Q2WA 3BG4C 4UFEH 4AB8A 2P16A 1DWDH 4ABJA 1EZXC 2WPIS 3R0FA 1ETRH 2GMTC 1TPSA 3GY6A 4AYYB 1V2UT 2PHBA 1GJ4H 2BDIA 3TU7H 4X6NA 2HVXA 4AFSA 2ZGBH 4RSPA 3RC4A 1P3EA 1O3LA 2TRMA 1VCWA 5A8ZA 4OS6A 4MNXA 2FOAA 1DDJA 2OBQA 2VWMA 3Q3KA 4JK5A 1GJ5H 2VU8E 5TCCA 1P03A 3T29A 4I8KA 1QR3E 1EAWA 3VXEH 4H6TA 1OWEA 2BX3A 1C5MD 3Q76A 2W3IA 4IMQA 1ESAA 1HYLA 1TNKA 3CS7A 1P3CA 5A09A 2SFAA 2VNTA 3M5LA 4NIXA 1THSH 1GI7B 1GJAB 1TBZH 3BIVH 2TPIZ 3SV8A 2VWOA 2C3SA 2K1QA 4D9QA 3A81A 1UTLM 3TH2H 1LHCH 1NFUA 4B2CA 4AB9A 4BOHA 4GPGA 3GCTF 4X8TH 4Y8YA 2P3UB 1NZQH 2BZ6H 1C5WB 4AFZA 2AMDA 4B75A 2WINI 5AHGH 3RM0H 1OPHB 3A89A 1ZGVA 4NCYA 2O8WA 1C1QA 1CBWC 1DX5M 4A1TA 4LZ4B 4DOQA 1PPZA 1BMMH 3NPSA 1GVKB 1C5UA 3A84A 3E0PB 1UHBA 1VR1H 5E0HA 1TNJA 4TYDA 3Q00A 3UQOA 1TGBA 2ZHDA 1OWIA 3ITIA 2HALA 3LPRA 2J94A 1K1MA 1UTKA 3RXLA 5GXPA 1FDPA 3VGCC 4CHAB 1AVXA 1IAUA 1K2I1 2GT7A 2ZDNA 4YOGA 4ZUHA 1SG8B 1ELAA 1F92A 2TGAA 1YPHC 2BZAA 1O3CA 4X1SU 2F3CE 4BXSA 3LJJA 4IN1A 3FFGA 1RD3B 1FZZA 2ZHWH 3DT0H 5DP5A 2BD7A 3U8RH 1V2PT 2F9PA 1ZYOA 3K6YA 1TGTA 4RN6A 4X2XA 1Z8IB 3VB3A 2BXUH 5LPFA 3RU4D 4RKOB 5DK1A 1C2HA 2VGCB 5HM9A 3DFJA 3GY3A 2H1UA 1SGDE 3A8CA 4BXWA 4JZDH 1KTTB 3MMGA 3SZNA 3U9AH 3QGJA 1AMHA 3GCHC 1BZXE 5CMXH 4AGKA 2WV5A 1OP2A 4INLA 5DGJA 3UNSA 2AIQA 5BRRE 2BD4A 1QCPA 1EZQA 2VIPA 2ZCKP 2BXTH 1JIRA 4I33A 1HJ9A 2C93B 2GKVE 3L6PA 3SNEA 1P9SA 3M3VA 2ESTE 1YLDA 5L2ZH 1Z7KA 1NROH 5FBIA 2ZFTA 3V3MA 3TK9A 1ELFA 1SGRE 1CO7E 1SB1H 1V2ST 3OYPA 1F0SA 1EKBB 5C1YA 1K21H 3RU4E 2A7JA 1S81A 1K1NA 4I8JA 1QIXB 2ZEBA 2XTTB 1CGIE 1LO6A 2OCVB 3AW0A 4TY6A 3HGPA 3PO1B 1TPOA 2WPLS 1O3FA 2WUBA 1ZMLA 1JBUH 1QJ7B 2HRVA 2GDEH 2ANYA 3ATIA 3PLKA 3GDVA 1WBGB 4ZH8A 1YBWA 4Y79A 1SQTA 1KY9A 1VJ9U 4ABHA 3F6UH 5G4BA 3UREA 2PGQB 1BT7A 2UUYA 3BIUH 5C67A 2Z9JA 2BDBA 2ZU1A 2VWLA 1PPCE 1XUGA 3NXPA 1RFNA 3U69H 2SGQE 1L1NA 3B9FH 2BQ6B 2VH0A 2D1JA 4WMFA 1QJ1B 2Q1JA 1MTVA 5GIBA 2AERH 1MAYA 3MU5A 4FUCA 2ODYB 5JPMH 3KN2A 3OSYA 3TIUA 1FV9A 1P12E 2JETB 1D3PB 3LJOA 2BY6X 1MKXK 1F0TA 1HJAB 1EP5A 3RXOA 2QF0A 1O0DH 3SGAE 2XCFA 4GVUA 2LNCA 2OXSA 2HGTH 1THRH 1C5NH 2F9BH 4ZKNU 4A1XA 2PWXA 2H9HA 1W13U 4FXGH 4Z6AH 3PWCA 4HFPB 5FPSA 4JZ1A 1FN8A 3A80A 1EB2A 4WXIA 2A7HA 5J4SA 3NWUA 1QBNA 4FUIA 2YNBA 3M7TA 5EODA 1C1OA 4NFEA 4O3TA 2XBXA 1Z8GA 4MNYA 1TA6A 3QZRA 3ZYEA 1CQQA 1FXYA 1JMOH 2GTBA 5LPRA 1EPTA 1UVUH 3T28A 1MTNC 1WTGH 4Y8XA 4BAHB 2F9OA 4R0IA 2QCYA 2TBSA 1B0FA 1O2WA 4B73A 3UOUA 5FXLA 1ZPZA 1MQ5A 1PJPA 1K22H 3GCHB 1CGJE 1TYNA 4H42U 2A5IA 2Z9KA 1GWAA 5F6MA 5A8XA 1W0ZU 1QB6A 1O2GH 3LGWA 1GCTC 1Z71A 2BVXH 2R0LA 1DUEA 1U6QA 1BOQA 1GDNA 2VWNA 2UUJB 2R3YA 1HAYB 5FPTA 8GCHF 1V3XA 6GCHF 1QB9A 3ZZ8A 4FUFA 1UVSH 5C20A 1KXEA 1HPGA 5JB8S 1T4UH 1AN1E 1DUAA 1GBIA 3SU6A 2QYIA 7ESTE 3IITA 2PKSB 1TMBH 1P10A 1ESTA 5C5OA 1IQHA 3VB6A 1DE7H 3ZZAA 2AMQA 1SOTA 1THPB 1FNIA 1D9IA 1LPKB 1PQ7A 4YO9A 3SV6A 1CHOF 1LHFH 1LHEH 1BIOA 1HRTH 1T8OA 3BTFE 2I6SA 1QRWA 3PMBB 2BVRH 3MNCA 1ZHMA 1SL3A 3SGBE 2HOBA 4MDSA 4CR9A 1E34B 1NTPA 2QA9E 3PM3A 2FYQA 1UCYK 2QY0B 1SFQB 3DUXH 2GCHF 3GY4A 3LGTA 1SGFA 3GYMA 3MH5A 3RXIA 3LGUA 3HKJB 3SUEA 3CS0A 3M5OA 4WH8A 2VIDA 3EA7A 3SNAA 4D9RA 1OSSA 3MTYA 1O3OA 1SI5H 1C1PA 3A8BA 1K1LA 1QBVH 2ZWLH 1E36B 1W12U 4YLUA 1TE0A 4OGYA 1BTUA 1P0SH 2OC1A 1H9HE 4TWYA 4YOIA 1J17T 4ABAA 2STAE 2SGEE 3MI4A 2GZ7A 4M7GA 3OX7U 2A0QB 1JRSA 4I8GA 2NU3E 5FAHA 2OINA 3FANA 3I77A 1SGNE 3UWJH 2TIOA 1GI4A 1UK4A 1O2VA 2NU1E 5DP4A 3HGNA 1P2MA 2V3HH 4NA9H 3TGJE 3SJOA 1HV7A 1NRPH 2A4OA 2AYWA 2GCTC 2IN2A 3MNXA 4DG4A 1A0HB 3PLPA 3OU0A 3QX5H 1YGCH 4ASHA 2STBE 3P95A 1RGQA 8LPRA 3D65E 4TWWA 1AFQC 1OYQA 1NRQH 1KXCA 1F0RA 3ZVCA 1EZUC 4DVAU 1WSSH 3T62A 1T8NA 1PYTD 4ZMAH 4WF8A 2FOHA 1MU6B 1GBHA 2Z3EA 3HK6B 3TK5A 1ABIH 1J8AA 5JBTA 3ZVDA 5EPYA 4KP0A 1WV7H 4MNVA 4NGAH 2XC4A 4X8UH 3STIA 4ABGA 3VB4A 1O3MA 3A7ZA 2PFEA 5L2YH 3EQ0H 1C5VA 3LGVA 3K9XB 4JZEH 1BJUA 2G4TA 1ZRKA 1GI5A 1MBMA 2ZGJA 1ELCA 3S7HB 3BTQE 1XKBC 2F83A 3BN9A 1Z8JB 3RXBA 2GP9B 4Y8ZA 2HWLB 5EU8A 2ZA5A 2TGTA 3CP7A 1TBQH 1PQ5A 5A8YA 1MU8B 3VFEA 3QTVH 1P2JA 4Q7XA 1O2OA 2NU2E 1O2SA 2BLWA 3GDUA 2PKSC 1A2CH 2B0FA 4OS1A 1F5RA 4ESTE 1O39A 1CE5A 1HGTH 5I46H 1EJAA 3ZVFA 2ZECA 5EQSA 2CF8H 3A8AA 2SGAA 1W2KH 1JWTA 1S6HA 4INHA 3V7TA 3BEIB 3EDXB 1EPTC 2Y5GA 1GVLA 3PLBA 4JYUH 2ZU5A 1WU1A 3QWCH 3TJOA 2ZTZA 1XMNB 2QAAA 1QGFA 2VIOA 2ZPQA 1UK2A 1Y3XA 1C1RA 1MCVA 3K65B 1BBRK 3LONA 2SGDE 1FLEE 4NA7A 4YLQH 3ZZCA 1QL7A 1DS2E 2A31A 2EC9H 3MU4A 3S7KB 1AVGH 2XWBI 1OWJA 3FP8E 4Y0YE 1B5GH 4BTTB 4Q2KA 1XUFA 1C2JA 1Z8RA 2CGAA 1O2QA 2AGEX 4X1QU 1TALA 3GISB 2VH6A 2AIPA 1GBLA 9ESTA 5FCKA 4DIHH 2B7DH 1GL1A 3KGPA 4I31A 1EXFA 1CA0C 1MMJN 4FUBA 1H1BA 2O9QA 5EXNA 3UTUH 1FJSA 1P01A 3RMMH 8KME2 1QA7A 3A7VA 1LKBA 2AMPA 3LDXH 1WQSA 1E0FD 1Y5AT 1W14U 4MPVA 4U2WA 1IQLA 2G8TA 1WUNH 4NZQA 3V0XA 1MCTA 1HIAB 2XYAA 1XXFA 3ESTA 2ZGHA 1MTWA 2A7CA 1G3BA 1ZSJA 2PGBB 4ABBA 4K1SA 1A1RA 2BD5A 1SLWB 3SQHE 2GT8A 3TH3H 5GPIB 3SHCH 1G2LA 4FVBA 4D8NA 3GCNA 3KNXA 4ZHMU 1C2EA 2DUCA 2YNAA 4NIWA 5T6DA 4NWLA 2C8YB 4ZHAA 7LPRA 1L1JA 4J2YB 1ZZZA 5C5NA 2OC7A 1C1MA 1C5TA 2UWPA 3SO3A 2BLOA 3RXAA 3OTJE 4YOJA 4Z0KA 2FP7B 2ZC9H 2FI5E 5AVDA 3RXPA 1L2EA 5T6FA 1D3QB 2V6NA 1DITH 2O8LA 2ZNKH 1Y5BT 5AFZH 3KL6A 1GI6A 1AE8H 1E37B 3F9FA 4K3JA 1C5QA 3M35A 3LGYA 4X2WA 1GJ6A 3UPEA 2ZIQH 3PO1C 1BRBE 3W95A 1ZMNA 5CE1A 1NM6A 2QGRA 1P02A 1Y8TA 3MOCA 1EZSC 1K9OE 3LOXA 4FUDA 3LC3A 4XBDA 4E05H 2GGVB 1W7GH 2H5DA 4VGCC 1UVOA 1PYTC 1ELDE 1O36A 1ZHPA 3VEQB 5E0JA 4TPYA 1KDQB 2Z3DA 4UFFH 5LH8A 4YM9A 3TGIE 4JYTA 3RXFA 3P8OA 1EAIA 3T26A 3PYHA 4ZKOU 3RLYH 3M37A 3ZV8A 3ZV9A 1LVMA 1PPFE 1O2IA 3TJNA 3WY8A 2RCEA 1H9LB 3EGKH 1V2VT 2B5TB 1K1PA 4DY7B 1PPHE 3RC6A 2PLXA 3QDZB 1H8DH 1AFEH 2PKAB 1JRTA 2VB0A 1VZQH 3A83A 1GI0A 1O32A 2AH4X 1UO6A 4XFQA 1G37A 2ZFSA 4IW4E 1ID5H 2VGCC 4K60A 4X8SH 2NU4E 1E35B 2CN0H 1FAXA 1TPAE 4KTUA 3P92A 1ZLRA 1S83A 3A7TA 2VIQA 4NIYA 1DWEH 5K0HA 4E7RG 1QY6A 1UK3A 3M5MA 4YZUA 1DSTA 1GBCA 1GG6B 2ZU4A 2GZ9A 1V2WT 3K6ZA 3SV7A 1IQMA 1DWBH 2FZZA 4X8VH 1ZSKA 4ABDA 1ZPCA 2WPMS 3ATWA 2BD3A 3P70B 3KQDA 3U1IB 3PTNA 3GY7A 1O33A 1S6FA 3V13A 1SVPA 2ZFFH 1TGNA 3U98H 3VB5A 1S5SA 2DE8A 1XUJA 1V2RT 1TABE 3A8DA 1FIZA 1NRSH 1LMWB 1Y3YA 2IPHA 3BG8A 1ETTH 1P2OA 3HATH 4OS4A 1ZMJA 2GCHG 1GI1A 4MNWA 1AB9C 2ZO3H 1W7XH 1YPEH 1P57B 1TA2A 3RXSA 4WMDA 2BD8A 3K2UA 1JIMA 3GCOA 3PROA 1YM0A 4ZXXH 1GHVH 3AW1A 1HAHH 3RXTA 1H4WA 1T31A 5FBEA 1F5LA 5FHTA 2QXHA 5EW2H 3HPTB 1A7SA 1OKXA 1KIGH 3EAJA 5L6NH 3P8GA 1A61H 2FS8A 1EOJA 2ZTXA 1A5GH 1EJMA 3PMJA 5EXLA 3QUMP 1PPEE 3RMLH 1CBWB 4CRDA 1Y3UA 4FU8A 1YPMH 4GAWA 4ZAEA 3P8NA 2TGPZ 4GCHF 1A5IA 3EYDA 1GHBG 4CRFA 5HYOA 4JCNA 3UQVA 1MZDA 3S69A 1JOUB 4ZROA 1TOMH 3MO6A 1AE5A 2D26C 3E8LA 2H5CA 1QA0A 2R9PA 2Z9LA 5DP3A 4Q80A 4UE7H 1KLJH 4AG1A 2FOEA 2CHAB 1DY8A 1YYY1 4B71A 3TVJB 3PTBA 1AUTC 1UHBB 2FOCA 4TPIZ 5DP7A 3LIWA 2ZCLP 4IC6A 3RUOA 3RXQA 4AFUA 2UUKB 1LHDH 4I7YH 4HTCH 1W10U 4OS5A 1B0EA 2XBVA 3QK1A 2ILNA 1C2IA 2FPZA 1WTHD 2NWNA 3P6ZB 3Q77A 3MO9A 1O5DH 3ATLA 3EE0B 1YCPH 1F5KU 2W3KA 1O5BB 3RXVA 3VB7A 2HNTF 3TJVA 4KKDA 1DPOA 5JBCS 2WYGA 1CT0E 5TCAA 1SGQE 3SQEE 1HJAC 3NK8A 3SHAH 4LXBH 3LC5A 2ZU2A 7KMEH 1QHRB 4CRCA 1GJ7B 1UTPA 3SGQE 1YPKH 3RU4T 2AGIX 4VGCB 4CR5A 3ATMA 5EQQA 1LVOA 5EGMA 4MTBA 2BD2A 1UTOA 4LK4A 4NIVA 3G01A 1GVZA 1YKTA 3UR9A 5JDUB 5A2MH 1V2JT 3MH4A 4BAOB 1ZJKA 2G5VA 1AKSB 2ZP0H 4YT7H 3SORA 1TNGA 1HUTH 3SJKA 2OTVA 1C4V2 1TMUH 3BTME 4GLYA 1DICA 1RTFB 4UFGH 5H4IB 1YF4A 3FZZA 4DIIH 5T6GA 2BDCA 1AWFH 4F4OC 5JBAS 3URDA 4B2AA 1D6RA 2RA0A 3DFLA 4XBCA 3UIRA 1GCTB 4AN7A 5C1XA 1GI3A 4JZIA 3BSQA 1SLXB 1Q3XA 2ASUB 1OYTH 1T32A 2QXIA 1AI8H 5A0BA 1ELBA 1Y3VA 1AVWA 1IHTH 1A3EH 1DSUA 1FY3A 1SBWA 1C5LH 1O2MA 2SNVA 1TBRH 1MD7A 1SGPE 2CXVA 4O03A 4OS7A 1VITH 2ZFRH 1GHAF 5CHAC 5E2PA 3RC5A 3UNRA 2FYRA 1C5YB 3MNBA 3I29A 4K1EA 1O30A 1QRXA 4THNH 1DOJA 4H4FA 1SGEE 2FO9A 6ESTA 5GWZA 1AZ8A 4FUHA 1C1TA 1XVOA 4K5ZA 1IQNA 3ODDA 2I6QA 4GHQA 1O2ZA 1GL0E 1QURH 1TX6A 1FMGA 2ZFQH 1PQAA 4BTUB 1TX7A 1ZJDA 4ZXYH 1O3HA 1N6XA 1BITA 1AIXH 1ZR0A 2ZDMA 4HI3A 3L3TA 4Y71A 3MU0A 2GX4A 4A7IB 2FXRA 2ZDAH 1KLTA 3MHWU 1N8OB 4IGDA 1O2KA 2ZKSA 3IWMA 3P17H 3MH7A 3NZIA 1LPGB 4KGAA 5L30H 1AFQB 3SNCA 2BDYA 4CRGA 1T8MA 2EI6A 1K1JA 2ZTYA 4DCDA 2BQWB 4GUXA 1LTOA 1CT4E 1BRCE 1O2UA 2F9VA 1GBBA 1VITG 1XUHA 3I78A 4B76A 2ODPA 1MZAA 1SLUB 2B8OH 1EOLA 1G3DA 4IN2A 1KXFA 5F8TA 1P9UA 3VGCB 4CHAC 3PWBA 2W7SA 1GDQA 1YC0A 1H8IH 1SFIA 1BCUH 2W5EA 1NFXA 4J1YA 1HNEE 1EQ9A 1QQ4A 3MH6A 1PPBH 3KEEA 4AZ2B 1FY4A 4K8BA 1VCQA 3MFJA 1NU7B 1UTMA 2OQ5A 2XC5A 1ESBA 1SHYA 2G00A 1UTQA 2XNIA 1F2SE 1S0RA 1FAKH 4K2YA 1FIWA 2BX4A 4X1PU 1L1GA 1J9CH 1P04A 3N7OA 5BPEA 1KXBA 1EASA 1O5EH 2EI8A 1FI8A 3O8BA 1O2TA 1TRYA 2H9TH 5DJ7A 2WPJS 3SV9A 5PTPA 3T27A 3HK3B 1GJBB 3BEFB 1TB6H 1DANH 4NWKA 1YPHE 4HZHA 4CH2B 1OWKA 2ZPRA 1O37A 1YCPK 1T8LA 4NZLA 3T2NA 1O2XA 3M61U 1ARCA 2FOFA 1K28D 4CRAA 1GHZA 1BTYA 3F9GA 2Q6GA 2PSYA 3M3SA 1EUFA 2GD4B 1YCPM 2BY8X 1F7ZA 1A5HA 1NRRH 3ZVBA 1BBRE 1TQ0B 2WPKS 1FUJA 2GVFA 2BQ7B 1XUKA 2ZDKA 4NSVA 4OS2A 1CA0B 1HAVA 4WXVA 4BANB 2VJ1A 2FIRH 1QQUA 4ABFA 3MO3A 4X1NU 1DY9A 1C9PA 5DKMA 1Y5UT 2A1DB 1YLCA 1XUIA 2C8WB 2HPQH 4E06H 3TK6A 5ESTE 1ARBA 2C90B 3RLWH 2Z3CA 1ZGIA 4R8TB 1S85A 3W94A 1RTKA 2G55A 1SGTA 1GI8B 4CREA 1GHXH 3RXRA 2FX6A 1NRNH 4U01A 4NFFA 2ZDVH 1C5RA 5HM2A 3FVFB 1P05A 8ESTE 1ORFA 1NT1A 2KAIB 4XDEA 1GMDG 2D8WA 2FMJA 3Q3YA 1C4U2 1ZTJA 1D6WA 1Z1IA 1AGJA 1OWDA 2ZHQH 4K1TA 3RXEA 1G36A 4INKA 3RXGA 1V2LT 1K1IA 1GMHF 4FUEA 3GICB 4BAKB 4SGAE 1WAYB 4A92A 5DP9A 1A0LA 1HAPH 1HCGA 2F9NA 3SJ9A 3SU2A 1G3CA 4X1RU 1D4PB 4IMZA 2GDDA 1MKWK 4AG2A 1P2QA 3TLOA 1TNLA 4IC5A 2Z7FE 1BUIA 1GBFA 3PMAB 2Y82A 3ZZ4A 1P2KA 2JETC 4DT7B 1V2QT 6CHAB 3U8OH 1SGIB 1GBAA 3Q3XA 1O5CB 1IQGA 1O2NA 2Y5HA 1PFXC 2ZQ1A 1O3AA 5ABWA 1C5SA 1NPMA 1FONA 3SBKA 3VXFH 3ZZ7A 2Y5FA 2G51A 1KXDA 1TLDA 5T3HA 4U30A 3ZYDA 5F8ZA 4MPWA 2LPRA 1RXPA 4X6OA 1CU1A 1ZTLA 3S9BA 2XRCA 2Z94A 3A7YA 1FPCH 3FP6E 1DT2A 1LCYA 1TNHA 1LPZB 2BB4A 2Q6DA 1UVTH 3ZZ3A 1GBDA 3E16B 2BDHA 2P95A 2Y80A 1GBJA 3BTDE 1HAXB 2ZU3A 3B23B 2FI4E 3LH1A 1QL9A 3MNSA 3UUZA 2G5NA 2G4UA 4O9VA 1WQVH 4CRBA 1ELGA 3QGNB 1P2IA 3DA9B 1LQEA 1ZOMA 1MH0A 1ZTKA 5GCHF 1BA8B 1HAIH 3FAOA 4NG9H 2Y6TA 4XOJA 4D76A 3A88A 1INCA 2SGFE 3RXHA 1GCDA 3S0NA 2BY5X 2THFB 4WH6A 4Y6DA 2QXGA 1B7XB 3KQCA 1O2PA 2RA3A 4IBLH 2A4RA 1CHGA 1QB1A 5E0GA 5JYIA 3LU9B 3RXUA 4AORA 1MUEB 2ANKH 1J14A 2FTLE 3ZZ6A 2QIQA 4UFDH 3SJIA 2P8OB 5FCRA 3AASA 1C5PA 1F0UA 4KTSA 1O35A 1TAWA 5ETXA 3LKWA 4ZKSU 1GHBF 4B2BA 2QXJA 1C1UH 5DG6A 1GBEA 1SOZA 3P8FA 1C2GA 1AB9B 3T5FH 2OBOA 1IQJA 1M9UA 3KQBA 1GMCF 2UUFB 2CHAC 1O3KA 2PTNA 2H2ZA 3E91A 1TX8A 1SLVB 5HXFA 5B6OA 1AHTH 1CHOG 2P8OC 1MTUA 1O3PB 4AX9H 1TMTH 3BTHE 2DE9A 5FX5A 4KELA 1UTJA 2FOGA 1BTHH 5EG4A 1EAUA 3S9CA 1O31A 1GI2A 1TWXB 3C27B 1TRNA 2G52A 4F49A 2A5AA 3ZVEA 3OY6U 3AVZA 1J15A 1BTXA 1JXPA 1ZRBA 2J4IA 4DGJA 4FUJA 2BLVA 1GBKA 5C1UA 1MTSA 2XCNA 1AD8H 4AGJA 1QTFA 1L4ZA 4DJZB 5EQRA 4I32A 3SU3A 3ODFA 5C2ZA 3UNQA 1GJ9B 1O3BA 2BYAX 4IS5A 2BY7X 1V2NT 2ULLA 2J2UA 1KSNA 3RM2H 3ATKA 1V6DA 2EI7A 4DW2U 1SQAA 5AFYH 2BVSH 3A82A 6CHAC 1C2FA 3KF2A 2FODA 3SW2B 3UFAA 4CBOA 2ZHFH 1UVPA 1C2DA 5GDSH 2FEQH 1IOEA 5HGGA 4MG3A 1O38A 4WJG2 1BHXF 4ISOA 1Z6EA 2AEIH 3FZDA 1O5GH 2J92A 3IG6B 3QZQA 1RRKA 1CGHA 3STJA 3GCTG 1RS0A 3S9AA 2A32A 1BDAA 1YPGH 2F91A 1PPGE 5GJ4B 3NKKA 1LVBA 3BTKE 1SMFE 3M5NA 1Z6JH 2F9UA 4AYVB 4WWYA 4A1VA 1EX3A 1FN6A 1Y59T 4UEHH 2J34A 4MLFB 1NC6A 1TFXA 1X7AC 1FY5A 2V3OH 2AS9A 4XSKU 2A2XH 1DM4B 2P59A 3KHVA 1O2LA 1BMLA 2OUAA 1C9TA 1TGCA 4KTCA 5FPYA 2H9EH 4UONA 1EATA 2V35A 2ANMH 3ZVAA 3A85A 1LQDB 4Y7AA 4UDWH 2JH6D 3GY2A 3VPKA 1CVWH 5IYTA 2A5KA 3QLPH 2QC2A 1A0JA 1C5XB 1AY6H 1C2MA 1O3DA 1KDQA 3BTTE 3PV4A 1ACBE 2HPPH 3V12A 1ETSH 2OQUA 4A5TS 6GCHG 1QNJA 2BOKA 1OXGA 1XKAC 3RDZA 3GY8A 1KLIH 1V2OT 2P3TB 4WMEA 4GCHG 1O3IA 3M36A 4Y11E 2GMTB 1GJ8B 4ISIH 1LDTT 2PKAA 3TPIZ 4Y76A 2BDAA 5F03A 2CV3A 1LVYA 3TNSA 1A4WH 1O2HA 4ABEA 4JYVH 2XBYA 2FM2A 3PMHB 2UWLA 2ZFPH 1EPTB 1ZHRA 3F68H 1XM1A 3RXKA 2YOLA 2BD9A 1ANDA 3H5CB 3SN8A 2A2QH 3KQEA 2O8MA 1YPJH 3BTEE 1EJNA 1ZSLA 5DP6A 3M7UA 1BRAA 4Q7ZA 5E2OA 3AAUA 3NCLA 2JH0D 2IJOB 5I25A 1G32B 2G81E 3BTWE 4RKJB 2PSXA 5LGOA 4Y10E 4PROA 5F8XA 3ZZ5A 2VINA 1SPJA 3ZVGA 1GJDB 2Z9IA 1SHHB 5DPAA 4U32A 1Y3WA 2VVCA 1IQKA 1SGFG 4XE4A 2VIVA 2FTMA 2V0BA 3TH4H 2ODQA 4AFQA 1O5FH 4TY7A 2WPHS 1QFKH 4CH8B 4X6PA 4CBNA 3RMOH 2BTCE 5EOKA 1S0QA 3GYLB 1DXWA 2A4QA 1C1VH 3D49H 4X2VA 1GMHG 4QT8C 2FI3E 1FY1A 3T25A 4A6LA 4AOQA 2FDAA 3SU1A 2OC0A 1TGSZ 4MPUA 1UCYH 2Z6BD 3L33A 1OP8A 3A86A 3TITA 5EXMA 1BQYA 1Q31A 1OOKB 1C4Y2 1O2RA 1MKWH 4MPXA 1GMCG 2P94A 3GOVB 4ABIA 3A7XA 1G3EA 1HLTH 3O8CA 3A7WA 2ZDLA 3BTGE 4HGCA 1TQ7B 2D2DA 3SU4A 3SUDA 3E0NB 1GGDC 2FESH 2TGDA 1P8VC 3BG4B 2FX4A 1QL8A 2ZPSA 1YP9A 3H7TA 1TNIA 1IQEA 3JZ1B 4ZHLU 1EAXA 5HMAA 2HNTE 1LHGH 3U8TH 5CHAB 5A0CA 2R3UA 3RP2A 1MBQA 1XVMA 1G30B 1DVAH 2QF3A 2J9NA 3OY5U 2ZGXH 1O3EA 3SI3H 1O2YA 2CJIA 1FPHH 1TRMA 1SGCA 2ALVA 2FLRH 2XBWA 4Y0ZE 3SJ8A 2ZHEH 1N6YA 4X0WU 2IOTA 3D23A 1EB1H 3EA9A 3SOSA 4K69A 3FP7E 2RDLA 5K7RA 1SQOA 1TONA 1MQ6A 3R3GB 1SSXA 1W3CA 1GJCB 3ZZ9A 1D3TB 2XWAA 1L4DA 3DHKH 1ELTA 5DO4H 1O34A 3TJUA 5SGAE 2O8UA 1GBTA 1NN6A 2ANWA 1T7CA 2BMGB 1W11U 2Z9GA 3E1XB 2A45B 3RXMA 1FY8E 1PQ8A 1GHYH 1AKSA 1NFYA 1OWHA 2HLCA 3A87A 3RXDA 7GCHF 2GCTB 4JMYA 2PR3A 1G9IE 5ESBA 3MYWA 3SUFA 1AQ7A 1L0ZA 3MWIU 1TOCB 3H7OA 2A4GA 1TIOA 2OP9A 2JKHA 1A46H 3O8DA 3M3TA 3RXJA 1ELEE 2GV7A 9LPRA 3URCA 2OD3B 3F9EA 1WYKA 3M7QA 3EA8A 1DLKB 1KXAA 4SGBE 1MKXH 3SU0A 2ZF0H 4O97A 4JK6A 3RXCA 1NU9A 1P2NA 4I8LA 1HXEH 1MTNB 1BMAA 1O2JA 5FX6A 1S84A 2ZGCA 1AO5A 1V2TT 2ZI2H 1EP6A 1O3GA 5EPNA 4Y7BA 3ELAH 2C8ZB 2WUCA 2P3FH 3O8RA 3SU5A 2Q6FA 1S82A 4NA8A 1HFDA 2Y81A 2CMYA 4FVDA 1GI9B 2ZCHP 4NSYA 1BRUP 1BTWA 4WY3A 4H6SB 4I8HA 4FU7A 1C2LA 2M5TA 1N1LA 5TJXA 5JBBS 1D3DB 1ANEA 3AAVA 3SNBA 1W0YH 4BNRA 4JZFH 2OC8A 1BBRH 2JH5D 5J4QA 1CT2E 1VGCB 1BMNH 1WCZA 4LOYH 3DD2H 1RJXB 1UCYE 1IQFA 4Q7YA 1HXFH 3ENSB 4MQAA 2R0KA 1GHWH 2PV9B 3CENA 1CA8B 2EA3A 2OLGA 3UWIA 1UTNA 4B1TA 3GY5A 3UY9A 3E6PH 3QN7A 7GCHG 2AGGX 1QJ6B 1V2KT 2FS9A 4ISNA 2FLBH 2EEKA 3TNTA 1NESE 3BV9B 2FOBA 2WV4A 3MU8A 2H6MA 3B8JA 3HKIB 2XW9A 2O8TA 1GG6C 3LH3A 5C3NA 3NUMA 1IQIA 1HAGE 4ISHH 3SI4H 2ALPA 1HB0B 1ANCA 2HNTC 4LZ1H 1ZPBA 1SC8U 3QO6A 2R2MB 3ZZDA 1E38B 1XX9A 3LT3A 4YT6H 2FOMB 1C1NA 2B9LA 2PUQH 1H9IE 1YPLH 2FWWA 1RIWC 1CSOE 1HIAA 1DWCH 1HJ8A 2PUXB 1C1SA 2BLQA 1QBOA 4D7GA 1A3BH 1KTSB 1C5ZB 1Z1JA 8GCHG 4YTAA 2C4FH 2GZ8A 1VCPA 1DLEA 1W8BH 1DFPA 2UWOA 3E3TA 2QN5T 1ANBA 2CF9H 1AU8A 2Y7XA 1TPPA 2J95A 4DURA 2AFQB 4ISLA 1VJAU 1IHSH 1RTLA 1KYNA 1GGDB 1UJ1A 3E90B 5DP8A 3LGIA 1BB0B 4O3UA
chains in the Genus database with same CATH superfamily
3KCGH 5IDKA 2R2WU 1O3NA 1NO9H 3UOPA 1WDIA 1GBMA 1OS8A 1QRZA 1VITF 2BHGA 2Y7ZA 3KIDU 4XBBA 1HBTH 2SGPE 4BAQB 3U1JB 4ZKRU 3BF6H 1P09A 4UD9H 1OP0A 2BY9X 1N8OC 3GDSA 4BAMB 2VIWA 5A0AE 1AUJA 1NFWA 1HAVB 1UMAH 3PB1E 1BTZA 1MAXA 1MD8A 1C2KA 4FUGA 3UR6A 1FQ3A 1SGYE 3ZZBA 1O5AB 1OX1A 2BM2A 2VVVA 1NS3A 2ZQ2A 4YESB 1RIWB 1ELVA 2VVUA 1V2MT 1BTPA 1HAOH 2GV6A 2YMSD 1P06A 3D62A 4D7FA 1AZZA 5GCHG 3RMNH 2P93A 2RG3A 2XXLA 1T4VH 2C8XB 1WOFA 5EW1H 1XXDA 3F9HA 1DXPA 1SR5C 5E8EH 3SUGA 4K8YA 2J38A 3BEUA 5EIYA 1NY22 4BTIB 6LPRA 3JZ2B 3DSOA 1P11E 4FU9A 3C1KA 4OGXA 4X2YA 1VGCC 2XC0A 1BJVA 2NU0E 4WVPE 3SNDA 2QV1A 1HDTH 3SV2H 2KAIA 1BHXB 1C1WH 1GMDF 4GSOA 1HAZB 2XOKD 1J16A 1GDUA 1GHAG 3TGKE 4GHTA 1G2MA 1K1OA 1GPZA 1C5OH 4B74A 1AWHB 2ZZUH 2W26A 3F1SB 4E7NA 5LPEA 2ZG0H 1O3JA 2BOHB 1ABJH 2WYJA 4MVNA 3QTOH 5AF9H 2SNWA 3MU1A 2PW8H 2W7UA 2PTCE 2BDGA 5JB9S 4X6MA 1LKAA 1Q2WA 3BG4C 4UFEH 4AB8A 2P16A 1DWDH 4ABJA 1EZXC 2WPIS 3R0FA 1ETRH 2GMTC 1TPSA 2EY4C 3GY6A 4AYYB 1V2UT 2PHBA 3ZIAD 1GJ4H 2BDIA 3TU7H 4X6NA 2HVXA 4AFSA 2ZGBH 4RSPA 3RC4A 1P3EA 1O3LA 2TRMA 1VCWA 5A8ZA 4OS6A 4MNXA 2FOAA 1DDJA 2OBQA 2VWMA 3Q3KA 4JK5A 1GJ5H 2VU8E 5TCCA 1P03A 3T29A 4I8KA 1QR3E 1EAWA 3VXEH 4H6TA 1OWEA 2BX3A 1C5MD 3Q76A 2W3IA 4IMQA 1ESAA 1HYLA 1TNKA 3CS7A 1P3CA 5A09A 2SFAA 2VNTA 3M5LA 4NIXA 1THSH 1GI7B 1GJAB 1TBZH 3BIVH 2TPIZ 3SV8A 2VWOA 2C3SA 2K1QA 4D9QA 3A81A 1UTLM 3TH2H 1LHCH 1NFUA 4B2CA 4AB9A 4BOHA 4GPGA 3GCTF 4X8TH 4Y8YA 2P3UB 1NZQH 2BZ6H 1C5WB 4AFZA 2AMDA 4B75A 2WINI 5AHGH 3WW7A 3RM0H 1OPHB 3A89A 1ZGVA 4NCYA 2O8WA 1C1QA 1CBWC 1DX5M 2L74A 4A1TA 4LZ4B 4DOQA 1PPZA 1BMMH 3NPSA 1GVKB 1C5UA 3A84A 3E0PB 1UHBA 1VR1H 5E0HA 1TNJA 4TYDA 3Q00A 3UQOA 1TGBA 2ZHDA 1OWIA 3ITIA 2HALA 3LPRA 2J94A 1K1MA 1UTKA 3RXLA 5GXPA 1FDPA 3VGCC 4CHAB 1AVXA 1IAUA 1K2I1 2GT7A 2ZDNA 4YOGA 4ZUHA 1SG8B 1ELAA 1F92A 2TGAA 1YPHC 2BZAA 1O3CA 4X1SU 2F3CE 4BXSA 3LJJA 4IN1A 3FFGA 1RD3B 1FZZA 2ZHWH 3DT0H 5DP5A 2BD7A 3U8RH 1V2PT 2F9PA 1ZYOA 3K6YA 4ASUD 1TGTA 4RN6A 4X2XA 1Z8IB 3VB3A 2BXUH 5LPFA 2HVYB 3RU4D 3W1EA 4RKOB 5DK1A 1C2HA 2VGCB 5HM9A 3DFJA 3GY3A 2H1UA 1SGDE 3A8CA 4BXWA 4JZDH 1KTTB 3MMGA 3SZNA 3U9AH 3QGJA 1AMHA 3GCHC 1BZXE 5CMXH 2W6ID 4AGKA 2WV5A 1OP2A 4INLA 5DGJA 3UNSA 2AIQA 5BRRE 2BD4A 1QCPA 1EZQA 2VIPA 2ZCKP 2BXTH 1JIRA 4I33A 1HJ9A 2C93B 2GKVE 3L6PA 3SNEA 1P9SA 3M3VA 2ESTE 1YLDA 5L2ZH 1Z7KA 1NROH 5FBIA 2ZFTA 3V3MA 3TK9A 1ELFA 4FETA 1SGRE 1CO7E 1SB1H 1V2ST 3OYPA 1F0SA 1EKBB 5C1YA 1K21H 3RU4E 2A7JA 1S81A 1K1NA 4I8JA 1QIXB 2ZEBA 2XTTB 1CGIE 1LO6A 2OCVB 3AW0A 4TY6A 3HGPA 3PO1B 1TPOA 2WPLS 1O3FA 2WUBA 1ZMLA 1JBUH 1QJ7B 2HRVA 2GDEH 2ANYA 3ATIA 3PLKA 3GDVA 1WBGB 4ZH8A 1YBWA 4Y79A 1SQTA 1KY9A 1VJ9U 3OEHD 4ABHA 3F6UH 5G4BA 3UREA 2PGQB 1BT7A 2UUYA 3BIUH 5C67A 2Z9JA 2BDBA 2ZU1A 2VWLA 1PPCE 1XUGA 3NXPA 3F2HA 1RFNA 3U69H 2SGQE 1L1NA 3B9FH 5EJLA 4AC9A 2BQ6B 2VH0A 2D1JA 4WMFA 1QJ1B 2Q1JA 1MTVA 1QZ8A 2AERH 1MAYA 3FOAA 3MU5A 5GIBA 4FUCA 2ODYB 5JPMH 3KN2A 3OSYA 3TIUA 1FV9A 1P12E 2JETB 1D3PB 3LJOA 2BY6X 1MKXK 1F0TA 1HJAB 1EP5A 3RXOA 2QF0A 1O0DH 3SGAE 2XCFA 4GVUA 3SYJA 2LELA 2LNCA 2OXSA 2HGTH 1THRH 1C5NH 2F9BH 4ZKNU 4A1XA 2PWXA 2H9HA 1W13U 4FXGH 4Z6AH 3PWCA 4HFPB 5FPSA 4JZ1A 1FN8A 3A80A 1EB2A 4WXIA 2A7HA 5J4SA 3NWUA 4RI0A 1QBNA 4FUIA 2YNBA 3M7TA 5EODA 1C1OA 4NFEA 4O3TA 2XBXA 1Z8GA 2VBCA 4MNYA 1TA6A 3QZRA 3ZYEA 1CQQA 1FXYA 1JMOH 2GTBA 5LPRA 1EPTA 1UVUH 3T28A 1MTNC 1WTGH 4Y8XA 4BAHB 2F9OA 4R0IA 2QCYA 2TBSA 1B0FA 1O2WA 4B73A 3UOUA 5FXLA 1ZPZA 1MQ5A 1PJPA 1K22H 3GCHB 1CGJE 2IPQX 1TYNA 4H42U 2A5IA 2Z9KA 1GWAA 5F6MA 5A8XA 1W0ZU 1QB6A 1O2GH 3LGWA 1GCTC 1Z71A 2BVXH 2R0LA 1DUEA 1U6QA 1BOQA 1NBME 1GDNA 2VWNA 2UUJB 2R3YA 1HAYB 5FPTA 8GCHF 1V3XA 6GCHF 1QB9A 2F4LA 2HLDD 3ZZ8A 4FUFA 1UVSH 5C20A 1KXEA 1HPGA 2KCPA 5JB8S 1T4UH 1AN1E 1DUAA 1GBIA 3SU6A 2QYIA 7ESTE 3IITA 2PKSB 1TMBH 1P10A 1ESTA 5C5OA 1IQHA 3VB6A 3UB0A 1DE7H 3ZZAA 2AMQA 1SOTA 1THPB 1FNIA 1D9IA 1LPKB 1PQ7A 5KEDA 4YO9A 3SV6A 1CHOF 1LHFH 1LHEH 1BIOA 1HRTH 1T8OA 3BTFE 2I6SA 1QRWA 3PMBB 2BVRH 3MNCA 1ZHMA 1SL3A 3SGBE 2HOBA 4MDSA 4CR9A 1E34B 1NTPA 2QA9E 3PM3A 2FYQA 1UCYK 2QY0B 1SFQB 2M2AA 3DUXH 2GCHF 3GY4A 3LGTA 1SGFA 3GYMA 3MH5A 3RXIA 3LGUA 3HKJB 3SUEA 3CS0A 3M5OA 4WH8A 2VIDA 3EA7A 3SNAA 4D9RA 1OSSA 3MTYA 1O3OA 1SI5H 1C1PA 3A8BA 1K1LA 1QBVH 2ZWLH 1E36B 1W12U 4YLUA 1TE0A 4OGYA 1BTUA 1P0SH 2OC1A 1H9HE 4TWYA 4YOIA 1J17T 4ABAA 2STAE 2SGEE 3MI4A 2GZ7A 4M7GA 3OX7U 2A0QB 1JRSA 4I8GA 2NU3E 4P00A 5FAHA 2OINA 3FANA 3I77A 1SGNE 3UWJH 2TIOA 1GI4A 1UK4A 1O2VA 2QE7D 2NU1E 5DP4A 3HGNA 1P2MA 2V3HH 4NA9H 3TGJE 3SJOA 1HV7A 1NRPH 2A4OA 2AYWA 4B6FA 2GCTC 3SZEA 2IN2A 3MNXA 4DG4A 1A0HB 3PLPA 3OU0A 3QX5H 1YGCH 4ASHA 2STBE 3P95A 1RGQA 8LPRA 3D65E 4TWWA 1AFQC 1OYQA 1NRQH 1KXCA 1F0RA 3ZVCA 1EZUC 4DVAU 1WSSH 3T62A 1T8NA 1PYTD 4ZMAH 4WF8A 2FOHA 1E1RD 1MU6B 1GBHA 2Z3EA 3HK6B 3TK5A 1ABIH 1J8AA 5JBTA 3ZVDA 5EPYA 4KP0A 1WV7H 4MNVA 4NGAH 2XC4A 4X8UH 3STIA 4ABGA 3VB4A 1O3MA 3A7ZA 2RDEA 2PFEA 5L2YH 3EQ0H 1C5VA 3LGVA 3K9XB 4JZEH 1BJUA 1YWUA 2G4TA 1ZRKA 1GI5A 1MBMA 2ZGJA 1ELCA 3S7HB 3BTQE 1XKBC 2F83A 3BN9A 1Z8JB 3RXBA 2GP9B 4Y8ZA 2HWLB 4YXWD 5EU8A 2ZA5A 2TGTA 2WPDD 3CP7A 1TBQH 1PQ5A 5A8YA 1MU8B 3VFEA 3QTVH 1P2JA 4Q7XA 1O2OA 2NU2E 1O2SA 2BLWA 3GDUA 2PKSC 1A2CH 2B0FA 4OS1A 1F5RA 4ESTE 1O39A 1CE5A 1HGTH 5I46H 3U28C 4ACBA 1EJAA 3ZVFA 2ZECA 5EQSA 2CF8H 3A8AA 2SGAA 2KCAA 4RT0A 1W2KH 1JWTA 1S6HA 4INHA 4F48B 3V7TA 3BEIB 3EDXB 1EPTC 2Y5GA 1GVLA 3PLBA 4JYUH 2ZU5A 1WU1A 3QWCH 3TJOA 2ZTZA 1XMNB 2QAAA 1QGFA 2VIOA 2ZPQA 1UK2A 1Y3XA 1C1RA 1MCVA 4XD7D 3K65B 1BBRK 3LONA 2SGDE 1FLEE 4NA7A 4YLQH 3ZZCA 1QL7A 1DS2E 5C94A 2A31A 2EC9H 3MU4A 3S7KB 1AVGH 2XWBI 1OWJA 3FP8E 4Y0YE 1B5GH 4BTTB 4Q2KA 1XUFA 2RFKC 1C2JA 1Z8RA 2CGAA 1O2QA 2AGEX 4X1QU 1TALA 3GISB 2VH6A 2AIPA 1GBLA 9ESTA 5FCKA 4DIHH 2B7DH 1GL1A 2V3MA 3GS9A 3KGPA 4I31A 1EXFA 1CA0C 1MMJN 4FUBA 1H1BA 2O9QA 5EXNA 3WWBA 3UTUH 1FJSA 1P01A 3RMMH 8KME2 1QA7A 3A7VA 1LKBA 2AMPA 3LDXH 4DT4A 1WQSA 1E0FD 1Y5AT 1W14U 3CNRA 4ACAA 4MPVA 4U2WA 1IQLA 2G8TA 1WUNH 4NZQA 3V0XA 3N7EA 1MCTA 1HIAB 2XYAA 1XXFA 3ESTA 2OK5A 5HIZA 2ZGHA 1MTWA 2A7CA 1G3BA 1ZSJA 2PGBB 4ABBA 4K1SA 1A1RA 2BD5A 1SLWB 5T1VA 3SQHE 2GT8A 3TH3H 5GPIB 3SHCH 1G2LA 3UAIC 4FVBA 4D8NA 3GCNA 3KNXA 4ZHMU 1VKYA 3DSGA 1C2EA 2DUCA 2YNAA 4NIWA 5T6DA 4NWLA 2C8YB 4ZHAA 5KGOA 7LPRA 3PRBA 1L1JA 4J2YB 1ZZZA 5C5NA 2OC7A 1C1MA 1C5TA 2UWPA 5EJ1A 3SO3A 2BLOA 3RXAA 3OTJE 4YOJA 4Z0KA 2FP7B 2ZC9H 2FI5E 5AVDA 3RXPA 1L2EA 2J98B 5T6FA 1D3QB 2V6NA 1DITH 2O8LA 2ZNKH 1Y5BT 5AFZH 3KL6A 1GI6A 1AE8H 1E37B 3F9FA 4K3JA 1C5QA 3M35A 3LGYA 4X2WA 1GJ6A 3UPEA 2ZIQH 3PO1C 1BRBE 3W95A 1ZMNA 5CE1A 1NM6A 2QGRA 1P02A 1Y8TA 3MOCA 1EZSC 1K9OE 3LOXA 4FUDA 3LC3A 4XBDA 4E05H 2GGVB 1W7GH 2H5DA 4VGCC 1UVOA 1PYTC 1ELDE 1O36A 1ZHPA 3VEQB 5E0JA 4TPYA 1KDQB 2Z3DA 4UFFH 5LH8A 4YM9A 3TGIE 4JYTA 3RXFA 3P8OA 1EAIA 3T26A 3PYHA 4ZKOU 3RLYH 3M37A 3ZV8A 3ZV9A 1LVMA 1PPFE 1O2IA 3TJNA 3WY8A 2RCEA 1H9LB 3EGKH 1V2VT 2B5TB 1K1PA 4DY7B 1PPHE 3RC6A 2PLXA 3QDZB 1H8DH 2V7QD 1AFEH 2PKAB 2KFWA 1JRTA 2VB0A 1VZQH 3A83A 1GI0A 1O32A 2AH4X 1UO6A 4XFQA 1G37A 2ZFSA 4IW4E 1ID5H 2VGCC 4K60A 4X8SH 2NU4E 2CN0H 1E35B 1FAXA 1TPAE 4KTUA 3P92A 1ZLRA 1S83A 3A7TA 2VIQA 4NIYA 1DWEH 5K0HA 4E7RG 1QY6A 1UK3A 3M5MA 4YZUA 1DSTA 1GBCA 1GG6B 2ZU4A 2GZ9A 1V2WT 3K6ZA 3SV7A 2JJ1D 1IQMA 1DWBH 2FZZA 4X8VH 1ZSKA 4ABDA 1ZPCA 2WPMS 3ATWA 2BD3A 3P70B 3KQDA 3FKSD 3U1IB 3PTNA 3GY7A 1O33A 1S6FA 3V13A 1SVPA 2ZFFH 1TGNA 3U98H 3VB5A 4B6EA 1S5SA 2DE8A 1XUJA 1V2RT 1TABE 5GNDA 3A8DA 1FIZA 3MQKC 1NRSH 1LMWB 1UW7A 1Y3YA 2IPHA 3BG8A 1ETTH 1P2OA 3HATH 4OS4A 4P02A 1ZMJA 2GCHG 1GI1A 4MNWA 1AB9C 2ZO3H 1W7XH 1YPEH 1P57B 3F0OA 1TA2A 3RXSA 4WMDA 2BD8A 3K2UA 1JIMA 5EJZA 3GCOA 3PROA 1YM0A 4ZXXH 1GHVH 3AW1A 1HAHH 3RXTA 1H4WA 1T31A 3OFND 1F5LA 5FBEA 5FHTA 2QXHA 5EW2H 3HPTB 1A7SA 1OKXA 1KIGH 3EAJA 2WHXA 3P8GA 5L6NH 1A61H 2FS8A 1EOJA 2ZTXA 3KYGA 1EJMA 1A5GH 1BMFD 3PMJA 5EXLA 3QUMP 1PPEE 3RMLH 1CBWB 4CRDA 1Y3UA 4FU8A 5B6LA 1YPMH 4GAWA 4ZAEA 3P8NA 2TGPZ 4GCHF 3VG8A 1A5IA 3EYDA 1GHBG 4CRFA 5HYOA 4JCNA 3UQVA 1MZDA 2WV9A 3S69A 1JOUB 4ZROA 1TOMH 3MO6A 1AE5A 2D26C 3E8LA 2H5CA 1QA0A 2IJD1 2AHME 2R9PA 2Z9LA 2W6JD 5DP3A 4Q80A 4UE7H 1KLJH 3F0PA 4AG1A 2FOEA 2CHAB 1DY8A 1YYY1 4B71A 3TVJB 1OHHD 3PTBA 1AUTC 1UHBB 2WZQA 3FO8D 2FOCA 4TPIZ 5DP7A 3LIWA 2ZCLP 4IC6A 3RUOA 3RXQA 4AFUA 2UUKB 1LHDH 4I7YH 4HTCH 1W10U 4OS5A 1B0EA 2XBVA 3QK1A 2ILNA 1C2IA 2FPZA 3N99A 1WTHD 2NWNA 3P6ZB 3Q77A 3MO9A 1O5DH 3ATLA 3EE0B 1YCPH 1F5KU 2W3KA 1O5BB 3RXVA 3VB7A 5DN6D 2HNTF 3TJVA 3PRDA 4KKDA 1DPOA 5JBCS 2WYGA 1CT0E 5TCAA 1SGQE 3SQEE 1HJAC 3NK8A 3SHAH 4LXBH 3LC5A 2ZU2A 7KMEH 1QHRB 4CRCA 1GJ7B 1UTPA 3SGQE 1YPKH 3RU4T 2AGIX 4VGCB 4CR5A 3ATMA 5EQQA 1LVOA 5EGMA 4MTBA 2BD2A 1UTOA 4LK4A 4NIVA 3G01A 1GVZA 1YKTA 3UR9A 5JDUB 5A2MH 1V2JT 3MH4A 4BAOB 1ZJKA 2G5VA 1AKSB 2ZP0H 4YT7H 3SORA 1TNGA 1HUTH 3SJKA 2OTVA 1C4V2 1TMUH 3BTME 4GLYA 1DICA 1RTFB 4UFGH 5H4IB 1YF4A 3FZZA 4DIIH 5T6GA 2BDCA 1AWFH 3OAAD 4F4OC 5JBAS 3URDA 4B2AA 2CK3D 1D6RA 2RA0A 3DFLA 4XBCA 3UIRA 1GCTB 4AN7A 2KM0A 5C1XA 1GI3A 4JZIA 3BSQA 1SLXB 1Q3XA 2ASUB 1OYTH 1T32A 2QXIA 1AI8H 5A0BA 1ELBA 1Y3VA 1AVWA 1IHTH 1A3EH 5C0UA 1DSUA 1FY3A 1SBWA 1C5LH 1O2MA 2SNVA 1TBRH 1MD7A 1SGPE 2CXVA 4O03A 4OS7A 1VITH 2ZFRH 1GHAF 5CHAC 5E2PA 3RC5A 3UNRA 2FYRA 1C5YB 3MNBA 3I29A 4K1EA 1O30A 1QRXA 4THNH 1DOJA 4H4FA 1SGEE 2FO9A 6ESTA 5GWZA 1AZ8A 4FUHA 1C1TA 1XVOA 4K5ZA 1IQNA 3ODDA 2I6QA 4GHQA 1O2ZA 1GL0E 1QURH 1TX6A 1FMGA 2ZFQH 1PQAA 3OTPA 1TX7A 1ZJDA 3H09A 1O3HA 4ZXYH 4BTUB 1N6XA 1BITA 1AIXH 1ZR0A 2ZDMA 4HI3A 3L3TA 4Y71A 3MU0A 2GX4A 4A7IB 2FXRA 2ZDAH 1KLTA 1E1QD 3MHWU 1N8OB 4IGDA 1O2KA 2LP6A 2ZKSA 3IWMA 3P17H 3MH7A 3NZIA 1LPGB 3F3BA 4KGAA 5L30H 1AFQB 3SNCA 2BDYA 4CRGA 1T8MA 2EI6A 1K1JA 2ZTYA 4DCDA 2BQWB 4GUXA 1LTOA 1CT4E 1BRCE 1O2UA 2F9VA 1GBBA 1VITG 1XUHA 3I78A 4B76A 2ODPA 2YMSB 1MZAA 1SLUB 2B8OH 1EOLA 1G3DA 4FOUC 1KXFA 4IN2A 1P9UA 5F8TA 3VGCB 4CHAC 3PWBA 2W7SA 1GDQA 1YC0A 1H8IH 1SFIA 1BCUH 2W5EA 1NFXA 4J1YA 1HNEE 1EQ9A 1QQ4A 3MH6A 1PPBH 3KEEA 4AZ2B 1FY4A 4K8BA 1VCQA 3MFJA 1NU7B 2KX4A 1UTMA 2OQ5A 2XC5A 1ESBA 1SHYA 2G00A 1UTQA 2XNIA 1F2SE 1S0RA 1FAKH 4K2YA 1FIWA 2BX4A 4X1PU 1L1GA 1J9CH 1P04A 3N7OA 5BPEA 1KXBA 1EASA 1O5EH 2EI8A 1FI8A 3O8BA 2PP6A 1O2TA 1TRYA 2H9TH 5DJ7A 2WPJS 3SV9A 5PTPA 3T27A 3HK3B 1GJBB 3BEFB 1YY3A 1TB6H 1DANH 4NWKA 4Z1MD 1YPHE 4HZHA 4CH2B 1OWKA 2ZPRA 1O37A 1YCPK 1T8LA 4NZLA 3T2NA 1O2XA 3M61U 1ARCA 2FOFA 1K28D 4CRAA 1GHZA 1BTYA 1SQRA 4I86A 3F9GA 2Q6GA 2PSYA 3M3SA 1EUFA 2GD4B 1YCPM 2BY8X 1F7ZA 1A5HA 1NRRH 3ZVBA 4OM9A 1BBRE 1TQ0B 2WPKS 1FUJA 2GVFA 2BQ7B 1XUKA 2ZDKA 4NSVA 4OS2A 1CA0B 1HAVA 4WXVA 4BANB 2VJ1A 2FIRH 1MABB 1QQUA 3NRLA 4ABFA 3MO3A 1W0JD 1DY9A 4X1NU 1C9PA 2QF4A 5DKMA 1Y5UT 1COWD 2A1DB 1YLCA 2KR7A 3PV5A 1XUIA 2C8WB 2HPQH 4E06H 3TK6A 4M9FA 5ESTE 1ARBA 2C90B 3RLWH 2Z3CA 1ZGIA 4R8TB 1S85A 3W94A 1RTKA 2G55A 1SGTA 1GI8B 4CREA 1GHXH 3RXRA 2FX6A 1NRNH 4U01A 4NFFA 2ZDVH 1C5RA 5HM2A 3FVFB 1P05A 8ESTE 4ZCNA 1ORFA 1NT1A 2KAIB 4XDEA 1GMDG 2D8WA 2FMJA 3Q3YA 1C4U2 1ZTJA 1D6WA 1Z1IA 1AGJA 1OWDA 2ZHQH 4K1TA 3RXEA 1G36A 4INKA 3RXGA 1V2LT 1K1IA 1GMHF 4FUEA 3GICB 4BAKB 4SGAE 1WAYB 4A92A 5DP9A 1A0LA 1HAPH 1HCGA 1SKYE 2F9NA 3SJ9A 3SU2A 1G3CA 4X1RU 1D4PB 4IMZA 2GDDA 1MKWK 4AG2A 1P2QA 3TLOA 1TNLA 4IC5A 2Z7FE 1BUIA 1GBFA 3PMAB 2Y82A 3ZZ4A 1P2KA 2JETC 4DT7B 1V2QT 6CHAB 3U8OH 1SGIB 1GBAA 3Q3XA 1O5CB 1IQGA 1O2NA 2Y5HA 1PFXC 2ZQ1A 1O3AA 5ABWA 1C5SA 1NPMA 1FONA 4TT3D 3SBKA 3VXFH 3ZZ7A 2Y5FA 2G51A 1KXDA 1TLDA 5T3HA 4U30A 3ZYDA 5F8ZA 4MPWA 2LPRA 1RXPA 4X6OA 1CU1A 1ZTLA 3S9BA 2XRCA 2Z94A 3A7YA 1FPCH 3FP6E 1DT2A 1LCYA 1TNHA 1LPZB 2BB4A 2Q6DA 1UVTH 3ZZ3A 1GBDA 3E16B 2BDHA 2P95A 2Y80A 1H8HD 1GBJA 3BTDE 1HAXB 2ZU3A 3B23B 2FI4E 3LH1A 1QL9A 3MNSA 3UUZA 1K0HA 2G5NA 2G4UA 4O9VA 1WQVH 4CRBA 1WXRA 1ELGA 3QGNB 1P2IA 3DA9B 1LQEA 1ZOMA 1MH0A 1ZTKA 5GCHF 1BA8B 1HAIH 3FAOA 4NG9H 2Y6TA 4XOJA 4D76A 3A88A 1INCA 2SGFE 3RXHA 1GCDA 3S0NA 2BY5X 2THFB 4WH6A 4Y6DA 2QXGA 1B7XB 3KQCA 1O2PA 2RA3A 4IBLH 2A4RA 1CHGA 1QB1A 4XRNA 5E0GA 5JYIA 3LU9B 3RXUA 4AORA 1MUEB 2ANKH 1J14A 2FTLE 3ZZ6A 2QIQA 4UFDH 3SJIA 2P8OB 2F43B 2GJGA 5C0TA 5FCRA 3OEED 3AASA 1C5PA 1F0UA 4KTSA 1O35A 1TAWA 5ETXA 3LKWA 3DCLA 4ZKSU 1GHBF 4B2BA 2QXJA 1C1UH 5DG6A 5IK2D 1GBEA 1SOZA 3P8FA 1C2GA 1AB9B 3T5FH 1W0KD 2OBOA 1IQJA 1M9UA 3KQBA 1GMCF 2UUFB 2CHAC 1O3KA 2PTNA 3KYFA 2H2ZA 3E91A 1TX8A 1SLVB 5HXFA 5B6OA 1AHTH 1CHOG 2P8OC 1MTUA 1O3PB 4AX9H 1TMTH 3BTHE 4HG6A 2DE9A 5FX5A 2L6OA 4KELA 2FOGA 1UTJA 1BTHH 1NBMD 5EG4A 1EAUA 3S9CA 1O31A 1GI2A 1TWXB 3C27B 1TRNA 2G52A 4F49A 2A5AA 3ZVEA 3OY6U 3AVZA 1J15A 1BTXA 1JXPA 1ZRBA 2J4IA 4DGJA 4FUJA 2BLVA 1GBKA 5C1UA 1MTSA 2XCNA 1AD8H 4AGJA 1QTFA 1L4ZA 4DJZB 5EQRA 4I32A 3SU3A 3ODFA 5C2ZA 3UNQA 1GJ9B 1O3BA 2BYAX 4IS5A 2BY7X 1V2NT 2ULLA 2J2UA 1KSNA 2EQNA 3RM2H 3ATKA 1V6DA 2EI7A 4DW2U 1SQAA 5AFYH 2BVSH 3A82A 6CHAC 1C2FA 3KF2A 2FODA 3SW2B 3UFAA 4CBOA 2ZHFH 3KQ5A 1UVPA 1C2DA 5GDSH 2FEQH 1IOEA 5HGGA 4MG3A 1O38A 4WJG2 1BHXF 4ISOA 1Z6EA 2AEIH 3FZDA 1O5GH 2J92A 3IG6B 3QZQA 1RRKA 1CGHA 3STJA 3GCTG 4TSFD 1RS0A 3S9AA 2A32A 1BDAA 1YPGH 2F91A 1PPGE 5GJ4B 5HKKD 3NKKA 1LVBA 3BTKE 1SMFE 3M5NA 1Z6JH 2F9UA 4AYVB 4WWYA 4A1VA 1EX3A 1FN6A 1Y59T 4UEHH 2J34A 4MLFB 1NC6A 1TFXA 1X7AC 2J98A 1FY5A 2V3OH 2AS9A 4XSKU 2A2XH 1DM4B 2P59A 3KHVA 1O2LA 1BMLA 2OUAA 1C9TA 1TGCA 4KTCA 5FPYA 2H9EH 4UONA 1EATA 2V35A 2ANMH 3ZVAA 3A85A 1LQDB 4Y7AA 4UDWH 2JH6D 3GY2A 3VPKA 1CVWH 5IYTA 2A5KA 3QLPH 2QC2A 1A0JA 1C5XB 1AY6H 1C2MA 1O3DA 1KDQA 3BTTE 3PV2A 3PV4A 1ACBE 2HPPH 3FN8A 3V12A 1ETSH 2OQUA 4A5TS 6GCHG 1QNJA 2BOKA 2WSSD 1OXGA 1XKAC 3RDZA 3GY8A 1KLIH 1V2OT 2P3TB 4WMEA 4GCHG 1O3IA 3M36A 4Y11E 2GMTB 1GJ8B 3F2GA 4ISIH 1LDTT 2PKAA 3TPIZ 4Y76A 2BDAA 2QF5A 5F03A 2CV3A 1LVYA 3TNSA 1A4WH 1O2HA 4ABEA 4JYVH 2XBYA 2FM2A 3PMHB 2UWLA 2ZFPH 1EPTB 1ZHRA 3F68H 1XM1A 3RXKA 2YOLA 2BD9A 1ANDA 3H5CB 5KECA 3SN8A 2A2QH 3KQEA 2O8MA 1YPJH 3BTEE 1EJNA 1ZSLA 5DP6A 3M7UA 1BRAA 4Q7ZA 5E2OA 3N7DA 3AAUA 3NCLA 3DSPA 2JH0D 2IJOB 5I25A 1G32B 2G81E 3BTWE 4RKJB 2PSXA 5LGOA 2JIZD 4Y10E 4PROA 5F8XA 3ZZ5A 2VINA 1SPJA 3ZVGA 1GJDB 2Z9IA 1SHHB 5DPAA 4U32A 1Y3WA 2VVCA 1IQKA 1SGFG 4XE4A 2VIVA 2FTMA 3F2FA 2V0BA 3TH4H 2ODQA 4AFQA 1O5FH 4TY7A 2WPHS 1QFKH 4CH8B 4X6PA 4CBNA 3OE7D 3RMOH 2BTCE 5EOKA 1S0QA 3GYLB 1DXWA 2A4QA 1C1VH 3D49H 4X2VA 1GMHG 4QT8C 2FI3E 1FY1A 3T25A 4A6LA 4AOQA 1KMHB 3EE7A 2FDAA 3SU1A 2OC0A 1TGSZ 4MPUA 1UCYH 2Z6BD 3L33A 5HIYA 1OP8A 3A86A 3TITA 5EXMA 1BQYA 1Q31A 1OOKB 1C4Y2 1O2RA 1MKWH 4MPXA 1GMCG 2P94A 3GOVB 5CHBA 4ABIA 3A7XA 1G3EA 1HLTH 3O8CA 3A7WA 2ZDLA 3BTGE 4HGCA 1TQ7B 2D2DA 3SU4A 3SUDA 3E0NB 1GGDC 2FESH 2TGDA 1P8VC 3BG4B 2FX4A 1QL8A 2ZPSA 1YP9A 3H7TA 1TNIA 1IQEA 3JZ1B 4ZHLU 1EAXA 5HMAA 2HNTE 1LHGH 3WWFA 3U8TH 5CHAB 1S6LA 5FL7D 5A0CA 2R3UA 5C17A 3RP2A 1MBQA 1XVMA 1G30B 1DVAH 2QF3A 2J9NA 3OY5U 2ZGXH 1O3EA 3SI3H 1O2YA 2CJIA 1FPHH 1TRMA 1EFRD 1SGCA 2J5UA 1YLNA 4RT1A 2ALVA 2FLRH 2XBWA 4Y0ZE 3SJ8A 2ZHEH 1N6YA 1H8ED 2IOTA 3D23A 4X0WU 1EB1H 3EA9A 3SOSA 4K69A 3FP7E 2RDLA 5K7RA 2KCYA 1SQOA 1TONA 1MQ6A 3R3GB 1E79D 1SSXA 1W3CA 1GJCB 3ZZ9A 1D3TB 5CDFE 2XWAA 1L4DA 3DHKH 1ELTA 5DO4H 1O34A 3TJUA 5SGAE 2O8UA 1GBTA 1NN6A 4Q4LA 2ANWA 2YMSC 1T7CA 2JJ2D 2BMGB 1W11U 2Z9GA 3E1XB 2A45B 3RXMA 1FY8E 1PQ8A 1GHYH 1AKSA 1NFYA 1OWHA 2HLCA 3A87A 3RXDA 7GCHF 2J97A 2GCTB 4JMYA 2PR3A 1G9IE 5ESBA 3MYWA 3SUFA 1AQ7A 1L0ZA 3AK5A 3MWIU 1TOCB 3H7OA 2A4GA 1TIOA 2OP9A 2JKHA 1A46H 3O8DA 3M3TA 3RXJA 1ELEE 2GV7A 9LPRA 3URCA 2OD3B 3F9EA 1WYKA 3M7QA 3EA8A 1DLKB 1KXAA 4SGBE 1MKXH 3SU0A 2ZF0H 4O97A 4JK6A 3RXCA 1NU9A 1P2NA 4I8LA 2KZ4A 1HXEH 1MTNB 1BMAA 1O2JA 5FX6A 1S84A 2ZGCA 1AO5A 1FX0B 1V2TT 2ZI2H 1EP6A 1O3GA 5EPNA 4Y7BA 3ELAH 2C8ZB 2WUCA 2P3FH 2KCOA 3O8RA 3SU5A 2Q6FA 1S82A 4NA8A 2XNDD 1HFDA 2Y81A 2CMYA 4FVDA 1GI9B 2ZCHP 4NSYA 1BRUP 1BTWA 4WY3A 4H6SB 4I8HA 4FU7A 1C2LA 2M5TA 1N1LA 5TJXA 5JBBS 1D3DB 1ANEA 3AAVA 3SNBA 1W0YH 4BNRA 4JZFH 2OC8A 1BBRH 2JH5D 5J4QA 1CT2E 1VGCB 1BMNH 1WCZA 4LOYH 3DD2H 1RJXB 1UCYE 1IQFA 4Q7YA 1HXFH 3ENSB 4MQAA 2R0KA 1GHWH 2PV9B 3CENA 1CA8B 4F55A 2EA3A 2OLGA 3UWIA 1UTNA 4B1TA 3GY5A 3UY9A 3E6PH 3QN7A 7GCHG 2AGGX 1QJ6B 1V2KT 2FS9A 4ISNA 2JDID 2FLBH 2EEKA 3TNTA 1NESE 3BV9B 2FOBA 2WV4A 3MU8A 2H6MA 3B8JA 3HKIB 2XW9A 2O8TA 1GG6C 3LH3A 5C3NA 5F53A 3NUMA 1IQIA 1HAGE 4ISHH 3SI4H 2ALPA 1HB0B 1ANCA 2HNTC 4LZ1H 1ZPBA 1SC8U 3QO6A 2R2MB 3ZZDA 1E38B 1XX9A 3LT3A 4YT6H 2FOMB 2K0QA 1C1NA 2B9LA 2PUQH 1H9IE 1YPLH 2FWWA 1RIWC 1CSOE 1HIAA 1DWCH 1HJ8A 2PUXB 1C1SA 2BLQA 1QBOA 4D7GA 1A3BH 1KTSB 1C5ZB 1Z1JA 8GCHG 4YTAA 2C4FH 2GZ8A 1VCPA 5DSFA 1DLEA 1W8BH 1DFPA 2UWOA 3E3TA 2QN5T 1ANBA 2CF9H 1AU8A 2Y7XA 1TPPA 4Q63A 2J95A 4DURA 2AFQB 2K8IA 4ISLA 1VJAU 1IHSH 1RTLA 1KYNA 1GGDB 1UJ1A 3E90B 5DP8A 3LGIA 1BB0B 4O3UA
chains in the Genus database with same CATH topology
3KCGH 5IDKA 2R2WU 1O3NA 1NO9H 3UOPA 3KIDU 1GBMA 1OS8A 1QRZA 1VITF 2BHGA 2Y7ZA 4XBBA 1HBTH 2SGPE 4BAQB 3U1JB 4ZKRU 3BF6H 1P09A 4UD9H 1OP0A 2BY9X 1N8OC 3GDSA 4BAMB 2VIWA 5A0AE 1AUJA 1NFWA 1HAVB 1UMAH 3PB1E 1BTZA 1MAXA 1MD8A 1C2KA 4FUGA 3UR6A 1FQ3A 1SGYE 3ZZBA 1O5AB 1OX1A 2BM2A 2VVVA 1NS3A 2ZQ2A 4YESB 1RIWB 1ELVA 2VVUA 1V2MT 1BTPA 1HAOH 2GV6A 1P06A 3D62A 4D7FA 1AZZA 5GCHG 3RMNH 2P93A 2RG3A 2XXLA 1T4VH 2C8XB 1WOFA 5EW1H 1XXDA 3F9HA 1DXPA 1SR5C 5E8EH 3SUGA 4K8YA 2J38A 3BEUA 1NY22 4BTIB 6LPRA 3JZ2B 1P11E 4FU9A 3C1KA 4OGXA 4X2YA 1VGCC 2XC0A 1BJVA 2NU0E 4WVPE 3SNDA 2QV1A 1HDTH 3SV2H 2KAIA 1BHXB 1C1WH 1GMDF 4GSOA 1HAZB 1J16A 1GDUA 1GHAG 3TGKE 4GHTA 1G2MA 1K1OA 1GPZA 1C5OH 4B74A 1AWHB 2ZZUH 2W26A 3F1SB 4E7NA 5LPEA 2ZG0H 1O3JA 2BOHB 1ABJH 2WYJA 4MVNA 3QTOH 5AF9H 2SNWA 3MU1A 2PW8H 2W7UA 2PTCE 2BDGA 5JB9S 4X6MA 1LKAA 1Q2WA 3BG4C 4UFEH 4AB8A 2P16A 1DWDH 4ABJA 1EZXC 2WPIS 3R0FA 1ETRH 2GMTC 1TPSA 3GY6A 4AYYB 1V2UT 2PHBA 1GJ4H 2BDIA 3TU7H 4X6NA 2HVXA 4AFSA 2ZGBH 4RSPA 3RC4A 1P3EA 1O3LA 2TRMA 1VCWA 5A8ZA 4OS6A 4MNXA 2FOAA 1DDJA 2OBQA 2VWMA 3Q3KA 4JK5A 1GJ5H 2VU8E 5TCCA 1P03A 3T29A 4I8KA 1QR3E 1EAWA 3VXEH 4H6TA 1OWEA 2BX3A 1C5MD 3Q76A 2W3IA 4IMQA 1ESAA 1HYLA 1TNKA 3CS7A 1P3CA 5A09A 2SFAA 2VNTA 3M5LA 4NIXA 1THSH 1GI7B 1GJAB 1TBZH 3BIVH 2TPIZ 3SV8A 2VWOA 2C3SA 2K1QA 4D9QA 3A81A 1UTLM 3TH2H 1LHCH 1NFUA 4B2CA 4AB9A 4BOHA 4GPGA 3GCTF 4X8TH 4Y8YA 2P3UB 1NZQH 2BZ6H 1C5WB 4AFZA 2AMDA 4B75A 2WINI 5AHGH 3RM0H 1OPHB 3A89A 1ZGVA 4NCYA 2O8WA 1C1QA 1CBWC 1DX5M 4A1TA 4LZ4B 4DOQA 1PPZA 1BMMH 3NPSA 1GVKB 1C5UA 3A84A 3E0PB 1UHBA 1VR1H 5E0HA 1TNJA 4TYDA 3Q00A 3UQOA 1TGBA 2ZHDA 1OWIA 3ITIA 2HALA 3LPRA 2J94A 1K1MA 1UTKA 3RXLA 5GXPA 1FDPA 3VGCC 4CHAB 1AVXA 1IAUA 1K2I1 2GT7A 2ZDNA 4YOGA 4ZUHA 1SG8B 1ELAA 1F92A 2TGAA 1YPHC 2BZAA 1O3CA 4X1SU 2F3CE 4BXSA 3LJJA 4IN1A 3FFGA 1RD3B 1FZZA 2ZHWH 3DT0H 5DP5A 2BD7A 3U8RH 1V2PT 2F9PA 1ZYOA 3K6YA 1TGTA 4RN6A 4X2XA 1Z8IB 3VB3A 2BXUH 5LPFA 3RU4D 4RKOB 5DK1A 1C2HA 2VGCB 5HM9A 3DFJA 3GY3A 2H1UA 1SGDE 3A8CA 4BXWA 4JZDH 1KTTB 3MMGA 3SZNA 3U9AH 3QGJA 1AMHA 3GCHC 1BZXE 5CMXH 4AGKA 2WV5A 1OP2A 4INLA 5DGJA 3UNSA 2AIQA 5BRRE 2BD4A 1QCPA 1EZQA 2VIPA 2ZCKP 2BXTH 1JIRA 4I33A 1HJ9A 2C93B 2GKVE 3L6PA 3SNEA 1P9SA 3M3VA 2ESTE 1YLDA 5L2ZH 1Z7KA 1NROH 5FBIA 2ZFTA 3V3MA 3TK9A 1ELFA 1SGRE 1CO7E 1SB1H 1V2ST 3OYPA 1F0SA 1EKBB 5C1YA 1K21H 3RU4E 2A7JA 1S81A 1K1NA 4I8JA 1QIXB 2ZEBA 2XTTB 1CGIE 1LO6A 2OCVB 3AW0A 4TY6A 3HGPA 3PO1B 1TPOA 2WPLS 1O3FA 2WUBA 1ZMLA 1JBUH 1QJ7B 2HRVA 2GDEH 2ANYA 3ATIA 3PLKA 3GDVA 1WBGB 4ZH8A 1YBWA 4Y79A 1SQTA 1KY9A 1VJ9U 4ABHA 3F6UH 5G4BA 3UREA 2PGQB 1BT7A 2UUYA 3BIUH 5C67A 2Z9JA 2BDBA 2ZU1A 2VWLA 1PPCE 1XUGA 3NXPA 1RFNA 3U69H 2SGQE 1L1NA 3B9FH 2BQ6B 2VH0A 2D1JA 4WMFA 1QJ1B 2Q1JA 1MTVA 5GIBA 2AERH 1MAYA 3MU5A 4FUCA 2ODYB 5JPMH 3KN2A 3OSYA 3TIUA 1FV9A 1P12E 2JETB 1D3PB 3LJOA 2BY6X 1MKXK 1F0TA 1HJAB 1EP5A 3RXOA 2QF0A 1O0DH 3SGAE 2XCFA 4GVUA 2LNCA 2OXSA 2HGTH 1THRH 1C5NH 2F9BH 4ZKNU 4A1XA 2PWXA 2H9HA 1W13U 4FXGH 4Z6AH 3PWCA 4HFPB 5FPSA 4JZ1A 1FN8A 3A80A 1EB2A 4WXIA 2A7HA 5J4SA 3NWUA 1QBNA 4FUIA 2YNBA 3M7TA 5EODA 1C1OA 4NFEA 4O3TA 2XBXA 1Z8GA 4MNYA 1TA6A 3QZRA 3ZYEA 1CQQA 1FXYA 1JMOH 2GTBA 5LPRA 1EPTA 1UVUH 3T28A 1MTNC 1WTGH 4Y8XA 4BAHB 2F9OA 4R0IA 2QCYA 2TBSA 1B0FA 1O2WA 4B73A 3UOUA 5FXLA 1ZPZA 1MQ5A 1PJPA 1K22H 3GCHB 1CGJE 1TYNA 4H42U 2A5IA 2Z9KA 1GWAA 5F6MA 5A8XA 1W0ZU 1QB6A 1O2GH 3LGWA 1GCTC 1Z71A 2BVXH 2R0LA 1DUEA 1U6QA 1BOQA 1GDNA 2VWNA 2UUJB 2R3YA 1HAYB 5FPTA 8GCHF 1V3XA 6GCHF 1QB9A 3ZZ8A 4FUFA 1UVSH 5C20A 1KXEA 1HPGA 5JB8S 1T4UH 1AN1E 1DUAA 1GBIA 3SU6A 2QYIA 7ESTE 3IITA 2PKSB 1TMBH 1P10A 1ESTA 5C5OA 1IQHA 3VB6A 1DE7H 3ZZAA 2AMQA 1SOTA 1THPB 1FNIA 1D9IA 1LPKB 1PQ7A 4YO9A 3SV6A 1CHOF 1LHFH 1LHEH 1BIOA 1HRTH 1T8OA 3BTFE 2I6SA 1QRWA 3PMBB 2BVRH 3MNCA 1ZHMA 1SL3A 3SGBE 2HOBA 4MDSA 4CR9A 1E34B 1NTPA 2QA9E 3PM3A 2FYQA 1UCYK 2QY0B 1SFQB 3DUXH 2GCHF 3GY4A 3LGTA 1SGFA 3GYMA 3MH5A 3RXIA 3LGUA 3HKJB 3SUEA 3CS0A 3M5OA 4WH8A 2VIDA 3EA7A 3SNAA 4D9RA 1OSSA 3MTYA 1O3OA 1SI5H 1C1PA 3A8BA 1K1LA 1QBVH 2ZWLH 1E36B 1W12U 4YLUA 1TE0A 4OGYA 1BTUA 1P0SH 2OC1A 1H9HE 4TWYA 4YOIA 1J17T 4ABAA 2STAE 2SGEE 3MI4A 2GZ7A 4M7GA 3OX7U 2A0QB 1JRSA 4I8GA 2NU3E 5FAHA 2OINA 3FANA 3I77A 1SGNE 3UWJH 2TIOA 1GI4A 1UK4A 1O2VA 2NU1E 5DP4A 3HGNA 1P2MA 2V3HH 4NA9H 3TGJE 3SJOA 1HV7A 1NRPH 2A4OA 2AYWA 2GCTC 2IN2A 3MNXA 4DG4A 1A0HB 3PLPA 3OU0A 3QX5H 1YGCH 4ASHA 2STBE 3P95A 1RGQA 8LPRA 3D65E 4TWWA 1AFQC 1OYQA 1NRQH 1KXCA 1F0RA 3ZVCA 1EZUC 4DVAU 1WSSH 3T62A 1T8NA 1PYTD 4ZMAH 4WF8A 2FOHA 1MU6B 1GBHA 2Z3EA 3HK6B 3TK5A 1ABIH 1J8AA 5JBTA 3ZVDA 5EPYA 4KP0A 1WV7H 4MNVA 4NGAH 2XC4A 4X8UH 3STIA 4ABGA 3VB4A 1O3MA 3A7ZA 2PFEA 5L2YH 3EQ0H 1C5VA 3LGVA 3K9XB 4JZEH 1BJUA 2G4TA 1ZRKA 1GI5A 1MBMA 2ZGJA 1ELCA 3S7HB 3BTQE 1XKBC 2F83A 3BN9A 1Z8JB 3RXBA 2GP9B 4Y8ZA 2HWLB 5EU8A 2ZA5A 2TGTA 3CP7A 1TBQH 1PQ5A 5A8YA 1MU8B 3VFEA 3QTVH 1P2JA 4Q7XA 1O2OA 2NU2E 1O2SA 2BLWA 3GDUA 2PKSC 1A2CH 2B0FA 4OS1A 1F5RA 4ESTE 1O39A 1CE5A 1HGTH 5I46H 1EJAA 3ZVFA 2ZECA 5EQSA 2CF8H 3A8AA 2SGAA 1W2KH 1JWTA 1S6HA 4INHA 3V7TA 3BEIB 3EDXB 1EPTC 2Y5GA 1GVLA 3PLBA 4JYUH 2ZU5A 1WU1A 3QWCH 3TJOA 2ZTZA 1XMNB 2QAAA 1QGFA 2VIOA 2ZPQA 1UK2A 1Y3XA 1C1RA 1MCVA 3K65B 1BBRK 3LONA 2SGDE 1FLEE 4NA7A 4YLQH 3ZZCA 1QL7A 1DS2E 2A31A 2EC9H 3MU4A 3S7KB 1AVGH 2XWBI 1OWJA 3FP8E 4Y0YE 1B5GH 4BTTB 4Q2KA 1XUFA 1C2JA 1Z8RA 2CGAA 1O2QA 2AGEX 4X1QU 1TALA 3GISB 2VH6A 2AIPA 1GBLA 9ESTA 5FCKA 4DIHH 2B7DH 1GL1A 3KGPA 4I31A 1EXFA 1CA0C 1MMJN 4FUBA 1H1BA 2O9QA 5EXNA 3UTUH 1FJSA 1P01A 3RMMH 8KME2 1QA7A 3A7VA 1LKBA 2AMPA 3LDXH 1WQSA 1E0FD 1Y5AT 1W14U 4MPVA 4U2WA 1IQLA 2G8TA 1WUNH 4NZQA 3V0XA 1MCTA 1HIAB 2XYAA 1XXFA 3ESTA 2ZGHA 1MTWA 2A7CA 1G3BA 1ZSJA 2PGBB 4ABBA 4K1SA 1A1RA 2BD5A 1SLWB 3SQHE 2GT8A 3TH3H 5GPIB 3SHCH 1G2LA 4FVBA 4D8NA 3GCNA 3KNXA 4ZHMU 1C2EA 2DUCA 2YNAA 4NIWA 5T6DA 4NWLA 2C8YB 4ZHAA 7LPRA 1L1JA 4J2YB 1ZZZA 5C5NA 2OC7A 1C1MA 1C5TA 2UWPA 3SO3A 2BLOA 3RXAA 3OTJE 4YOJA 4Z0KA 2FP7B 2ZC9H 2FI5E 5AVDA 3RXPA 1L2EA 5T6FA 1D3QB 2V6NA 1DITH 2O8LA 2ZNKH 1Y5BT 5AFZH 3KL6A 1GI6A 1AE8H 1E37B 3F9FA 4K3JA 1C5QA 3M35A 3LGYA 4X2WA 1GJ6A 3UPEA 2ZIQH 3PO1C 1BRBE 3W95A 1ZMNA 5CE1A 1NM6A 2QGRA 1P02A 1Y8TA 3MOCA 1EZSC 1K9OE 3LOXA 4FUDA 3LC3A 4XBDA 4E05H 2GGVB 1W7GH 2H5DA 4VGCC 1UVOA 1PYTC 1ELDE 1O36A 1ZHPA 3VEQB 5E0JA 4TPYA 1KDQB 2Z3DA 4UFFH 5LH8A 4YM9A 3TGIE 4JYTA 3RXFA 3P8OA 1EAIA 3T26A 3PYHA 4ZKOU 3RLYH 3M37A 3ZV8A 3ZV9A 1LVMA 1PPFE 1O2IA 3TJNA 3WY8A 2RCEA 1H9LB 3EGKH 1V2VT 2B5TB 1K1PA 4DY7B 1PPHE 3RC6A 2PLXA 3QDZB 1H8DH 1AFEH 2PKAB 1JRTA 2VB0A 1VZQH 3A83A 1GI0A 1O32A 2AH4X 1UO6A 4XFQA 1G37A 2ZFSA 4IW4E 1ID5H 2VGCC 4K60A 4X8SH 2NU4E 1E35B 2CN0H 1FAXA 1TPAE 4KTUA 3P92A 1ZLRA 1S83A 3A7TA 2VIQA 4NIYA 1DWEH 5K0HA 4E7RG 1QY6A 1UK3A 3M5MA 4YZUA 1DSTA 1GBCA 1GG6B 2ZU4A 2GZ9A 1V2WT 3K6ZA 3SV7A 1IQMA 1DWBH 2FZZA 4X8VH 1ZSKA 4ABDA 1ZPCA 2WPMS 3ATWA 2BD3A 3P70B 3KQDA 3U1IB 3PTNA 3GY7A 1O33A 1S6FA 3V13A 1SVPA 2ZFFH 1TGNA 3U98H 3VB5A 1S5SA 2DE8A 1XUJA 1V2RT 1TABE 3A8DA 1FIZA 1NRSH 1LMWB 1Y3YA 2IPHA 3BG8A 1ETTH 1P2OA 3HATH 4OS4A 1ZMJA 2GCHG 1GI1A 4MNWA 1AB9C 2ZO3H 1W7XH 1YPEH 1P57B 1TA2A 3RXSA 4WMDA 2BD8A 3K2UA 1JIMA 3GCOA 3PROA 1YM0A 4ZXXH 1GHVH 3AW1A 1HAHH 3RXTA 1H4WA 1T31A 5FBEA 1F5LA 5FHTA 2QXHA 5EW2H 3HPTB 1A7SA 1OKXA 1KIGH 3EAJA 5L6NH 3P8GA 1A61H 2FS8A 1EOJA 2ZTXA 1A5GH 1EJMA 3PMJA 5EXLA 3QUMP 1PPEE 3RMLH 1CBWB 4CRDA 1Y3UA 4FU8A 1YPMH 4GAWA 4ZAEA 3P8NA 2TGPZ 4GCHF 1A5IA 3EYDA 1GHBG 4CRFA 5HYOA 4JCNA 3UQVA 1MZDA 3S69A 1JOUB 4ZROA 1TOMH 3MO6A 1AE5A 2D26C 3E8LA 2H5CA 1QA0A 2R9PA 2Z9LA 5DP3A 4Q80A 4UE7H 1KLJH 4AG1A 2FOEA 2CHAB 1DY8A 1YYY1 4B71A 3TVJB 3PTBA 1AUTC 1UHBB 2FOCA 4TPIZ 5DP7A 3LIWA 2ZCLP 4IC6A 3RUOA 3RXQA 4AFUA 2UUKB 1LHDH 4I7YH 4HTCH 1W10U 4OS5A 1B0EA 2XBVA 3QK1A 2ILNA 1C2IA 2FPZA 1WTHD 2NWNA 3P6ZB 3Q77A 3MO9A 1O5DH 3ATLA 3EE0B 1YCPH 1F5KU 2W3KA 1O5BB 3RXVA 3VB7A 2HNTF 3TJVA 4KKDA 1DPOA 5JBC