3BTXA

X-ray structure of human abh2 bound to dsdna through active site cross-linking
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
204
structure length
204
Chain Sequence
b'ASWRHIRAEGLDSSYTVLFGKAEADEIFQELEKEVEYFTGALARVQVFGKWHSVPRKQATYGDAGLTYTFSGLTLSPKPWIPVLERIRDHVSGVTGQTFNFVLINRYKDGSDHIGEHRDDCRELAPGSPIASVSFGASRDFVFRHKDSRGKSPSRRVAVVRLPLAHGSLLMMNHPTNTHWYHSLPVRKKVLAPRVNLTFRKILL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-ketoglutarate-dependent dioxygenase alkB homolog 2
molecule tags Oxidoreductase/dna
source organism Homo sapiens
publication title Crystal structures of DNA/RNA repair enzymes AlkB and ABH2 bound to dsDNA.
pubmed doi rcsb
total genus 53
structure length 204
sequence length 204
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2007-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13532 2OG-FeII_Oxy_2 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 3btxA00
2FDIA 4NRMA 4ZS3A 4NROA 3O1PA 3O1SA 3BI3A 4NIGA 3LFMA 4IE5A 4QKFA 4NIHA 4NJ4A 4QHOA 3I3MA 3S57A 3I49A 3BU0A 3RZHA 3O1UA 4NRPA 3I3QA 4OCTA 5F8PA 4QKBA 4ZS2A 5DABA 4ZHNA 3H8XA 4O61A 2FD8A 3BKZA 2FDHA 4MG2A 4CXWA 4CXXA 4NPMA 3O1OA 4NPLA 4O7XA 4CXYA 3S5AA 3T4HB 2FDGA 4IE6A 4IE7A 3BTYA 2FDJA 4NIDA 3RZMA 3BTZA 4NRQA 4IE0A 4NIIA 3T3YA 3BIEA 3H8RA 3I2OA 3KHCA 4QKNA 4MGTA 4IDZA 3T4VA 4JHTA 3O1MA 3O1VA 4QKDA 3BTXA 3RZJA 3KHBA 3O1RA 4RFRB 2FDKA 3RZLA 3H8OA 4IE4A 2FDFA 2IUWA 3BUCA 3O1TA 3RZKA 3RZGA
chains in the Genus database with same CATH superfamily
1D2QA 2VNGA 1CAVA 2XJSA 4NROA 4NIGA 2BNMA 2BWAA 2C1FA 4BMEA 3OGSA 1M4WA 2HWD3 4W65A 5LA0A 2PXJA 4E27A 5IK7A 4XAEA 1WBFA 3DYPA 4UW6A 5FYZA 3C7GA 3I4IA 4J25A 5A32B 3S7EA 1IGOA 2CL2A 2A6YA 2GN3A 2N7GA 2V4VA 2LALA 1F5FA 4IE7A 4Q0QA 2ZBJA 4UXAA 1KITA 3DYOA 2VOTA 2W08A 4OI0A 4XF0A 3RQ0A 2HWC1 1QEXA 2PN5A 5D1IA 2BUKA 4QKDA 4K21A 1F35A 1RUI3 3AZXA 5A32A 2E7AA 2DUOA 1FATA 5DAXA 1LENA 1SCRA 3M3IA 4QGMA 2Q8EA 2YMZA 4Y20A 1VP6A 1XYOA 1OFSA 4IEPA 4ZU5A 1F15A 5IVBA 3THDA 4AEJA 2KD7A 2XWBB 4MLOA 3OBTA 4MGKE 1SFPA 5FZGA 2CGPA 1JZ8A 4ZHNA 1RTVA 5JSRA 2RS52 5CFDC 4QDQA 4IEVA 1HIXA 2HWB3 3WNNA 5JPMB 1UOBA 1RMU3 1FT9A 1Z0HA 2VR4A 5JMCA 4P14A 5A6XA 2VNOA 1AJKA 2XBO1 1X7NA 3ATGA 1NQJA 4DOUA 3H8OA 4FOVA 1KDKA 1SBEA 2RDNA 1DCSA 3J7MA 1FMD2 5FYSA 3NJXA 4ATEA 1REEA 2W0XA 1BMV2 4PBPA 1CPNA 2DBNA 2WNUA 1CAXB 2VM9A 4CDXA 4YSFA 2XHKA 1WMFA 2WNOA 4AQ2A 4MHRA 3WG4A 4AFMA 1TME1 3UJQA 5FTTC 4Q4W3 5LZ6A 5KXEA 1WLWA 4FPGA 2Y33A 4N8MA 4Q4V1 5CFDA 3M4FA 3PUSA 1W39A 3V0BA 4BH9A 3LOIA 3GBWA 3H8UA 4IEWA 5APAA 2WNUB 3GYDA 5J48A 1AR81 3LA7A 3WNPA 5FZ4A 1DBNA 1R1ZA 1UF2C 2JD4A 2G19A 3VHRA 1D7PM 1RITA 4FO9A 4JDOA 4Y1VA 5IVEA 4RS5A 3S6PA 1RUE1 3E1F1 3I2DA 4D0QA 5C6CA 4MVTA 3RZLA 5FPBA 5LK5A 3U07A 3WQ7A 1EPWA 2ZGLA 3N9MA 2WAAA 4CTEA 3VBUA 1NZCA 4AVTA 5E1RA 1ULOA 5LY2A 3AK0A 1O7FA 1BEV3 1QQP1 3WHUA 3ZR5A 4B29A 2J1VA 2AENA 1OH3A 5LBEA 2F4LA 1MQTB 1B35A 3ZMOA 1JMUB 1VJ2A 4EZ4A 2JKBA 5BNPC 3O1OA 1NT0A 1XNCA 4EWAA 2QQJA 2BVVA 4DIQA 3KVAA 2YC0A 1G8WA 2WR9A 4IE0A 1QJU3 4IW3A 3TEXA 4FXGB 3KHCA 2EAKA 1YFXA 2QZ2A 3MW4A 1B35B 5H9SA 3EO6A 2BGCA 2YZ4A 4XFBA 4XPVA 1GKBA 1UYYA 3OBAA 3TWIA 1BBT2 1OC1A 2K9ZA 5ACA1 2WT2A 5FZ9A 3IMMA 3VD5A 3ELNA 2WJSA 2QQVA 1D0GA 2UWBA 1JZ6A 4CCCA 4XIKA 2NN8A 3PDQA 4LKSA 5FLIA 5FUPA 5BV6A 2GMMA 5JCTA 3WP6A 2X05A 2W95A 4XYXA 1YQ5A 2FCVA 4AE2A 4QXKA 4CUGA 2A71A 2OVUA 3M3OA 3W9AA 4QX8A 3MF9A 1HXS3 4QM9A 3CNAA 3RMXA 2GNDA 3B9CA 1FYUA 2WWJA 4Q4Y2 5E88A 2VMCA 4CCEA 5FDBA 3DF0A 4AQTA 1XRUA 2WFF2 3VBHA 2ARAA 4AAXA 4XC9A 4GALA 2ZTNA 5CKNA 3WW4A 1MVQA 2C24A 2O14A 1CAUB 2VZRA 5FYCA 4P08A 1H6XA 2ADDA 1TQ5A 4I0AA 2BGPA 1XJAA 2ZKNA 3D6EA 4RS5C 5FZBA 1VBA2 5A3LA 1RJ7A 2Y60A 1AZDA 4R9DA 1U5YA 4G9SB 4BYYA 1OFNA 1LKNA 1T6BX 1UCXA 2GSYA 2SLIA 5FOBB 4MADA 3M2MA 2D97A 1CAUA 5AC91 3ACFA 3WQBA 2R072 1XSRA 3B02A 4DXTA 5C5TA 3CIHA 4IE6A 2LUWA 4JV4A 1ND2B 5I0UA 2R063 2ZAHA 1X82A 1RUE2 1Z7S2 4NMIA 4TLGA 2AGSA 1Z78A 2NYYA 4UW3A 3WD5A 3V0AA 3ROUA 4Q4Y1 3KM5A 1UPSA 1MS3A 3PVEA 2TUNA 1OLQA 4HOOA 1ZRRA 4E4DX 4Y5SA 4ES8A 2WT0A 1HN0A 3FE5A 3LE0A 1HDKA 1FX5A 5ANQA 4FPEA 2YPJA 4BQ3A 1VBB3 1UU6A 2ZS6B 3KF5A 4QKBA 5IK8A 1PM7A 1PIV2 5BNNA 1YNAA 5CB7A 3E5XA 1N3OA 2GC0A 3K3NA 1OF4A 3LIGA 3WQ1A 1FOD1 3I2GA 3NNGA 2MHFA 1OUSA 4E4ZA 5GZFA 1A34A 3FUQA 1VALA 4JRLA 3D82A 5KXDA 4UFLA 2DVFA 2HWE3 1IQDC 4LBJA 4FPJA 4JGYC 4QB2A 1RVF1 1COV1 5CYYA 3ZYIB 4BZ4A 3AZYA 3BODA 2B42B 1JBCA 5GZGA 1F5JA 1VMHA 4QPWA 5C3SA 2BPA2 4SBVA 4IV3B 2RDQA 1H30A 2VCAA 5KWRA 1H9PA 1I6XA 2D44A 2EIGA 4XHXA 5FK8A 3VZMA 1LOEA 5IT6A 2AC1A 5L9RA 3AL5A 3JQWA 2B4KA 4HVOA 2JG9B 3WINE 5BNNC 3R0RA 2ZMNA 1OSGA 3H3UA 4I0BA 4NE9A 5FPAA 3H8XA 2KA3A 4LEJA 4ZXEA 1HQNA 4XQ4A 2WN2A 4AZZA 1GZTA 2C5DA 2R6QA 3GDBA 2JDMA 2OZJA 2GH8A 4HVRA 4Q1RA 4DXSA 1NE4A 2BGOA 2JDYA 2HKXA 4L0PA 2KR2A 3RZGA 2FHRA 4AF9A 2ES3A 1MZFA 1SFYA 3OUJA 3UYJA 4DS0A 3FC0A 3BI3A 5JR2A 4CDUA 4LOTA 5FXVA 5LRSA 2VOKA 2WFF1 1VBE2 2EA7A 2JDNA 1IG3A 3POGA 1RIRA 4M3CB 4C1WA 2R062 4HL0A 4KMQA 4YARA 2Z4FA 5K4LA 2IVJA 3WF3A 4FPLA 4LLOA 2D40A 4LTAA 3AJYA 2IVIB 4CDUB 3GZTB 1ULDA 3JQXA 4FPCA 5FZFA 2AR6A 3HMYA 1FPN2 2IXHA 3ILNA 3U11A 3VGIA 5JUVA 5HCBA 1Q8PA 3G7DA 3CLPA 5JAXA 1MQTA 2XJUA 2NP0A 2VZPA 1QXJA 4RGKA 4BXFA 3O12A 3URFA 2BJSA 3PUHA 3HN3A 4ASKA 1R082 3DN7A 1R092 3WDYA 5JVVA 1FNYA 5A70A 4K1ZA 1RXGA 3OJBA 4BA6A 4HG6B 2QTWB 3AZVA 3E97A 4BIFA 1MR5A 2CHHA 1W90A 4Q5OA 3H9AA 1W6OB 4MHUA 3A23A 5J98B 3RNSA 4DXRA 5FY7A 1K42A 4Y22A 5FRAA 4XIOA 1UN1A 4AFAA 1FPN1 2ZGKA 2D43A 2O0OA 3FFZA 3L2YA 4HXCA 4ATFA 2XJRA 2RMU3 3WDTA 1UO9A 3MIDA 3NNLA 2ZHMA 5AVAA 2JIGA 3CHXA 3ECQA 5LK7B 2VQAA 4Q0VA 1KGYA 1QJFA 2PQQA 2Y6LA 2XWJB 2ZGMA 3H1YA 3PU3A 1PMJX 4YW6A 3N35A 5C9AB 4QX7A 2E33A 3VDBA 1JH5A 2BNNA 5CVRA 1LU1A 3OBZA 1DLLA 2FDHA 5CBLA 4K40A 2WNVB 4FPOB 4CP2A 2MEV3 1OQ1A 2WAOA 3NWKA 1G6NA 2Q0AA 2ZEYA 4BOWA 2CDPA 3SKVA 4DFSA 4CEYB 5JLVA 2ZX1A 3MIEA 1J3PA 3BALA 3WDXA 3ZSKA 2D3RA 4XILA 2VQ0A 4CCDA 4Y1YA 5JXJA 5FIXA 4FOYA 2YPDA 4CEWB 3AZZA 4LHLA 4XE9A 2VMDA 1NA1A 2WNVA 3KV6A 2ZX3A 3BYWA 1UXXX 3TNQA 1H6YA 4YM1A 3I3DA 3OGJA 5IATA 3QBQA 2JE9A 3WF1A 4L99A 1RUC3 1RUNA 2EXHA 4Q4X3 1W6NA 4NVPA 4CP9A 3FLPA 1O6UA 4IUGA 4DY3A 4I30A 3HNMA 3M8LA 2HYXA 5F5QA 4UF0A 5FBZA 3VZLA 4CXXA 2F4PA 2ZKLA 3FBYA 4OMDA 4YYOA 3KB5A 3X29B 5C4WB 3LPFA 4BWOA 1AXZA 1XPWA 3FBMA 1REDA 1VBB2 1IQAA 1YQCA 4LIUA 1CIWA 5DPNA 4AHZA 3NMBA 5FFOC 2ZGTA 1K3IA 4HK9A 4UF0B 2P37A 5L7OB 2AEZA 4AHXA 3MIFA 1ZZ6A 5KHJA 3Q9OA 2V5YA 5GZCA 1QH7A 1LESA 5J09A 2VBBA 2VZVA 1AYN3 1EAH3 3NKGA 1DU3D 3PJYA 5KHIA 3W20A 5FYTA 4L8QA 4XXPA 1XE7A 2VAUA 2Y6GA 4D6SA 5L7OA 2BU9A 3AVSA 4IEZA 2WS91 2HWC2 3NNFA 5JXHA 2WDBA 4NPLA 4MGYE 3ZYHA 3VBRA 5DUXA 2J7MA 4BDVB 4XUNA 5JSPA 4GAZA 4IV3C 1S0IA 5LRRA 2PA7A 5FPXA 2VH9A 4CCOA 4LK6A 4ZKTB 1PHMA 2JXAA 2Q4SA 2WYSA 1RB8G 1UD1A 4XHBA 1TMF3 4DUWA 2WKKA 1GZWA 2C9KA 1POQA 4COWA 1L3JA 1GYKA 1NA1C 2DDUA 1MS5A 2WNVC 2VW2A 4MXVA 2WLQA 3WQ0A 2VO5A 4BQWA 5CEHA 1VRH3 4BQ1A 4FXKB 3ZR6A 1XYPA 3THPA 3VDAA 1ZZ7A 3DUIA 1GZWB 2FMDA 1Z7S1 5LY1A 4WM7A 3PL0A 2B7YA 1FPN3 3PIJA 5JI7A 3FL7A 1W8HA 2RM22 3HNYM 3N7MA 5A6QA 4B7EA 1W0OA 3CJIB 1OI6A 5IVVA 3RI9A 3OD0A 2GH2A 2HWD2 2XKOA 3VBOB 2WZEA 4B7KA 1ZA7A 4HN1A 1WD4A 2WIIB 5EP9A 1HJFA 2BP6A 3NJVA 2RS33 5I8SA 5KHGA 1NCQB 1LOFC 3HWJA 4YM2A 2UURA 4GZ9A 5IAXA 3E6CC 2WRAA 5I8YA 1NLRA 4JTOA 1VB2A 3N9PA 5C4WC 5FYHA 3MO4A 5DN2A 1AX1A 3IDEA 2VNRA 1COV2 3IIIA 4KBZA 2ZEWA 2CWSA 3CMGA 1W8UA 3TOJA 1MS1A 1RL3A 4HK8A 3I3BA 3AP6A 4IGOA 3JU9A 3W5NA 3UGHA 1IPJA 4PF5A 2WQ4A 2RS32 3OTFA 4N7IA 3VKOA 4K7JA 3MLJA 1F8VA 3MLLA 4DRRA 2WQ8A 4DMIA 4HKWA 1PGL1 1NX9A 2JE7A 3VL9A 3MW2A 4LA2A 4CUBA 4LLFA 2GMEA 1S0FA 4H2AA 5DG2A 2EIDA 3M3QA 3O1RA 5FZMA 1R083 2OA2A 2VUJA 2J1AA 3MYXA 4N7UA 3LD8A 1MS0A 2VOVA 2VZ1A 3SISA 4JDNA 2RR12 5ACA2 3ACGA 3M1HA 5CZKA 2W9XA 2NMOA 4IE5A 4U36A 5JMOA 1RUD1 3U4SA 2DU0A 2VXRA 4RYDA 1Q43A 4NRPA 1ZZ9A 1WCUA 4AI2A 1GMMA 1E57A 2QQUA 3LQCA 2J1EA 5LATA 3MFAA 1JN2P 1KEXA 5F5IA 2ATFA 4EWDA 4OFGA 1TMF2 5DG1A 4UFIA 2VOXA 1AL22 2JDUA 4RSUA 3O0VA 3JUUA 3EMRA 1ZNPA 4W4ZA 1YRZA 2ZEZA 5JZGA 1Y9QA 2UYBA 1LOAA 3Q8BA 2E7TA 3GF6A 4IEYA 4NR1A 3T0DA 3BUCA 4RGAA 2ZHKA 3AKRA 3I2JA 1QMJA 1H2MA 5IVJA 3UGFA 4CCJA 1CAXA 4CDXB 4WVWA 2EALA 4WM7C 5FP3A 1AYN2 4FP2A 1HRI1 2A70A 3NV3A 4A45A 1CQ9A 4CEWA 4AVVA 3CBNA 2QFEA 3K48A 5JIAA 3Q8FA 1NCQC 5FZIA 4COYA 1H2KA 3IM0A 3V0BB 5B2GB 3EHKA 4AFCA 2GC3A 4GMP3 1TVGA 3FZ3A 4WVMB 4CP9B 3D0JA 4XABA 5L19A 1CJDA 4K1YA 3LIHA 1NG0A 2XJQA 3AL6A 4YFWA 1UW8A 2W87A 3AKQA 4UYBA 1O4YA 3BOWA 5BXXA 1UMIA 4R9BA 4TWTA 3WNMA 2WINB 3WZ1A 5BY5A 4LBLA 1RUOA 3HBKA 1BBT1 1AXYA 2YGLA 3VBFB 3MUZ1 1MS8A 3TN93 4RL7A 4QHOA 1KDMA 3N3HA 5IVCA 3ASIA 4Q4X2 3O14A 2VMEA 1AR71 3UK9A 4I3GA 1KQRA 4GH4A 4KWJA 4YM0A 1YJKA 2HEWF 4Q4Y3 1XNKA 5FZ8A 5H9QA 3T4HB 2VY0A 3POFA 5D8AC 3TBDA 1LNSA 1US3A 1VMFA 5T5JA 2ZAAA 4KG0A 4ITCA 2JJ6A 3H3LA 2RG4A 5EJZB 1C28A 3PURA 4BQ5A 1AR73 1RVF2 3SH4A 1W2TA 1LJ7A 2JDHA 2BVBA 4AOCA 3WNLA 2YDEA 4AI0A 1ODNA 2AREA 1HX6A 4ORFA 3A21A 4XF4A 3VBRB 1ZBE2 4TYSA 4FPKA 1BBT3 4R52A 1LHUA 3T2QA 2YY1A 4TLFA 3VZJA 2X8KA 1WW7A 2DBIA 5HBAA 2FZ2A 2HWF3 3SH3A 2D98A 2W1UA 1HV1A 1UYZA 4PIXA 2JG9C 3I3EA 4F3JA 4GMP1 1UY1A 3EBRA 1HQWA 2ERFA 4XF1A 3NV2A 4HSLA 1DP0A 5CIRA 2EIBA 2ZGOA 3LZZA 2VVFA 1JOPA 1XNBA 3HIFA 3JB8A 1YFYA 3LB9A 3ENRA 3ZDSA 4Y4YA 4COZA 2R7EB 4MGSA 3O1VA 3KHBA 4LO6B 3FJSA 3AP4A 3AZWA 3IKWA 4BQ2A 2DURA 3THCA 2RM23 3D8CA 2IXCA 4EN0A 1SLIA 3B00A 1W8NA 4BM8A 4D3WA 2GALA 4N43A 1AX0A 3NJZA 1DFQA 3VKMA 1YXWA 3VKFC 1BHGA 1DGRN 1BLZA 1VBD3 2XOMA 3KCYA 1JYWA 2XR4A 3TAYA 2PHUA 1VRH2 5FJHA 1U5XA 1YQ6A 2FMYA 4GMP0 5F6KA 1O3SA 1O59A 4XJAA 2I45A 3SCFA 3UGGA 1NCQA 4TXWA 2JG8B 4R8HA 5CKQA 1I5ZA 3CKHA 4LPLA 2PHLA 1YLLA 4DY5A 4QT6A 3PMSA 1PMHX 2CGOA 4B1MA 1V6KA 4S2HA 2YUEA 1NKGA 3BCWA 3AFKA 1DYKA 2W91A 2DUQA 1GNYA 3GALA 1G9AA 3LA2A 4DINB 1J84A 1IG0A 4N53C 3WG1A 4PI2A 5CFCA 1RJ8A 2BOIA 3VD7A 1D4VB 1CAVB 3O0WA 1VR3A 3BU0A 4IV1B 3PUAA 5LWBA 4AEKA 1JU4A 1LECA 3VD9A 1ZRCA 1VLNA 1QNYA 3G6JB 3KF3A 2ORZA 2R16A 2XXZA 2A7AA 2B5HA 2WA3A 1APNA 2XQRA 1X8EA 3P3NA 1AR83 3NAPA 4XAAA 2BYVE 3BPSA 4GWJA 2OW4A 4YG0A 2TBVA 5EJ3A 5F2WA 3RS6A 3H7YA 4B4RA 3ZYJB 5T52A 5CG9A 2WL1A 1CR7A 2PHDA 2WC2A 4JAAA 4Q4V3 4QDRA 4DRVA 2VQUA 4WVVA 4P9IA 4XJZA 4YW1A 1HRV2 2IUWA 5IJRA 3ZXJA 1S55A 2OQ7A 3K75B 1EPZA 3TYJA 4IV3A 5AC92 1JZ3A 4NRMA 2OKXA 4MGIE 4CPBA 2G4IA 2CAUA 5A7QA 4FSJA 2XL7A 2YHJA 2JG9A 3MUY1 2B45X 2JD9A 5FZOA 2A3WA 1E5SA 2A73B 5C9AC 3R6SA 5FPUA 2QQPA 3BOPA 1LOBA 4QQOA 3VHPA 2XQXA 2PAKA 3NV1A 1AYM2 5J36A 1RMU1 1S0DA 1RUG3 1YC61 4FQ4A 2WNUC 2VBPA 1LOCA 1OLME 4EN6B 1ULCA 1XSQA 2D6LX 3KCXA 1DG6A 2P3IA 4XUTA 1BK1A 4C8DA 1JYVA 1IPSA 2BERA 2R49A 5KXBA 3P3PA 1WA6X 1AR82 3J26N 2QUOA 4PT6A 4Q4V2 3O1PA 2EXIA 5FZAA 3UETA 4G4FA 4KU7A 3CO2A 2BV4A 2RS13 2XJVA 3GCXA 4RR3C 3ZSEA 4EROA 5F3CA 1BJQA 3ZFGC 1TNFA 3BGAA 1HB2A 1RUI1 1RUH3 3B3QE 4M0NA 4NHXA 1GNHA 2RMU2 2WWUA 2W1WA 2Z5WA 3LDKA 1W8WA 4S2FA 5D8AB 1CVNA 2P2KA 2R0HA 3CZUA 3LKJA 3P5BA 4AEDA 1UZYA 3SMHA 1ENQA 3AYAA 3PNAA 4MYEA 4BQ4A 5KHKA 3MFCA 5F3GA 2Y6KA 5JZGB 2NM1A 2SBAA 1QWRA 4OHXA 4RS5B 5GALA 2XHNA 3PLQA 1JXNA 4QX1A 4UFKA 2JDKA 2W52A 2ZMLA 5B4NA 2QVSB 5CA6A 1OKQA 2J1TA 3DYMA 1HB1A 3WV6A 4AI8A 1ZA4A 4P9GA 4COUA 4AEDC 2P6HA 1AHSA 4NJ4A 5EPAA 3USUB 3VBUB 2JECA 4PLOA 2PYTA 4DEQA 1ND3A 5FZEA 1W3VA 3ZYRA 4LBNA 1PZ9A 5DZGA 2B8MA 1L7QA 1W2OA 1OA2A 3E6BA 2X29A 4CEWC 4CU9A 3DPRB 3JB4C 3OY8A 4YW5A 2P1BA 4QXBA 4CU6A 4XJUA 5F3EA 3I2OA 3RWNA 4UI9L 1G9FA 1RINA 3POIA 3GZEA 3GZAA 4Y22B 5EZWA 3ST7A 1ND3B 1ODMA 2VL4A 3EQEA 3IDAA 4OULA 2GZWA 5FY4A 3IPVA 1PZ7A 2DCJA 3N7LA 1I9RA 3DEMA 1RYYA 3ZN5A 1H8TA 3TRSB 4FBFA 1WLDA 4PHZA 4MXWA 4A2UA 4UOJA 3HAGA 5F6LB 1YYNA 3DPRC 3T1LA 3RZHA 3IPVB 1YI9A 5FBJA 1NCRB 4L92A 1H1IA 4BLJA 5IHRA 1IZ3A 1N1YA 1J58A 1WLTA 1VAVA 3ZIWA 1UU4A 2VVDA 3N9LA 1CPMA 4FFHA 4N43B 4EN7B 1C1FA 3LFIA 3WHTA 4XFAA 2DCKA 2CYFA 4QDSA 1W03A 1MQTC 2JENA 3WX5A 4I01A 1ONAA 1ZBE3 2VMGA 3ALQA 5FMOS 3WNXA 3VBHB 1IOAA 3FN9A 2A6ZA 3GHMA 3MBWA 4MV2A 2X10A 4NHMA 2XMLA 3NL1A 1HW5A 4J1XA 4LE4A 4GWIA 5LASA 3K2OA 2ZHLA 3APBA 4KGQA 2JB8A 4LIVA 4D8MA 5ISLA 5FP4A 2B9VA 3W59A 5I91A 4C91A 5FO9B 3RYPA 3VV1A 2P6CA 4CXWA 1W0NA 1DF0A 4BU2A 1POV3 4A41A 3VHOA 2DCYA 4QD2A 5E16A 3B5LB 4WZCA 1ENXA 1ND2A 3T0BA 4DPNA 3C8XA 4AYUA 4COVA 1UY3A 3TN92 3HVDA 1G9CA 1UYXA 4QXHA 2VMIA 4IEXA 4IV1A 3DECA 2C4XA 4QPYA 4AGVA 1KS5A 2BOJA 2W2IA 1P8JA 1R1A2 1JI6A 1QXPA 5FY0A 5C8CC 4H14A 4LR4A 4QGLA 5FP9A 3DL3A 3TEYA 1KJLA 1GR3A 4PCRA 4UW4A 5IUQA 4O65A 1ND3C 2JX9A 1I1EA 3CJIC 1GOGA 5BNNB 1LULA 2HJIA 3ORJA 2P3JA 5FOJB 2QQIA 4ASLA 2XONA 2GDFA 1GLHA 1XE0A 4GKYA 4YG6A 4XDOA 5I93A 1WZXA 1D4M2 3A0NA 3S7IA 4OZOA 4H3WA 3OPWA 5SV5A 2BW8A 1LTEA 2BBAA 1R64A 1RMU2 4W6YA 1R1A1 1AL23 4YZ4A 5GLWA 5JOZA 1OXCA 2Q1ZB 4RR3B 1W9FA 4AVAA 3O1SA 3MHZA 3CF6E 4RHV3 1O4ZA 2FZ1A 3LEKA 3RDIA 4RA0A 1QJX1 3OEBA 2BQPA 1TG7A 2FD8A 1PZ8A 3AYEA 1RUF2 2V5DA 4WM7B 3DCQA 5KBFA 4RR3A 2W1QA 3ZFEA 4Q0PA 1I3HA 5A3OA 1YJLA 2A3XA 4NHYA 3T2TA 4LHSA 3MV11 4LUKA 1QJZA 2YGMA 4QKNA 4HKLA 3K4DA 5FAXA 5FV3A 2UY9A 3T1MA 3PTYA 5BNOC 1ASJ2 3IWZA 2VMFA 4CRQA 4RFRB 5LEKA 1SEFA 5BYNA 1WMEA 4M0HA 4URAA 2PHTA 3A0KA 1NUKA 3AP9A 3H0OA 5D8AA 5EYYA 1MZ5A 3HBZA 3JBG3 3I54A 3NQHA 4CDQB 5K8SA 4GIQA 3ILRA 5DAPA 2VOWA 2TNFA 1IS6A 2DVBA 4JKKA 4CU8A 1DZTA 2PLV3 4YZ2A 4FI9A 1POV0 4MZUA 4XTPA 4XUOA 1X9PA 1COV3 1E5RA 2VW1A 1KFXL 1E5HA 1V6IA 2IXLA 2WA4A 2HWE1 4UWDA 4FQZA 1YEWA 2I74A 3FHIB 5HCHA 2D93A 5FZ7A 3AMQA 3GGLA 1XXNA 1UMZA 3MPBA 3USUA 4XFIA 2VGDA 1W0PA 2PLV2 4BB3A 2OX0A 1SLBA 3I8TA 1XU2A 2WUHA 4XTMA 4ZY9A 4AW7A 3HT1A 1AR92 1VBB1 5A7NA 3R4UA 4UFJA 1K5MC 3T2OA 3VBSA 1S1AA 1NLQA 4LUMA 1H1AA 1W6QB 3OY8B 2DYCA 2PAMA 3CEWA 3GCWA 3GNEA 4YLZA 5FPZA 5I8TA 1PGW1 1ULPA 1ASJ3 3KGZA 1MVEA 2R32A 3LDBA 4YW7A 2EICA 4QX0A 3ZLIA 3IAQA 3BKZA 5IW0A 4YGCA 3ZFFB 3AYCA 1AR63 3B9IA 3IAPA 4IEUA 4MXWB 1W6OA 1C8M2 2E7QA 1FI2A 3ACHA 5JZGC 2E63A 4B1LA 1T2XA 1DGLA 4H55A 3ZIXA 4FAHA 1NCRA 4NAOA 2QQOA 3ETQA 3OCPA 4XUQA 1HRV1 2ZGNA 3J7NA 3NJYA 2QQWA 1PGL2 4LHKA 5E8AA 3MF6A 1H1MA 4NN0A 5FXXA 4XXAA 1ZZ8A 3ZN6A 3QOPA 1SLTA 2E31A 3IN9A 1YIPA 1EAH2 1UY4A 1J3QA 2ORXA 1PK6A 2QDRA 1Y9GA 2R043 3JD72 4HPKB 4PIYA 4PF1A 3USSA 1RUH2 2OQ6A 4WVMA 1JU3A 2W5FA 4JQTA 4IQPA 4H7LA 1W8FA 4E2GA 5JR7B 2XGXA 1WW5A 3TEWA 2BDRA 3J8F2 2FQPA 1PK6B 2DTWA 4PDWC 4QHBA 4ZS3A 3N36A 4ZU7A 3I2HA 1GBGA 1VBD1 1JOBA 1ZRIA 5HCAA 4H7MA 1V6OA 1W6NB 3WNKA 2ENRA 5A7WA 4ET7A 4D6RA 1J83A 2Y8KA 1PGSA 2IFRA 1KD7A 3NV4A 1IPKA 4MGQA 2EXJA 1FV3A 1OLRA 2D6KA 2IXKA 2RM21 3BB6A 3IB3A 5DZFA 5EXOA 3FMGA 1ST8A 4Q2FA 4GH4B 1VB4A 3C3VA 3JXSA 3LGRA 4RQPC 4YW3A 1QU0A 4F8AA 4CZSA 1QJU1 4OZXA 4X6RB 5C4WA 2Z42A 1W9YA 2D5HA 3PIGA 3U10A 3QH6A 3ZOIA 2R041 4JDMA 5E6HA 4A7ZA 1VBC2 4BE3A 1YHFA 2QQMA 5DDJ2 5D2AA 1GQGA 1NOVA 4FTSA 2OS2A 2Q1MA 4FFGA 4YVWA 2HWF1 5C3RA 1DZRA 4P5YA 2XLGA 3KT7A 3J4UH 1SLAA 4B8EA 2IC1A 2DVAA 4KWLA 3A4UA 4LKEA 5F5AA 4MO3M 3FX3A 5F39A 4AK3A 2RE9A 3KS7A 1KFUL 1HRV3 4JHZA 5A3UA 1ZYBA 2A5ZA 3OG2A 1SFNA 2J42A 1UZ0A 2YU1A 4Y5Z0 4NO4A 4XFHA 4YVSC 2Q8DA 2LROA 3AFGA 4NIDA 5FLJA 1WMDA 3WEZA 4ASMB 4F7ZA 2ET7A 1W9WA 3NKTA 5DAVA 4CUAA 3BVCA 3SLIA 1V9U2 2ZACA 1X9TA 1JYIA 3WCSA 1UOGA 2R042 3JD73 2Y0IA 4B4PA 5JPNB 2FCTA 4LBOA 4CVUA 2VMHA 3ILFA 4BK5A 1Q8SA 4EE2A 3GBFA 4V2WA 5C70A 4LBQD 4R4XA 1ASJ1 1DQ0A 4MH0E 4CPBD 3H50A 1WCSA 1FV2A 3I97A 1MZEA 3ZYFA 2W46A 3ZFEB 4HVQA 1W99A 1WA4A 2YFUA 1MS4A 4IESA 4DXZA 1CZTA 3RGBA 2VE1A 2IFWA 3AYDA 2YU2A 3FLTA 1ZZCA 4FFIA 3ZSJA 2XVKA 3LWCA 4GWNA 4AR2A 4AWDA 1MACA 1ZBA1 4JQRA 2XBO3 5BNOB 4UAPA 4I0WB 3UESA 3ZXEA 4XF3A 5JI9A 1UAIA 2JG8A 2FDJA 3B93A 4Y1UA 4TZDA 1UIKA 1R093 2CDOA 2DFBA 4JGZA 4L97A 4OI4A 2PHXA 5HCFA 3ZPYA 1DQ2A 2XJPA 3H1WA 4IDZA 2DFCA 2HBUA 4BIOA 4NIHA 1CZVA 5BNOA 1W2UA 1AJOA 3ACIA 5LEJA 3N7JA 1O3QA 1HRI3 2VCCA 3VUOA 2PLV1 1BYHA 3POJA 4OHYA 2HH9A 2H6BA 3LFMA 4LBQB 5CFCB 1SCSA 2K46A 5FZCA 1AL0G 4JGZC 5FZ0A 4HT1T 2X53S 2PHRA 2XUEA 5FWEA 3ZFFC 1OF3A 3QH7A 5GLUA 3S5AA 2WN3A 4OYUA 3AX4A 4AVBA 1DQ1A 2HWC3 3ZXKA 3EB7A 4AVCA 3GXUA 1QJY2 3OUIA 2EXKA 3AM2A 3NAPB 4QU2A 3GBGA 3WF0A 1W6QA 3ZXLA 1NYWA 1WCKA 2GNBA 3WW2A 1V70A 2RV9A 4HKOA 1GZ9A 1V0AA 1MPXA 2P3YA 1V9U3 1QOSA 1WCQA 2RS12 4LO8A 1XNTA 4NPRA 2HWD1 4YVSB 1O3TA 1C8M1 3NNJA 2FDIA 2Z79A 3I7DA 1PNFA 4GKXA 4XQWA 2RDRA 5FO7B 2WT1A 3ZYBA 3E5UA 4K8RB 4ZZ8A 1TNRA 2DF7A 5IYYA 3WT3A 4YGDA 3O0XA 1YQ2A 1AL21 1YO8A 1R1A3 4FFFA 4Y33A 4YVSA 3VN4A 4FOQA 5FZOB 5T3NA 4WVZA 1D2SA 3CDZB 3GZUC 4P9LA 2WYFA 1IHMA 2FDGA 1U12A 3LEGA 3AMPA 3C7HA 2CNAA 5AFBA 3WW3A 1OVSA 5FYMA 2VXJA 2KM2A 5CNAA 3EJKA 1RUC2 3UL2A 3HQRA 4HZFA 4Q26A 5FYIA 2DVDA 2YBPA 1VBC3 4B4QA 4OLLA 3K46A 1LHWA 5CAZA 3KV5A 5A3NA 4QMAA 4PLMA 3C7EA 5K0UB 2J1SA 1JYTA 2WS92 2Y26A 2HWE2 2ARBA 1H4HA 2CSGA 2NPIA 3AMNA 4META 4PBOA 4AI3A 3VKLA 2VJXA 4Z2WA 3B01A 5K0UC 1QIQA 1TME2 2YFZA 3OGVA 5JXIA 3WW1A 1WUVA 5EFUA 2RS31 4OMCA 1DQ6A 3NVCA 4E4HA 3VZOA 4OI1A 4AEDB 5DMYA 3VBUC 3PMEA 5CKMA 2E6VA 3AMHA 5TSWA 1N47A 4NUBA 1CESA 1HQLA 2CV6A 4HMZA 4Q29A 1Z7S3 3Q8EA 1TEIA 4SLIA 3RZKA 2L9LA 3KV4A 1NXMA 5F2SA 2O8QA 3OEAA 4XETA 4NHKA 5FYVA 4XOGA 1LGBA 1QOOA 3LDRA 3VBRC 3VBFA 1KJRA 1VRH1 1MS9A 2XDVA 3O1UA 1QQP2 2W68A 4RN5A 4P9JA 4LO5B 2E26A 1WW6A 4YZ3A 4YVWB 1TMF1 4CDWB 4LORA 2ID4A 3IT8A 2IXJA 1PVC2 1V00A 5JIUA 1XB9A 4CDXC 1RUJ1 3KT4A 4TN7A 4WM8A 1D4M1 1MEC2 3J8F1 2Z2SB 1OD3A 1W8OA 4A6OA 3KT1A 2FDKA 1RXFA 2OPWA 1VBD2 1W06A 4NIAA 3SXWA 4C0HA 1GWLA 2BTVC 4XQDA 3T0AA 1PO13 2YG0A 3K4ZA 5JOXA 1LAJA 4LHNA 5FCCA 2GAUA 3T30A 3POWA 5FWJA 1S0CA 3WDWA 1ZZBA 5EYXA 3D5OA 2F17A 2Y6FA 3O7OA 2XL9A 3LF7A 5BNQA 2D7FA 1AUYA 2GP5A 4KL1A 4UBGA 1YI7A 1N3QA 4TSVA 4XFCA 5F3IA 2BRTA 4E8CA 1SZBA 2P4EA 1VBE3 5FP7A 3T3YA 3VDDC 1G86A 4WBBA 2D6MA 2RJ2A 4QQ2A 1U0AA 2HWF2 2VD7A 1VAMA 2BZDA 2NMNA 5T5LA 4IL7A 3ZN4A 2WQZC 3U78A 4JGYA 3U1XA 2JE8A 3R4SA 4QPGB 1EUUA 1C4RA 2IZWA 4P9WA 3AB0A 4Q4X1 4HFSA 1K12A 3AKTA 3UKNA 1RUC1 1ZX5A 2RS51 1PO22 3AVRA 5F8PA 5FUIA 4YPJA 4M00A 2F6BA 4ISQA 4IGQA 1LCLA 1BEV2 1OOPA 2J1UA 4MOAA 4QXCA 3V56A 4MG2A 3AJZA 4XJ8A 1LGNA 2WO3A 1LGCA 1KS4A 3BTAA 1PMIA 4LBKA 2HEYF 2P17A 1EP0A 3OYWA 4J1WA 5L9VA 5C8CA 5M0TA 2I07B 3FFQA 4P02B 2ZGRA 4GB31 3PUQA 4K6BA 4Y26A 3VD4A 5IAVA 1G9DA 1CAWB 1PM4A 1QXRA 3WR0A 3SKJE 2DCTA 2CU5A 1RUH1 4LT5A 2E53A 4IGPA 4YVWC 3IZOA 4JKLA 5A7SA 3MIGA 1A8DA 1AR91 4Z8BA 1AF9A 1LRHA 3POYA 2ZGUA 2RS11 3NO8A 3C7FA 1CAWA 1S0JA 3HN1A 3I49A 3WSOA 2ET1A 1STMA 1PVC3 2JDZA 3DV8A 2UU8A 1OBNA 1UZVA 1QNWA 2RMU1 1QF3A 2Y0OA 3LPGA 3MW3A 4X6QB 1Y7BA 4D7SA 5ABJB 3VBFC 2VUDA 1UIJA 4HSJA 2GC1A 1PIV3 4CU7A 3DXTA 3WCRA 1SBFA 4NRQA 1GWKA 1RUG1 4XBQA 3K3OA 4E8DA 4INDA 4HLTA 2ZPXA 4YZ1A 2OIIA 5F9TA 3RVHA 4XFGA 1Q3EA 4UT5A 3J9SA 2DU1A 4QU1A 3TNPB 4JVAA 3C2UA 4LK7A 4PQ9A 2B46X 3LA3A 5C33A 2VBDA 5FXZA 5T5PA 5I0DA 4K8FA 5FPLA 3QD6A 4O61A 1EV11 2HLEA 3D0SA 3HR9A 2FBEA 1JYNA 2XPJA 5T55A 2GP3A 1V6LA 2JEMA 2UYAA 4XBNA 3OPZA 2DCZA 4QPIC 5FR3A 2ZA9A 3BIEA 1QDOA 4XJ9A 3VZNA 2ILMA 1VBA3 4N53A 3ZVXA 4YWAA 1BCXA 4DNYA 3LOBA 1QH6A 4DO0A 5FMCA 1S2KA 1OPMA 5LBFA 2E9QA 4XMIA 1UY2A 3ZSLA 5EQUA 3A22A 4EWEA 5FREA 1CZSA 1OA4A 1CWPA 3QACA 3N9QA 1UXZA 3I59A 2WFF3 1QDCA 5FQ0B 1RUI2 2DVGA 3ZPOA 4BLIA 4HANA 3N4MA 5GZDA 4CDQA 4M3CE 1OOPC 2Y64A 4B3NA 3KGLA 4BCUA 3LCPA 4XZUG 3OD4A 5HV0A 1UX6A 4O7XA 5FQ0A 4AQSA 4LKFA 2VUCA 2ADEA 2GMPA 3SQOA 4TTGA 5IK5A 2QBXA 4K20A 4URTA 5FMDA 2H0VA 1XE8A 2GN7A 3CU7A 3RG0A 5G05L 3PU8A 1DGWX 5H9RA 1QGLA 5A33B 2WWSA 1DYPA 3RRDA 2A6XA 4OI2A 4ARYA 2J1RA 4CDWA 1Q8QA 1HB4A 3DGTA 4ZONA 1SACA 1J3RA 1SQ4A 2C0ZA 2VG9A 2VZUA 4S2DA 2DV9A 4WM8B 5IK4A 4FTBA 1JZ5A 3ZFGA 2IWGB 3JZVA 5A33A 1UU5A 5AFEA 5L36A 4C1XA 3KSCA 3GJBA 2WABA 5GJ6A 4AAPA 5LCWL 1AR72 1RVF3 5A1AA 3JBG2 1JTZX 1A6CA 1M06G 1GZCA 4KU8A 2G9FA 2K2SA 2XLFA 3AKPA 1EY2A 2VC9A 2K0GA 3DPRA 3RYKA 3H8RA 3ZKYA 4MGTA 4CCLA 2TEPA 3ZFGB 1DLCA 2YV8A 1JUIA 2ARCA 1FOD3 3NW4A 5GZEA 4AG4A 1PO12 5HXMA 4BPZA 1W6PB 5JOYA 4WM8C 1WLCA 4IXLA 3VDCA 4A6SA 4NOTA 5KR7A 1H8TB 1PNGA 3LEIA 5DUVA 4LO4B 1ULFA 1DGRA 1RUF3 2ZX2A 1FAYA 4OUSA 5LBBA 4M4PA 4XURA 3I3QA 4GH4C 2J22A 3VL8A 3ZM8A 3ZFEC 3ZN6B 4DQAA 1QOTA 1W6PA 1Y3TA 4HONA 1GOFA 3PVNA 2EVXA 1JS9A 1XYNA 3W21A 3ES1A 4FCAA 3MV01 4LKDA 4XCAA 4C0BA 4KG8A 4OQ9A 4OQ8A 4QPGC 4Q0UA 5CG8A 2R061 3ITQA 1HKDA 2W39A 2W92A 3NNMA 4XZPA 1HB3A 3MLKA 3PVOA 5LA2A 3OUHA 2ZX0A 4K3UA 4PLNA 2WZPP 1W9TA 4W8JA 5DUUA 1PX3A 3INAA 1X50A 4M3CF 2RVAA 3TN91 5C8CB 2PTMA 3S57A 3CL1A 1H0BA 3MI8A 4GD4A 4OHWA 5FP8A 5A7WB 5ABJC 2BBVA 3WY6A 5A3PA 2JICA 1WBLA 2V73A 3M3EA 2CAVA 1VMJA 2CGNA 2WZ8A 2ZGPA 3ETPA 3GJAA 2Q5TA 3MGUA 3ON7A 1LODA 2OUHA 4EV0A 5F1RA 3WUDA 3KVBA 4QAWA 4AQ6A 4W6XA 1XBFA 3O1MA 4FPHA 4DUXA 2WZR1 5A1LA 3VZKA 1OQDA 3FWEA 1UNBA 3IMNA 4JCKA 1GSLA 1YCIA 4OUEA 3UKVA 3ZXDA 2R0FA 1GOHA 4AFDA 5FO8B 1UZZA 5DDJ3 2G1MA 3D4KA 1ND2C 2HEVF 4G3YC 3IDBB 3O1TA 2ZEXA 5ACA3 1B35C 5CFDB 2UWCA 1J1TA 3OBRA 3WP5A 5L9BA 3RYRA 1H4GA 1X36A 2Y38A 3WVJA 5F32A 3POBA 1C8NA 1VPHA 2BWCA 2Y34A 2VNVA 2VW0A 4EQVA 2MEV2 1OLMA 4EYUA 1PIV1 4JX0A 2EIEA 1OA3A 4QGNA 1NLSA 4QHZA 2WO2A 3H42B 4XDPA 5KHHA 4M01A 4QQLA 4CA9A 5DUWA 1ENRA 1C3HA 4XUPA 4XFFA 3OSDA 2YBSA 2QDNA 4IETA 5C3QA 3VBHC 4FPYA 3TEZA 1RUD3 3HPNA 1DQ4A 1LHNA 2JDAA 1ZREA 4UFHA 3U4XA 3KV9A 4FOWA 5FKCA 2B39A 2QJVA 4QX5A 5LW9A 1R081 2H6CA 3RI8A 3ME2A 4JKMA 1RUE3 4LOSA 3WG2A 4GB33 2R071 3HOBA 3I59B 4X8NA 2LW8A 1BVVA 1G7YA 4ONUA 2XVLA 1LHOA 4XF9A 2VTFA 1NCRC 4JGZB 1UKRA 4LMFA 2PFWA 1LOFA 5GLTA 4LJHA 4LNVA 3ZO0B 1J59A 1SLLA 4Q4W1 1WCDJ 3K51A 3AC0A 2PMWB 2OUJA 3HQUA 5KC6A 1K5MB 4LE3A 4LBQA 5BPXA 4FT8A 3AKSA 2CTVA 4A3ZA 5I0RA 3F95A 3PVBB 3ZDVA 4WV8A 1C57A 4XBLA 1UZWA 1UMHA 1GQHA 5C3PA 3UNPA 3E5QA 4BK4A 3WP4A 1G9BA 2WLPA 1DGWA 1K5MA 1IS5A 4RGGA 3WF2A 1CX1A 5HV4A 1MZ6A 4BJ0A 1US2A 4N43C 4XDQA 3T4VA 5FPVA 2VQTA 2WSVA 5HXVA 1SBDA 1MEC1 4DZGA 3L2HA 2PQSA 4L2NA 4NHLA 2PHFA 1FNZA 4KQ7A 3RJRA 3OB8A 1W04A 3MIHA 4RFT0 1EV12 3VBSB 3B94A 3L9JT 2ZHNA 1GP6A 1PO11 4K9SA 1AYM1 1WWYA 2O1QA 4YZ5A 1YQ8A 4PQQA 3ZXGA 5L73A 1HN1A 2OXBA 5L7OC 4ZPIA 1CGPA 2OT7A 1BKZA 2V72A 3ZFFA 1RUJ3 4EJRA 5EWSA 4AL9A 1W3XA 2VU9A 2YXSA 3WNOA 4QB1A 5EV7A 1YIFA 2RDSA 4JC1A 3WDUA 1C5HA 5DAQA 1NXD1 4A42A 1JZ2A 1RGSA 3WP3A 3MZHA 1SHWB 3LAGA 2WS93 1AYM3 1O5UA 4HN0A 3SITA 2H0BA 3UJOA 1V6JA 3FLRA 2ARXA 2P3KA 3DKQA 1K5JA 2VECA 4PDWB 1BVP1 1AYN1 1EAH1 1B09A 3ACLA 3I3MA 2YROA 2C26A 4GJYA 2Q30A 5A7OA 5IVFA 4ZS2A 1YUDA 3ES4A 1MEC3 2JKXA 2W3JA 1XNDA 4BQXA 4QX2A 1GP4A 4Z2AA 4PDWA 5F7UA 4HPKA 1O4TA 2D6NA 2LS6A 4YFZA 3BPZA 5A3MA 1YFWA 4RHV2 3ZKUA 5A6YA 1Q8OA 1V6NA 1SDWA 1EUTA 5FZDA 1OUXA 4Y20B 5C71A 2YC2A 3JCIA 4PI0A 3QCWA 4XEZA 2A6VA 1S4CA 1REFA 3N9NA 1JHNA 2ZX4A 5FZ1A 4QX3A 5CADA 3OGRA 4YGEA 1VBC1 2I2SA 2UY8A 2Q8OA 1Y4WA 1W8TA 3FUOA 5DABA 3U75A 1W8ZA 4CUCA 2RR11 4CDQC 5K0UA 5IFPA 4Z1VA 2OPKA 4AEMA 1F4HA 3RSJA 2R073 1SPPA 3T2PA 2QKDA 1S0EA 1ALYA 1IS4A 1N1TA 1OD5A 1L7LA 2MEV1 4CP0A 3VD3A 3OPTA 3T09A 2PAEA 2HBTA 3POSA 3E6DA 4Q27A 4GQ7A 2WBKA 5F5CA 3MICA 3I2KA 4LULA 4HBNA 1OPOA 5JXGA 1C8M3 2VTXJ 4CSWA 3MPPG 1V9U1 1LR5A 2A75A 2Y6JA 4D69A 4RQPA 2CWMA 4GA9A 3KQ4B 2V4AA 3OGGA 2XH6A 1SDDB 4Y1XA 1UX7A 1FOD2 2AUYA 5ERLA 5FMBA 3SEEA 5EIYB 2QZ3A 1UOFA 2JIJA 1DIWA 3WOGA 2NLRA 2P5BA 1F9KA 2O8OA 2ZGSA 4D94A 1L7RA 2AH2A 1ACCA 5FZLA 4QPIB 4J6GA 1UPIA 1WGPA 4A7YA 1F4AA 2YB7A 4BISA 2GC2A 1W9SA 1D0HA 1XOYA 5GLZA 2RJLA 1FMD1 5I0TA 1NE6A 5G04L 5H9PA 4JGYB 4CXYA 1GFF2 4QPGA 3HJRA 4IEQA 5LA9A 4XJWA 5DDJ1 4HETA 5LBCA 1OT5A 1GU3A 4NAMA 4OHZA 4CEYC 4PIZA 2VZSA 2YBKA 3Q8CA 2WZR2 1PK6C 4W6WA 2PELA 1K45A 3I2FA 1H2NA 1TZOA 2BFUL 2WZR3 3MEPA 3SNMA 4NPMA 1JODA 1OOPB 1CX4A 1QJU2 2A1XA 3CJXA 4A3XA 3BTYA 2OZ6A 1RC6A 4AFBA 1R091 3BTZA 2NQYA 1OKOA 1XU1A 5A3WA 3AXEA 4FAGA 1GANA 1C5IA 2X5IB 2JDPA 2LRPA 5GKAC 3W5MA 5FYYA 4GJZA 1RHI2 1ZBA3 3LSEA 1LB2A 3BU7A 2RHPA 2YC4A 5FJKA 4AI9A 2PHWA 1U5ZA 1A78A 2WO1A 3S0MA 3SCHA 1BK0A 3M70A 3QLQA 2X5IA 1X33A 2XKPA 1NAEA 4FPFA 5FLHA 4KNCA 3AMMA 1VIWB 5FXWA 5IFTA 4OHVA 3KD4A 1JZ4A 5FY8A 3UV9A 3JD71 1QKQA 3KZ4C 4RD7A 1T6GC 5ABJA 3D3AA 2E32A 3WDVA 3WXPA 5J96B 4NIIA 2UWAA 1XNAA 1DQ5A 1Q5OA 3VBSC 1NA1B 1OVPA 5EJ1B 3WG3A 1N1VA 4N9HA 4O9EA 4Q1PA 2ZGQA 4Q8LA 1UOJA 1ZRFA 1BQPA 1PVXA 1WKYA 1RUF1 5I0SA 3N7KA 4Z92B 4MX3A 2BNOA 2EF6A 2GU9A 3HNBM 2AYHA 1SG3A 2YYOA 3M7AA 4IERA 4FVVA 3ZMNA 1AVBA 4KWUA 2CY6A 3GM8A 3BIWE 4A44A 2Q1FA 3RPQA 3B7MA 1UL9A 4GULA 3T08A 3THTA 3W58A 1S0GA 1JUHA 3OF1A 3V0AB 1F31A 1YFUA 3MDPA 3RJ2X 3SC7X 4JHTA 1S2EA 1O91A 4ZU4A 5FY9A 4V2VA 5LB6A 2C9AA 2FDFA 1GQPA 3TB0A 2BFUS 1W2AX 4YGBA 1DYOA 2XJTA 3M3CA 1UQXA 4M4RA 1XQNA 4MGZE 3H3ZA 4QKFA 1HV0A 1DHKB 1JW6A 3P6BA 3VBOC 4QWNA 4AVSA 4I2OA 3F2ZA 1O8SA 4NWVA 1O8PA 4LBMA 1V6MA 4YW2A 5T54A 5K9YA 3N9OA 4BQYA 5FY5A 2DWRA 1CIYA 4ZXKA 5J1XA 1QJY1 1GNZA 2LM3A 5FZ6A 2LTNA 3UT0A 1W28A 3RZMA 5J3UA 4LO7A 1ZVFA 3CQOA 5K7PA 2D3PA 3VKNA 1HXS2 1JYCA 4S2GA 5AC93 4DB5A 3ZSMA 5F37A 4Y4RA 1UKGA 4IE4A 4P9XA 1ULEA 5JSOA 1S2BA 2BEOA 2HYKA 4N90A 4KGGA 4AGRA 4AXOA 4F83A 4LXLA 5A1FA 3FHQA 2Z69A 1CONA 1NY72 1PO23 4R9CA 4AGGA 4UFMA 1GV9A 3WF4A 4ISRA 3POEA 1PO21 1SPPB 2ZMKA 4O9GA 1QY4A 3UKTA 4GWMA 4R9AA 4E2QA 1BXHA 4I3PA 2GNTA 4EZHA 3O5SA 2WO7A 2VZTA 1ENSA 3PJQA 2VTXA 1NQDA 2ZZQA 5CISA 3CJIA 1VBA1 3ZX7A 2MNGA 4QB6A 5FZHA 3SHRA 4LA3A 4JTNA 1AR61 2VZQA 3VHNA 1HXS1 4DEVA 3H7JA 3J7LA 4Y1ZA 2X09A 5C7GA 1DDLA 1EV13 2VCBA 1QJY3 2FCUA 4QM8A 3SH5A 1W6MB 4W50A 1X8MA 5C5UA 4RQPB 1GWMA 1GICA 1PX4A 3IDCB 5T5OA 4JRAA 1E5IA 3WUCA 2W47A 2D3SA 2R1BA 4DUVA 1A8MA 1A3KA 4M3CA 1ULGA 5IWFA 4QPIA 4P00B 4CCMA 4A4AA 4MUVA 1LHVA 5HI0A 5DXDA 3AP7A 1OH4A 4KBBA 2DTYA 4WZFA 2VVEA 1W2NA 3NRUA 1QJEA 4OVEA 2E51A 3KCCA 1FXZA 5FZKA 1WMXA 5GLVA 3CZJA 4D6QA 1URXA 3OOXA 1VAKA 2JB4A 5FY1A 3KLSA 3RZJA 4LQRA 2W94A 2V09A 1PVC1 2QNKA 4XVHA 3RMYA 2ZABA 2XBO2 1TE1B 4Q8KA 3HQXA 1BEV1 1QQP3 1DZQA 1O5LA 3HT2A 5J37A 3JBG1 1AR93 3SEPA 1W05A 4BHPA 5C8WA 5KC5A 1PGW2 4CP1A 4CE8A 1IKPA 1EYBA 1Y43B 4R4ZA 2VULA 2W1SA 3V65A 1SMVA 1GP5A 1VRBA 2D5FA 4GB32 1XC6A 2QE3A 2DUPA 5A7PA 3WLUA 2X5IC 3NSTA 2WSUA 4P5HA 4FP3A 4CCKA 1N1SA 4BXSV 2AEYA 1AXKA 3MIBA 3KQRA 3OYWB 2VZ3A 1H9WA 3ZXAC 1IKQA 4CDUC 4EN9B 1Q8VA 3HD8B 3P1IA 4CCNA 3BTXA 1IS3A 2ZOEB 5ANNA 3H1MA 5IVYA 2HWB2 1H8TC 1QJX3 3IBMA 1NY71 1Y9MA 2RS53 3ZYGA 5A6ZA 1TME3 1JOJA 1CN1A 4AHYA 3RFRA 4RHV1 4GXLA 2JG8C 3PTRB 1S0BA 1RUG2 5C9AA 2EAAA 3KWVA 5B4XA 2R1DA 4XW3A 5SV8A 5A80A 2QQLA 2XLAA 5FKBA 2VUAA 4CEYA 4I09A 2P34A 4XMAA 3K77A 5FK7A 2AZ5A 1VBE1 4EN8B 3DXUA 1ZM1A 3C7OA 4X8PA 5JOWA 2C6SA 2RJKA 2VCMA 1BMV1 2VZOA 2HWB1 3LSDA 3VDDB 1H8VA 3Q8AA 3R05A 4CDWC 3VLBB 5LA1A 2ZJCA 2XVGA 1OHFA 2ETEA 2VPVA 1LOGA 4Q4W2 3NAPC 4IEOA 4N9IA 1HJGA 3S30A 1QHDA 3U0ZA 1QJX2 5D21A 4YW4A 1F2NA 5JWPA 3VDDA 4Y5TA 3B69A 4C90A 2A6WA 5BUVA 3KMHA 4OUMA 1RUJ2 1WD3A 1UY0A 2GNMA 4XACA 3J8F3 5E89A 2ZCWA 2Y6HA 5T50A 5J7MA 1FMD3 4YRDA 1D4M3 5DQ0A 4KH9A 4ARXA 1ZRDA 3K4AA 3SCGA 1NZIA 1Q56A 2D6OX 1LEMA 3A7QA 5AVPA 1HLCA 3VB9A 1POV1 3DKWA 4N53B 4A7KA 4E2SA 5BNPB 2IXIA 4P9YA 3I2IA 3S5QA 5C3OA 1U5IA 3LEMA 3ZYPA 5JDBA 4L11A 1CJPA 2QQKA 4Q0SA 4MSVA 3ABZA 2NZ9A 3J7HA 4Z82A 3U14A 4IV1C 4V1PA 1N3PA 1BZWA 1YWKA 2JWPA 3IIAA 1H2LA 1WW4A 5FZ3A 3EYPA 2R30A 5KXCA 4D7YA 3HEIA 1JYXA 5BNPA 4OCTA 1O3RA 1UYPA 1HRI2 1C1LA 1ZBE1 5A3TA 4YM3A 4BMBA 4AHWA 4I02A 3FHAA 4QQHA 1VE0A 5EHDA 2XUMA 5GM0A 4E4SA 3RWKX 2G9ZA 4E9KA 4D7TA 2WFPA 4ZZ5A 1JHJA 1UWWA 4KI5M 4NWWA 4U2AA 4PJYA 1OURA 1J1LA 2WNEA 3AXDA 5FYUA 5FMOL 2B9UA 2QCSB 3PUIA 5FUNA 1KXGA 4QQPA 2AACA 1AR62 2RR13 2MPFA 1SLCA 4XCBA 4UBHA 1RHI1 3AP5A 3EXUA 4YNIA 1OMIA 2ZZJA 4UW5A 5DZEA 5DAWA 1OQEA 2QQNA 4L9BA 4AI1A 4JZRA 4LITA 5CU1A 4CYDA 1LU2A 1RHI3 1ZBA2 1GUIA 2ZXQA 2XB6C 3ZXFA 1W6MA 2OYZA 2D6PA 1JZ7A 2G9GA 3VBOA 2Q8CA 1AX2A 2A3YA 4YG3A 1RUD2 2XG3A 3R4DB 3BN6A 3GHNA 4KWKA 4Y3OA 4Z07A 5FYBA 5CFCC 1LEDA 1KRIA 1CD3G 4ES9A 3PHMA 5HPOA 4Y24A 3RZZA 2KXLA 3V64A 4FTEA 1I5PA 3U37A
chains in the Genus database with same CATH topology
2FDIA 4NRMA 4ZS3A 4NROA 3O1PA 3O1SA 3BI3A 4NIGA 3LFMA 4IE5A 4QKFA 4NIHA 4NJ4A 4QHOA 3I3MA 3S57A 3I49A 3BU0A 3RZHA 3O1UA 4NRPA 3I3QA 4OCTA 5F8PA 4QKBA 4ZS2A 5DABA 4ZHNA 3H8XA 4O61A 2FD8A 3BKZA 2FDHA 4MG2A 4CXWA 4CXXA 4NPMA 3O1OA 4NPLA 4O7XA 4CXYA 3S5AA 3T4HB 2FDGA 4IE6A 4IE7A 3BTYA 2FDJA 4NIDA 3RZMA 3BTZA 4NRQA 4IE0A 4NIIA 3T3YA 3BIEA 3H8RA 3I2OA 3KHCA 4QKNA 4MGTA 4IDZA 3T4VA 4JHTA 3O1MA 3O1VA 4QKDA 3BTXA 3RZJA 3KHBA 3O1RA 4RFRB 2FDKA 3RZLA 3H8OA 4IE4A 2FDFA 2IUWA 3BUCA 3O1TA 3RZKA 3RZGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FDI A;  4NRM A;  4ZS3 A;  4NRO A;  3O1P A;  3O1S A;  3BI3 A;  4NIG A;  3LFM A;  4IE5 A;  4QKF A;  4NIH A;  4NJ4 A;  4QHO A;  3I3M A;  3S57 A;  3I49 A;  3BU0 A;  3RZH A;  3O1U A;  4NRP A;  3I3Q A;  4OCT A;  5F8P A;  4QKB A;  4ZS2 A;  5DAB A;  4ZHN A;  3H8X A;  4O61 A;  2FD8 A;  3BKZ A;  2FDH A;  4MG2 A;  4CXW A;  4CXX A;  4NPM A;  3O1O A;  4NPL A;  4O7X A;  4CXY A;  3S5A A;  3T4H B;  2FDG A;  4IE6 A;  4IE7 A;  3BTY A;  2FDJ A;  4NID A;  3RZM A;  3BTZ A;  4NRQ A;  4IE0 A;  4NII A;  3T3Y A;  3BIE A;  3H8R A;  3I2O A;  3KHC A;  4QKN A;  4MGT A;  4IDZ A;  3T4V A;  4JHT A;  3O1M A;  3O1V A;  4QKD A;  3BTX A;  3RZJ A;  3KHB A;  3O1R A;  4RFR B;  2FDK A;  3RZL A;  3H8O A;  4IE4 A;  2FDF A;  2IUW A;  3BUC A;  3O1T A;  3RZK A;  3RZG A; 
#chains in the Genus database with same CATH topology
 1D2Q A;  2VNG A;  1CAV A;  2XJS A;  4NRO A;  4NIG A;  2BNM A;  2BWA A;  2C1F A;  4BME A;  3OGS A;  1M4W A;  2HWD 3;  4W65 A;  5LA0 A;  2PXJ A;  4E27 A;  5IK7 A;  4XAE A;  1WBF A;  3DYP A;  4UW6 A;  5FYZ A;  3C7G A;  3I4I A;  4J25 A;  5A32 B;  3S7E A;  1IGO A;  2CL2 A;  2A6Y A;  2GN3 A;  2N7G A;  2V4V A;  2LAL A;  1F5F A;  4IE7 A;  4Q0Q A;  2ZBJ A;  4UXA A;  1KIT A;  3DYO A;  2VOT A;  2W08 A;  4OI0 A;  4XF0 A;  3RQ0 A;  2HWC 1;  1QEX A;  2PN5 A;  5D1I A;  2BUK A;  4QKD A;  4K21 A;  1F35 A;  1RUI 3;  3AZX A;  5A32 A;  2E7A A;  2DUO A;  1FAT A;  5DAX A;  1LEN A;  1SCR A;  3M3I A;  4QGM A;  2Q8E A;  2YMZ A;  4Y20 A;  1VP6 A;  1XYO A;  1OFS A;  4IEP A;  4ZU5 A;  1F15 A;  5IVB A;  3THD A;  4AEJ A;  2KD7 A;  2XWB B;  4MLO A;  3OBT A;  4MGK E;  1SFP A;  5FZG A;  2CGP A;  1JZ8 A;  4ZHN A;  1RTV A;  5JSR A;  2RS5 2;  5CFD C;  4QDQ A;  4IEV A;  1HIX A;  2HWB 3;  3WNN A;  5JPM B;  1UOB A;  1RMU 3;  1FT9 A;  1Z0H A;  2VR4 A;  5JMC A;  4P14 A;  5A6X A;  2VNO A;  1AJK A;  2XBO 1;  1X7N A;  3ATG A;  1NQJ A;  4DOU A;  3H8O A;  4FOV A;  1KDK A;  1SBE A;  2RDN A;  1DCS A;  3J7M A;  1FMD 2;  5FYS A;  3NJX A;  4ATE A;  1REE A;  2W0X A;  1BMV 2;  4PBP A;  1CPN A;  2DBN A;  2WNU A;  1CAX B;  2VM9 A;  4CDX A;  4YSF A;  2XHK A;  1WMF A;  2WNO A;  4AQ2 A;  4MHR A;  3WG4 A;  4AFM A;  1TME 1;  3UJQ A;  5FTT C;  4Q4W 3;  5LZ6 A;  5KXE A;  1WLW A;  4FPG A;  2Y33 A;  4N8M A;  4Q4V 1;  5CFD A;  3M4F A;  3PUS A;  1W39 A;  3V0B A;  4BH9 A;  3LOI A;  3GBW A;  3H8U A;  4IEW A;  5APA A;  2WNU B;  3GYD A;  5J48 A;  1AR8 1;  3LA7 A;  3WNP A;  5FZ4 A;  1DBN A;  1R1Z A;  1UF2 C;  2JD4 A;  2G19 A;  3VHR A;  1D7P M;  1RIT A;  4FO9 A;  4JDO A;  4Y1V A;  5IVE A;  4RS5 A;  3S6P A;  1RUE 1;  3E1F 1;  3I2D A;  4D0Q A;  5C6C A;  4MVT A;  3RZL A;  5FPB A;  5LK5 A;  3U07 A;  3WQ7 A;  1EPW A;  2ZGL A;  3N9M A;  2WAA A;  4CTE A;  3VBU A;  1NZC A;  4AVT A;  5E1R A;  1ULO A;  5LY2 A;  3AK0 A;  1O7F A;  1BEV 3;  1QQP 1;  3WHU A;  3ZR5 A;  4B29 A;  2J1V A;  2AEN A;  1OH3 A;  5LBE A;  2F4L A;  1MQT B;  1B35 A;  3ZMO A;  1JMU B;  1VJ2 A;  4EZ4 A;  2JKB A;  5BNP C;  3O1O A;  1NT0 A;  1XNC A;  4EWA A;  2QQJ A;  2BVV A;  4DIQ A;  3KVA A;  2YC0 A;  1G8W A;  2WR9 A;  4IE0 A;  1QJU 3;  4IW3 A;  3TEX A;  4FXG B;  3KHC A;  2EAK A;  1YFX A;  2QZ2 A;  3MW4 A;  1B35 B;  5H9S A;  3EO6 A;  2BGC A;  2YZ4 A;  4XFB A;  4XPV A;  1GKB A;  1UYY A;  3OBA A;  3TWI A;  1BBT 2;  1OC1 A;  2K9Z A;  5ACA 1;  2WT2 A;  5FZ9 A;  3IMM A;  3VD5 A;  3ELN A;  2WJS A;  2QQV A;  1D0G A;  2UWB A;  1JZ6 A;  4CCC A;  4XIK A;  2NN8 A;  3PDQ A;  4LKS A;  5FLI A;  5FUP A;  5BV6 A;  2GMM A;  5JCT A;  3WP6 A;  2X05 A;  2W95 A;  4XYX A;  1YQ5 A;  2FCV A;  4AE2 A;  4QXK A;  4CUG A;  2A71 A;  2OVU A;  3M3O A;  3W9A A;  4QX8 A;  3MF9 A;  1HXS 3;  4QM9 A;  3CNA A;  3RMX A;  2GND A;  3B9C A;  1FYU A;  2WWJ A;  4Q4Y 2;  5E88 A;  2VMC A;  4CCE A;  5FDB A;  3DF0 A;  4AQT A;  1XRU A;  2WFF 2;  3VBH A;  2ARA A;  4AAX A;  4XC9 A;  4GAL A;  2ZTN A;  5CKN A;  3WW4 A;  1MVQ A;  2C24 A;  2O14 A;  1CAU B;  2VZR A;  5FYC A;  4P08 A;  1H6X A;  2ADD A;  1TQ5 A;  4I0A A;  2BGP A;  1XJA A;  2ZKN A;  3D6E A;  4RS5 C;  5FZB A;  1VBA 2;  5A3L A;  1RJ7 A;  2Y60 A;  1AZD A;  4R9D A;  1U5Y A;  4G9S B;  4BYY A;  1OFN A;  1LKN A;  1T6B X;  1UCX A;  2GSY A;  2SLI A;  5FOB B;  4MAD A;  3M2M A;  2D97 A;  1CAU A;  5AC9 1;  3ACF A;  3WQB A;  2R07 2;  1XSR A;  3B02 A;  4DXT A;  5C5T A;  3CIH A;  4IE6 A;  2LUW A;  4JV4 A;  1ND2 B;  5I0U A;  2R06 3;  2ZAH A;  1X82 A;  1RUE 2;  1Z7S 2;  4NMI A;  4TLG A;  2AGS A;  1Z78 A;  2NYY A;  4UW3 A;  3WD5 A;  3V0A A;  3ROU A;  4Q4Y 1;  3KM5 A;  1UPS A;  1MS3 A;  3PVE A;  2TUN A;  1OLQ A;  4HOO A;  1ZRR A;  4E4D X;  4Y5S A;  4ES8 A;  2WT0 A;  1HN0 A;  3FE5 A;  3LE0 A;  1HDK A;  1FX5 A;  5ANQ A;  4FPE A;  2YPJ A;  4BQ3 A;  1VBB 3;  1UU6 A;  2ZS6 B;  3KF5 A;  4QKB A;  5IK8 A;  1PM7 A;  1PIV 2;  5BNN A;  1YNA A;  5CB7 A;  3E5X A;  1N3O A;  2GC0 A;  3K3N A;  1OF4 A;  3LIG A;  3WQ1 A;  1FOD 1;  3I2G A;  3NNG A;  2MHF A;  1OUS A;  4E4Z A;  5GZF A;  1A34 A;  3FUQ A;  1VAL A;  4JRL A;  3D82 A;  5KXD A;  4UFL A;  2DVF A;  2HWE 3;  1IQD C;  4LBJ A;  4FPJ A;  4JGY C;  4QB2 A;  1RVF 1;  1COV 1;  5CYY A;  3ZYI B;  4BZ4 A;  3AZY A;  3BOD A;  2B42 B;  1JBC A;  5GZG A;  1F5J A;  1VMH A;  4QPW A;  5C3S A;  2BPA 2;  4SBV A;  4IV3 B;  2RDQ A;  1H30 A;  2VCA A;  5KWR A;  1H9P A;  1I6X A;  2D44 A;  2EIG A;  4XHX A;  5FK8 A;  3VZM A;  1LOE A;  5IT6 A;  2AC1 A;  5L9R A;  3AL5 A;  3JQW A;  2B4K A;  4HVO A;  2JG9 B;  3WIN E;  5BNN C;  3R0R A;  2ZMN A;  1OSG A;  3H3U A;  4I0B A;  4NE9 A;  5FPA A;  3H8X A;  2KA3 A;  4LEJ A;  4ZXE A;  1HQN A;  4XQ4 A;  2WN2 A;  4AZZ A;  1GZT A;  2C5D A;  2R6Q A;  3GDB A;  2JDM A;  2OZJ A;  2GH8 A;  4HVR A;  4Q1R A;  4DXS A;  1NE4 A;  2BGO A;  2JDY A;  2HKX A;  4L0P A;  2KR2 A;  3RZG A;  2FHR A;  4AF9 A;  2ES3 A;  1MZF A;  1SFY A;  3OUJ A;  3UYJ A;  4DS0 A;  3FC0 A;  3BI3 A;  5JR2 A;  4CDU A;  4LOT A;  5FXV A;  5LRS A;  2VOK A;  2WFF 1;  1VBE 2;  2EA7 A;  2JDN A;  1IG3 A;  3POG A;  1RIR A;  4M3C B;  4C1W A;  2R06 2;  4HL0 A;  4KMQ A;  4YAR A;  2Z4F A;  5K4L A;  2IVJ A;  3WF3 A;  4FPL A;  4LLO A;  2D40 A;  4LTA A;  3AJY A;  2IVI B;  4CDU B;  3GZT B;  1ULD A;  3JQX A;  4FPC A;  5FZF A;  2AR6 A;  3HMY A;  1FPN 2;  2IXH A;  3ILN A;  3U11 A;  3VGI A;  5JUV A;  5HCB A;  1Q8P A;  3G7D A;  3CLP A;  5JAX A;  1MQT A;  2XJU A;  2NP0 A;  2VZP A;  1QXJ A;  4RGK A;  4BXF A;  3O12 A;  3URF A;  2BJS A;  3PUH A;  3HN3 A;  4ASK A;  1R08 2;  3DN7 A;  1R09 2;  3WDY A;  5JVV A;  1FNY A;  5A70 A;  4K1Z A;  1RXG A;  3OJB A;  4BA6 A;  4HG6 B;  2QTW B;  3AZV A;  3E97 A;  4BIF A;  1MR5 A;  2CHH A;  1W90 A;  4Q5O A;  3H9A A;  1W6O B;  4MHU A;  3A23 A;  5J98 B;  3RNS A;  4DXR A;  5FY7 A;  1K42 A;  4Y22 A;  5FRA A;  4XIO A;  1UN1 A;  4AFA A;  1FPN 1;  2ZGK A;  2D43 A;  2O0O A;  3FFZ A;  3L2Y A;  4HXC A;  4ATF A;  2XJR A;  2RMU 3;  3WDT A;  1UO9 A;  3MID A;  3NNL A;  2ZHM A;  5AVA A;  2JIG A;  3CHX A;  3ECQ A;  5LK7 B;  2VQA A;  4Q0V A;  1KGY A;  1QJF A;  2PQQ A;  2Y6L A;  2XWJ B;  2ZGM A;  3H1Y A;  3PU3 A;  1PMJ X;  4YW6 A;  3N35 A;  5C9A B;  4QX7 A;  2E33 A;  3VDB A;  1JH5 A;  2BNN A;  5CVR A;  1LU1 A;  3OBZ A;  1DLL A;  2FDH A;  5CBL A;  4K40 A;  2WNV B;  4FPO B;  4CP2 A;  2MEV 3;  1OQ1 A;  2WAO A;  3NWK A;  1G6N A;  2Q0A A;  2ZEY A;  4BOW A;  2CDP A;  3SKV A;  4DFS A;  4CEY B;  5JLV A;  2ZX1 A;  3MIE A;  1J3P A;  3BAL A;  3WDX A;  3ZSK A;  2D3R A;  4XIL A;  2VQ0 A;  4CCD A;  4Y1Y A;  5JXJ A;  5FIX A;  4FOY A;  2YPD A;  4CEW B;  3AZZ A;  4LHL A;  4XE9 A;  2VMD A;  1NA1 A;  2WNV A;  3KV6 A;  2ZX3 A;  3BYW A;  1UXX X;  3TNQ A;  1H6Y A;  4YM1 A;  3I3D A;  3OGJ A;  5IAT A;  3QBQ A;  2JE9 A;  3WF1 A;  4L99 A;  1RUC 3;  1RUN A;  2EXH A;  4Q4X 3;  1W6N A;  4NVP A;  4CP9 A;  3FLP A;  1O6U A;  4IUG A;  4DY3 A;  4I30 A;  3HNM A;  3M8L A;  2HYX A;  5F5Q A;  4UF0 A;  5FBZ A;  3VZL A;  4CXX A;  2F4P A;  2ZKL A;  3FBY A;  4OMD A;  4YYO A;  3KB5 A;  3X29 B;  5C4W B;  3LPF A;  4BWO A;  1AXZ A;  1XPW A;  3FBM A;  1RED A;  1VBB 2;  1IQA A;  1YQC A;  4LIU A;  1CIW A;  5DPN A;  4AHZ A;  3NMB A;  5FFO C;  2ZGT A;  1K3I A;  4HK9 A;  4UF0 B;  2P37 A;  5L7O B;  2AEZ A;  4AHX A;  3MIF A;  1ZZ6 A;  5KHJ A;  3Q9O A;  2V5Y A;  5GZC A;  1QH7 A;  1LES A;  5J09 A;  2VBB A;  2VZV A;  1AYN 3;  1EAH 3;  3NKG A;  1DU3 D;  3PJY A;  5KHI A;  3W20 A;  5FYT A;  4L8Q A;  4XXP A;  1XE7 A;  2VAU A;  2Y6G A;  4D6S A;  5L7O A;  2BU9 A;  3AVS A;  4IEZ A;  2WS9 1;  2HWC 2;  3NNF A;  5JXH A;  2WDB A;  4NPL A;  4MGY E;  3ZYH A;  3VBR A;  5DUX A;  2J7M A;  4BDV B;  4XUN A;  5JSP A;  4GAZ A;  4IV3 C;  1S0I A;  5LRR A;  2PA7 A;  5FPX A;  2VH9 A;  4CCO A;  4LK6 A;  4ZKT B;  1PHM A;  2JXA A;  2Q4S A;  2WYS A;  1RB8 G;  1UD1 A;  4XHB A;  1TMF 3;  4DUW A;  2WKK A;  1GZW A;  2C9K A;  1POQ A;  4COW A;  1L3J A;  1GYK A;  1NA1 C;  2DDU A;  1MS5 A;  2WNV C;  2VW2 A;  4MXV A;  2WLQ A;  3WQ0 A;  2VO5 A;  4BQW A;  5CEH A;  1VRH 3;  4BQ1 A;  4FXK B;  3ZR6 A;  1XYP A;  3THP A;  3VDA A;  1ZZ7 A;  3DUI A;  1GZW B;  2FMD A;  1Z7S 1;  5LY1 A;  4WM7 A;  3PL0 A;  2B7Y A;  1FPN 3;  3PIJ A;  5JI7 A;  3FL7 A;  1W8H A;  2RM2 2;  3HNY M;  3N7M A;  5A6Q A;  4B7E A;  1W0O A;  3CJI B;  1OI6 A;  5IVV A;  3RI9 A;  3OD0 A;  2GH2 A;  2HWD 2;  2XKO A;  3VBO B;  2WZE A;  4B7K A;  1ZA7 A;  4HN1 A;  1WD4 A;  2WII B;  5EP9 A;  1HJF A;  2BP6 A;  3NJV A;  2RS3 3;  5I8S A;  5KHG A;  1NCQ B;  1LOF C;  3HWJ A;  4YM2 A;  2UUR A;  4GZ9 A;  5IAX A;  3E6C C;  2WRA A;  5I8Y A;  1NLR A;  4JTO A;  1VB2 A;  3N9P A;  5C4W C;  5FYH A;  3MO4 A;  5DN2 A;  1AX1 A;  3IDE A;  2VNR A;  1COV 2;  3III A;  4KBZ A;  2ZEW A;  2CWS A;  3CMG A;  1W8U A;  3TOJ A;  1MS1 A;  1RL3 A;  4HK8 A;  3I3B A;  3AP6 A;  4IGO A;  3JU9 A;  3W5N A;  3UGH A;  1IPJ A;  4PF5 A;  2WQ4 A;  2RS3 2;  3OTF A;  4N7I A;  3VKO A;  4K7J A;  3MLJ A;  1F8V A;  3MLL A;  4DRR A;  2WQ8 A;  4DMI A;  4HKW A;  1PGL 1;  1NX9 A;  2JE7 A;  3VL9 A;  3MW2 A;  4LA2 A;  4CUB A;  4LLF A;  2GME A;  1S0F A;  4H2A A;  5DG2 A;  2EID A;  3M3Q A;  3O1R A;  5FZM A;  1R08 3;  2OA2 A;  2VUJ A;  2J1A A;  3MYX A;  4N7U A;  3LD8 A;  1MS0 A;  2VOV A;  2VZ1 A;  3SIS A;  4JDN A;  2RR1 2;  5ACA 2;  3ACG A;  3M1H A;  5CZK A;  2W9X A;  2NMO A;  4IE5 A;  4U36 A;  5JMO A;  1RUD 1;  3U4S A;  2DU0 A;  2VXR A;  4RYD A;  1Q43 A;  4NRP A;  1ZZ9 A;  1WCU A;  4AI2 A;  1GMM A;  1E57 A;  2QQU A;  3LQC A;  2J1E A;  5LAT A;  3MFA A;  1JN2 P;  1KEX A;  5F5I A;  2ATF A;  4EWD A;  4OFG A;  1TMF 2;  5DG1 A;  4UFI A;  2VOX A;  1AL2 2;  2JDU A;  4RSU A;  3O0V A;  3JUU A;  3EMR A;  1ZNP A;  4W4Z A;  1YRZ A;  2ZEZ A;  5JZG A;  1Y9Q A;  2UYB A;  1LOA A;  3Q8B A;  2E7T A;  3GF6 A;  4IEY A;  4NR1 A;  3T0D A;  3BUC A;  4RGA A;  2ZHK A;  3AKR A;  3I2J A;  1QMJ A;  1H2M A;  5IVJ A;  3UGF A;  4CCJ A;  1CAX A;  4CDX B;  4WVW A;  2EAL A;  4WM7 C;  5FP3 A;  1AYN 2;  4FP2 A;  1HRI 1;  2A70 A;  3NV3 A;  4A45 A;  1CQ9 A;  4CEW A;  4AVV A;  3CBN A;  2QFE A;  3K48 A;  5JIA A;  3Q8F A;  1NCQ C;  5FZI A;  4COY A;  1H2K A;  3IM0 A;  3V0B B;  5B2G B;  3EHK A;  4AFC A;  2GC3 A;  4GMP 3;  1TVG A;  3FZ3 A;  4WVM B;  4CP9 B;  3D0J A;  4XAB A;  5L19 A;  1CJD A;  4K1Y A;  3LIH A;  1NG0 A;  2XJQ A;  3AL6 A;  4YFW A;  1UW8 A;  2W87 A;  3AKQ A;  4UYB A;  1O4Y A;  3BOW A;  5BXX A;  1UMI A;  4R9B A;  4TWT A;  3WNM A;  2WIN B;  3WZ1 A;  5BY5 A;  4LBL A;  1RUO A;  3HBK A;  1BBT 1;  1AXY A;  2YGL A;  3VBF B;  3MUZ 1;  1MS8 A;  3TN9 3;  4RL7 A;  4QHO A;  1KDM A;  3N3H A;  5IVC A;  3ASI A;  4Q4X 2;  3O14 A;  2VME A;  1AR7 1;  3UK9 A;  4I3G A;  1KQR A;  4GH4 A;  4KWJ A;  4YM0 A;  1YJK A;  2HEW F;  4Q4Y 3;  1XNK A;  5FZ8 A;  5H9Q A;  3T4H B;  2VY0 A;  3POF A;  5D8A C;  3TBD A;  1LNS A;  1US3 A;  1VMF A;  5T5J A;  2ZAA A;  4KG0 A;  4ITC A;  2JJ6 A;  3H3L A;  2RG4 A;  5EJZ B;  1C28 A;  3PUR A;  4BQ5 A;  1AR7 3;  1RVF 2;  3SH4 A;  1W2T A;  1LJ7 A;  2JDH A;  2BVB A;  4AOC A;  3WNL A;  2YDE A;  4AI0 A;  1ODN A;  2ARE A;  1HX6 A;  4ORF A;  3A21 A;  4XF4 A;  3VBR B;  1ZBE 2;  4TYS A;  4FPK A;  1BBT 3;  4R52 A;  1LHU A;  3T2Q A;  2YY1 A;  4TLF A;  3VZJ A;  2X8K A;  1WW7 A;  2DBI A;  5HBA A;  2FZ2 A;  2HWF 3;  3SH3 A;  2D98 A;  2W1U A;  1HV1 A;  1UYZ A;  4PIX A;  2JG9 C;  3I3E A;  4F3J A;  4GMP 1;  1UY1 A;  3EBR A;  1HQW A;  2ERF A;  4XF1 A;  3NV2 A;  4HSL A;  1DP0 A;  5CIR A;  2EIB A;  2ZGO A;  3LZZ A;  2VVF A;  1JOP A;  1XNB A;  3HIF A;  3JB8 A;  1YFY A;  3LB9 A;  3ENR A;  3ZDS A;  4Y4Y A;  4COZ A;  2R7E B;  4MGS A;  3O1V A;  3KHB A;  4LO6 B;  3FJS A;  3AP4 A;  3AZW A;  3IKW A;  4BQ2 A;  2DUR A;  3THC A;  2RM2 3;  3D8C A;  2IXC A;  4EN0 A;  1SLI A;  3B00 A;  1W8N A;  4BM8 A;  4D3W A;  2GAL A;  4N43 A;  1AX0 A;  3NJZ A;  1DFQ A;  3VKM A;  1YXW A;  3VKF C;  1BHG A;  1DGR N;  1BLZ A;  1VBD 3;  2XOM A;  3KCY A;  1JYW A;  2XR4 A;  3TAY A;  2PHU A;  1VRH 2;  5FJH A;  1U5X A;  1YQ6 A;  2FMY A;  4GMP 0;  5F6K A;  1O3S A;  1O59 A;  4XJA A;  2I45 A;  3SCF A;  3UGG A;  1NCQ A;  4TXW A;  2JG8 B;  4R8H A;  5CKQ A;  1I5Z A;  3CKH A;  4LPL A;  2PHL A;  1YLL A;  4DY5 A;  4QT6 A;  3PMS A;  1PMH X;  2CGO A;  4B1M A;  1V6K A;  4S2H A;  2YUE A;  1NKG A;  3BCW A;  3AFK A;  1DYK A;  2W91 A;  2DUQ A;  1GNY A;  3GAL A;  1G9A A;  3LA2 A;  4DIN B;  1J84 A;  1IG0 A;  4N53 C;  3WG1 A;  4PI2 A;  5CFC A;  1RJ8 A;  2BOI A;  3VD7 A;  1D4V B;  1CAV B;  3O0W A;  1VR3 A;  3BU0 A;  4IV1 B;  3PUA A;  5LWB A;  4AEK A;  1JU4 A;  1LEC A;  3VD9 A;  1ZRC A;  1VLN A;  1QNY A;  3G6J B;  3KF3 A;  2ORZ A;  2R16 A;  2XXZ A;  2A7A A;  2B5H A;  2WA3 A;  1APN A;  2XQR A;  1X8E A;  3P3N A;  1AR8 3;  3NAP A;  4XAA A;  2BYV E;  3BPS A;  4GWJ A;  2OW4 A;  4YG0 A;  2TBV A;  5EJ3 A;  5F2W A;  3RS6 A;  3H7Y A;  4B4R A;  3ZYJ B;  5T52 A;  5CG9 A;  2WL1 A;  1CR7 A;  2PHD A;  2WC2 A;  4JAA A;  4Q4V 3;  4QDR A;  4DRV A;  2VQU A;  4WVV A;  4P9I A;  4XJZ A;  4YW1 A;  1HRV 2;  2IUW A;  5IJR A;  3ZXJ A;  1S55 A;  2OQ7 A;  3K75 B;  1EPZ A;  3TYJ A;  4IV3 A;  5AC9 2;  1JZ3 A;  4NRM A;  2OKX A;  4MGI E;  4CPB A;  2G4I A;  2CAU A;  5A7Q A;  4FSJ A;  2XL7 A;  2YHJ A;  2JG9 A;  3MUY 1;  2B45 X;  2JD9 A;  5FZO A;  2A3W A;  1E5S A;  2A73 B;  5C9A C;  3R6S A;  5FPU A;  2QQP A;  3BOP A;  1LOB A;  4QQO A;  3VHP A;  2XQX A;  2PAK A;  3NV1 A;  1AYM 2;  5J36 A;  1RMU 1;  1S0D A;  1RUG 3;  1YC6 1;  4FQ4 A;  2WNU C;  2VBP A;  1LOC A;  1OLM E;  4EN6 B;  1ULC A;  1XSQ A;  2D6L X;  3KCX A;  1DG6 A;  2P3I A;  4XUT A;  1BK1 A;  4C8D A;  1JYV A;  1IPS A;  2BER A;  2R49 A;  5KXB A;  3P3P A;  1WA6 X;  1AR8 2;  3J26 N;  2QUO A;  4PT6 A;  4Q4V 2;  3O1P A;  2EXI A;  5FZA A;  3UET A;  4G4F A;  4KU7 A;  3CO2 A;  2BV4 A;  2RS1 3;  2XJV A;  3GCX A;  4RR3 C;  3ZSE A;  4ERO A;  5F3C A;  1BJQ A;  3ZFG C;  1TNF A;  3BGA A;  1HB2 A;  1RUI 1;  1RUH 3;  3B3Q E;  4M0N A;  4NHX A;  1GNH A;  2RMU 2;  2WWU A;  2W1W A;  2Z5W A;  3LDK A;  1W8W A;  4S2F A;  5D8A B;  1CVN A;  2P2K A;  2R0H A;  3CZU A;  3LKJ A;  3P5B A;  4AED A;  1UZY A;  3SMH A;  1ENQ A;  3AYA A;  3PNA A;  4MYE A;  4BQ4 A;  5KHK A;  3MFC A;  5F3G A;  2Y6K A;  5JZG B;  2NM1 A;  2SBA A;  1QWR A;  4OHX A;  4RS5 B;  5GAL A;  2XHN A;  3PLQ A;  1JXN A;  4QX1 A;  4UFK A;  2JDK A;  2W52 A;  2ZML A;  5B4N A;  2QVS B;  5CA6 A;  1OKQ A;  2J1T A;  3DYM A;  1HB1 A;  3WV6 A;  4AI8 A;  1ZA4 A;  4P9G A;  4COU A;  4AED C;  2P6H A;  1AHS A;  4NJ4 A;  5EPA A;  3USU B;  3VBU B;  2JEC A;  4PLO A;  2PYT A;  4DEQ A;  1ND3 A;  5FZE A;  1W3V A;  3ZYR A;  4LBN A;  1PZ9 A;  5DZG A;  2B8M A;  1L7Q A;  1W2O A;  1OA2 A;  3E6B A;  2X29 A;  4CEW C;  4CU9 A;  3DPR B;  3JB4 C;  3OY8 A;  4YW5 A;  2P1B A;  4QXB A;  4CU6 A;  4XJU A;  5F3E A;  3I2O A;  3RWN A;  4UI9 L;  1G9F A;  1RIN A;  3POI A;  3GZE A;  3GZA A;  4Y22 B;  5EZW A;  3ST7 A;  1ND3 B;  1ODM A;  2VL4 A;  3EQE A;  3IDA A;  4OUL A;  2GZW A;  5FY4 A;  3IPV A;  1PZ7 A;  2DCJ A;  3N7L A;  1I9R A;  3DEM A;  1RYY A;  3ZN5 A;  1H8T A;  3TRS B;  4FBF A;  1WLD A;  4PHZ A;  4MXW A;  4A2U A;  4UOJ A;  3HAG A;  5F6L B;  1YYN A;  3DPR C;  3T1L A;  3RZH A;  3IPV B;  1YI9 A;  5FBJ A;  1NCR B;  4L92 A;  1H1I A;  4BLJ A;  5IHR A;  1IZ3 A;  1N1Y A;  1J58 A;  1WLT A;  1VAV A;  3ZIW A;  1UU4 A;  2VVD A;  3N9L A;  1CPM A;  4FFH A;  4N43 B;  4EN7 B;  1C1F A;  3LFI A;  3WHT A;  4XFA A;  2DCK A;  2CYF A;  4QDS A;  1W03 A;  1MQT C;  2JEN A;  3WX5 A;  4I01 A;  1ONA A;  1ZBE 3;  2VMG A;  3ALQ A;  5FMO S;  3WNX A;  3VBH B;  1IOA A;  3FN9 A;  2A6Z A;  3GHM A;  3MBW A;  4MV2 A;  2X10 A;  4NHM A;  2XML A;  3NL1 A;  1HW5 A;  4J1X A;  4LE4 A;  4GWI A;  5LAS A;  3K2O A;  2ZHL A;  3APB A;  4KGQ A;  2JB8 A;  4LIV A;  4D8M A;  5ISL A;  5FP4 A;  2B9V A;  3W59 A;  5I91 A;  4C91 A;  5FO9 B;  3RYP A;  3VV1 A;  2P6C A;  4CXW A;  1W0N A;  1DF0 A;  4BU2 A;  1POV 3;  4A41 A;  3VHO A;  2DCY A;  4QD2 A;  5E16 A;  3B5L B;  4WZC A;  1ENX A;  1ND2 A;  3T0B A;  4DPN A;  3C8X A;  4AYU A;  4COV A;  1UY3 A;  3TN9 2;  3HVD A;  1G9C A;  1UYX A;  4QXH A;  2VMI A;  4IEX A;  4IV1 A;  3DEC A;  2C4X A;  4QPY A;  4AGV A;  1KS5 A;  2BOJ A;  2W2I A;  1P8J A;  1R1A 2;  1JI6 A;  1QXP A;  5FY0 A;  5C8C C;  4H14 A;  4LR4 A;  4QGL A;  5FP9 A;  3DL3 A;  3TEY A;  1KJL A;  1GR3 A;  4PCR A;  4UW4 A;  5IUQ A;  4O65 A;  1ND3 C;  2JX9 A;  1I1E A;  3CJI C;  1GOG A;  5BNN B;  1LUL A;  2HJI A;  3ORJ A;  2P3J A;  5FOJ B;  2QQI A;  4ASL A;  2XON A;  2GDF A;  1GLH A;  1XE0 A;  4GKY A;  4YG6 A;  4XDO A;  5I93 A;  1WZX A;  1D4M 2;  3A0N A;  3S7I A;  4OZO A;  4H3W A;  3OPW A;  5SV5 A;  2BW8 A;  1LTE A;  2BBA A;  1R64 A;  1RMU 2;  4W6Y A;  1R1A 1;  1AL2 3;  4YZ4 A;  5GLW A;  5JOZ A;  1OXC A;  2Q1Z B;  4RR3 B;  1W9F A;  4AVA A;  3O1S A;  3MHZ A;  3CF6 E;  4RHV 3;  1O4Z A;  2FZ1 A;  3LEK A;  3RDI A;  4RA0 A;  1QJX 1;  3OEB A;  2BQP A;  1TG7 A;  2FD8 A;  1PZ8 A;  3AYE A;  1RUF 2;  2V5D A;  4WM7 B;  3DCQ A;  5KBF A;  4RR3 A;  2W1Q A;  3ZFE A;  4Q0P A;  1I3H A;  5A3O A;  1YJL A;  2A3X A;  4NHY A;  3T2T A;  4LHS A;  3MV1 1;  4LUK A;  1QJZ A;  2YGM A;  4QKN A;  4HKL A;  3K4D A;  5FAX A;  5FV3 A;  2UY9 A;  3T1M A;  3PTY A;  5BNO C;  1ASJ 2;  3IWZ A;  2VMF A;  4CRQ A;  4RFR B;  5LEK A;  1SEF A;  5BYN A;  1WME A;  4M0H A;  4URA A;  2PHT A;  3A0K A;  1NUK A;  3AP9 A;  3H0O A;  5D8A A;  5EYY A;  1MZ5 A;  3HBZ A;  3JBG 3;  3I54 A;  3NQH A;  4CDQ B;  5K8S A;  4GIQ A;  3ILR A;  5DAP A;  2VOW A;  2TNF A;  1IS6 A;  2DVB A;  4JKK A;  4CU8 A;  1DZT A;  2PLV 3;  4YZ2 A;  4FI9 A;  1POV 0;  4MZU A;  4XTP A;  4XUO A;  1X9P A;  1COV 3;  1E5R A;  2VW1 A;  1KFX L;  1E5H A;  1V6I A;  2IXL A;  2WA4 A;  2HWE 1;  4UWD A;  4FQZ A;  1YEW A;  2I74 A;  3FHI B;  5HCH A;  2D93 A;  5FZ7 A;  3AMQ A;  3GGL A;  1XXN A;  1UMZ A;  3MPB A;  3USU A;  4XFI A;  2VGD A;  1W0P A;  2PLV 2;  4BB3 A;  2OX0 A;  1SLB A;  3I8T A;  1XU2 A;  2WUH A;  4XTM A;  4ZY9 A;  4AW7 A;  3HT1 A;  1AR9 2;  1VBB 1;  5A7N A;  3R4U A;  4UFJ A;  1K5M C;  3T2O A;  3VBS A;  1S1A A;  1NLQ A;  4LUM A;  1H1A A;  1W6Q B;  3OY8 B;  2DYC A;  2PAM A;  3CEW A;  3GCW A;  3GNE A;  4YLZ A;  5FPZ A;  5I8T A;  1PGW 1;  1ULP A;  1ASJ 3;  3KGZ A;  1MVE A;  2R32 A;  3LDB A;  4YW7 A;  2EIC A;  4QX0 A;  3ZLI A;  3IAQ A;  3BKZ A;  5IW0 A;  4YGC A;  3ZFF B;  3AYC A;  1AR6 3;  3B9I A;  3IAP A;  4IEU A;  4MXW B;  1W6O A;  1C8M 2;  2E7Q A;  1FI2 A;  3ACH A;  5JZG C;  2E63 A;  4B1L A;  1T2X A;  1DGL A;  4H55 A;  3ZIX A;  4FAH A;  1NCR A;  4NAO A;  2QQO A;  3ETQ A;  3OCP A;  4XUQ A;  1HRV 1;  2ZGN A;  3J7N A;  3NJY A;  2QQW A;  1PGL 2;  4LHK A;  5E8A A;  3MF6 A;  1H1M A;  4NN0 A;  5FXX A;  4XXA A;  1ZZ8 A;  3ZN6 A;  3QOP A;  1SLT A;  2E31 A;  3IN9 A;  1YIP A;  1EAH 2;  1UY4 A;  1J3Q A;  2ORX A;  1PK6 A;  2QDR A;  1Y9G A;  2R04 3;  3JD7 2;  4HPK B;  4PIY A;  4PF1 A;  3USS A;  1RUH 2;  2OQ6 A;  4WVM A;  1JU3 A;  2W5F A;  4JQT A;  4IQP A;  4H7L A;  1W8F A;  4E2G A;  5JR7 B;  2XGX A;  1WW5 A;  3TEW A;  2BDR A;  3J8F 2;  2FQP A;  1PK6 B;  2DTW A;  4PDW C;  4QHB A;  4ZS3 A;  3N36 A;  4ZU7 A;  3I2H A;  1GBG A;  1VBD 1;  1JOB A;  1ZRI A;  5HCA A;  4H7M A;  1V6O A;  1W6N B;  3WNK A;  2ENR A;  5A7W A;  4ET7 A;  4D6R A;  1J83 A;  2Y8K A;  1PGS A;  2IFR A;  1KD7 A;  3NV4 A;  1IPK A;  4MGQ A;  2EXJ A;  1FV3 A;  1OLR A;  2D6K A;  2IXK A;  2RM2 1;  3BB6 A;  3IB3 A;  5DZF A;  5EXO A;  3FMG A;  1ST8 A;  4Q2F A;  4GH4 B;  1VB4 A;  3C3V A;  3JXS A;  3LGR A;  4RQP C;  4YW3 A;  1QU0 A;  4F8A A;  4CZS A;  1QJU 1;  4OZX A;  4X6R B;  5C4W A;  2Z42 A;  1W9Y A;  2D5H A;  3PIG A;  3U10 A;  3QH6 A;  3ZOI A;  2R04 1;  4JDM A;  5E6H A;  4A7Z A;  1VBC 2;  4BE3 A;  1YHF A;  2QQM A;  5DDJ 2;  5D2A A;  1GQG A;  1NOV A;  4FTS A;  2OS2 A;  2Q1M A;  4FFG A;  4YVW A;  2HWF 1;  5C3R A;  1DZR A;  4P5Y A;  2XLG A;  3KT7 A;  3J4U H;  1SLA A;  4B8E A;  2IC1 A;  2DVA A;  4KWL A;  3A4U A;  4LKE A;  5F5A A;  4MO3 M;  3FX3 A;  5F39 A;  4AK3 A;  2RE9 A;  3KS7 A;  1KFU L;  1HRV 3;  4JHZ A;  5A3U A;  1ZYB A;  2A5Z A;  3OG2 A;  1SFN A;  2J42 A;  1UZ0 A;  2YU1 A;  4Y5Z 0;  4NO4 A;  4XFH A;  4YVS C;  2Q8D A;  2LRO A;  3AFG A;  4NID A;  5FLJ A;  1WMD A;  3WEZ A;  4ASM B;  4F7Z A;  2ET7 A;  1W9W A;  3NKT A;  5DAV A;  4CUA A;  3BVC A;  3SLI A;  1V9U 2;  2ZAC A;  1X9T A;  1JYI A;  3WCS A;  1UOG A;  2R04 2;  3JD7 3;  2Y0I A;  4B4P A;  5JPN B;  2FCT A;  4LBO A;  4CVU A;  2VMH A;  3ILF A;  4BK5 A;  1Q8S A;  4EE2 A;  3GBF A;  4V2W A;  5C70 A;  4LBQ D;  4R4X A;  1ASJ 1;  1DQ0 A;  4MH0 E;  4CPB D;  3H50 A;  1WCS A;  1FV2 A;  3I97 A;  1MZE A;  3ZYF A;  2W46 A;  3ZFE B;  4HVQ A;  1W99 A;  1WA4 A;  2YFU A;  1MS4 A;  4IES A;  4DXZ A;  1CZT A;  3RGB A;  2VE1 A;  2IFW A;  3AYD A;  2YU2 A;  3FLT A;  1ZZC A;  4FFI A;  3ZSJ A;  2XVK A;  3LWC A;  4GWN A;  4AR2 A;  4AWD A;  1MAC A;  1ZBA 1;  4JQR A;  2XBO 3;  5BNO B;  4UAP A;  4I0W B;  3UES A;  3ZXE A;  4XF3 A;  5JI9 A;  1UAI A;  2JG8 A;  2FDJ A;  3B93 A;  4Y1U A;  4TZD A;  1UIK A;  1R09 3;  2CDO A;  2DFB A;  4JGZ A;  4L97 A;  4OI4 A;  2PHX A;  5HCF A;  3ZPY A;  1DQ2 A;  2XJP A;  3H1W A;  4IDZ A;  2DFC A;  2HBU A;  4BIO A;  4NIH A;  1CZV A;  5BNO A;  1W2U A;  1AJO A;  3ACI A;  5LEJ A;  3N7J A;  1O3Q A;  1HRI 3;  2VCC A;  3VUO A;  2PLV 1;  1BYH A;  3POJ A;  4OHY A;  2HH9 A;  2H6B A;  3LFM A;  4LBQ B;  5CFC B;  1SCS A;  2K46 A;  5FZC A;  1AL0 G;  4JGZ C;  5FZ0 A;  4HT1 T;  2X53 S;  2PHR A;  2XUE A;  5FWE A;  3ZFF C;  1OF3 A;  3QH7 A;  5GLU A;  3S5A A;  2WN3 A;  4OYU A;  3AX4 A;  4AVB A;  1DQ1 A;  2HWC 3;  3ZXK A;  3EB7 A;  4AVC A;  3GXU A;  1QJY 2;  3OUI A;  2EXK A;  3AM2 A;  3NAP B;  4QU2 A;  3GBG A;  3WF0 A;  1W6Q A;  3ZXL A;  1NYW A;  1WCK A;  2GNB A;  3WW2 A;  1V70 A;  2RV9 A;  4HKO A;  1GZ9 A;  1V0A A;  1MPX A;  2P3Y A;  1V9U 3;  1QOS A;  1WCQ A;  2RS1 2;  4LO8 A;  1XNT A;  4NPR A;  2HWD 1;  4YVS B;  1O3T A;  1C8M 1;  3NNJ A;  2FDI A;  2Z79 A;  3I7D A;  1PNF A;  4GKX A;  4XQW A;  2RDR A;  5FO7 B;  2WT1 A;  3ZYB A;  3E5U A;  4K8R B;  4ZZ8 A;  1TNR A;  2DF7 A;  5IYY A;  3WT3 A;  4YGD A;  3O0X A;  1YQ2 A;  1AL2 1;  1YO8 A;  1R1A 3;  4FFF A;  4Y33 A;  4YVS A;  3VN4 A;  4FOQ A;  5FZO B;  5T3N A;  4WVZ A;  1D2S A;  3CDZ B;  3GZU C;  4P9L A;  2WYF A;  1IHM A;  2FDG A;  1U12 A;  3LEG A;  3AMP A;  3C7H A;  2CNA A;  5AFB A;  3WW3 A;  1OVS A;  5FYM A;  2VXJ A;  2KM2 A;  5CNA A;  3EJK A;  1RUC 2;  3UL2 A;  3HQR A;  4HZF A;  4Q26 A;  5FYI A;  2DVD A;  2YBP A;  1VBC 3;  4B4Q A;  4OLL A;  3K46 A;  1LHW A;  5CAZ A;  3KV5 A;  5A3N A;  4QMA A;  4PLM A;  3C7E A;  5K0U B;  2J1S A;  1JYT A;  2WS9 2;  2Y26 A;  2HWE 2;  2ARB A;  1H4H A;  2CSG A;  2NPI A;  3AMN A;  4MET A;  4PBO A;  4AI3 A;  3VKL A;  2VJX A;  4Z2W A;  3B01 A;  5K0U C;  1QIQ A;  1TME 2;  2YFZ A;  3OGV A;  5JXI A;  3WW1 A;  1WUV A;  5EFU A;  2RS3 1;  4OMC A;  1DQ6 A;  3NVC A;  4E4H A;  3VZO A;  4OI1 A;  4AED B;  5DMY A;  3VBU C;  3PME A;  5CKM A;  2E6V A;  3AMH A;  5TSW A;  1N47 A;  4NUB A;  1CES A;  1HQL A;  2CV6 A;  4HMZ A;  4Q29 A;  1Z7S 3;  3Q8E A;  1TEI A;  4SLI A;  3RZK A;  2L9L A;  3KV4 A;  1NXM A;  5F2S A;  2O8Q A;  3OEA A;  4XET A;  4NHK A;  5FYV A;  4XOG A;  1LGB A;  1QOO A;  3LDR A;  3VBR C;  3VBF A;  1KJR A;  1VRH 1;  1MS9 A;  2XDV A;  3O1U A;  1QQP 2;  2W68 A;  4RN5 A;  4P9J A;  4LO5 B;  2E26 A;  1WW6 A;  4YZ3 A;  4YVW B;  1TMF 1;  4CDW B;  4LOR A;  2ID4 A;  3IT8 A;  2IXJ A;  1PVC 2;  1V00 A;  5JIU A;  1XB9 A;  4CDX C;  1RUJ 1;  3KT4 A;  4TN7 A;  4WM8 A;  1D4M 1;  1MEC 2;  3J8F 1;  2Z2S B;  1OD3 A;  1W8O A;  4A6O A;  3KT1 A;  2FDK A;  1RXF A;  2OPW A;  1VBD 2;  1W06 A;  4NIA A;  3SXW A;  4C0H A;  1GWL A;  2BTV C;  4XQD A;  3T0A A;  1PO1 3;  2YG0 A;  3K4Z A;  5JOX A;  1LAJ A;  4LHN A;  5FCC A;  2GAU A;  3T30 A;  3POW A;  5FWJ A;  1S0C A;  3WDW A;  1ZZB A;  5EYX A;  3D5O A;  2F17 A;  2Y6F A;  3O7O A;  2XL9 A;  3LF7 A;  5BNQ A;  2D7F A;  1AUY A;  2GP5 A;  4KL1 A;  4UBG A;  1YI7 A;  1N3Q A;  4TSV A;  4XFC A;  5F3I A;  2BRT A;  4E8C A;  1SZB A;  2P4E A;  1VBE 3;  5FP7 A;  3T3Y A;  3VDD C;  1G86 A;  4WBB A;  2D6M A;  2RJ2 A;  4QQ2 A;  1U0A A;  2HWF 2;  2VD7 A;  1VAM A;  2BZD A;  2NMN A;  5T5L A;  4IL7 A;  3ZN4 A;  2WQZ C;  3U78 A;  4JGY A;  3U1X A;  2JE8 A;  3R4S A;  4QPG B;  1EUU A;  1C4R A;  2IZW A;  4P9W A;  3AB0 A;  4Q4X 1;  4HFS A;  1K12 A;  3AKT A;  3UKN A;  1RUC 1;  1ZX5 A;  2RS5 1;  1PO2 2;  3AVR A;  5F8P A;  5FUI A;  4YPJ A;  4M00 A;  2F6B A;  4ISQ A;  4IGQ A;  1LCL A;  1BEV 2;  1OOP A;  2J1U A;  4MOA A;  4QXC A;  3V56 A;  4MG2 A;  3AJZ A;  4XJ8 A;  1LGN A;  2WO3 A;  1LGC A;  1KS4 A;  3BTA A;  1PMI A;  4LBK A;  2HEY F;  2P17 A;  1EP0 A;  3OYW A;  4J1W A;  5L9V A;  5C8C A;  5M0T A;  2I07 B;  3FFQ A;  4P02 B;  2ZGR A;  4GB3 1;  3PUQ A;  4K6B A;  4Y26 A;  3VD4 A;  5IAV A;  1G9D A;  1CAW B;  1PM4 A;  1QXR A;  3WR0 A;  3SKJ E;  2DCT A;  2CU5 A;  1RUH 1;  4LT5 A;  2E53 A;  4IGP A;  4YVW C;  3IZO A;  4JKL A;  5A7S A;  3MIG A;  1A8D A;  1AR9 1;  4Z8B A;  1AF9 A;  1LRH A;  3POY A;  2ZGU A;  2RS1 1;  3NO8 A;  3C7F A;  1CAW A;  1S0J A;  3HN1 A;  3I49 A;  3WSO A;  2ET1 A;  1STM A;  1PVC 3;  2JDZ A;  3DV8 A;  2UU8 A;  1OBN A;  1UZV A;  1QNW A;  2RMU 1;  1QF3 A;  2Y0O A;  3LPG A;  3MW3 A;  4X6Q B;  1Y7B A;  4D7S A;  5ABJ B;  3VBF C;  2VUD A;  1UIJ A;  4HSJ A;  2GC1 A;  1PIV 3;  4CU7 A;  3DXT A;  3WCR A;  1SBF A;  4NRQ A;  1GWK A;  1RUG 1;  4XBQ A;  3K3O A;  4E8D A;  4IND A;  4HLT A;  2ZPX A;  4YZ1 A;  2OII A;  5F9T A;  3RVH A;  4XFG A;  1Q3E A;  4UT5 A;  3J9S A;  2DU1 A;  4QU1 A;  3TNP B;  4JVA A;  3C2U A;  4LK7 A;  4PQ9 A;  2B46 X;  3LA3 A;  5C33 A;  2VBD A;  5FXZ A;  5T5P A;  5I0D A;  4K8F A;  5FPL A;  3QD6 A;  4O61 A;  1EV1 1;  2HLE A;  3D0S A;  3HR9 A;  2FBE A;  1JYN A;  2XPJ A;  5T55 A;  2GP3 A;  1V6L A;  2JEM A;  2UYA A;  4XBN A;  3OPZ A;  2DCZ A;  4QPI C;  5FR3 A;  2ZA9 A;  3BIE A;  1QDO A;  4XJ9 A;  3VZN A;  2ILM A;  1VBA 3;  4N53 A;  3ZVX A;  4YWA A;  1BCX A;  4DNY A;  3LOB A;  1QH6 A;  4DO0 A;  5FMC A;  1S2K A;  1OPM A;  5LBF A;  2E9Q A;  4XMI A;  1UY2 A;  3ZSL A;  5EQU A;  3A22 A;  4EWE A;  5FRE A;  1CZS A;  1OA4 A;  1CWP A;  3QAC A;  3N9Q A;  1UXZ A;  3I59 A;  2WFF 3;  1QDC A;  5FQ0 B;  1RUI 2;  2DVG A;  3ZPO A;  4BLI A;  4HAN A;  3N4M A;  5GZD A;  4CDQ A;  4M3C E;  1OOP C;  2Y64 A;  4B3N A;  3KGL A;  4BCU A;  3LCP A;  4XZU G;  3OD4 A;  5HV0 A;  1UX6 A;  4O7X A;  5FQ0 A;  4AQS A;  4LKF A;  2VUC A;  2ADE A;  2GMP A;  3SQO A;  4TTG A;  5IK5 A;  2QBX A;  4K20 A;  4URT A;  5FMD A;  2H0V A;  1XE8 A;  2GN7 A;  3CU7 A;  3RG0 A;  5G05 L;  3PU8 A;  1DGW X;  5H9R A;  1QGL A;  5A33 B;  2WWS A;  1DYP A;  3RRD A;  2A6X A;  4OI2 A;  4ARY A;  2J1R A;  4CDW A;  1Q8Q A;  1HB4 A;  3DGT A;  4ZON A;  1SAC A;  1J3R A;  1SQ4 A;  2C0Z A;  2VG9 A;  2VZU A;  4S2D A;  2DV9 A;  4WM8 B;  5IK4 A;  4FTB A;  1JZ5 A;  3ZFG A;  2IWG B;  3JZV A;  5A33 A;  1UU5 A;  5AFE A;  5L36 A;  4C1X A;  3KSC A;  3GJB A;  2WAB A;  5GJ6 A;  4AAP A;  5LCW L;  1AR7 2;  1RVF 3;  5A1A A;  3JBG 2;  1JTZ X;  1A6C A;  1M06 G;  1GZC A;  4KU8 A;  2G9F A;  2K2S A;  2XLF A;  3AKP A;  1EY2 A;  2VC9 A;  2K0G A;  3DPR A;  3RYK A;  3H8R A;  3ZKY A;  4MGT A;  4CCL A;  2TEP A;  3ZFG B;  1DLC A;  2YV8 A;  1JUI A;  2ARC A;  1FOD 3;  3NW4 A;  5GZE A;  4AG4 A;  1PO1 2;  5HXM A;  4BPZ A;  1W6P B;  5JOY A;  4WM8 C;  1WLC A;  4IXL A;  3VDC A;  4A6S A;  4NOT A;  5KR7 A;  1H8T B;  1PNG A;  3LEI A;  5DUV A;  4LO4 B;  1ULF A;  1DGR A;  1RUF 3;  2ZX2 A;  1FAY A;  4OUS A;  5LBB A;  4M4P A;  4XUR A;  3I3Q A;  4GH4 C;  2J22 A;  3VL8 A;  3ZM8 A;  3ZFE C;  3ZN6 B;  4DQA A;  1QOT A;  1W6P A;  1Y3T A;  4HON A;  1GOF A;  3PVN A;  2EVX A;  1JS9 A;  1XYN A;  3W21 A;  3ES1 A;  4FCA A;  3MV0 1;  4LKD A;  4XCA A;  4C0B A;  4KG8 A;  4OQ9 A;  4OQ8 A;  4QPG C;  4Q0U A;  5CG8 A;  2R06 1;  3ITQ A;  1HKD A;  2W39 A;  2W92 A;  3NNM A;  4XZP A;  1HB3 A;  3MLK A;  3PVO A;  5LA2 A;  3OUH A;  2ZX0 A;  4K3U A;  4PLN A;  2WZP P;  1W9T A;  4W8J A;  5DUU A;  1PX3 A;  3INA A;  1X50 A;  4M3C F;  2RVA A;  3TN9 1;  5C8C B;  2PTM A;  3S57 A;  3CL1 A;  1H0B A;  3MI8 A;  4GD4 A;  4OHW A;  5FP8 A;  5A7W B;  5ABJ C;  2BBV A;  3WY6 A;  5A3P A;  2JIC A;  1WBL A;  2V73 A;  3M3E A;  2CAV A;  1VMJ A;  2CGN A;  2WZ8 A;  2ZGP A;  3ETP A;  3GJA A;  2Q5T A;  3MGU A;  3ON7 A;  1LOD A;  2OUH A;  4EV0 A;  5F1R A;  3WUD A;  3KVB A;  4QAW A;  4AQ6 A;  4W6X A;  1XBF A;  3O1M A;  4FPH A;  4DUX A;  2WZR 1;  5A1L A;  3VZK A;  1OQD A;  3FWE A;  1UNB A;  3IMN A;  4JCK A;  1GSL A;  1YCI A;  4OUE A;  3UKV A;  3ZXD A;  2R0F A;  1GOH A;  4AFD A;  5FO8 B;  1UZZ A;  5DDJ 3;  2G1M A;  3D4K A;  1ND2 C;  2HEV F;  4G3Y C;  3IDB B;  3O1T A;  2ZEX A;  5ACA 3;  1B35 C;  5CFD B;  2UWC A;  1J1T A;  3OBR A;  3WP5 A;  5L9B A;  3RYR A;  1H4G A;  1X36 A;  2Y38 A;  3WVJ A;  5F32 A;  3POB A;  1C8N A;  1VPH A;  2BWC A;  2Y34 A;  2VNV A;  2VW0 A;  4EQV A;  2MEV 2;  1OLM A;  4EYU A;  1PIV 1;  4JX0 A;  2EIE A;  1OA3 A;  4QGN A;  1NLS A;  4QHZ A;  2WO2 A;  3H42 B;  4XDP A;  5KHH A;  4M01 A;  4QQL A;  4CA9 A;  5DUW A;  1ENR A;  1C3H A;  4XUP A;  4XFF A;  3OSD A;  2YBS A;  2QDN A;  4IET A;  5C3Q A;  3VBH C;  4FPY A;  3TEZ A;  1RUD 3;  3HPN A;  1DQ4 A;  1LHN A;  2JDA A;  1ZRE A;  4UFH A;  3U4X A;  3KV9 A;  4FOW A;  5FKC A;  2B39 A;  2QJV A;  4QX5 A;  5LW9 A;  1R08 1;  2H6C A;  3RI8 A;  3ME2 A;  4JKM A;  1RUE 3;  4LOS A;  3WG2 A;  4GB3 3;  2R07 1;  3HOB A;  3I59 B;  4X8N A;  2LW8 A;  1BVV A;  1G7Y A;  4ONU A;  2XVL A;  1LHO A;  4XF9 A;  2VTF A;  1NCR C;  4JGZ B;  1UKR A;  4LMF A;  2PFW A;  1LOF A;  5GLT A;  4LJH A;  4LNV A;  3ZO0 B;  1J59 A;  1SLL A;  4Q4W 1;  1WCD J;  3K51 A;  3AC0 A;  2PMW B;  2OUJ A;  3HQU A;  5KC6 A;  1K5M B;  4LE3 A;  4LBQ A;  5BPX A;  4FT8 A;  3AKS A;  2CTV A;  4A3Z A;  5I0R A;  3F95 A;  3PVB B;  3ZDV A;  4WV8 A;  1C57 A;  4XBL A;  1UZW A;  1UMH A;  1GQH A;  5C3P A;  3UNP A;  3E5Q A;  4BK4 A;  3WP4 A;  1G9B A;  2WLP A;  1DGW A;  1K5M A;  1IS5 A;  4RGG A;  3WF2 A;  1CX1 A;  5HV4 A;  1MZ6 A;  4BJ0 A;  1US2 A;  4N43 C;  4XDQ A;  3T4V A;  5FPV A;  2VQT A;  2WSV A;  5HXV A;  1SBD A;  1MEC 1;  4DZG A;  3L2H A;  2PQS A;  4L2N A;  4NHL A;  2PHF A;  1FNZ A;  4KQ7 A;  3RJR A;  3OB8 A;  1W04 A;  3MIH A;  4RFT 0;  1EV1 2;  3VBS B;  3B94 A;  3L9J T;  2ZHN A;  1GP6 A;  1PO1 1;  4K9S A;  1AYM 1;  1WWY A;  2O1Q A;  4YZ5 A;  1YQ8 A;  4PQQ A;  3ZXG A;  5L73 A;  1HN1 A;  2OXB A;  5L7O C;  4ZPI A;  1CGP A;  2OT7 A;  1BKZ A;  2V72 A;  3ZFF A;  1RUJ 3;  4EJR A;  5EWS A;  4AL9 A;  1W3X A;  2VU9 A;  2YXS A;  3WNO A;  4QB1 A;  5EV7 A;  1YIF A;  2RDS A;  4JC1 A;  3WDU A;  1C5H A;  5DAQ A;  1NXD 1;  4A42 A;  1JZ2 A;  1RGS A;  3WP3 A;  3MZH A;  1SHW B;  3LAG A;  2WS9 3;  1AYM 3;  1O5U A;  4HN0 A;  3SIT A;  2H0B A;  3UJO A;  1V6J A;  3FLR A;  2ARX A;  2P3K A;  3DKQ A;  1K5J A;  2VEC A;  4PDW B;  1BVP 1;  1AYN 1;  1EAH 1;  1B09 A;  3ACL A;  3I3M A;  2YRO A;  2C26 A;  4GJY A;  2Q30 A;  5A7O A;  5IVF A;  4ZS2 A;  1YUD A;  3ES4 A;  1MEC 3;  2JKX A;  2W3J A;  1XND A;  4BQX A;  4QX2 A;  1GP4 A;  4Z2A A;  4PDW A;  5F7U A;  4HPK A;  1O4T A;  2D6N A;  2LS6 A;  4YFZ A;  3BPZ A;  5A3M A;  1YFW A;  4RHV 2;  3ZKU A;  5A6Y A;  1Q8O A;  1V6N A;  1SDW A;  1EUT A;  5FZD A;  1OUX A;  4Y20 B;  5C71 A;  2YC2 A;  3JCI A;  4PI0 A;  3QCW A;  4XEZ A;  2A6V A;  1S4C A;  1REF A;  3N9N A;  1JHN A;  2ZX4 A;  5FZ1 A;  4QX3 A;  5CAD A;  3OGR A;  4YGE A;  1VBC 1;  2I2S A;  2UY8 A;  2Q8O A;  1Y4W A;  1W8T A;  3FUO A;  5DAB A;  3U75 A;  1W8Z A;  4CUC A;  2RR1 1;  4CDQ C;  5K0U A;  5IFP A;  4Z1V A;  2OPK A;  4AEM A;  1F4H A;  3RSJ A;  2R07 3;  1SPP A;  3T2P A;  2QKD A;  1S0E A;  1ALY A;  1IS4 A;  1N1T A;  1OD5 A;  1L7L A;  2MEV 1;  4CP0 A;  3VD3 A;  3OPT A;  3T09 A;  2PAE A;  2HBT A;  3POS A;  3E6D A;  4Q27 A;  4GQ7 A;  2WBK A;  5F5C A;  3MIC A;  3I2K A;  4LUL A;  4HBN A;  1OPO A;  5JXG A;  1C8M 3;  2VTX J;  4CSW A;  3MPP G;  1V9U 1;  1LR5 A;  2A75 A;  2Y6J A;  4D69 A;  4RQP A;  2CWM A;  4GA9 A;  3KQ4 B;  2V4A A;  3OGG A;  2XH6 A;  1SDD B;  4Y1X A;  1UX7 A;  1FOD 2;  2AUY A;  5ERL A;  5FMB A;  3SEE A;  5EIY B;  2QZ3 A;  1UOF A;  2JIJ A;  1DIW A;  3WOG A;  2NLR A;  2P5B A;  1F9K A;  2O8O A;  2ZGS A;  4D94 A;  1L7R A;  2AH2 A;  1ACC A;  5FZL A;  4QPI B;  4J6G A;  1UPI A;  1WGP A;  4A7Y A;  1F4A A;  2YB7 A;  4BIS A;  2GC2 A;  1W9S A;  1D0H A;  1XOY A;  5GLZ A;  2RJL A;  1FMD 1;  5I0T A;  1NE6 A;  5G04 L;  5H9P A;  4JGY B;  4CXY A;  1GFF 2;  4QPG A;  3HJR A;  4IEQ A;  5LA9 A;  4XJW A;  5DDJ 1;  4HET A;  5LBC A;  1OT5 A;  1GU3 A;  4NAM A;  4OHZ A;  4CEY C;  4PIZ A;  2VZS A;  2YBK A;  3Q8C A;  2WZR 2;  1PK6 C;  4W6W A;  2PEL A;  1K45 A;  3I2F A;  1H2N A;  1TZO A;  2BFU L;  2WZR 3;  3MEP A;  3SNM A;  4NPM A;  1JOD A;  1OOP B;  1CX4 A;  1QJU 2;  2A1X A;  3CJX A;  4A3X A;  3BTY A;  2OZ6 A;  1RC6 A;  4AFB A;  1R09 1;  3BTZ A;  2NQY A;  1OKO A;  1XU1 A;  5A3W A;  3AXE A;  4FAG A;  1GAN A;  1C5I A;  2X5I B;  2JDP A;  2LRP A;  5GKA C;  3W5M A;  5FYY A;  4GJZ A;  1RHI 2;  1ZBA 3;  3LSE A;  1LB2 A;  3BU7 A;  2RHP A;  2YC4 A;  5FJK A;  4AI9 A;  2PHW A;  1U5Z A;  1A78 A;  2WO1 A;  3S0M A;  3SCH A;  1BK0 A;  3M70 A;  3QLQ A;  2X5I A;  1X33 A;  2XKP A;  1NAE A;  4FPF A;  5FLH A;  4KNC A;  3AMM A;  1VIW B;  5FXW A;  5IFT A;  4OHV A;  3KD4 A;  1JZ4 A;  5FY8 A;  3UV9 A;  3JD7 1;  1QKQ A;  3KZ4 C;  4RD7 A;  1T6G C;  5ABJ A;  3D3A A;  2E32 A;  3WDV A;  3WXP A;  5J96 B;  4NII A;  2UWA A;  1XNA A;  1DQ5 A;  1Q5O A;  3VBS C;  1NA1 B;  1OVP A;  5EJ1 B;  3WG3 A;  1N1V A;  4N9H A;  4O9E A;  4Q1P A;  2ZGQ A;  4Q8L A;  1UOJ A;  1ZRF A;  1BQP A;  1PVX A;  1WKY A;  1RUF 1;  5I0S A;  3N7K A;  4Z92 B;  4MX3 A;  2BNO A;  2EF6 A;  2GU9 A;  3HNB M;  2AYH A;  1SG3 A;  2YYO A;  3M7A A;  4IER A;  4FVV A;  3ZMN A;  1AVB A;  4KWU A;  2CY6 A;  3GM8 A;  3BIW E;  4A44 A;  2Q1F A;  3RPQ A;  3B7M A;  1UL9 A;  4GUL A;  3T08 A;  3THT A;  3W58 A;  1S0G A;  1JUH A;  3OF1 A;  3V0A B;  1F31 A;  1YFU A;  3MDP A;  3RJ2 X;  3SC7 X;  4JHT A;  1S2E A;  1O91 A;  4ZU4 A;  5FY9 A;  4V2V A;  5LB6 A;  2C9A A;  2FDF A;  1GQP A;  3TB0 A;  2BFU S;  1W2A X;  4YGB A;  1DYO A;  2XJT A;  3M3C A;  1UQX A;  4M4R A;  1XQN A;  4MGZ E;  3H3Z A;  4QKF A;  1HV0 A;  1DHK B;  1JW6 A;  3P6B A;  3VBO C;  4QWN A;  4AVS A;  4I2O A;  3F2Z A;  1O8S A;  4NWV A;  1O8P A;  4LBM A;  1V6M A;  4YW2 A;  5T54 A;  5K9Y A;  3N9O A;  4BQY A;  5FY5 A;  2DWR A;  1CIY A;  4ZXK A;  5J1X A;  1QJY 1;  1GNZ A;  2LM3 A;  5FZ6 A;  2LTN A;  3UT0 A;  1W28 A;  3RZM A;  5J3U A;  4LO7 A;  1ZVF A;  3CQO A;  5K7P A;  2D3P A;  3VKN A;  1HXS 2;  1JYC A;  4S2G A;  5AC9 3;  4DB5 A;  3ZSM A;  5F37 A;  4Y4R A;  1UKG A;  4IE4 A;  4P9X A;  1ULE A;  5JSO A;  1S2B A;  2BEO A;  2HYK A;  4N90 A;  4KGG A;  4AGR A;  4AXO A;  4F83 A;  4LXL A;  5A1F A;  3FHQ A;  2Z69 A;  1CON A;  1NY7 2;  1PO2 3;  4R9C A;  4AGG A;  4UFM A;  1GV9 A;  3WF4 A;  4ISR A;  3POE A;  1PO2 1;  1SPP B;  2ZMK A;  4O9G A;  1QY4 A;  3UKT A;  4GWM A;  4R9A A;  4E2Q A;  1BXH A;  4I3P A;  2GNT A;  4EZH A;  3O5S A;  2WO7 A;  2VZT A;  1ENS A;  3PJQ A;  2VTX A;  1NQD A;  2ZZQ A;  5CIS A;  3CJI A;  1VBA 1;  3ZX7 A;  2MNG A;  4QB6 A;  5FZH A;  3SHR A;  4LA3 A;  4JTN A;  1AR6 1;  2VZQ A;  3VHN A;  1HXS 1;  4DEV A;  3H7J A;  3J7L A;  4Y1Z A;  2X09 A;  5C7G A;  1DDL A;  1EV1 3;  2VCB A;  1QJY 3;  2FCU A;  4QM8 A;  3SH5 A;  1W6M B;  4W50 A;  1X8M A;  5C5U A;  4RQP B;  1GWM A;  1GIC A;  1PX4 A;  3IDC B;  5T5O A;  4JRA A;  1E5I A;  3WUC A;  2W47 A;  2D3S A;  2R1B A;  4DUV A;  1A8M A;  1A3K A;  4M3C A;  1ULG A;  5IWF A;  4QPI A;  4P00 B;  4CCM A;  4A4A A;  4MUV A;  1LHV A;  5HI0 A;  5DXD A;  3AP7 A;  1OH4 A;  4KBB A;  2DTY A;  4WZF A;  2VVE A;  1W2N A;  3NRU A;  1QJE A;  4OVE A;  2E51 A;  3KCC A;  1FXZ A;  5FZK A;  1WMX A;  5GLV A;  3CZJ A;  4D6Q A;  1URX A;  3OOX A;  1VAK A;  2JB4 A;  5FY1 A;  3KLS A;  3RZJ A;  4LQR A;  2W94 A;  2V09 A;  1PVC 1;  2QNK A;  4XVH A;  3RMY A;  2ZAB A;  2XBO 2;  1TE1 B;  4Q8K A;  3HQX A;  1BEV 1;  1QQP 3;  1DZQ A;  1O5L A;  3HT2 A;  5J37 A;  3JBG 1;  1AR9 3;  3SEP A;  1W05 A;  4BHP A;  5C8W A;  5KC5 A;  1PGW 2;  4CP1 A;  4CE8 A;  1IKP A;  1EYB A;  1Y43 B;  4R4Z A;  2VUL A;  2W1S A;  3V65 A;  1SMV A;  1GP5 A;  1VRB A;  2D5F A;  4GB3 2;  1XC6 A;  2QE3 A;  2DUP A;  5A7P A;  3WLU A;  2X5I C;  3NST A;  2WSU A;  4P5H A;  4FP3 A;  4CCK A;  1N1S A;  4BXS V;  2AEY A;  1AXK A;  3MIB A;  3KQR A;  3OYW B;  2VZ3 A;  1H9W A;  3ZXA C;  1IKQ A;  4CDU C;  4EN9 B;  1Q8V A;  3HD8 B;  3P1I A;  4CCN A;  3BTX A;  1IS3 A;  2ZOE B;  5ANN A;  3H1M A;  5IVY A;  2HWB 2;  1H8T C;  1QJX 3;  3IBM A;  1NY7 1;  1Y9M A;  2RS5 3;  3ZYG A;  5A6Z A;  1TME 3;  1JOJ A;  1CN1 A;  4AHY A;  3RFR A;  4RHV 1;  4GXL A;  2JG8 C;  3PTR B;  1S0B A;  1RUG 2;  5C9A A;  2EAA A;  3KWV A;  5B4X A;  2R1D A;  4XW3 A;  5SV8 A;  5A80 A;  2QQL A;  2XLA A;  5FKB A;  2VUA A;  4CEY A;  4I09 A;  2P34 A;  4XMA A;  3K77 A;  5FK7 A;  2AZ5 A;  1VBE 1;  4EN8 B;  3DXU A;  1ZM1 A;  3C7O A;  4X8P A;  5JOW A;  2C6S A;  2RJK A;  2VCM A;  1BMV 1;  2VZO A;  2HWB 1;  3LSD A;  3VDD B;  1H8V A;  3Q8A A;  3R05 A;  4CDW C;  3VLB B;  5LA1 A;  2ZJC A;  2XVG A;  1OHF A;  2ETE A;  2VPV A;  1LOG A;  4Q4W 2;  3NAP C;  4IEO A;  4N9I A;  1HJG A;  3S30 A;  1QHD A;  3U0Z A;  1QJX 2;  5D21 A;  4YW4 A;  1F2N A;  5JWP A;  3VDD A;  4Y5T A;  3B69 A;  4C90 A;  2A6W A;  5BUV A;  3KMH A;  4OUM A;  1RUJ 2;  1WD3 A;  1UY0 A;  2GNM A;  4XAC A;  3J8F 3;  5E89 A;  2ZCW A;  2Y6H A;  5T50 A;  5J7M A;  1FMD 3;  4YRD A;  1D4M 3;  5DQ0 A;  4KH9 A;  4ARX A;  1ZRD A;  3K4A A;  3SCG A;  1NZI A;  1Q56 A;  2D6O X;  1LEM A;  3A7Q A;  5AVP A;  1HLC A;  3VB9 A;  1POV 1;  3DKW A;  4N53 B;  4A7K A;  4E2S A;  5BNP B;  2IXI A;  4P9Y A;  3I2I A;  3S5Q A;  5C3O A;  1U5I A;  3LEM A;  3ZYP A;  5JDB A;  4L11 A;  1CJP A;  2QQK A;  4Q0S A;  4MSV A;  3ABZ A;  2NZ9 A;  3J7H A;  4Z82 A;  3U14 A;  4IV1 C;  4V1P A;  1N3P A;  1BZW A;  1YWK A;  2JWP A;  3IIA A;  1H2L A;  1WW4 A;  5FZ3 A;  3EYP A;  2R30 A;  5KXC A;  4D7Y A;  3HEI A;  1JYX A;  5BNP A;  4OCT A;  1O3R A;  1UYP A;  1HRI 2;  1C1L A;  1ZBE 1;  5A3T A;  4YM3 A;  4BMB A;  4AHW A;  4I02 A;  3FHA A;  4QQH A;  1VE0 A;  5EHD A;  2XUM A;  5GM0 A;  4E4S A;  3RWK X;  2G9Z A;  4E9K A;  4D7T A;  2WFP A;  4ZZ5 A;  1JHJ A;  1UWW A;  4KI5 M;  4NWW A;  4U2A A;  4PJY A;  1OUR A;  1J1L A;  2WNE A;  3AXD A;  5FYU A;  5FMO L;  2B9U A;  2QCS B;  3PUI A;  5FUN A;  1KXG A;  4QQP A;  2AAC A;  1AR6 2;  2RR1 3;  2MPF A;  1SLC A;  4XCB A;  4UBH A;  1RHI 1;  3AP5 A;  3EXU A;  4YNI A;  1OMI A;  2ZZJ A;  4UW5 A;  5DZE A;  5DAW A;  1OQE A;  2QQN A;  4L9B A;  4AI1 A;  4JZR A;  4LIT A;  5CU1 A;  4CYD A;  1LU2 A;  1RHI 3;  1ZBA 2;  1GUI A;  2ZXQ A;  2XB6 C;  3ZXF A;  1W6M A;  2OYZ A;  2D6P A;  1JZ7 A;  2G9G A;  3VBO A;  2Q8C A;  1AX2 A;  2A3Y A;  4YG3 A;  1RUD 2;  2XG3 A;  3R4D B;  3BN6 A;  3GHN A;  4KWK A;  4Y3O A;  4Z07 A;  5FYB A;  5CFC C;  1LED A;  1KRI A;  1CD3 G;  4ES9 A;  3PHM A;  5HPO A;  4Y24 A;  3RZZ A;  2KXL A;  3V64 A;  4FTE A;  1I5P A;  3U37 A; 
#chains in the Genus database with same CATH homology
 2FDI A;  4NRM A;  4ZS3 A;  4NRO A;  3O1P A;  3O1S A;  3BI3 A;  4NIG A;  3LFM A;  4IE5 A;  4QKF A;  4NIH A;  4NJ4 A;  4QHO A;  3I3M A;  3S57 A;  3I49 A;  3BU0 A;  3RZH A;  3O1U A;  4NRP A;  3I3Q A;  4OCT A;  5F8P A;  4QKB A;  4ZS2 A;  5DAB A;  4ZHN A;  3H8X A;  4O61 A;  2FD8 A;  3BKZ A;  2FDH A;  4MG2 A;  4CXW A;  4CXX A;  4NPM A;  3O1O A;  4NPL A;  4O7X A;  4CXY A;  3S5A A;  3T4H B;  2FDG A;  4IE6 A;  4IE7 A;  3BTY A;  2FDJ A;  4NID A;  3RZM A;  3BTZ A;  4NRQ A;  4IE0 A;  4NII A;  3T3Y A;  3BIE A;  3H8R A;  3I2O A;  3KHC A;  4QKN A;  4MGT A;  4IDZ A;  3T4V A;  4JHT A;  3O1M A;  3O1V A;  4QKD A;  3BTX A;  3RZJ A;  3KHB A;  3O1R A;  4RFR B;  2FDK A;  3RZL A;  3H8O A;  4IE4 A;  2FDF A;  2IUW A;  3BUC A;  3O1T A;  3RZK A;  3RZG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...