3BTXA

X-ray structure of human abh2 bound to dsdna through active site cross-linking
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
204
structure length
204
Chain Sequence
ASWRHIRAEGLDSSYTVLFGKAEADEIFQELEKEVEYFTGALARVQVFGKWHSVPRKQATYGDAGLTYTFSGLTLSPKPWIPVLERIRDHVSGVTGQTFNFVLINRYKDGSDHIGEHRDDCRELAPGSPIASVSFGASRDFVFRHKDSRGKSPSRRVAVVRLPLAHGSLLMMNHPTNTHWYHSLPVRKKVLAPRVNLTFRKILL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-ketoglutarate-dependent dioxygenase alkB homolog 2
publication title Crystal structures of DNA/RNA repair enzymes AlkB and ABH2 bound to dsDNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/dna
total genus 53
structure length 204
sequence length 204
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2007-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13532 2OG-FeII_Oxy_2 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 3btxA00
3KHBA 4MG2A 4NJ4A 4IE5A 3O1TA 4NRMA 3I3QA 4ZS3A 3O1VA 4NRPA 4O61A 3O1PA 4IDZA 3H8XA 4IE0A 2FDGA 3T4VA 3O1RA 3O1UA 4NIGA 3BIEA 3RZGA 4OCTA 5F8PA 4O7XA 3I2OA 4QKBA 2FDFA 3BI3A 2FDKA 3T3YA 3RZHA 3KHCA 4NROA 4NPLA 3LFMA 3H8OA 4ZS2A 3O1OA 4CXXA 5DABA 3RZMA 3RZKA 4NPMA 2FD8A 2IUWA 3S5AA 3RZJA 4IE7A 4NIIA 3H8RA 2FDHA 4NIHA 4IE4A 4CXYA 3T4HB 3O1MA 4JHTA 4MGTA 3O1SA 3S57A 4IE6A 3I3MA 3BUCA 3BTZA 3BKZA 3RZLA 4RFRB 3BTYA 2FDJA 4CXWA 4QKNA 4QKDA 3BTXA 4ZHNA 3BU0A 4NIDA 4QHOA 4QKFA 2FDIA 3I49A 4NRQA
chains in the Genus database with same CATH superfamily
2GMEA 4MG2A 2AZ5A 4IE5A 1JUHA 4P02B 4HN0A 4CU7A 3RS6A 1Q43A 2XL7A 4CDQA 3LGRA 4IV1A 3PU8A 4QDSA 2ZHMA 5T5LA 5EP9A 4AQ6A 1DGRN 2E7TA 2ZGQA 4N43C 1XPWA 2CWSA 3MYXA 4ZS3A 3S0MA 2CU5A 4P9JA 1OI6A 5E16A 2A6XA 1SMVA 3SCHA 3SISA 1W8UA 4UFJA 1I1EA 2IWGB 3W5MA 1O3RA 1I5ZA 1RUE2 3ORJA 1CJPA 2RM22 3E6CC 2HBTA 2B42B 1RXFA 2R7EB 3E5QA 3E5XA 3KCXA 3NNLA 5IJRA 4YFZA 2VCCA 3AP5A 4ZXEA 1I5PA 3GCXA 2ARAA 2IZWA 1JHJA 1AR82 1BMV2 1O7FA 3MFAA 4OCTA 4N7IA 2X5IC 1LHOA 2MNGA 4QPGA 3IZOA 4INDA 1LOEA 2WZ8A 4QKBA 4ISRA 2LTNA 2VJXA 1OT5A 3P3NA 2D44A 2VULA 4GWJA 2WSUA 3LWCA 3RRDA 1JMUB 4UFLA 3ZIXA 3GBGA 1X9TA 3R0RA 4IW3A 2BOIA 3RYPA 1PO13 3E97A 3RZKA 1W6QB 1H2LA 5FUPA 1BEV3 1OOPB 1L7LA 2DUQA 4RS5B 3LEKA 1HJFA 1LU2A 3AP4A 3POYA 4AZZA 1UOGA 4D6RA 3C3VA 1YC61 2BNOA 2JIJA 2ENRA 5FZ0A 4COYA 5DAVA 2X5IB 5IVVA 3WP6A 5F37A 3N7KA 4EWDA 3EO6A 2W1WA 5F2SA 4LLOA 5G04L 4YGBA 3V65A 2R061 5GLZA 3KS7A 4LO7A 5FWJA 3VKNA 3USUB 1R091 2IUWA 1WMFA 3V0AB 5BNNC 4E4HA 5FY4A 1NQJA 1GFF2 1REDA 1PM4A 5GALA 2EAKA 1ZBE1 4CZSA 3ACFA 3PTRB 4YRDA 2WO2A 3HMYA 2JWPA 1ONAA 2BFUS 2PHDA 3GGLA 4GULA 3WNLA 4E2GA 4WM8C 1UXXX 4W4ZA 2LRPA 4MGTA 4I0WB 1VRH1 1RITA 5LCWL 3W5NA 3NAPB 3RG0A 1UZYA 1U5IA 1OD5A 1LGBA 3RQ0A 2DV9A 2WFF3 1QH7A 5KHJA 2I2SA 2Z4FA 3JBG2 2XUEA 4GB31 3CO2A 1CIWA 3ENRA 1RUNA 4W6YA 2XVKA 5FK8A 1NE6A 3FHIB 3P1IA 1ND3A 2QQJA 3DYMA 5FP7A 2A70A 1GQHA 3HVDA 2E9QA 4N8MA 2XPJA 3TYJA 2CDOA 1G9CA 1C8NA 3SITA 4BMEA 5CADA 2WYFA 4YVSB 2WT1A 2BGCA 3HWJA 3Q9OA 5CZKA 3B01A 3A7QA 4XJ8A 3ZYHA 1AVBA 2DBNA 4YZ1A 4W6XA 5ANQA 1AYN3 2RR12 4Y22A 3ECQA 2VZQA 3GHNA 3WF1A 1ENXA 2VZVA 5ABJC 1GNHA 2Q8DA 2ZMLA 4LXLA 1F31A 2R16A 1ZRIA 4FQ4A 5A7QA 3O1TA 2JG9A 3BTAA 1MZ5A 1RYYA 2WS93 2WO7A 2XOMA 4LNVA 2PELA 5AFBA 5F6KA 5JR2A 1AL22 4FTSA 3WQ1A 3QH6A 4XJ9A 3HNBM 1HJGA 3LIHA 5C71A 1PZ8A 4UFMA 3JQXA 5ABJB 4XUQA 2D97A 1W8NA 2VZUA 1ULOA 4XACA 4HVRA 2DYCA 2HWD3 2HWF2 1PO22 3VZJA 1WMXA 2DVGA 4CDQB 3A23A 1LGNA 3LPGA 2OIIA 4IV1B 3SLIA 4DIQA 2G9FA 1H6YA 1GANA 3D0SA 1W0NA 2HWB3 3ZPOA 1F2NA 4KQ7A 1TEIA 1YYNA 4URTA 2Y38A 3J8F1 1BZWA 1RMU3 2HBUA 5FY9A 3SKVA 4HFSA 4DUVA 4PIZA 4PIYA 1RUJ3 3RMXA 2VUAA 3NKTA 2O8QA 4PDWC 4XJUA 5F5QA 3SKJE 5J96B 5HCHA 2JB8A 4XE9A 1LOFA 2UY9A 4GKXA 4LOTA 5A3NA 1V6LA 4J1XA 4ZONA 1I6XA 3PUIA 1VBE1 3MV01 4QX1A 2JENA 1SBEA 3CLPA 4TLFA 2V73A 3CIHA 1KS4A 5FZDA 5CB7A 1AYM2 2AC1A 1C57A 4JGZC 4GZ9A 3SEEA 4OHYA 4UBHA 1XBFA 3IT8A 1QJY2 1WMEA 4GB32 3AYCA 2RMU2 4E4DX 4QPGB 3ZR5A 1VMFA 3JD73 5ABJA 1OH3A 1BLZA 3H3ZA 3KV6A 3ZDSA 1DZRA 5JOYA 2QKDA 2YUEA 2DTWA 3SH5A 1PMHX 5KBFA 3CU7A 1JOPA 3RJRA 2P34A 4H55A 1PIV1 5F32A 3WDTA 3W21A 1COV3 4MUVA 4Q1RA 1UWWA 4LBMA 1EV12 2QQVA 3NJYA 4EWEA 2P3JA 3MO4A 2EIGA 1UIJA 2H0VA 3H8RA 1KDMA 1F15A 1UMZA 2JDUA 3ABZA 1UXZA 4IV3A 3HPNA 4B29A 4BQYA 2D3PA 4R8HA 5I0TA 2VMFA 5FYTA 1OF4A 5G05L 1IOAA 5FPVA 3O1SA 2ZGLA 1O5UA 1B35A 4HANA 4IESA 3ZSEA 1X8MA 3OTFA 5CISA 1FYUA 5LEKA 5L36A 2ETEA 1YIFA 2BU9A 5CAZA 2GNTA 4IEVA 4FOYA 2WFPA 2P3IA 2B9UA 2PN5A 1HW5A 4A4AA 4B1LA 1HRI3 1AX1A 5IAVA 1ZVFA 4HMZA 4IEYA 1JYXA 4QB2A 4LIVA 4BK4A 5JZGA 5FBZA 4HLTA 5FZ4A 2VZOA 1UY0A 3OSDA 4JCKA 2HEWF 1S0IA 1DQ0A 4CCCA 4BIOA 2Q8EA 4DZGA 1C28A 2Y8KA 3AL5A 3H8UA 5ERLA 1ND3B 3T2TA 1NLQA 1TME2 3HD8B 4EJRA 4IEWA 4DMIA 1XE7A 5LBBA 2D7FA 4XDQA 2VMIA 2QDNA 4CEWA 1JYIA 3N4MA 3FFZA 5GKAC 4GJZA 4CCLA 3W9AA 1HV0A 2PAEA 5HBAA 2ZZQA 3AP9A 1GBGA 2Q1MA 4YYOA 3I4IA 1C4RA 4PT6A 4Y22B 5FKBA 3CDZB 1LJ7A 1D7PM 1UO9A 3LEIA 4FO9A 5CG9A 1DDLA 4OMDA 1A34A 1LKNA 3QD6A 1RUC2 4XVHA 1TNFA 2H6BA 2JG9B 2WQ4A 1KFXL 4M4RA 4ZPIA 5C3RA 5C3QA 1CJDA 1ULCA 5FBJA 4BA6A 2VCAA 2UURA 1N3OA 4CDUA 4M01A 4A2UA 5DXDA 1H1AA 1MS4A 4BQWA 1VALA 4ZXKA 4A41A 2C9KA 3OY8A 2NN8A 1Z7S2 2UY8A 3NNMA 5L9RA 3MPBA 2OQ6A 1H4GA 3ITQA 3MIDA 5BXXA 1E5IA 1R1A1 5FLJA 3T2PA 3BI3A 5DUWA 4W6WA 3B94A 1V70A 1J83A 2XQRA 4O9GA 2YDEA 2GC1A 1DP0A 1LCLA 1W3VA 1DHKB 2V72A 3CZJA 2DVAA 4XFAA 3A4UA 4OI2A 3THPA 2WZEA 4QAWA 1IQAA 4QX7A 4ZKTB 1WD3A 2D3SA 2HWC1 3FLRA 5DABA 1HRV1 2YBPA 1CGPA 4NMIA 4QXCA 4DEVA 1LR5A 4HPKA 3FBMA 1Q8OA 2W39A 2XUMA 3N35A 2WNOA 5KHKA 1ZZ6A 4A3XA 3IM0A 2DCTA 3MEPA 5M0TA 1IKQA 4N53A 2VVEA 4KWUA 1H9WA 4CCKA 4YM0A 1W2UA 2RS32 4Y1ZA 4Z2WA 1U5YA 1H2NA 3P3PA 4CP0A 2QQMA 1W06A 1SLTA 2P37A 3AMMA 3FL7A 3PVEA 4I30A 4XTPA 3SQOA 3U4SA 1CVNA 1TMF1 4OHZA 3NJVA 5DAPA 3OJBA 1FMD1 1PK6A 4Y5Z0 5C3OA 2ADDA 3MUY1 3T1LA 4M4PA 1ODNA 4FOVA 3OEAA 4P08A 5IK4A 4E2QA 4YVWC 1A8MA 4Y1XA 1YNAA 3ZXGA 4IV3B 4OHVA 5F7UA 1IPKA 3URFA 5A7SA 3AMQA 1OC1A 2WA3A 2GDFA 4GWMA 2W2IA 3T2QA 4MHUA 5HV0A 4QKNA 3R4SA 3BCWA 1B35B 2QNKA 4ZHNA 3LEMA 4QU2A 4BHPA 5EFUA 4BQ2A 2IXCA 1GP6A 4RSUA 2Y60A 3VKLA 1GQPA 4KBBA 4Y24A 1ENRA 1F5JA 4MGZE 1E5HA 1JH5A 1SDWA 5A7OA 3UYJA 4Y1VA 5JIAA 3CNAA 4YFWA 4WBBA 4AOCA 2OA2A 2P6HA 3IDBB 3ZPYA 5JZGB 2BOJA 2IC1A 1SFPA 4P9GA 4QQHA 4IQPA 1VBD1 4XW3A 2VXRA 5GZDA 2WA4A 4OUMA 4XBLA 2PHXA 3BODA 1CZTA 1QXRA 2HWE2 5EJZB 5IFTA 1C8M1 3B00A 1AUYA 2R063 5SV5A 5HPOA 4CEWB 4CPBA 5A6QA 3ZSJA 4XUNA 3U11A 1R093 5FO8B 5EJ1B 3UESA 4CCEA 3B02A 1NY71 1SG3A 1V0AA 1BJQA 1Q3EA 3F95A 2ARXA 2VOVA 1ZBE3 4LA3A 4Q0QA 1FX5A 1QY4A 1OXCA 3OPTA 4CDUC 3OG2A 5T5PA 3THDA 1NA1A 2VR4A 4HN1A 2ZGRA 1Y43B 5A80A 4AR2A 1OSGA 3N9OA 1VRH3 1OMIA 1WKYA 3AKPA 3O1RA 3M3QA 2AUYA 3JB8A 4LBQD 3RZGA 2ZGKA 3IMNA 4P5HA 4BOWA 5L9BA 3HAGA 3I2KA 1S0EA 1CAXA 1DYKA 2YB7A 3LZZA 4P9XA 1OFSA 3OCPA 3PJYA 4Q8KA 4GB33 3M3EA 1FMD2 4PLOA 1GNZA 2W5FA 4CDUB 3VZMA 4XJAA 5LRRA 2XVLA 4NROA 2EVXA 2YG0A 5E89A 1QWRA 2VZ1A 2KR2A 5F3IA 3OD0A 3OY8B 4JVAA 1LTEA 5CVRA 3ZVXA 2B7YA 2CNAA 4BZ4A 2YROA 4QWNA 3WHTA 1LECA 4Z82A 3UGFA 1ND2A 4Y4RA 3VBOC 2DCZA 1ODMA 4ISQA 4Q1PA 4BQ5A 3H42B 4N9IA 5IVEA 5JXJA 2VU9A 2D6MA 3G6JB 2YPDA 3FWEA 1UYPA 4Q0UA 1GP5A 1GOHA 3O5SA 3WDVA 4AVBA 5A1AA 4QHBA 1J59A 2XJRA 4YSFA 1YFWA 2RDRA 1UIKA 1PZ9A 3APBA 1WBFA 3TWIA 3ZR6A 4DNYA 4IE4A 2D6LX 2JE9A 1MQTA 3AL6A 5CNAA 3MIFA 4HPKB 1NZIA 3WDUA 4AVSA 2X10A 3O1MA 5IW0A 2G9ZA 1SLAA 3POIA 1HQWA 3QACA 3PUAA 5FXXA 4AI3A 1GP4A 1RHI1 3A22A 4N53B 2VM9A 3ZO0B 1G9FA 1PO12 5J7MA 1H8TC 1BEV2 4PI2A 5K9YA 4B8EA 3I2FA 3GZTB 5H9RA 1WA4A 3RZLA 1O3TA 2JDPA 4Q8LA 4QT6A 2PAKA 3M7AA 3N9NA 1KEXA 1PK6B 4OULA 1ZA4A 1PGW2 4A3ZA 3J8F3 5LA0A 4P5YA 1FXZA 3DEMA 3BGAA 1JW6A 5C8CA 2VNVA 5T3NA 2HYKA 3ZX7A 1OLQA 4UW4A 2D40A 5I8TA 3TEXA 1NLSA 3VHRA 4CU8A 2VCBA 4IGQA 4QD2A 3WF2A 2JKXA 1VBE3 3IDEA 4Z92B 4NAOA 1FATA 3FLTA 3QBQA 4E8DA 4SBVA 4Q4Y3 3KCYA 1GU3A 4FFFA 2JDAA 2ZABA 1EUUA 3MIBA 3MF6A 4IEPA 1LESA 4C0HA 4EN0A 2VZPA 4FI9A 4QX8A 3VZNA 3M3CA 3VD9A 2V5DA 4NRMA 3I3BA 4FOQA 3WP3A 4CP1A 4KWKA 2WFF2 2EAAA 3W58A 3ZXDA 4LHNA 4NHYA 1PIV3 1RVF1 1UOBA 5FPZA 5FZLA 2XKPA 2VQAA 4U2AA 3ZYGA 4ES8A 1OKOA 1RJ7A 3PLQA 3AB0A 3JQWA 4MX3A 3ZFFC 2ID4A 4K20A 2QQUA 3EMRA 3MHZA 5FTTC 2DU1A 5IHRA 3K46A 2TBVA 4FXGB 2V5YA 1GKBA 4AHWA 1UZVA 4Y1UA 4IE0A 4AFCA 5C4WB 4Q0SA 2AYHA 1WLWA 2PQSA 2VECA 4JGYA 3BIEA 4PHZA 4NN0A 4V2VA 1AYN2 1GLHA 3A0KA 1QH6A 4EQVA 1QGLA 1PX4A 4HONA 3KB5A 4AVAA 2PFWA 1HB2A 3B7MA 1DQ1A 4Y4YA 4FPGA 4XFGA 1POV0 1ZRRA 1NA1B 3D0JA 2H0BA 1V6NA 2J1SA 5J98B 3SH4A 2WS92 3IPVA 4CTEA 1UL9A 1QEXA 4CDWC 1W2AX 2D3RA 2J1TA 4XOGA 4LO8A 1CAXB 3K2OA 4YGEA 5FPAA 5FYHA 3ZDVA 4AVVA 3MW3A 5DG1A 4GMP0 2SBAA 1VJ2A 3KWVA 1LOBA 4MXVA 3ZIWA 3RZMA 1HRI1 1K5MA 3DN7A 4XJZA 2XJSA 2HWD2 2YU2A 3H1YA 4G3YC 2N7GA 1Q5OA 2Z5WA 5IK8A 2FCUA 2VMEA 4YG6A 2YBSA 3N7LA 1JYTA 4K3UA 2HWB2 3KF5A 1YEWA 2EXKA 1XYPA 4A7KA 2XJUA 1NCQC 1MQTC 2OXBA 1UY2A 4AI1A 4CEYC 1CX1A 3RMYA 1ND2B 1RUJ2 4LO5B 1ZX5A 4UW5A 2VE1A 1BCXA 2IVIB 4XPVA 1KFUL 2Q30A 1US3A 1VRBA 4AYUA 3M70A 2WC2A 4OI4A 2XLGA 1QJEA 3ALQA 5FMOL 1ZRCA 3TN91 1YQ6A 3DYOA 3WW2A 3K75B 4R9DA 3O7OA 3RYKA 3VBFC 5HV4A 1MQTB 3WDWA 5GZCA 2D93A 4GXLA 5CYYA 2XBO1 1UU4A 4MVTA 2X29A 4N9HA 3BTYA 1Q8PA 2LW8A 3R6SA 3VD3A 3JD72 2V09A 3B9IA 5F3EA 5FR3A 5FP8A 4LQRA 1D4M1 2BW8A 5FYCA 1LU1A 1YJKA 1POV1 1CN1A 2Y34A 2X53S 1VMHA 3BIWE 4IL7A 5CFCA 3WNKA 1IQDC 3AP6A 4I2OA 1COV2 4NIDA 1LULA 2R49A 3IN9A 1ZA7A 4XFFA 4YG3A 4A44A 1HDKA 2R6QA 4LOSA 2P6CA 1R1A3 2F6BA 4B7KA 5EZWA 4EWAA 3AJYA 2ARBA 3BPSA 3AZZA 2HJIA 3I2GA 4GMP1 5JWPA 4DUXA 5C8CB 1W8WA 3NL1A 4OMCA 2WQ8A 5B4NA 2ZX0A 3UGGA 1X50A 1F35A 4NR1A 4AFMA 2Z79A 1PNFA 3T2OA 2HWC3 2JEMA 1VIWB 4BWOA 4CCJA 1HRV3 2P3YA 4LBKA 4HZFA 2CGPA 2WKKA 3GZUC 2ZBJA 4BDVB 4LBJA 4BPZA 4DEQA 2VNGA 4Q4V1 3ACGA 5D1IA 3VZKA 1NCRA 2ZKLA 4ARYA 4CDXA 2K2SA 1DZTA 4EN8B 4JHZA 5FYSA 3VBSA 1HRI2 1TG7A 5EV7A 1HB1A 4E2SA 1SPPA 5IK7A 5H9QA 5GLVA 2PHUA 2VVDA 3NO8A 3C7FA 1ZZCA 1WW4A 4M3CA 5DMYA 1OA3A 4YPJA 2EICA 4BCUA 3T30A 4CUCA 1A6CA 2FDGA 1YFUA 1Q8VA 1TMF3 4XDOA 1XYNA 1FMD3 2W95A 4ZZ8A 4CE8A 2QZ2A 2D5FA 5DAXA 1FV3A 1N1TA 4JC1A 3K3NA 3QLQA 4NPRA 4RGAA 2ARCA 2VQ0A 3AYAA 4AHYA 5FMBA 1T6BX 1C1LA 1F4HA 2E6VA 1SQ4A 1NX9A 3PU3A 4IEOA 4FOWA 4CPBD 2Y33A 3AMNA 5A32A 1IKPA 2BQPA 1PVC1 2ZAHA 3LSEA 1DGWX 4OQ9A 3KHCA 1GZWA 3TN92 2WO3A 4XCBA 4JGYB 2NQYA 4YGCA 4GAZA 1U5ZA 1YXWA 1PGL1 2A6VA 2PAMA 2WN3A 2Y6KA 2XXZA 5C4WC 1HX6A 4AFBA 1NYWA 2CHHA 2XBO2 5D8AA 5JIUA 1MR5A 3MIGA 4OUSA 5FWEA 4NHXA 3RVHA 5CU1A 1OOPC 2WNEA 4AFDA 4MXWA 4RS5C 4AK3A 5A70A 1UCXA 3IPVB 4YW1A 4CA9A 2W47A 5IVFA 1VAMA 3I7DA 2J7MA 3J7HA 4D7TA 1HQNA 1UU5A 1XRUA 2QUOA 1EYBA 4LUMA 1RUI1 3RWNA 1VBD3 2WABA 1K5MB 2VL4A 3KGZA 3OYWA 5DUVA 3AYDA 3ZKYA 1N47A 1UW8A 3THTA 5LASA 1C8M3 3S30A 4EN9B 5K0UA 3VZLA 5FZFA 4I02A 1ZZ7A 3VDDA 3S57A 2XKOA 1W8FA 2P3KA 1UNBA 1W99A 1GV9A 1D0HA 1XYOA 5K4LA 2JDKA 4JKLA 5BYNA 1VLNA 4N7UA 1DQ6A 3UL2A 3WP4A 4ZU7A 4EZ4A 3BYWA 3NAPC 3ACHA 4ES9A 3ZN5A 4P14A 4ONUA 4Y20A 5LWBA 3WNXA 3DXTA 4RGGA 3ST7A 1YHFA 4MYEA 2UYBA 4FAGA 3J9SA 1VBB1 4G4FA 2AEZA 5J09A 2GNMA 3VD4A 1J3PA 1VBC1 3H7YA 4GH4A 5EWSA 3TB0A 2BVBA 3TOJA 3WNOA 1NKGA 5CIRA 3N7MA 2AENA 3GBWA 5FY1A 2WL1A 2B9VA 1IG0A 2RJKA 2BDRA 3CHXA 4YVSC 2Y0OA 3NJXA 3KQ4B 4LKDA 3KHBA 4Y26A 1UMHA 3T1MA 3ON7A 3KQRA 4GD4A 3C7GA 4R52A 3PUHA 5CFCB 3ETPA 1OPMA 5FYZA 4MH0E 3LDKA 1OLMA 1UX7A 2GC0A 3PHMA 2ORZA 3KD4A 4E8CA 1DQ2A 1NCRC 2YXSA 3HJRA 2FCTA 4AW7A 4DXZA 3C7EA 4WV8A 2A75A 2QQWA 2UWAA 4OLLA 2O8OA 2J1UA 2ZX3A 2HLEA 1QDCA 4L97A 4AI0A 4K6BA 3VKFC 2YV8A 4XBQA 5A6ZA 1H2MA 5B2GB 1G9BA 5CKNA 3WHUA 4H3WA 3WNMA 2PXJA 3VHOA 2B8MA 4RQPA 3T4VA 1CAVA 1W8HA 5C3SA 1WWYA 4XIOA 3BB6A 1NCRB 2VTFA 1OVPA 4DS0A 2XWJB 4LJHA 4CDXB 4L8QA 1RHI3 4CDQC 4IV1C 5JPNB 1SLBA 1X9PA 2QQNA 1XC6A 4LBQA 1BVP1 3VBSB 4TZDA 4QX0A 2DDUA 2ORXA 3IIIA 3JU9A 1SPPB 4Z2AA 5IWFA 1W6MA 4M3CB 4Q2FA 3VBRA 2GSYA 3FE5A 4PLNA 5A6YA 5T55A 1UZZA 4M00A 4FVVA 5JI9A 2FCVA 1SLIA 3DL3A 3D4KA 5DDJ1 4B4RA 2Q1ZB 2NZ9A 3LFMA 2NLRA 4KBZA 1H2KA 1Q56A 3AM2A 4IXLA 3TAYA 3ETQA 1H30A 2D43A 2R062 1PX3A 1QNYA 3OF1A 4ASKA 2BFUL 5A7WA 1JU3A 3LPFA 1R092 2VMDA 4JKMA 5DPNA 4NVPA 3VBHA 1QKQA 4FP3A 3POJA 1GZWB 1ZBE2 4NHLA 1XE0A 3IDAA 4AAXA 4K7JA 4RHV1 2XVGA 2C4XA 4QPGC 1OQ1A 1S4CA 3POFA 1QOTA 2G1MA 3C8XA 3FZ3A 4RD7A 2AREA 2A73B 4YW3A 5D8AB 4CYDA 5KXDA 1VRH2 4EYUA 4Q4Y1 4M0HA 5ISLA 1S0JA 1UY3A 4MXWB 5IK5A 4CXYA 3H7JA 1WLTA 3G7DA 4TLGA 2RHPA 5FP9A 4JHTA 1WW6A 1OURA 5FO7B 2ZMKA 4A42A 2OS2A 3ACLA 5IYYA 4AEJA 5F6LB 2QQPA 3QH7A 1W28A 1RVF3 2EXIA 4Q4X1 2VZTA 5IVBA 1AJOA 3FC0A 3I3MA 2YC4A 4BJ0A 4UFIA 2YC2A 2K9ZA 4HVQA 3PNAA 3CQOA 5HI0A 2GN7A 3K4AA 1ZZ9A 5FLIA 4KL1A 3H50A 2VUCA 3PMEA 4FPLA 2GNBA 4XAAA 5FZEA 1ENQA 3OBRA 2PLV1 3OYWB 5C33A 2VMHA 2XLFA 2DCYA 4AQ2A 2VC9A 5HXMA 5K0UB 1DG6A 5L7OA 3V0BA 3VDDB 5AVPA 3ZMNA 2EXJA 4QDQA 3DECA 1HB3A 4GH4C 3MPPG 1O8SA 2P4EA 5J36A 1APNA 1YO8A 2BTVC 3T08A 1PVXA 3M8LA 4H7MA 4S2HA 4Q26A 4HSJA 3BALA 1ULFA 3VHNA 3WF0A 1GWKA 2A3XA 1HKDA 1ASJ1 2YGMA 3O0WA 4Y20B 3I49A 4N90A 2XJPA 5CFDA 2JKBA 2QCSB 2OPKA 3OUIA 5LBFA 3IMMA 2WBKA 2ZX2A 1QJX1 2C9AA 1RB8G 2W1SA 2XG3A 3OGVA 4GH4B 1ND3C 3HT1A 4ZZ5A 3RI8A 4ASLA 2W92A 4MSVA 1EAH1 3NNGA 3T0DA 2XQXA 4HKLA 5F1RA 2RDSA 5FMCA 1K42A 3POEA 4XZUG 1UKGA 2DF7A 2VGDA 5F5AA 1E5RA 5EQUA 1LHVA 5FPUA 4YZ5A 1I9RA 4K1YA 4MV2A 3AVSA 2MPFA 1MVQA 4P9WA 4JRLA 4QB1A 1DQ4A 2G4IA 4LORA 4QX5A 3J8F2 1XJAA 1W2NA 3GCWA 1X33A 4TYSA 1GUIA 4C1WA 5JAXA 1LNSA 3UNPA 5C70A 4I0BA 3K3OA 2J1EA 4M3CE 1OUSA 2JG9C 3O1UA 5FZGA 2DCJA 4FQZA 1VBE2 2QVSB 3VDBA 2GC3A 1ZRFA 1BKZA 1JI6A 4LMFA 4Q4Y2 3TN93 3ZN4A 4L11A 2Q8CA 1AR61 1DFQA 4KH9A 1QXPA 2DWRA 1RL3A 2XONA 2Y0IA 5L73A 2FDFA 3K4DA 2VZRA 1A3KA 4ASMB 4LLFA 3AFGA 4RGKA 4LHSA 5FOJB 2XBO3 4XF1A 4RQPB 3B93A 1CAVB 3I3EA 2YFZA 3I59A 4ORFA 4XYXA 4Q4W1 4YZ3A 4KWLA 1D4M3 5FY0A 2JICA 2PQQA 4LBQB 1POV3 1N3QA 4YNIA 1PIV2 3D82A 5T5OA 5I0SA 2D6PA 1VR3A 1W6MB 3VBRB 2ZAAA 1CD3G 5FYBA 1OF3A 3VL8A 3ZSMA 5JOXA 1KITA 2YY1A 4QXHA 3ZFGA 1X8EA 4KG8A 3LDRA 3H3LA 1FOD1 4FT8A 2FD8A 1LOFC 1D2SA 2OW4A 1VPHA 2HKXA 4MGYE 5I0UA 2VXJA 4PIXA 4XUPA 4GMP3 1XNTA 3TEYA 2ZHKA 3UKTA 2VBPA 5A7WB 3VHPA 3FN9A 2ZEYA 3RYRA 5EYXA 5FPLA 3TRSB 3VBHB 3Q8AA 4FCAA 4XUOA 4QXBA 2ES3A 2WR9A 4CSWA 4NHMA 5FPBA 2DTYA 1IS6A 4Q4V3 1AHSA 3CF6E 1OUXA 5CG8A 1EAH2 2DUOA 3S7IA 1WA6X 1H9PA 5CEHA 4FFIA 2DFBA 2B39A 2VPVA 2W87A 4I01A 4RFRB 5FZ8A 2DFCA 2GAUA 5A3PA 3KF3A 5FXWA 2VQUA 3PDQA 4XF9A 4EROA 3MF9A 3KCCA 1GQGA 1N1SA 5AC91 1PMJX 2XWBB 5JSRA 3E6DA 4OI0A 4IV3C 1OVSA 2KM2A 2C26A 2GP5A 3DKWA 1V9U1 3WV6A 1W0OA 2Y6JA 4TSVA 5C3PA 5C7GA 2CL2A 2VBBA 3HNMA 1LB2A 1Z78A 4QHOA 1ZRDA 4FPOB 3HN1A 1B35C 1S55A 1PVC3 1TE1B 4S2GA 5I93A 5L7OB 1KJRA 3V0BB 2EF6A 3E1F1 3UKNA 3AX4A 3VB9A 5A3MA 2XL9A 3ILFA 5BNOA 2CAVA 4BB3A 3VZOA 2Y6HA 3N9MA 3FHQA 4LHLA 2WWUA 3AKQA 3R4UA 4FTEA 1J1LA 1OHFA 1OD3A 1CPNA 2ZOEB 3IIAA 4H7LA 4OUEA 3FMGA 1R081 3DV8A 4SLIA 1RJ8A 5CFDB 1OLME 1XNDA 1WGPA 2FMDA 3VD7A 5JZGC 1NOVA 3Q8CA 3ASIA 2E53A 1OH4A 4CCOA 3UJOA 1JYVA 5GZEA 2VY0A 5EYYA 2BWAA 2R30A 1RUI3 4COVA 4CEWC 1FOD2 3AKSA 1BYHA 1C5IA 2JG8A 3AKTA 4IETA 1LHNA 1LGCA 3SH3A 4EV0A 2QBXA 5JXIA 1ZZ8A 1JZ5A 1QQP1 4XQDA 1R1A2 4NHKA 2X05A 1MS8A 2OZ6A 4CP9A 3IB3A 3NSTA 1Y9GA 4K21A 4H14A 2VOKA 4R9CA 3KVBA 5APAA 1F4AA 3FUOA 5A1FA 1T6GC 1ALYA 2XJQA 4RFT0 1UOJA 2JE7A 4J25A 3VDCA 4X8PA 4AEDA 5J48A 1GZ9A 3RZHA 5FYIA 2RV9A 1FI2A 3GALA 3U0ZA 2HWC2 2QDRA 1K12A 4DRRA 4QMAA 1HRV2 4LR4A 1VBB3 2HYXA 2KD7A 3C7HA 1VBC3 3TEWA 3AFKA 2FQPA 3ES4A 1C1FA 5FRAA 3O12A 1UPIA 4AI9A 5GZGA 2B46X 4YM1A 5B4XA 1STMA 4JTNA 1BK0A 2B45X 3I59B 1G7YA 3J7LA 4UW6A 5BY5A 2Q4SA 5L9VA 1HLCA 1XNAA 1BK1A 4FPHA 1DGWA 1KGYA 3WG3A 4WVVA 1ULEA 2JX9A 2WO1A 5DZFA 1TMF2 4XZPA 4LEJA 3HOBA 2ZS6B 1JTZX 3AVRA 1H6XA 4R4XA 2WAOA 3DPRA 2ZGSA 3ZFGB 2NYYA 2XMLA 1GYKA 5LBCA 3POBA 5IT6A 2DVBA 1QJU1 1V6MA 4A6OA 2F4LA 2J22A 5J37A 3P5BA 4XFBA 4I3GA 4F3JA 1CESA 5FDBA 1AR91 3I8TA 2VD7A 3BTZA 1WW7A 5FOBB 2A5ZA 1TQ5A 4C91A 1TZOA 3NV1A 1W04A 5KWRA 4WVMA 4HOOA 3AZVA 4MGQA 3VBUA 2O0OA 1FPN1 4N53C 4CRQA 1AR71 2R32A 3IAPA 4OFGA 4CXWA 2DU0A 2OUHA 3KT4A 3ZKUA 1VMJA 2TNFA 4OZXA 1UMIA 1MS3A 2JIGA 2E7QA 4XFCA 1PZ7A 1PK6C 3SXWA 4QKFA 4XXPA 1CAUA 1H8VA 4XETA 2FDIA 2WUHA 5FCCA 5HCBA 4B7EA 2WLPA 1VBD2 2BNNA 4ATEA 2GH2A 5DDJ3 4MGIE 3WOGA 2WNUA 2JJ6A 2ZJCA 3GYDA 1C8M2 1UQXA 1BBT1 2WRAA 3F2ZA 4KU7A 2VUDA 2Y6FA 5C8WA 4NWWA 3I2JA 4DINB 1NY72 2E63A 3NW4A 1OPOA 4FPCA 1V6OA 2YMZA 2XGXA 3ZFEA 1SEFA 4RHV3 5BNOB 2MEV3 3UV9A 4CUAA 1CWPA 3LA3A 4NWVA 4TWTA 4V2WA 3NV4A 1ZBA1 4R4ZA 4COUA 4QPIA 2W94A 3ZXKA 1GMMA 1AF9A 4Q0PA 3B3QE 1JZ8A 3LE0A 4Y3OA 5T52A 2ATFA 3WDYA 4NIGA 1M06G 2A3WA 3KSCA 4Q4X3 1DU3D 2ET7A 3NKGA 1LOAA 5FJHA 3V64A 2R041 5JPMB 3I2OA 3JB4C 3THCA 1SBFA 4AEDC 2FZ2A 2JG8B 1QJU2 2E51A 1WCSA 2PLV3 4XCAA 5JLVA 2FDKA 1VBA1 3M1HA 4K1ZA 2P17A 5IATA 5FMDA 2RJLA 1ZNPA 4OQ8A 4JQRA 3LSDA 4Q29A 2V4AA 3EHKA 4AE2A 5EJ3A 1RUF1 4A6SA 4FSJA 4UT5A 4CP9B 1OKQA 4BYYA 1CIYA 2F17A 2AH2A 5A6XA 1NA1C 4XC9A 4AHXA 2BYVE 2XHKA 1FPN2 3K48A 4XIKA 2PHLA 1GWMA 2GN3A 1PGSA 5BV6A 4AEDB 1MVEA 1KJLA 1ASJ3 1NXMA 1GICA 3WCSA 1UD1A 1J84A 1CAWA 5ACA3 2D98A 2BJSA 4E4SA 1QJX3 1RUH3 1CR7A 2WLQA 4NIIA 1VP6A 4AGGA 5FZAA 3VGIA 3DCQA 1C3HA 1LOGA 1EAH3 3Q8BA 1RHI2 1XOYA 1IPJA 2RVAA 1HQLA 1BHGA 2L9LA 5FAXA 5LB6A 3GZEA 1PMIA 4LIUA 1OBNA 3U75A 3N9LA 3O0VA 5JOZA 1ND2C 2XLAA 4KG0A 5DQ0A 3J4UH 4FPEA 4UF0A 5C9AA 1BXHA 2FBEA 3DPRB 3VBUC 3K51A 1EP0A 2PHWA 1JOBA 1HXS1 4L99A 3AKRA 2VNOA 1JZ2A 4FP2A 4LULA 3SMHA 2VCMA 3BVCA 3GJBA 4AAPA 4EN7B 3ZM8A 4N43A 5F39A 4GJYA 2TUNA 5FQ0A 2Y64A 1GR3A 5JUVA 1ZBA2 3BU0A 3NRUA 4AL9A 2RS11 5DAQA 1AR63 4CUGA 3GDBA 2QTWB 4Q0VA 3WX5A 1PHMA 5GZFA 2PHRA 4WVMB 1MPXA 4QM9A 3VBUB 4D8MA 1LHWA 3SCFA 5F5IA 3LQCA 3D8CA 3EYPA 1MEC1 1TNRA 1DYPA 1S0CA 3FJSA 2WT2A 1W3XA 4Q4W3 2WNUC 2FHRA 2IXKA 2DURA 2R071 2IXLA 2WZR1 3AK0A 4LTAA 5FO9B 2ZA9A 4GQ7A 1XSQA 3PVOA 1RVF2 3O0XA 5E88A 1CAUB 2BWCA 2WT0A 3CBNA 3D6EA 1UU6A 3DKQA 5C5TA 5C8CC 3WG2A 3USSA 1AXKA 2JDHA 5BNQA 3AJZA 5DUXA 1FOD3 5GJ6A 1XQNA 3ZYIB 1J1TA 1O4ZA 1WZXA 4J1WA 1JYNA 3WVJA 1O91A 1XNKA 2WNUB 4YW6A 1M4WA 3AZYA 4QPIC 5BUVA 2JD9A 1W6PA 4KGGA 1WCQA 4HSLA 2OKXA 2VAUA 2P5BA 1RUE1 1O6UA 3M3OA 2RM21 3HIFA 3KT1A 1RXGA 3ZFEB 2VTXJ 4YZ4A 4YW4A 4U36A 4A7YA 3C2UA 5A33A 3GZAA 3LA2A 5BNNA 4YM2A 3I97A 3N3HA 1G9AA 1X7NA 3NV2A 4LKSA 2CYFA 5A7NA 4QPIB 3OBZA 1BMV1 3N9PA 1XB9A 4AG4A 1QOSA 3ZLIA 2C6SA 3I54A 4QX2A 3WZ1A 1S2KA 2RJ2A 2UWBA 3INAA 4MADA 4WM8A 3WW4A 2V4VA 4META 3TEZA 5LATA 2XHNA 3S5QA 5AC93 3H8OA 4UW3A 1VAKA 4BU2A 2XDVA 2QJVA 4K8RB 4CCNA 1WMDA 2NP0A 4I3PA 5T5JA 3GNEA 5FP3A 2I74A 1G9DA 1V9U3 1XSRA 5KXBA 3WNNA 4JGYC 3ACIA 4BH9A 3FFQA 1RINA 3MIHA 4UOJA 2CDPA 4JV4A 3MUZ1 3OUJA 1VB2A 1W6OA 2J42A 1YIPA 1HIXA 1FV2A 4K8FA 3EJKA 2OVUA 3NMBA 5JMOA 4I0AA 4KMQA 3AMHA 4AVTA 4LUKA 4NIHA 1CZVA 2NMOA 1URXA 3VL9A 1L7QA 3LOBA 2BNMA 5LW9A 1R083 5E1RA 1JUIA 2ERFA 2WZR2 5KC6A 1RUOA 1LODA 1DYOA 3H1WA 1CAWB 3SNMA 3GBFA 2BP6A 4GWIA 3OEBA 3ELNA 3NJZA 4GALA 3ZYPA 2LALA 5C9AC 1JYCA 1K5MC 1LHUA 1JBCA 4D6SA 1NE4A 4Z1VA 2VOWA 4WM7A 1MZFA 3MBWA 1D4M2 2IXJA 4KU8A 5L19A 1LAJA 1GSLA 1B09A 4IERA 4XMAA 5FIXA 4Z8BA 4HK8A 3D5OA 1MS1A 3JBG1 1U12A 2FDJA 1I3HA 4OZOA 2E32A 2W1UA 4ZU5A 1E5SA 4HVOA 1U0AA 2WJSA 5EHDA 1DGLA 1QQP3 4DUWA 2J1AA 5E8AA 5C9AB 4UF0B 1XU2A 2JDMA 5TSWA 1CZSA 4F8AA 1X82A 2PYTA 1QIQA 2ZX4A 4NRQA 4YLZA 1FNYA 5FYUA 4N43B 1JZ6A 2IFRA 5FQ0B 2RR11 3S6PA 4JAAA 1H0BA 2BGOA 3RSJA 5JXHA 1ULDA 4MGSA 3OB8A 5J1XA 4BISA 2ZGNA 4ARXA 4QGMA 4PDWA 4F7ZA 4Q4V2 5FJKA 4C90A 3I3QA 1IPSA 2WWSA 2VW1A 1PM7A 4Y1YA 1O8PA 1J3RA 1GOFA 1W2TA 2WAAA 4AHZA 3HQRA 5CFCC 1AL21 4XF3A 4HK9A 5DUUA 5LA9A 4JGZA 4OVEA 4LO6B 2CWMA 2DUPA 5FY8A 3V56A 1XXNA 5FPXA 3H0OA 5FV3A 1MS9A 4L2NA 4LT5A 3HQUA 2DBIA 3J7NA 1JZ3A 4L92A 4WVWA 3POGA 1W9YA 2HWF1 1PO21 2Z2SB 4RR3A 1W0PA 1S2EA 2FMYA 4XFIA 4XILA 4Y33A 5GLTA 1O4TA 1QJU3 1W8TA 2W9XA 1LRHA 2IXIA 5CKQA 5F8PA 3MGUA 4DQAA 2GMMA 1PVC2 1AR93 4JDNA 5FFOC 1DZQA 1VE0A 3OGGA 4NOTA 5E6HA 5H9SA 1PGL2 1W6PB 1YFYA 3I2DA 4LBOA 3E5UA 3VV1A 3T3YA 4XFHA 4BIFA 3MLLA 4CDXC 3N7JA 4B3NA 3OUHA 1FPN3 1O3QA 4LK7A 3VBSC 1AR73 1MS0A 1ST8A 1UY1A 4DY3A 4MZUA 5K7PA 1JYWA 3DUIA 1R1ZA 1DBNA 4CP2A 5A33B 4AQTA 4PQ9A 4AWDA 1AYM1 2GMPA 5BNNB 5J3UA 1F9KA 1RUG3 2A6ZA 5EIYB 4BQXA 1W9WA 2GALA 2PMWB 1HV1A 1QJY1 1REFA 1YI9A 3L2HA 1FNZA 2RMU1 3HN3A 4R9AA 1QDOA 1S2BA 1ULPA 3AZWA 5CKMA 1SFNA 4WM8B 4XTMA 3QOPA 4P9LA 2AGSA 3ILRA 1UOFA 1RUI2 3WUDA 4D7SA 1E57A 1IZ3A 3RI9A 5FY5A 3LAGA 2BEOA 3POSA 1XU1A 5EPAA 5I8SA 4F83A 5D21A 4DB5A 2FDHA 1BBT3 1EV11 2A71A 4DY5A 4BMBA 1S1AA 1D0GA 1MS5A 3ZMOA 4AGVA 1N1YA 5H9PA 2OYZA 5K8SA 2OT7A 5IVJA 4HG6B 4QQPA 4AQSA 1W6OB 4UFHA 1MZEA 3MFCA 3T09A 3PMSA 4ITCA 5D8AC 3MICA 3MW4A 4IE6A 4QPWA 5FZHA 4QDRA 3WXPA 1S0FA 4WM7C 1O5LA 5FZBA 1OQDA 5A32B 1EPZA 2W3JA 3P6BA 4FTBA 4PQQA 1ZBA3 1NXD1 1VBB2 4NO4A 4EE2A 2E7AA 3BPZA 3I3DA 4XURA 1VBC2 2MEV1 2QQOA 3LD8A 1YWKA 1N1VA 2GNDA 2WWJA 5JOWA 4QKDA 1Q8QA 3BTXA 2VOXA 4AEMA 4YW5A 5FZMA 4QM8A 5DG2A 1AL0G 4EN6B 3PTYA 4WM7B 5FUIA 2R043 1UAIA 3T0AA 5BNPA 2WDBA 2OUJA 3GF6A 2WYSA 3MLJA 2ZHLA 5K0UC 5GLWA 1W05A 3VDDC 4JDOA 3ZYBA 4XHXA 5C6CA 1W8OA 5CBLA 5FXZA 1VBA3 4PF1A 4UYBA 3Q8FA 5JDBA 3TBDA 5KC5A 1TME1 2HEVF 1RUF3 1VB4A 1DCSA 3PIGA 3VLBB 4BQ1A 2GU9A 3WQ0A 1QJFA 2YYOA 2VW2A 4LK6A 5JSOA 2ZMNA 1L3JA 3AXDA 3I2IA 4Q5OA 4BXSV 3HQXA 5JR7B 1FAYA 3WSOA 4BM8A 3U37A 2YPJA 5IAXA 2A7AA 4W8JA 2W08A 4GA9A 1JN2P 4MOAA 5F5CA 4PDWB 4OI1A 3ES1A 3B69A 1RUC1 1LENA 1H1MA 4IDZA 5A3UA 1V00A 2A3YA 4RR3C 2ZX1A 3H8XA 2RS53 2YGLA 5FREA 3WNPA 4XMIA 4QGNA 4GWNA 5FY7A 2KA3A 4I09A 5ACA1 5IFPA 4A45A 1RUH1 1Y4WA 2DVFA 1NZCA 2WQZC 3IDCB 4JGZB 1Q8SA 4RL7A 3ZXEA 3RJ2X 3IBMA 2A6YA 1UYXA 2GC2A 2VO5A 4WZCA 4DRVA 2QQIA 5DDJ2 5IUQA 1Z7S1 4UXAA 4NIAA 4FPFA 1IG3A 5HXVA 4RR3B 2R0HA 5D2AA 1Y9MA 1CQ9A 1HXS3 1XE8A 3O14A 2JD4A 1YCIA 5LA1A 5JCTA 1Y3TA 2BVVA 2XB6C 4KI5M 2Q5TA 4ZS2A 2C0ZA 2LM3A 3H1MA 4GIQA 5FLHA 5FYYA 4CXXA 4QQ2A 2D6KA 2RS13 1Y9QA 2JECA 2UWCA 1GOGA 4IUGA 2MEV2 2NM1A 4RHV2 4RQPC 4YVWA 3U10A 2W52A 1JS9A 4NPMA 4QX3A 2JXAA 3K4ZA 2A1XA 4HKOA 3MDPA 3W59A 2WNVA 4KWJA 1MEC3 4QPYA 3S5AA 3MIEA 5LK5A 1DLCA 3A0NA 3RZJA 4WZFA 1L7RA 2R073 2WZR3 3T0BA 3VBRC 1WUVA 3B9CA 2YFUA 5SV8A 1AXYA 2CAUA 3KT7A 3VN4A 3TNPB 4Q4X2 1YJLA 1U5XA 5FZ1A 4ZU4A 3SCGA 2RS31 4E9KA 2ZGPA 4YG0A 2YU1A 2D6OX 3D3AA 4LA2A 4XXAA 4DPNA 1C5HA 2CGOA 4EZHA 2PLV2 2ADEA 2NMNA 4LE3A 3ZYRA 4YARA 5A1LA 2EALA 3VBHC 4JRAA 4JTOA 5HCAA 4JX0A 2J1RA 3MV11 1UZ0A 4UAPA 4CCMA 2JDYA 2VTXA 4UFKA 1AJKA 4FPYA 1AX0A 5KHHA 3SEPA 4AI8A 5KXCA 4FAHA 3U1XA 4URAA 1RUE3 2RM23 3VKMA 4L0PA 1SCSA 1QJZA 1UYYA 2CTVA 4M3CF 4MLOA 4AVCA 5A3LA 3WY6A 1IS4A 4PCRA 3UKVA 1ASJ2 2G9GA 5BNPC 5IVCA 2K46A 4BK5A 5ACA2 1AR83 2OZJA 4DXRA 1QJX2 3DF0A 1RUH2 3K77A 4JDMA 4AFAA 3HBZA 5FZ3A 3W20A 3WEZA 1JODA 2P1BA 3ZOIA 1NLRA 3MLKA 1SDDB 1EPWA 1VAVA 5BNPB 2ZCWA 3WDXA 2E31A 3LDBA 1OQEA 2EIBA 3WG4A 3ZN6A 5L7OC 5CA6A 3X29B 3U07A 2E33A 1UY4A 4PBPA 1IS5A 1RTVA 1HN1A 4XEZA 4K40A 4XJWA 3UT0A 5I8YA 3LB9A 4NRPA 4D0QA 2HWE1 3WD5A 3EXUA 5F3GA 3OGJA 4LITA 4BLIA 2ET1A 4OYUA 3U78A 1HN0A 1YRZA 1WCDJ 2W91A 1W6NA 3RZZA 5CFDC 1QMJA 1RUD1 3HT2A 3PL0A 1KRIA 2CY6A 3JUUA 3DXUA 1W39A 1AR62 4E4ZA 3VBOA 1DLLA 4JZRA 3H9AA 1GZCA 2PTMA 2VQTA 4HL0A 3U14A 1D4VB 1QOOA 3KV4A 2Z42A 3RPQA 1QNWA 3CEWA 2C24A 2ZGUA 3FBYA 4LBLA 4PF5A 5FZCA 4B1MA 1YQCA 4FPKA 4Q4W2 2HH9A 4A7ZA 1W8ZA 3N9QA 4FFGA 5LA2A 1ZYBA 1REEA 3JBG3 3OBTA 4QU1A 1QXJA 1ZZBA 1FT9A 4YGDA 3WW3A 4LBNA 2BERA 2VVFA 2EIDA 2X8KA 4FFHA 1UN1A 4D7YA 3CJIA 4B4PA 1H8TA 2MHFA 5FZ9A 1UZWA 3NNJA 4J6GA 2F4PA 3AP7A 2WNVC 3LOIA 4XUTA 2W68A 2ZGMA 3LCPA 4JQTA 5FZ6A 1G6NA 4S2DA 3CJXA 4CU6A 4P00B 1LEDA 2ZHNA 4TXWA 2RR13 2YC0A 4CCDA 2VG9A 4IEXA 3FHAA 4AGRA 5FUNA 1A8DA 3UETA 4YVWB 5AFEA 1GNYA 1CX4A 2VMGA 3T4HB 4BQ4A 1O59A 2B5HA 1KS5A 3DGTA 1AXZA 3KGLA 3E6BA 4XBNA 4BXFA 2WNVB 4JKKA 4XABA 3AYEA 5FZOA 3ZXFA 2WINB 4AXOA 3CKHA 1OFNA 2QQKA 5KHIA 3FLPA 4CUBA 4O65A 5FZIA 1AL23 5LY2A 3MW2A 3WQ7A 2ZZJA 2WZPP 3CL1A 5T54A 5JXGA 3ZFGC 2QQLA 3WINE 1IS3A 4YW2A 3ZXLA 3LF7A 5AC92 2KXLA 5HCFA 1PO11 2NPIA 2OPWA 3LEGA 1BEV1 1WLCA 1W9FA 4UI9L 2RDQA 2HWF3 1PO23 5JI7A 4IEZA 5JSPA 1V9U2 1XNCA 1SLLA 3J26N 3WF4A 1AZDA 3PVNA 2PHFA 2XH6A 4TN7A 2Q8OA 3GXUA 4P9YA 2ZEXA 3UJQA 3WQBA 2GH8A 1DIWA 5A3WA 1D2QA 1RUD2 1PGW1 1ZM1A 4DXSA 2BRTA 2H6CA 3ZFFA 4BQ3A 4HXCA 1SLCA 1NQDA 2VW0A 1RC6A 3RGBA 3L2YA 4FPJA 3J7MA 4COZA 1J3QA 2VUJA 4PI0A 3C7OA 3HNYM 5FYMA 5JVVA 4C8DA 2ILMA 4QB6A 1WW5A 4TTGA 1XNBA 2W1QA 3MZHA 3LA7A 4M0NA 4UBGA 4DOUA 3UGHA 5LBEA 3LKJA 1R082 3FX3A 1AYM3 3VUOA 1YUDA 5GLUA 4CU9A 1O3SA 2I07B 3HBKA 3RDIA 1CPMA 1R64A 3FUQA 1QJY3 3BOPA 2B4KA 2RMU3 3HEIA 2ZGTA 3DYPA 4XF0A 5DAWA 1QF3A 2R1DA 1K5JA 3O1VA 4P9IA 2AR6A 1RUG1 2CGNA 4O61A 1V6IA 5FZ7A 1TVGA 3WW1A 1QU0A 2VNRA 2WFF1 4IEUA 5FKCA 4G9SB 1PNGA 4CDWA 2RDNA 3ZN6B 1ZREA 2ZXQA 2A6WA 4LKEA 1EV13 3BU7A 3GJAA 1QQP2 4LPLA 1GWLA 3POWA 4UWDA 5A7PA 5BNOC 1WCUA 1NAEA 1T2XA 4LO4B 3EB7A 3JZVA 1O4YA 4W65A 2Q1FA 2XJVA 4DO0A 2XR4A 3OBAA 4YWAA 2DVDA 3VKOA 1JZ7A 3OGRA 5FK7A 1JOJA 4RYDA 2P2KA 4LE4A 4X6RB 1W6NB 1AYN1 1NCQA 4CEYA 1W03A 4V1PA 4Z07A 5LK7B 1YLLA 5LY1A 4X8NA 1X36A 3VBOB 2I45A 4NPLA 5I91A 1P8JA 1S0GA 2JE8A 1EUTA 1ENSA 5T50A 2IFWA 3LIGA 2WS91 1Y7BA 2QFEA 2JG8C 2VZSA 3O1OA 3CJIC 4LKFA 4S2FA 1W9TA 3NVCA 3TNQA 1KQRA 1SCRA 3VD5A 1W90A 2GZWA 3VBFA 2WSVA 1EY2A 1WBLA 2R0FA 3NNFA 1MACA 4C0BA 1JHNA 4NAMA 1N3PA 3PJQA 4D69A 3S7EA 2O1QA 4O9EA 3KLSA 1TME3 2HWD1 4PBOA 3H3UA 3QCWA 1H1IA 4PJYA 1JU4A 3HR9A 3CJIB 5BPXA 1H8TB 2HWB1 4Y5TA 5FP4A 2PA7A 4XQ4A 1BVVA 2EXHA 1AR92 2K0GA 1SACA 1SHWB 3WUCA 1RMU1 3WG1A 1YQ2A 4D94A 1RUJ1 2C5DA 2ZPXA 5F9TA 2ZTNA 4YW7A 3KZ4C 3MI8A 3SC7X 4AF9A 2JDZA 4QHZA 4PLMA 1AR72 3LFIA 1POQA 4E27A 5KXEA 1DF0A 1RUC3 2YHJA 3RWKX 3BOWA 4WVZA 1RGSA 3PUSA 2C1FA 4DFSA 4OHXA 3JXSA 1RUG2 3PUQA 1JXNA 1NT0A 2VZ3A 2XJTA 3JCIA 4OHWA 5FZOB 2IXHA 1K3IA 1SZBA 1SBDA 3KV9A 3M3IA 4BLJA 1S0DA 5FMOS 5C5UA 5LZ6A 1UKRA 2IVJA 2Z69A 4ET7A 3DPRC 3JD71 1IGOA 2RS51 2W0XA 3CMGA 2CV6A 3EBRA 2BPA2 1OA4A 1Z7S3 1H4HA 1LOCA 2ZGOA 1COV1 1US2A 3EQEA 3GHMA 4MO3M 2BZDA 1BBT2 3A21A 4NJ4A 2JDNA 4XAEA 3ZXAC 3OGSA 2GP3A 3VDAA 1WD4A 5A3OA 3WLUA 3AC0A 3ILNA 5FYVA 1DQ5A 3ZFFB 1YQ8A 2W46A 4YM3A 3U4XA 2Y6GA 1V6KA 4RA0A 4HBNA 2J1VA 2QZ3A 3OD4A 5I0DA 2OX0A 2ZACA 2EA7A 4IGPA 1F5FA 1AX2A 2PHTA 2YZ4A 2VOTA 4MGKE 3ROUA 1MZ6A 2RE9A 1V6JA 5KHGA 2LROA 1Z0HA 3RNSA 4QQOA 1NG0A 4C1XA 3O1PA 1W2OA 4GKYA 5C4WA 2LUWA 3OOXA 3M4FA 4HETA 4X6QB 2RG4A 3PIJA 3R4DB 1UPSA 3BN6A 3WT3A 3ZXJA 4YZ2A 1W6QA 2RS33 2TEPA 3KM5A 1OOPA 2R042 3NWKA 4XF4A 5GM0A 1OA2A 2UYAA 4KNCA 4RS5A 5F3CA 2Y6LA 3AMPA 1SFYA 2BBAA 3KV5A 4AI2A 2AEYA 1F8VA 2D6NA 1YFXA 3AZXA 1VBA2 1YI7A 2FZ1A 3M2MA 1KD7A 4O7XA 2D5HA 5DZGA 4CDWB 1LEMA 1UF2C 1G86A 1WLDA 2LS6A 2X5IA 3ME2A 4DXTA 2SLIA 1RMU2 2WIIB 2VH9A 3OPZA 2O14A 3WF3A 4XHBA 3ZYFA 2BBVA 3PURA 2CSGA 1HB4A 1RUF2 2HEYF 2X09A 1BQPA 3ZFEC 4L9BA 5I0RA 3R05A 1IHMA 3NQHA 4ATFA 4NE9A 5A3TA 2BV4A 4Q27A 4W50A 3USUA 3V0AA 1YQ5A 2OQ7A 3ZYJB 1UYZA 4HT1T 4KGQA 5F2WA 5DZEA 2BUKA 3Q8EA 1KXGA 4BE3A 3N36A 3KMHA 2Q0AA 3WP5A 3UK9A 3B5LB 2DCKA 2AACA 4H2AA 3L9JT 5EXOA 4CVUA 1NCQB 4CEYB 5AVAA 3PVBB 2R1BA 4K9SA 1JZ4A 1S0BA 1K45A 5IVYA 4XDPA 4QXKA 1GZTA 2VBDA 3NAPA 4AEKA 5LRSA 1DGRA 2RS52 1NUKA 4IE7A 4FBFA 1RIRA 3ATGA 3SHRA 1AR81 2BGPA 3AXEA 4FXKB 2JB4A 5DN2A 3ZSLA 4LHKA 4D6QA 2WN2A 1ULGA 3VBFB 2G19A 3CZUA 5FXVA 3IKWA 4MHRA 2ZEZA 4HKWA 3BUCA 2Y26A 4IEQA 4YVSA 2HWE3 4RN5A 3BKZA 2YBKA 2ZKNA 2EIEA 1HXS2 3WCRA 5LEJA 3RFRA 1G8WA 4Y5SA 3ZSKA 4NUBA 1KDKA 1CONA 1J58A 1RUD3 5ANNA 4COWA 3WR0A 3IWZA 2VMCA 1WCKA 2E26A 2RS12 4R9BA 5JMCA 4QQLA 3NV3A 2ZEWA 5KR7A 1UX6A 4ZY9A 4D3WA 1OLRA 2UU8A 3KVAA 4XQWA 3OPWA 1MEC2 3I2HA 1A78A 4QGLA 3GM8A 5FZKA 1W9SA 4B4QA 2R072 3IAQA 1ACCA 2QE3A 4IGOA 1QHDA
chains in the Genus database with same CATH topology
3KHBA 4MG2A 4NJ4A 4IE5A 3O1TA 4NRMA 3I3QA 4ZS3A 3O1VA 4NRPA 4O61A 3O1PA 4IDZA 3H8XA 4IE0A 2FDGA 3T4VA 3O1RA 3O1UA 4NIGA 3BIEA 3RZGA 4OCTA 5F8PA 4O7XA 3I2OA 4QKBA 2FDFA 3BI3A 2FDKA 3T3YA 3RZHA 3KHCA 4NROA 4NPLA 3LFMA 3H8OA 4ZS2A 3O1OA 4CXXA 5DABA 3RZMA 3RZKA 4NPMA 2FD8A 2IUWA 3S5AA 3RZJA 4IE7A 4NIIA 3H8RA 2FDHA 4NIHA 4IE4A 4CXYA 3T4HB 3O1MA 4JHTA 4MGTA 3O1SA 3S57A 4IE6A 3I3MA 3BUCA 3BTZA 3BKZA 3RZLA 4RFRB 3BTYA 2FDJA 4CXWA 4QKNA 4QKDA 3BTXA 4ZHNA 3BU0A 4NIDA 4QHOA 4QKFA 2FDIA 3I49A 4NRQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KHB A;  4MG2 A;  4NJ4 A;  4IE5 A;  3O1T A;  4NRM A;  3I3Q A;  4ZS3 A;  3O1V A;  4NRP A;  4O61 A;  3O1P A;  4IDZ A;  3H8X A;  4IE0 A;  2FDG A;  3T4V A;  3O1R A;  3O1U A;  4NIG A;  3BIE A;  3RZG A;  4OCT A;  5F8P A;  4O7X A;  3I2O A;  4QKB A;  2FDF A;  3BI3 A;  2FDK A;  3T3Y A;  3RZH A;  3KHC A;  4NRO A;  4NPL A;  3LFM A;  3H8O A;  4ZS2 A;  3O1O A;  4CXX A;  5DAB A;  3RZM A;  3RZK A;  4NPM A;  2FD8 A;  2IUW A;  3S5A A;  3RZJ A;  4IE7 A;  4NII A;  3H8R A;  2FDH A;  4NIH A;  4IE4 A;  4CXY A;  3T4H B;  3O1M A;  4JHT A;  4MGT A;  3O1S A;  3S57 A;  4IE6 A;  3I3M A;  3BUC A;  3BTZ A;  3BKZ A;  3RZL A;  4RFR B;  3BTY A;  2FDJ A;  4CXW A;  4QKN A;  4QKD A;  3BTX A;  4ZHN A;  3BU0 A;  4NID A;  4QHO A;  4QKF A;  2FDI A;  3I49 A;  4NRQ A; 
#chains in the Genus database with same CATH topology
 2GME A;  4MG2 A;  2AZ5 A;  4IE5 A;  1JUH A;  4P02 B;  4HN0 A;  4CU7 A;  3RS6 A;  1Q43 A;  2XL7 A;  4CDQ A;  3LGR A;  4IV1 A;  3PU8 A;  4QDS A;  2ZHM A;  5T5L A;  5EP9 A;  4AQ6 A;  1DGR N;  2E7T A;  2ZGQ A;  4N43 C;  1XPW A;  2CWS A;  3MYX A;  4ZS3 A;  3S0M A;  2CU5 A;  4P9J A;  1OI6 A;  5E16 A;  2A6X A;  1SMV A;  3SCH A;  3SIS A;  1W8U A;  4UFJ A;  1I1E A;  2IWG B;  3W5M A;  1O3R A;  1I5Z A;  1RUE 2;  3ORJ A;  1CJP A;  2RM2 2;  3E6C C;  2HBT A;  2B42 B;  1RXF A;  2R7E B;  3E5Q A;  3E5X A;  3KCX A;  3NNL A;  5IJR A;  4YFZ A;  2VCC A;  3AP5 A;  4ZXE A;  1I5P A;  3GCX A;  2ARA A;  2IZW A;  1JHJ A;  1AR8 2;  1BMV 2;  1O7F A;  3MFA A;  4OCT A;  4N7I A;  2X5I C;  1LHO A;  2MNG A;  4QPG A;  3IZO A;  4IND A;  1LOE A;  2WZ8 A;  4QKB A;  4ISR A;  2LTN A;  2VJX A;  1OT5 A;  3P3N A;  2D44 A;  2VUL A;  4GWJ A;  2WSU A;  3LWC A;  3RRD A;  1JMU B;  4UFL A;  3ZIX A;  3GBG A;  1X9T A;  3R0R A;  4IW3 A;  2BOI A;  3RYP A;  1PO1 3;  3E97 A;  3RZK A;  1W6Q B;  1H2L A;  5FUP A;  1BEV 3;  1OOP B;  1L7L A;  2DUQ A;  4RS5 B;  3LEK A;  1HJF A;  1LU2 A;  3AP4 A;  3POY A;  4AZZ A;  1UOG A;  4D6R A;  3C3V A;  1YC6 1;  2BNO A;  2JIJ A;  2ENR A;  5FZ0 A;  4COY A;  5DAV A;  2X5I B;  5IVV A;  3WP6 A;  5F37 A;  3N7K A;  4EWD A;  3EO6 A;  2W1W A;  5F2S A;  4LLO A;  5G04 L;  4YGB A;  3V65 A;  2R06 1;  5GLZ A;  3KS7 A;  4LO7 A;  5FWJ A;  3VKN A;  3USU B;  1R09 1;  2IUW A;  1WMF A;  3V0A B;  5BNN C;  4E4H A;  5FY4 A;  1NQJ A;  1GFF 2;  1RED A;  1PM4 A;  5GAL A;  2EAK A;  1ZBE 1;  4CZS A;  3ACF A;  3PTR B;  4YRD A;  2WO2 A;  3HMY A;  2JWP A;  1ONA A;  2BFU S;  2PHD A;  3GGL A;  4GUL A;  3WNL A;  4E2G A;  4WM8 C;  1UXX X;  4W4Z A;  2LRP A;  4MGT A;  4I0W B;  1VRH 1;  1RIT A;  5LCW L;  3W5N A;  3NAP B;  3RG0 A;  1UZY A;  1U5I A;  1OD5 A;  1LGB A;  3RQ0 A;  2DV9 A;  2WFF 3;  1QH7 A;  5KHJ A;  2I2S A;  2Z4F A;  3JBG 2;  2XUE A;  4GB3 1;  3CO2 A;  1CIW A;  3ENR A;  1RUN A;  4W6Y A;  2XVK A;  5FK8 A;  1NE6 A;  3FHI B;  3P1I A;  1ND3 A;  2QQJ A;  3DYM A;  5FP7 A;  2A70 A;  1GQH A;  3HVD A;  2E9Q A;  4N8M A;  2XPJ A;  3TYJ A;  2CDO A;  1G9C A;  1C8N A;  3SIT A;  4BME A;  5CAD A;  2WYF A;  4YVS B;  2WT1 A;  2BGC A;  3HWJ A;  3Q9O A;  5CZK A;  3B01 A;  3A7Q A;  4XJ8 A;  3ZYH A;  1AVB A;  2DBN A;  4YZ1 A;  4W6X A;  5ANQ A;  1AYN 3;  2RR1 2;  4Y22 A;  3ECQ A;  2VZQ A;  3GHN A;  3WF1 A;  1ENX A;  2VZV A;  5ABJ C;  1GNH A;  2Q8D A;  2ZML A;  4LXL A;  1F31 A;  2R16 A;  1ZRI A;  4FQ4 A;  5A7Q A;  3O1T A;  2JG9 A;  3BTA A;  1MZ5 A;  1RYY A;  2WS9 3;  2WO7 A;  2XOM A;  4LNV A;  2PEL A;  5AFB A;  5F6K A;  5JR2 A;  1AL2 2;  4FTS A;  3WQ1 A;  3QH6 A;  4XJ9 A;  3HNB M;  1HJG A;  3LIH A;  5C71 A;  1PZ8 A;  4UFM A;  3JQX A;  5ABJ B;  4XUQ A;  2D97 A;  1W8N A;  2VZU A;  1ULO A;  4XAC A;  4HVR A;  2DYC A;  2HWD 3;  2HWF 2;  1PO2 2;  3VZJ A;  1WMX A;  2DVG A;  4CDQ B;  3A23 A;  1LGN A;  3LPG A;  2OII A;  4IV1 B;  3SLI A;  4DIQ A;  2G9F A;  1H6Y A;  1GAN A;  3D0S A;  1W0N A;  2HWB 3;  3ZPO A;  1F2N A;  4KQ7 A;  1TEI A;  1YYN A;  4URT A;  2Y38 A;  3J8F 1;  1BZW A;  1RMU 3;  2HBU A;  5FY9 A;  3SKV A;  4HFS A;  4DUV A;  4PIZ A;  4PIY A;  1RUJ 3;  3RMX A;  2VUA A;  3NKT A;  2O8Q A;  4PDW C;  4XJU A;  5F5Q A;  3SKJ E;  5J96 B;  5HCH A;  2JB8 A;  4XE9 A;  1LOF A;  2UY9 A;  4GKX A;  4LOT A;  5A3N A;  1V6L A;  4J1X A;  4ZON A;  1I6X A;  3PUI A;  1VBE 1;  3MV0 1;  4QX1 A;  2JEN A;  1SBE A;  3CLP A;  4TLF A;  2V73 A;  3CIH A;  1KS4 A;  5FZD A;  5CB7 A;  1AYM 2;  2AC1 A;  1C57 A;  4JGZ C;  4GZ9 A;  3SEE A;  4OHY A;  4UBH A;  1XBF A;  3IT8 A;  1QJY 2;  1WME A;  4GB3 2;  3AYC A;  2RMU 2;  4E4D X;  4QPG B;  3ZR5 A;  1VMF A;  3JD7 3;  5ABJ A;  1OH3 A;  1BLZ A;  3H3Z A;  3KV6 A;  3ZDS A;  1DZR A;  5JOY A;  2QKD A;  2YUE A;  2DTW A;  3SH5 A;  1PMH X;  5KBF A;  3CU7 A;  1JOP A;  3RJR A;  2P34 A;  4H55 A;  1PIV 1;  5F32 A;  3WDT A;  3W21 A;  1COV 3;  4MUV A;  4Q1R A;  1UWW A;  4LBM A;  1EV1 2;  2QQV A;  3NJY A;  4EWE A;  2P3J A;  3MO4 A;  2EIG A;  1UIJ A;  2H0V A;  3H8R A;  1KDM A;  1F15 A;  1UMZ A;  2JDU A;  3ABZ A;  1UXZ A;  4IV3 A;  3HPN A;  4B29 A;  4BQY A;  2D3P A;  4R8H A;  5I0T A;  2VMF A;  5FYT A;  1OF4 A;  5G05 L;  1IOA A;  5FPV A;  3O1S A;  2ZGL A;  1O5U A;  1B35 A;  4HAN A;  4IES A;  3ZSE A;  1X8M A;  3OTF A;  5CIS A;  1FYU A;  5LEK A;  5L36 A;  2ETE A;  1YIF A;  2BU9 A;  5CAZ A;  2GNT A;  4IEV A;  4FOY A;  2WFP A;  2P3I A;  2B9U A;  2PN5 A;  1HW5 A;  4A4A A;  4B1L A;  1HRI 3;  1AX1 A;  5IAV A;  1ZVF A;  4HMZ A;  4IEY A;  1JYX A;  4QB2 A;  4LIV A;  4BK4 A;  5JZG A;  5FBZ A;  4HLT A;  5FZ4 A;  2VZO A;  1UY0 A;  3OSD A;  4JCK A;  2HEW F;  1S0I A;  1DQ0 A;  4CCC A;  4BIO A;  2Q8E A;  4DZG A;  1C28 A;  2Y8K A;  3AL5 A;  3H8U A;  5ERL A;  1ND3 B;  3T2T A;  1NLQ A;  1TME 2;  3HD8 B;  4EJR A;  4IEW A;  4DMI A;  1XE7 A;  5LBB A;  2D7F A;  4XDQ A;  2VMI A;  2QDN A;  4CEW A;  1JYI A;  3N4M A;  3FFZ A;  5GKA C;  4GJZ A;  4CCL A;  3W9A A;  1HV0 A;  2PAE A;  5HBA A;  2ZZQ A;  3AP9 A;  1GBG A;  2Q1M A;  4YYO A;  3I4I A;  1C4R A;  4PT6 A;  4Y22 B;  5FKB A;  3CDZ B;  1LJ7 A;  1D7P M;  1UO9 A;  3LEI A;  4FO9 A;  5CG9 A;  1DDL A;  4OMD A;  1A34 A;  1LKN A;  3QD6 A;  1RUC 2;  4XVH A;  1TNF A;  2H6B A;  2JG9 B;  2WQ4 A;  1KFX L;  4M4R A;  4ZPI A;  5C3R A;  5C3Q A;  1CJD A;  1ULC A;  5FBJ A;  4BA6 A;  2VCA A;  2UUR A;  1N3O A;  4CDU A;  4M01 A;  4A2U A;  5DXD A;  1H1A A;  1MS4 A;  4BQW A;  1VAL A;  4ZXK A;  4A41 A;  2C9K A;  3OY8 A;  2NN8 A;  1Z7S 2;  2UY8 A;  3NNM A;  5L9R A;  3MPB A;  2OQ6 A;  1H4G A;  3ITQ A;  3MID A;  5BXX A;  1E5I A;  1R1A 1;  5FLJ A;  3T2P A;  3BI3 A;  5DUW A;  4W6W A;  3B94 A;  1V70 A;  1J83 A;  2XQR A;  4O9G A;  2YDE A;  2GC1 A;  1DP0 A;  1LCL A;  1W3V A;  1DHK B;  2V72 A;  3CZJ A;  2DVA A;  4XFA A;  3A4U A;  4OI2 A;  3THP A;  2WZE A;  4QAW A;  1IQA A;  4QX7 A;  4ZKT B;  1WD3 A;  2D3S A;  2HWC 1;  3FLR A;  5DAB A;  1HRV 1;  2YBP A;  1CGP A;  4NMI A;  4QXC A;  4DEV A;  1LR5 A;  4HPK A;  3FBM A;  1Q8O A;  2W39 A;  2XUM A;  3N35 A;  2WNO A;  5KHK A;  1ZZ6 A;  4A3X A;  3IM0 A;  2DCT A;  3MEP A;  5M0T A;  1IKQ A;  4N53 A;  2VVE A;  4KWU A;  1H9W A;  4CCK A;  4YM0 A;  1W2U A;  2RS3 2;  4Y1Z A;  4Z2W A;  1U5Y A;  1H2N A;  3P3P A;  4CP0 A;  2QQM A;  1W06 A;  1SLT A;  2P37 A;  3AMM A;  3FL7 A;  3PVE A;  4I30 A;  4XTP A;  3SQO A;  3U4S A;  1CVN A;  1TMF 1;  4OHZ A;  3NJV A;  5DAP A;  3OJB A;  1FMD 1;  1PK6 A;  4Y5Z 0;  5C3O A;  2ADD A;  3MUY 1;  3T1L A;  4M4P A;  1ODN A;  4FOV A;  3OEA A;  4P08 A;  5IK4 A;  4E2Q A;  4YVW C;  1A8M A;  4Y1X A;  1YNA A;  3ZXG A;  4IV3 B;  4OHV A;  5F7U A;  1IPK A;  3URF A;  5A7S A;  3AMQ A;  1OC1 A;  2WA3 A;  2GDF A;  4GWM A;  2W2I A;  3T2Q A;  4MHU A;  5HV0 A;  4QKN A;  3R4S A;  3BCW A;  1B35 B;  2QNK A;  4ZHN A;  3LEM A;  4QU2 A;  4BHP A;  5EFU A;  4BQ2 A;  2IXC A;  1GP6 A;  4RSU A;  2Y60 A;  3VKL A;  1GQP A;  4KBB A;  4Y24 A;  1ENR A;  1F5J A;  4MGZ E;  1E5H A;  1JH5 A;  1SDW A;  5A7O A;  3UYJ A;  4Y1V A;  5JIA A;  3CNA A;  4YFW A;  4WBB A;  4AOC A;  2OA2 A;  2P6H A;  3IDB B;  3ZPY A;  5JZG B;  2BOJ A;  2IC1 A;  1SFP A;  4P9G A;  4QQH A;  4IQP A;  1VBD 1;  4XW3 A;  2VXR A;  5GZD A;  2WA4 A;  4OUM A;  4XBL A;  2PHX A;  3BOD A;  1CZT A;  1QXR A;  2HWE 2;  5EJZ B;  5IFT A;  1C8M 1;  3B00 A;  1AUY A;  2R06 3;  5SV5 A;  5HPO A;  4CEW B;  4CPB A;  5A6Q A;  3ZSJ A;  4XUN A;  3U11 A;  1R09 3;  5FO8 B;  5EJ1 B;  3UES A;  4CCE A;  3B02 A;  1NY7 1;  1SG3 A;  1V0A A;  1BJQ A;  1Q3E A;  3F95 A;  2ARX A;  2VOV A;  1ZBE 3;  4LA3 A;  4Q0Q A;  1FX5 A;  1QY4 A;  1OXC A;  3OPT A;  4CDU C;  3OG2 A;  5T5P A;  3THD A;  1NA1 A;  2VR4 A;  4HN1 A;  2ZGR A;  1Y43 B;  5A80 A;  4AR2 A;  1OSG A;  3N9O A;  1VRH 3;  1OMI A;  1WKY A;  3AKP A;  3O1R A;  3M3Q A;  2AUY A;  3JB8 A;  4LBQ D;  3RZG A;  2ZGK A;  3IMN A;  4P5H A;  4BOW A;  5L9B A;  3HAG A;  3I2K A;  1S0E A;  1CAX A;  1DYK A;  2YB7 A;  3LZZ A;  4P9X A;  1OFS A;  3OCP A;  3PJY A;  4Q8K A;  4GB3 3;  3M3E A;  1FMD 2;  4PLO A;  1GNZ A;  2W5F A;  4CDU B;  3VZM A;  4XJA A;  5LRR A;  2XVL A;  4NRO A;  2EVX A;  2YG0 A;  5E89 A;  1QWR A;  2VZ1 A;  2KR2 A;  5F3I A;  3OD0 A;  3OY8 B;  4JVA A;  1LTE A;  5CVR A;  3ZVX A;  2B7Y A;  2CNA A;  4BZ4 A;  2YRO A;  4QWN A;  3WHT A;  1LEC A;  4Z82 A;  3UGF A;  1ND2 A;  4Y4R A;  3VBO C;  2DCZ A;  1ODM A;  4ISQ A;  4Q1P A;  4BQ5 A;  3H42 B;  4N9I A;  5IVE A;  5JXJ A;  2VU9 A;  2D6M A;  3G6J B;  2YPD A;  3FWE A;  1UYP A;  4Q0U A;  1GP5 A;  1GOH A;  3O5S A;  3WDV A;  4AVB A;  5A1A A;  4QHB A;  1J59 A;  2XJR A;  4YSF A;  1YFW A;  2RDR A;  1UIK A;  1PZ9 A;  3APB A;  1WBF A;  3TWI A;  3ZR6 A;  4DNY A;  4IE4 A;  2D6L X;  2JE9 A;  1MQT A;  3AL6 A;  5CNA A;  3MIF A;  4HPK B;  1NZI A;  3WDU A;  4AVS A;  2X10 A;  3O1M A;  5IW0 A;  2G9Z A;  1SLA A;  3POI A;  1HQW A;  3QAC A;  3PUA A;  5FXX A;  4AI3 A;  1GP4 A;  1RHI 1;  3A22 A;  4N53 B;  2VM9 A;  3ZO0 B;  1G9F A;  1PO1 2;  5J7M A;  1H8T C;  1BEV 2;  4PI2 A;  5K9Y A;  4B8E A;  3I2F A;  3GZT B;  5H9R A;  1WA4 A;  3RZL A;  1O3T A;  2JDP A;  4Q8L A;  4QT6 A;  2PAK A;  3M7A A;  3N9N A;  1KEX A;  1PK6 B;  4OUL A;  1ZA4 A;  1PGW 2;  4A3Z A;  3J8F 3;  5LA0 A;  4P5Y A;  1FXZ A;  3DEM A;  3BGA A;  1JW6 A;  5C8C A;  2VNV A;  5T3N A;  2HYK A;  3ZX7 A;  1OLQ A;  4UW4 A;  2D40 A;  5I8T A;  3TEX A;  1NLS A;  3VHR A;  4CU8 A;  2VCB A;  4IGQ A;  4QD2 A;  3WF2 A;  2JKX A;  1VBE 3;  3IDE A;  4Z92 B;  4NAO A;  1FAT A;  3FLT A;  3QBQ A;  4E8D A;  4SBV A;  4Q4Y 3;  3KCY A;  1GU3 A;  4FFF A;  2JDA A;  2ZAB A;  1EUU A;  3MIB A;  3MF6 A;  4IEP A;  1LES A;  4C0H A;  4EN0 A;  2VZP A;  4FI9 A;  4QX8 A;  3VZN A;  3M3C A;  3VD9 A;  2V5D A;  4NRM A;  3I3B A;  4FOQ A;  3WP3 A;  4CP1 A;  4KWK A;  2WFF 2;  2EAA A;  3W58 A;  3ZXD A;  4LHN A;  4NHY A;  1PIV 3;  1RVF 1;  1UOB A;  5FPZ A;  5FZL A;  2XKP A;  2VQA A;  4U2A A;  3ZYG A;  4ES8 A;  1OKO A;  1RJ7 A;  3PLQ A;  3AB0 A;  3JQW A;  4MX3 A;  3ZFF C;  2ID4 A;  4K20 A;  2QQU A;  3EMR A;  3MHZ A;  5FTT C;  2DU1 A;  5IHR A;  3K46 A;  2TBV A;  4FXG B;  2V5Y A;  1GKB A;  4AHW A;  1UZV A;  4Y1U A;  4IE0 A;  4AFC A;  5C4W B;  4Q0S A;  2AYH A;  1WLW A;  2PQS A;  2VEC A;  4JGY A;  3BIE A;  4PHZ A;  4NN0 A;  4V2V A;  1AYN 2;  1GLH A;  3A0K A;  1QH6 A;  4EQV A;  1QGL A;  1PX4 A;  4HON A;  3KB5 A;  4AVA A;  2PFW A;  1HB2 A;  3B7M A;  1DQ1 A;  4Y4Y A;  4FPG A;  4XFG A;  1POV 0;  1ZRR A;  1NA1 B;  3D0J A;  2H0B A;  1V6N A;  2J1S A;  5J98 B;  3SH4 A;  2WS9 2;  3IPV A;  4CTE A;  1UL9 A;  1QEX A;  4CDW C;  1W2A X;  2D3R A;  2J1T A;  4XOG A;  4LO8 A;  1CAX B;  3K2O A;  4YGE A;  5FPA A;  5FYH A;  3ZDV A;  4AVV A;  3MW3 A;  5DG1 A;  4GMP 0;  2SBA A;  1VJ2 A;  3KWV A;  1LOB A;  4MXV A;  3ZIW A;  3RZM A;  1HRI 1;  1K5M A;  3DN7 A;  4XJZ A;  2XJS A;  2HWD 2;  2YU2 A;  3H1Y A;  4G3Y C;  2N7G A;  1Q5O A;  2Z5W A;  5IK8 A;  2FCU A;  2VME A;  4YG6 A;  2YBS A;  3N7L A;  1JYT A;  4K3U A;  2HWB 2;  3KF5 A;  1YEW A;  2EXK A;  1XYP A;  4A7K A;  2XJU A;  1NCQ C;  1MQT C;  2OXB A;  1UY2 A;  4AI1 A;  4CEY C;  1CX1 A;  3RMY A;  1ND2 B;  1RUJ 2;  4LO5 B;  1ZX5 A;  4UW5 A;  2VE1 A;  1BCX A;  2IVI B;  4XPV A;  1KFU L;  2Q30 A;  1US3 A;  1VRB A;  4AYU A;  3M70 A;  2WC2 A;  4OI4 A;  2XLG A;  1QJE A;  3ALQ A;  5FMO L;  1ZRC A;  3TN9 1;  1YQ6 A;  3DYO A;  3WW2 A;  3K75 B;  4R9D A;  3O7O A;  3RYK A;  3VBF C;  5HV4 A;  1MQT B;  3WDW A;  5GZC A;  2D93 A;  4GXL A;  5CYY A;  2XBO 1;  1UU4 A;  4MVT A;  2X29 A;  4N9H A;  3BTY A;  1Q8P A;  2LW8 A;  3R6S A;  3VD3 A;  3JD7 2;  2V09 A;  3B9I A;  5F3E A;  5FR3 A;  5FP8 A;  4LQR A;  1D4M 1;  2BW8 A;  5FYC A;  1LU1 A;  1YJK A;  1POV 1;  1CN1 A;  2Y34 A;  2X53 S;  1VMH A;  3BIW E;  4IL7 A;  5CFC A;  3WNK A;  1IQD C;  3AP6 A;  4I2O A;  1COV 2;  4NID A;  1LUL A;  2R49 A;  3IN9 A;  1ZA7 A;  4XFF A;  4YG3 A;  4A44 A;  1HDK A;  2R6Q A;  4LOS A;  2P6C A;  1R1A 3;  2F6B A;  4B7K A;  5EZW A;  4EWA A;  3AJY A;  2ARB A;  3BPS A;  3AZZ A;  2HJI A;  3I2G A;  4GMP 1;  5JWP A;  4DUX A;  5C8C B;  1W8W A;  3NL1 A;  4OMC A;  2WQ8 A;  5B4N A;  2ZX0 A;  3UGG A;  1X50 A;  1F35 A;  4NR1 A;  4AFM A;  2Z79 A;  1PNF A;  3T2O A;  2HWC 3;  2JEM A;  1VIW B;  4BWO A;  4CCJ A;  1HRV 3;  2P3Y A;  4LBK A;  4HZF A;  2CGP A;  2WKK A;  3GZU C;  2ZBJ A;  4BDV B;  4LBJ A;  4BPZ A;  4DEQ A;  2VNG A;  4Q4V 1;  3ACG A;  5D1I A;  3VZK A;  1NCR A;  2ZKL A;  4ARY A;  4CDX A;  2K2S A;  1DZT A;  4EN8 B;  4JHZ A;  5FYS A;  3VBS A;  1HRI 2;  1TG7 A;  5EV7 A;  1HB1 A;  4E2S A;  1SPP A;  5IK7 A;  5H9Q A;  5GLV A;  2PHU A;  2VVD A;  3NO8 A;  3C7F A;  1ZZC A;  1WW4 A;  4M3C A;  5DMY A;  1OA3 A;  4YPJ A;  2EIC A;  4BCU A;  3T30 A;  4CUC A;  1A6C A;  2FDG A;  1YFU A;  1Q8V A;  1TMF 3;  4XDO A;  1XYN A;  1FMD 3;  2W95 A;  4ZZ8 A;  4CE8 A;  2QZ2 A;  2D5F A;  5DAX A;  1FV3 A;  1N1T A;  4JC1 A;  3K3N A;  3QLQ A;  4NPR A;  4RGA A;  2ARC A;  2VQ0 A;  3AYA A;  4AHY A;  5FMB A;  1T6B X;  1C1L A;  1F4H A;  2E6V A;  1SQ4 A;  1NX9 A;  3PU3 A;  4IEO A;  4FOW A;  4CPB D;  2Y33 A;  3AMN A;  5A32 A;  1IKP A;  2BQP A;  1PVC 1;  2ZAH A;  3LSE A;  1DGW X;  4OQ9 A;  3KHC A;  1GZW A;  3TN9 2;  2WO3 A;  4XCB A;  4JGY B;  2NQY A;  4YGC A;  4GAZ A;  1U5Z A;  1YXW A;  1PGL 1;  2A6V A;  2PAM A;  2WN3 A;  2Y6K A;  2XXZ A;  5C4W C;  1HX6 A;  4AFB A;  1NYW A;  2CHH A;  2XBO 2;  5D8A A;  5JIU A;  1MR5 A;  3MIG A;  4OUS A;  5FWE A;  4NHX A;  3RVH A;  5CU1 A;  1OOP C;  2WNE A;  4AFD A;  4MXW A;  4RS5 C;  4AK3 A;  5A70 A;  1UCX A;  3IPV B;  4YW1 A;  4CA9 A;  2W47 A;  5IVF A;  1VAM A;  3I7D A;  2J7M A;  3J7H A;  4D7T A;  1HQN A;  1UU5 A;  1XRU A;  2QUO A;  1EYB A;  4LUM A;  1RUI 1;  3RWN A;  1VBD 3;  2WAB A;  1K5M B;  2VL4 A;  3KGZ A;  3OYW A;  5DUV A;  3AYD A;  3ZKY A;  1N47 A;  1UW8 A;  3THT A;  5LAS A;  1C8M 3;  3S30 A;  4EN9 B;  5K0U A;  3VZL A;  5FZF A;  4I02 A;  1ZZ7 A;  3VDD A;  3S57 A;  2XKO A;  1W8F A;  2P3K A;  1UNB A;  1W99 A;  1GV9 A;  1D0H A;  1XYO A;  5K4L A;  2JDK A;  4JKL A;  5BYN A;  1VLN A;  4N7U A;  1DQ6 A;  3UL2 A;  3WP4 A;  4ZU7 A;  4EZ4 A;  3BYW A;  3NAP C;  3ACH A;  4ES9 A;  3ZN5 A;  4P14 A;  4ONU A;  4Y20 A;  5LWB A;  3WNX A;  3DXT A;  4RGG A;  3ST7 A;  1YHF A;  4MYE A;  2UYB A;  4FAG A;  3J9S A;  1VBB 1;  4G4F A;  2AEZ A;  5J09 A;  2GNM A;  3VD4 A;  1J3P A;  1VBC 1;  3H7Y A;  4GH4 A;  5EWS A;  3TB0 A;  2BVB A;  3TOJ A;  3WNO A;  1NKG A;  5CIR A;  3N7M A;  2AEN A;  3GBW A;  5FY1 A;  2WL1 A;  2B9V A;  1IG0 A;  2RJK A;  2BDR A;  3CHX A;  4YVS C;  2Y0O A;  3NJX A;  3KQ4 B;  4LKD A;  3KHB A;  4Y26 A;  1UMH A;  3T1M A;  3ON7 A;  3KQR A;  4GD4 A;  3C7G A;  4R52 A;  3PUH A;  5CFC B;  3ETP A;  1OPM A;  5FYZ A;  4MH0 E;  3LDK A;  1OLM A;  1UX7 A;  2GC0 A;  3PHM A;  2ORZ A;  3KD4 A;  4E8C A;  1DQ2 A;  1NCR C;  2YXS A;  3HJR A;  2FCT A;  4AW7 A;  4DXZ A;  3C7E A;  4WV8 A;  2A75 A;  2QQW A;  2UWA A;  4OLL A;  2O8O A;  2J1U A;  2ZX3 A;  2HLE A;  1QDC A;  4L97 A;  4AI0 A;  4K6B A;  3VKF C;  2YV8 A;  4XBQ A;  5A6Z A;  1H2M A;  5B2G B;  1G9B A;  5CKN A;  3WHU A;  4H3W A;  3WNM A;  2PXJ A;  3VHO A;  2B8M A;  4RQP A;  3T4V A;  1CAV A;  1W8H A;  5C3S A;  1WWY A;  4XIO A;  3BB6 A;  1NCR B;  2VTF A;  1OVP A;  4DS0 A;  2XWJ B;  4LJH A;  4CDX B;  4L8Q A;  1RHI 3;  4CDQ C;  4IV1 C;  5JPN B;  1SLB A;  1X9P A;  2QQN A;  1XC6 A;  4LBQ A;  1BVP 1;  3VBS B;  4TZD A;  4QX0 A;  2DDU A;  2ORX A;  3III A;  3JU9 A;  1SPP B;  4Z2A A;  5IWF A;  1W6M A;  4M3C B;  4Q2F A;  3VBR A;  2GSY A;  3FE5 A;  4PLN A;  5A6Y A;  5T55 A;  1UZZ A;  4M00 A;  4FVV A;  5JI9 A;  2FCV A;  1SLI A;  3DL3 A;  3D4K A;  5DDJ 1;  4B4R A;  2Q1Z B;  2NZ9 A;  3LFM A;  2NLR A;  4KBZ A;  1H2K A;  1Q56 A;  3AM2 A;  4IXL A;  3TAY A;  3ETQ A;  1H30 A;  2D43 A;  2R06 2;  1PX3 A;  1QNY A;  3OF1 A;  4ASK A;  2BFU L;  5A7W A;  1JU3 A;  3LPF A;  1R09 2;  2VMD A;  4JKM A;  5DPN A;  4NVP A;  3VBH A;  1QKQ A;  4FP3 A;  3POJ A;  1GZW B;  1ZBE 2;  4NHL A;  1XE0 A;  3IDA A;  4AAX A;  4K7J A;  4RHV 1;  2XVG A;  2C4X A;  4QPG C;  1OQ1 A;  1S4C A;  3POF A;  1QOT A;  2G1M A;  3C8X A;  3FZ3 A;  4RD7 A;  2ARE A;  2A73 B;  4YW3 A;  5D8A B;  4CYD A;  5KXD A;  1VRH 2;  4EYU A;  4Q4Y 1;  4M0H A;  5ISL A;  1S0J A;  1UY3 A;  4MXW B;  5IK5 A;  4CXY A;  3H7J A;  1WLT A;  3G7D A;  4TLG A;  2RHP A;  5FP9 A;  4JHT A;  1WW6 A;  1OUR A;  5FO7 B;  2ZMK A;  4A42 A;  2OS2 A;  3ACL A;  5IYY A;  4AEJ A;  5F6L B;  2QQP A;  3QH7 A;  1W28 A;  1RVF 3;  2EXI A;  4Q4X 1;  2VZT A;  5IVB A;  1AJO A;  3FC0 A;  3I3M A;  2YC4 A;  4BJ0 A;  4UFI A;  2YC2 A;  2K9Z A;  4HVQ A;  3PNA A;  3CQO A;  5HI0 A;  2GN7 A;  3K4A A;  1ZZ9 A;  5FLI A;  4KL1 A;  3H50 A;  2VUC A;  3PME A;  4FPL A;  2GNB A;  4XAA A;  5FZE A;  1ENQ A;  3OBR A;  2PLV 1;  3OYW B;  5C33 A;  2VMH A;  2XLF A;  2DCY A;  4AQ2 A;  2VC9 A;  5HXM A;  5K0U B;  1DG6 A;  5L7O A;  3V0B A;  3VDD B;  5AVP A;  3ZMN A;  2EXJ A;  4QDQ A;  3DEC A;  1HB3 A;  4GH4 C;  3MPP G;  1O8S A;  2P4E A;  5J36 A;  1APN A;  1YO8 A;  2BTV C;  3T08 A;  1PVX A;  3M8L A;  4H7M A;  4S2H A;  4Q26 A;  4HSJ A;  3BAL A;  1ULF A;  3VHN A;  3WF0 A;  1GWK A;  2A3X A;  1HKD A;  1ASJ 1;  2YGM A;  3O0W A;  4Y20 B;  3I49 A;  4N90 A;  2XJP A;  5CFD A;  2JKB A;  2QCS B;  2OPK A;  3OUI A;  5LBF A;  3IMM A;  2WBK A;  2ZX2 A;  1QJX 1;  2C9A A;  1RB8 G;  2W1S A;  2XG3 A;  3OGV A;  4GH4 B;  1ND3 C;  3HT1 A;  4ZZ5 A;  3RI8 A;  4ASL A;  2W92 A;  4MSV A;  1EAH 1;  3NNG A;  3T0D A;  2XQX A;  4HKL A;  5F1R A;  2RDS A;  5FMC A;  1K42 A;  3POE A;  4XZU G;  1UKG A;  2DF7 A;  2VGD A;  5F5A A;  1E5R A;  5EQU A;  1LHV A;  5FPU A;  4YZ5 A;  1I9R A;  4K1Y A;  4MV2 A;  3AVS A;  2MPF A;  1MVQ A;  4P9W A;  4JRL A;  4QB1 A;  1DQ4 A;  2G4I A;  4LOR A;  4QX5 A;  3J8F 2;  1XJA A;  1W2N A;  3GCW A;  1X33 A;  4TYS A;  1GUI A;  4C1W A;  5JAX A;  1LNS A;  3UNP A;  5C70 A;  4I0B A;  3K3O A;  2J1E A;  4M3C E;  1OUS A;  2JG9 C;  3O1U A;  5FZG A;  2DCJ A;  4FQZ A;  1VBE 2;  2QVS B;  3VDB A;  2GC3 A;  1ZRF A;  1BKZ A;  1JI6 A;  4LMF A;  4Q4Y 2;  3TN9 3;  3ZN4 A;  4L11 A;  2Q8C A;  1AR6 1;  1DFQ A;  4KH9 A;  1QXP A;  2DWR A;  1RL3 A;  2XON A;  2Y0I A;  5L73 A;  2FDF A;  3K4D A;  2VZR A;  1A3K A;  4ASM B;  4LLF A;  3AFG A;  4RGK A;  4LHS A;  5FOJ B;  2XBO 3;  4XF1 A;  4RQP B;  3B93 A;  1CAV B;  3I3E A;  2YFZ A;  3I59 A;  4ORF A;  4XYX A;  4Q4W 1;  4YZ3 A;  4KWL A;  1D4M 3;  5FY0 A;  2JIC A;  2PQQ A;  4LBQ B;  1POV 3;  1N3Q A;  4YNI A;  1PIV 2;  3D82 A;  5T5O A;  5I0S A;  2D6P A;  1VR3 A;  1W6M B;  3VBR B;  2ZAA A;  1CD3 G;  5FYB A;  1OF3 A;  3VL8 A;  3ZSM A;  5JOX A;  1KIT A;  2YY1 A;  4QXH A;  3ZFG A;  1X8E A;  4KG8 A;  3LDR A;  3H3L A;  1FOD 1;  4FT8 A;  2FD8 A;  1LOF C;  1D2S A;  2OW4 A;  1VPH A;  2HKX A;  4MGY E;  5I0U A;  2VXJ A;  4PIX A;  4XUP A;  4GMP 3;  1XNT A;  3TEY A;  2ZHK A;  3UKT A;  2VBP A;  5A7W B;  3VHP A;  3FN9 A;  2ZEY A;  3RYR A;  5EYX A;  5FPL A;  3TRS B;  3VBH B;  3Q8A A;  4FCA A;  4XUO A;  4QXB A;  2ES3 A;  2WR9 A;  4CSW A;  4NHM A;  5FPB A;  2DTY A;  1IS6 A;  4Q4V 3;  1AHS A;  3CF6 E;  1OUX A;  5CG8 A;  1EAH 2;  2DUO A;  3S7I A;  1WA6 X;  1H9P A;  5CEH A;  4FFI A;  2DFB A;  2B39 A;  2VPV A;  2W87 A;  4I01 A;  4RFR B;  5FZ8 A;  2DFC A;  2GAU A;  5A3P A;  3KF3 A;  5FXW A;  2VQU A;  3PDQ A;  4XF9 A;  4ERO A;  3MF9 A;  3KCC A;  1GQG A;  1N1S A;  5AC9 1;  1PMJ X;  2XWB B;  5JSR A;  3E6D A;  4OI0 A;  4IV3 C;  1OVS A;  2KM2 A;  2C26 A;  2GP5 A;  3DKW A;  1V9U 1;  3WV6 A;  1W0O A;  2Y6J A;  4TSV A;  5C3P A;  5C7G A;  2CL2 A;  2VBB A;  3HNM A;  1LB2 A;  1Z78 A;  4QHO A;  1ZRD A;  4FPO B;  3HN1 A;  1B35 C;  1S55 A;  1PVC 3;  1TE1 B;  4S2G A;  5I93 A;  5L7O B;  1KJR A;  3V0B B;  2EF6 A;  3E1F 1;  3UKN A;  3AX4 A;  3VB9 A;  5A3M A;  2XL9 A;  3ILF A;  5BNO A;  2CAV A;  4BB3 A;  3VZO A;  2Y6H A;  3N9M A;  3FHQ A;  4LHL A;  2WWU A;  3AKQ A;  3R4U A;  4FTE A;  1J1L A;  1OHF A;  1OD3 A;  1CPN A;  2ZOE B;  3IIA A;  4H7L A;  4OUE A;  3FMG A;  1R08 1;  3DV8 A;  4SLI A;  1RJ8 A;  5CFD B;  1OLM E;  1XND A;  1WGP A;  2FMD A;  3VD7 A;  5JZG C;  1NOV A;  3Q8C A;  3ASI A;  2E53 A;  1OH4 A;  4CCO A;  3UJO A;  1JYV A;  5GZE A;  2VY0 A;  5EYY A;  2BWA A;  2R30 A;  1RUI 3;  4COV A;  4CEW C;  1FOD 2;  3AKS A;  1BYH A;  1C5I A;  2JG8 A;  3AKT A;  4IET A;  1LHN A;  1LGC A;  3SH3 A;  4EV0 A;  2QBX A;  5JXI A;  1ZZ8 A;  1JZ5 A;  1QQP 1;  4XQD A;  1R1A 2;  4NHK A;  2X05 A;  1MS8 A;  2OZ6 A;  4CP9 A;  3IB3 A;  3NST A;  1Y9G A;  4K21 A;  4H14 A;  2VOK A;  4R9C A;  3KVB A;  5APA A;  1F4A A;  3FUO A;  5A1F A;  1T6G C;  1ALY A;  2XJQ A;  4RFT 0;  1UOJ A;  2JE7 A;  4J25 A;  3VDC A;  4X8P A;  4AED A;  5J48 A;  1GZ9 A;  3RZH A;  5FYI A;  2RV9 A;  1FI2 A;  3GAL A;  3U0Z A;  2HWC 2;  2QDR A;  1K12 A;  4DRR A;  4QMA A;  1HRV 2;  4LR4 A;  1VBB 3;  2HYX A;  2KD7 A;  3C7H A;  1VBC 3;  3TEW A;  3AFK A;  2FQP A;  3ES4 A;  1C1F A;  5FRA A;  3O12 A;  1UPI A;  4AI9 A;  5GZG A;  2B46 X;  4YM1 A;  5B4X A;  1STM A;  4JTN A;  1BK0 A;  2B45 X;  3I59 B;  1G7Y A;  3J7L A;  4UW6 A;  5BY5 A;  2Q4S A;  5L9V A;  1HLC A;  1XNA A;  1BK1 A;  4FPH A;  1DGW A;  1KGY A;  3WG3 A;  4WVV A;  1ULE A;  2JX9 A;  2WO1 A;  5DZF A;  1TMF 2;  4XZP A;  4LEJ A;  3HOB A;  2ZS6 B;  1JTZ X;  3AVR A;  1H6X A;  4R4X A;  2WAO A;  3DPR A;  2ZGS A;  3ZFG B;  2NYY A;  2XML A;  1GYK A;  5LBC A;  3POB A;  5IT6 A;  2DVB A;  1QJU 1;  1V6M A;  4A6O A;  2F4L A;  2J22 A;  5J37 A;  3P5B A;  4XFB A;  4I3G A;  4F3J A;  1CES A;  5FDB A;  1AR9 1;  3I8T A;  2VD7 A;  3BTZ A;  1WW7 A;  5FOB B;  2A5Z A;  1TQ5 A;  4C91 A;  1TZO A;  3NV1 A;  1W04 A;  5KWR A;  4WVM A;  4HOO A;  3AZV A;  4MGQ A;  3VBU A;  2O0O A;  1FPN 1;  4N53 C;  4CRQ A;  1AR7 1;  2R32 A;  3IAP A;  4OFG A;  4CXW A;  2DU0 A;  2OUH A;  3KT4 A;  3ZKU A;  1VMJ A;  2TNF A;  4OZX A;  1UMI A;  1MS3 A;  2JIG A;  2E7Q A;  4XFC A;  1PZ7 A;  1PK6 C;  3SXW A;  4QKF A;  4XXP A;  1CAU A;  1H8V A;  4XET A;  2FDI A;  2WUH A;  5FCC A;  5HCB A;  4B7E A;  2WLP A;  1VBD 2;  2BNN A;  4ATE A;  2GH2 A;  5DDJ 3;  4MGI E;  3WOG A;  2WNU A;  2JJ6 A;  2ZJC A;  3GYD A;  1C8M 2;  1UQX A;  1BBT 1;  2WRA A;  3F2Z A;  4KU7 A;  2VUD A;  2Y6F A;  5C8W A;  4NWW A;  3I2J A;  4DIN B;  1NY7 2;  2E63 A;  3NW4 A;  1OPO A;  4FPC A;  1V6O A;  2YMZ A;  2XGX A;  3ZFE A;  1SEF A;  4RHV 3;  5BNO B;  2MEV 3;  3UV9 A;  4CUA A;  1CWP A;  3LA3 A;  4NWV A;  4TWT A;  4V2W A;  3NV4 A;  1ZBA 1;  4R4Z A;  4COU A;  4QPI A;  2W94 A;  3ZXK A;  1GMM A;  1AF9 A;  4Q0P A;  3B3Q E;  1JZ8 A;  3LE0 A;  4Y3O A;  5T52 A;  2ATF A;  3WDY A;  4NIG A;  1M06 G;  2A3W A;  3KSC A;  4Q4X 3;  1DU3 D;  2ET7 A;  3NKG A;  1LOA A;  5FJH A;  3V64 A;  2R04 1;  5JPM B;  3I2O A;  3JB4 C;  3THC A;  1SBF A;  4AED C;  2FZ2 A;  2JG8 B;  1QJU 2;  2E51 A;  1WCS A;  2PLV 3;  4XCA A;  5JLV A;  2FDK A;  1VBA 1;  3M1H A;  4K1Z A;  2P17 A;  5IAT A;  5FMD A;  2RJL A;  1ZNP A;  4OQ8 A;  4JQR A;  3LSD A;  4Q29 A;  2V4A A;  3EHK A;  4AE2 A;  5EJ3 A;  1RUF 1;  4A6S A;  4FSJ A;  4UT5 A;  4CP9 B;  1OKQ A;  4BYY A;  1CIY A;  2F17 A;  2AH2 A;  5A6X A;  1NA1 C;  4XC9 A;  4AHX A;  2BYV E;  2XHK A;  1FPN 2;  3K48 A;  4XIK A;  2PHL A;  1GWM A;  2GN3 A;  1PGS A;  5BV6 A;  4AED B;  1MVE A;  1KJL A;  1ASJ 3;  1NXM A;  1GIC A;  3WCS A;  1UD1 A;  1J84 A;  1CAW A;  5ACA 3;  2D98 A;  2BJS A;  4E4S A;  1QJX 3;  1RUH 3;  1CR7 A;  2WLQ A;  4NII A;  1VP6 A;  4AGG A;  5FZA A;  3VGI A;  3DCQ A;  1C3H A;  1LOG A;  1EAH 3;  3Q8B A;  1RHI 2;  1XOY A;  1IPJ A;  2RVA A;  1HQL A;  1BHG A;  2L9L A;  5FAX A;  5LB6 A;  3GZE A;  1PMI A;  4LIU A;  1OBN A;  3U75 A;  3N9L A;  3O0V A;  5JOZ A;  1ND2 C;  2XLA A;  4KG0 A;  5DQ0 A;  3J4U H;  4FPE A;  4UF0 A;  5C9A A;  1BXH A;  2FBE A;  3DPR B;  3VBU C;  3K51 A;  1EP0 A;  2PHW A;  1JOB A;  1HXS 1;  4L99 A;  3AKR A;  2VNO A;  1JZ2 A;  4FP2 A;  4LUL A;  3SMH A;  2VCM A;  3BVC A;  3GJB A;  4AAP A;  4EN7 B;  3ZM8 A;  4N43 A;  5F39 A;  4GJY A;  2TUN A;  5FQ0 A;  2Y64 A;  1GR3 A;  5JUV A;  1ZBA 2;  3BU0 A;  3NRU A;  4AL9 A;  2RS1 1;  5DAQ A;  1AR6 3;  4CUG A;  3GDB A;  2QTW B;  4Q0V A;  3WX5 A;  1PHM A;  5GZF A;  2PHR A;  4WVM B;  1MPX A;  4QM9 A;  3VBU B;  4D8M A;  1LHW A;  3SCF A;  5F5I A;  3LQC A;  3D8C A;  3EYP A;  1MEC 1;  1TNR A;  1DYP A;  1S0C A;  3FJS A;  2WT2 A;  1W3X A;  4Q4W 3;  2WNU C;  2FHR A;  2IXK A;  2DUR A;  2R07 1;  2IXL A;  2WZR 1;  3AK0 A;  4LTA A;  5FO9 B;  2ZA9 A;  4GQ7 A;  1XSQ A;  3PVO A;  1RVF 2;  3O0X A;  5E88 A;  1CAU B;  2BWC A;  2WT0 A;  3CBN A;  3D6E A;  1UU6 A;  3DKQ A;  5C5T A;  5C8C C;  3WG2 A;  3USS A;  1AXK A;  2JDH A;  5BNQ A;  3AJZ A;  5DUX A;  1FOD 3;  5GJ6 A;  1XQN A;  3ZYI B;  1J1T A;  1O4Z A;  1WZX A;  4J1W A;  1JYN A;  3WVJ A;  1O91 A;  1XNK A;  2WNU B;  4YW6 A;  1M4W A;  3AZY A;  4QPI C;  5BUV A;  2JD9 A;  1W6P A;  4KGG A;  1WCQ A;  4HSL A;  2OKX A;  2VAU A;  2P5B A;  1RUE 1;  1O6U A;  3M3O A;  2RM2 1;  3HIF A;  3KT1 A;  1RXG A;  3ZFE B;  2VTX J;  4YZ4 A;  4YW4 A;  4U36 A;  4A7Y A;  3C2U A;  5A33 A;  3GZA A;  3LA2 A;  5BNN A;  4YM2 A;  3I97 A;  3N3H A;  1G9A A;  1X7N A;  3NV2 A;  4LKS A;  2CYF A;  5A7N A;  4QPI B;  3OBZ A;  1BMV 1;  3N9P A;  1XB9 A;  4AG4 A;  1QOS A;  3ZLI A;  2C6S A;  3I54 A;  4QX2 A;  3WZ1 A;  1S2K A;  2RJ2 A;  2UWB A;  3INA A;  4MAD A;  4WM8 A;  3WW4 A;  2V4V A;  4MET A;  3TEZ A;  5LAT A;  2XHN A;  3S5Q A;  5AC9 3;  3H8O A;  4UW3 A;  1VAK A;  4BU2 A;  2XDV A;  2QJV A;  4K8R B;  4CCN A;  1WMD A;  2NP0 A;  4I3P A;  5T5J A;  3GNE A;  5FP3 A;  2I74 A;  1G9D A;  1V9U 3;  1XSR A;  5KXB A;  3WNN A;  4JGY C;  3ACI A;  4BH9 A;  3FFQ A;  1RIN A;  3MIH A;  4UOJ A;  2CDP A;  4JV4 A;  3MUZ 1;  3OUJ A;  1VB2 A;  1W6O A;  2J42 A;  1YIP A;  1HIX A;  1FV2 A;  4K8F A;  3EJK A;  2OVU A;  3NMB A;  5JMO A;  4I0A A;  4KMQ A;  3AMH A;  4AVT A;  4LUK A;  4NIH A;  1CZV A;  2NMO A;  1URX A;  3VL9 A;  1L7Q A;  3LOB A;  2BNM A;  5LW9 A;  1R08 3;  5E1R A;  1JUI A;  2ERF A;  2WZR 2;  5KC6 A;  1RUO A;  1LOD A;  1DYO A;  3H1W A;  1CAW B;  3SNM A;  3GBF A;  2BP6 A;  4GWI A;  3OEB A;  3ELN A;  3NJZ A;  4GAL A;  3ZYP A;  2LAL A;  5C9A C;  1JYC A;  1K5M C;  1LHU A;  1JBC A;  4D6S A;  1NE4 A;  4Z1V A;  2VOW A;  4WM7 A;  1MZF A;  3MBW A;  1D4M 2;  2IXJ A;  4KU8 A;  5L19 A;  1LAJ A;  1GSL A;  1B09 A;  4IER A;  4XMA A;  5FIX A;  4Z8B A;  4HK8 A;  3D5O A;  1MS1 A;  3JBG 1;  1U12 A;  2FDJ A;  1I3H A;  4OZO A;  2E32 A;  2W1U A;  4ZU5 A;  1E5S A;  4HVO A;  1U0A A;  2WJS A;  5EHD A;  1DGL A;  1QQP 3;  4DUW A;  2J1A A;  5E8A A;  5C9A B;  4UF0 B;  1XU2 A;  2JDM A;  5TSW A;  1CZS A;  4F8A A;  1X82 A;  2PYT A;  1QIQ A;  2ZX4 A;  4NRQ A;  4YLZ A;  1FNY A;  5FYU A;  4N43 B;  1JZ6 A;  2IFR A;  5FQ0 B;  2RR1 1;  3S6P A;  4JAA A;  1H0B A;  2BGO A;  3RSJ A;  5JXH A;  1ULD A;  4MGS A;  3OB8 A;  5J1X A;  4BIS A;  2ZGN A;  4ARX A;  4QGM A;  4PDW A;  4F7Z A;  4Q4V 2;  5FJK A;  4C90 A;  3I3Q A;  1IPS A;  2WWS A;  2VW1 A;  1PM7 A;  4Y1Y A;  1O8P A;  1J3R A;  1GOF A;  1W2T A;  2WAA A;  4AHZ A;  3HQR A;  5CFC C;  1AL2 1;  4XF3 A;  4HK9 A;  5DUU A;  5LA9 A;  4JGZ A;  4OVE A;  4LO6 B;  2CWM A;  2DUP A;  5FY8 A;  3V56 A;  1XXN A;  5FPX A;  3H0O A;  5FV3 A;  1MS9 A;  4L2N A;  4LT5 A;  3HQU A;  2DBI A;  3J7N A;  1JZ3 A;  4L92 A;  4WVW A;  3POG A;  1W9Y A;  2HWF 1;  1PO2 1;  2Z2S B;  4RR3 A;  1W0P A;  1S2E A;  2FMY A;  4XFI A;  4XIL A;  4Y33 A;  5GLT A;  1O4T A;  1QJU 3;  1W8T A;  2W9X A;  1LRH A;  2IXI A;  5CKQ A;  5F8P A;  3MGU A;  4DQA A;  2GMM A;  1PVC 2;  1AR9 3;  4JDN A;  5FFO C;  1DZQ A;  1VE0 A;  3OGG A;  4NOT A;  5E6H A;  5H9S A;  1PGL 2;  1W6P B;  1YFY A;  3I2D A;  4LBO A;  3E5U A;  3VV1 A;  3T3Y A;  4XFH A;  4BIF A;  3MLL A;  4CDX C;  3N7J A;  4B3N A;  3OUH A;  1FPN 3;  1O3Q A;  4LK7 A;  3VBS C;  1AR7 3;  1MS0 A;  1ST8 A;  1UY1 A;  4DY3 A;  4MZU A;  5K7P A;  1JYW A;  3DUI A;  1R1Z A;  1DBN A;  4CP2 A;  5A33 B;  4AQT A;  4PQ9 A;  4AWD A;  1AYM 1;  2GMP A;  5BNN B;  5J3U A;  1F9K A;  1RUG 3;  2A6Z A;  5EIY B;  4BQX A;  1W9W A;  2GAL A;  2PMW B;  1HV1 A;  1QJY 1;  1REF A;  1YI9 A;  3L2H A;  1FNZ A;  2RMU 1;  3HN3 A;  4R9A A;  1QDO A;  1S2B A;  1ULP A;  3AZW A;  5CKM A;  1SFN A;  4WM8 B;  4XTM A;  3QOP A;  4P9L A;  2AGS A;  3ILR A;  1UOF A;  1RUI 2;  3WUD A;  4D7S A;  1E57 A;  1IZ3 A;  3RI9 A;  5FY5 A;  3LAG A;  2BEO A;  3POS A;  1XU1 A;  5EPA A;  5I8S A;  4F83 A;  5D21 A;  4DB5 A;  2FDH A;  1BBT 3;  1EV1 1;  2A71 A;  4DY5 A;  4BMB A;  1S1A A;  1D0G A;  1MS5 A;  3ZMO A;  4AGV A;  1N1Y A;  5H9P A;  2OYZ A;  5K8S A;  2OT7 A;  5IVJ A;  4HG6 B;  4QQP A;  4AQS A;  1W6O B;  4UFH A;  1MZE A;  3MFC A;  3T09 A;  3PMS A;  4ITC A;  5D8A C;  3MIC A;  3MW4 A;  4IE6 A;  4QPW A;  5FZH A;  4QDR A;  3WXP A;  1S0F A;  4WM7 C;  1O5L A;  5FZB A;  1OQD A;  5A32 B;  1EPZ A;  2W3J A;  3P6B A;  4FTB A;  4PQQ A;  1ZBA 3;  1NXD 1;  1VBB 2;  4NO4 A;  4EE2 A;  2E7A A;  3BPZ A;  3I3D A;  4XUR A;  1VBC 2;  2MEV 1;  2QQO A;  3LD8 A;  1YWK A;  1N1V A;  2GND A;  2WWJ A;  5JOW A;  4QKD A;  1Q8Q A;  3BTX A;  2VOX A;  4AEM A;  4YW5 A;  5FZM A;  4QM8 A;  5DG2 A;  1AL0 G;  4EN6 B;  3PTY A;  4WM7 B;  5FUI A;  2R04 3;  1UAI A;  3T0A A;  5BNP A;  2WDB A;  2OUJ A;  3GF6 A;  2WYS A;  3MLJ A;  2ZHL A;  5K0U C;  5GLW A;  1W05 A;  3VDD C;  4JDO A;  3ZYB A;  4XHX A;  5C6C A;  1W8O A;  5CBL A;  5FXZ A;  1VBA 3;  4PF1 A;  4UYB A;  3Q8F A;  5JDB A;  3TBD A;  5KC5 A;  1TME 1;  2HEV F;  1RUF 3;  1VB4 A;  1DCS A;  3PIG A;  3VLB B;  4BQ1 A;  2GU9 A;  3WQ0 A;  1QJF A;  2YYO A;  2VW2 A;  4LK6 A;  5JSO A;  2ZMN A;  1L3J A;  3AXD A;  3I2I A;  4Q5O A;  4BXS V;  3HQX A;  5JR7 B;  1FAY A;  3WSO A;  4BM8 A;  3U37 A;  2YPJ A;  5IAX A;  2A7A A;  4W8J A;  2W08 A;  4GA9 A;  1JN2 P;  4MOA A;  5F5C A;  4PDW B;  4OI1 A;  3ES1 A;  3B69 A;  1RUC 1;  1LEN A;  1H1M A;  4IDZ A;  5A3U A;  1V00 A;  2A3Y A;  4RR3 C;  2ZX1 A;  3H8X A;  2RS5 3;  2YGL A;  5FRE A;  3WNP A;  4XMI A;  4QGN A;  4GWN A;  5FY7 A;  2KA3 A;  4I09 A;  5ACA 1;  5IFP A;  4A45 A;  1RUH 1;  1Y4W A;  2DVF A;  1NZC A;  2WQZ C;  3IDC B;  4JGZ B;  1Q8S A;  4RL7 A;  3ZXE A;  3RJ2 X;  3IBM A;  2A6Y A;  1UYX A;  2GC2 A;  2VO5 A;  4WZC A;  4DRV A;  2QQI A;  5DDJ 2;  5IUQ A;  1Z7S 1;  4UXA A;  4NIA A;  4FPF A;  1IG3 A;  5HXV A;  4RR3 B;  2R0H A;  5D2A A;  1Y9M A;  1CQ9 A;  1HXS 3;  1XE8 A;  3O14 A;  2JD4 A;  1YCI A;  5LA1 A;  5JCT A;  1Y3T A;  2BVV A;  2XB6 C;  4KI5 M;  2Q5T A;  4ZS2 A;  2C0Z A;  2LM3 A;  3H1M A;  4GIQ A;  5FLH A;  5FYY A;  4CXX A;  4QQ2 A;  2D6K A;  2RS1 3;  1Y9Q A;  2JEC A;  2UWC A;  1GOG A;  4IUG A;  2MEV 2;  2NM1 A;  4RHV 2;  4RQP C;  4YVW A;  3U10 A;  2W52 A;  1JS9 A;  4NPM A;  4QX3 A;  2JXA A;  3K4Z A;  2A1X A;  4HKO A;  3MDP A;  3W59 A;  2WNV A;  4KWJ A;  1MEC 3;  4QPY A;  3S5A A;  3MIE A;  5LK5 A;  1DLC A;  3A0N A;  3RZJ A;  4WZF A;  1L7R A;  2R07 3;  2WZR 3;  3T0B A;  3VBR C;  1WUV A;  3B9C A;  2YFU A;  5SV8 A;  1AXY A;  2CAU A;  3KT7 A;  3VN4 A;  3TNP B;  4Q4X 2;  1YJL A;  1U5X A;  5FZ1 A;  4ZU4 A;  3SCG A;  2RS3 1;  4E9K A;  2ZGP A;  4YG0 A;  2YU1 A;  2D6O X;  3D3A A;  4LA2 A;  4XXA A;  4DPN A;  1C5H A;  2CGO A;  4EZH A;  2PLV 2;  2ADE A;  2NMN A;  4LE3 A;  3ZYR A;  4YAR A;  5A1L A;  2EAL A;  3VBH C;  4JRA A;  4JTO A;  5HCA A;  4JX0 A;  2J1R A;  3MV1 1;  1UZ0 A;  4UAP A;  4CCM A;  2JDY A;  2VTX A;  4UFK A;  1AJK A;  4FPY A;  1AX0 A;  5KHH A;  3SEP A;  4AI8 A;  5KXC A;  4FAH A;  3U1X A;  4URA A;  1RUE 3;  2RM2 3;  3VKM A;  4L0P A;  1SCS A;  1QJZ A;  1UYY A;  2CTV A;  4M3C F;  4MLO A;  4AVC A;  5A3L A;  3WY6 A;  1IS4 A;  4PCR A;  3UKV A;  1ASJ 2;  2G9G A;  5BNP C;  5IVC A;  2K46 A;  4BK5 A;  5ACA 2;  1AR8 3;  2OZJ A;  4DXR A;  1QJX 2;  3DF0 A;  1RUH 2;  3K77 A;  4JDM A;  4AFA A;  3HBZ A;  5FZ3 A;  3W20 A;  3WEZ A;  1JOD A;  2P1B A;  3ZOI A;  1NLR A;  3MLK A;  1SDD B;  1EPW A;  1VAV A;  5BNP B;  2ZCW A;  3WDX A;  2E31 A;  3LDB A;  1OQE A;  2EIB A;  3WG4 A;  3ZN6 A;  5L7O C;  5CA6 A;  3X29 B;  3U07 A;  2E33 A;  1UY4 A;  4PBP A;  1IS5 A;  1RTV A;  1HN1 A;  4XEZ A;  4K40 A;  4XJW A;  3UT0 A;  5I8Y A;  3LB9 A;  4NRP A;  4D0Q A;  2HWE 1;  3WD5 A;  3EXU A;  5F3G A;  3OGJ A;  4LIT A;  4BLI A;  2ET1 A;  4OYU A;  3U78 A;  1HN0 A;  1YRZ A;  1WCD J;  2W91 A;  1W6N A;  3RZZ A;  5CFD C;  1QMJ A;  1RUD 1;  3HT2 A;  3PL0 A;  1KRI A;  2CY6 A;  3JUU A;  3DXU A;  1W39 A;  1AR6 2;  4E4Z A;  3VBO A;  1DLL A;  4JZR A;  3H9A A;  1GZC A;  2PTM A;  2VQT A;  4HL0 A;  3U14 A;  1D4V B;  1QOO A;  3KV4 A;  2Z42 A;  3RPQ A;  1QNW A;  3CEW A;  2C24 A;  2ZGU A;  3FBY A;  4LBL A;  4PF5 A;  5FZC A;  4B1M A;  1YQC A;  4FPK A;  4Q4W 2;  2HH9 A;  4A7Z A;  1W8Z A;  3N9Q A;  4FFG A;  5LA2 A;  1ZYB A;  1REE A;  3JBG 3;  3OBT A;  4QU1 A;  1QXJ A;  1ZZB A;  1FT9 A;  4YGD A;  3WW3 A;  4LBN A;  2BER A;  2VVF A;  2EID A;  2X8K A;  4FFH A;  1UN1 A;  4D7Y A;  3CJI A;  4B4P A;  1H8T A;  2MHF A;  5FZ9 A;  1UZW A;  3NNJ A;  4J6G A;  2F4P A;  3AP7 A;  2WNV C;  3LOI A;  4XUT A;  2W68 A;  2ZGM A;  3LCP A;  4JQT A;  5FZ6 A;  1G6N A;  4S2D A;  3CJX A;  4CU6 A;  4P00 B;  1LED A;  2ZHN A;  4TXW A;  2RR1 3;  2YC0 A;  4CCD A;  2VG9 A;  4IEX A;  3FHA A;  4AGR A;  5FUN A;  1A8D A;  3UET A;  4YVW B;  5AFE A;  1GNY A;  1CX4 A;  2VMG A;  3T4H B;  4BQ4 A;  1O59 A;  2B5H A;  1KS5 A;  3DGT A;  1AXZ A;  3KGL A;  3E6B A;  4XBN A;  4BXF A;  2WNV B;  4JKK A;  4XAB A;  3AYE A;  5FZO A;  3ZXF A;  2WIN B;  4AXO A;  3CKH A;  1OFN A;  2QQK A;  5KHI A;  3FLP A;  4CUB A;  4O65 A;  5FZI A;  1AL2 3;  5LY2 A;  3MW2 A;  3WQ7 A;  2ZZJ A;  2WZP P;  3CL1 A;  5T54 A;  5JXG A;  3ZFG C;  2QQL A;  3WIN E;  1IS3 A;  4YW2 A;  3ZXL A;  3LF7 A;  5AC9 2;  2KXL A;  5HCF A;  1PO1 1;  2NPI A;  2OPW A;  3LEG A;  1BEV 1;  1WLC A;  1W9F A;  4UI9 L;  2RDQ A;  2HWF 3;  1PO2 3;  5JI7 A;  4IEZ A;  5JSP A;  1V9U 2;  1XNC A;  1SLL A;  3J26 N;  3WF4 A;  1AZD A;  3PVN A;  2PHF A;  2XH6 A;  4TN7 A;  2Q8O A;  3GXU A;  4P9Y A;  2ZEX A;  3UJQ A;  3WQB A;  2GH8 A;  1DIW A;  5A3W A;  1D2Q A;  1RUD 2;  1PGW 1;  1ZM1 A;  4DXS A;  2BRT A;  2H6C A;  3ZFF A;  4BQ3 A;  4HXC A;  1SLC A;  1NQD A;  2VW0 A;  1RC6 A;  3RGB A;  3L2Y A;  4FPJ A;  3J7M A;  4COZ A;  1J3Q A;  2VUJ A;  4PI0 A;  3C7O A;  3HNY M;  5FYM A;  5JVV A;  4C8D A;  2ILM A;  4QB6 A;  1WW5 A;  4TTG A;  1XNB A;  2W1Q A;  3MZH A;  3LA7 A;  4M0N A;  4UBG A;  4DOU A;  3UGH A;  5LBE A;  3LKJ A;  1R08 2;  3FX3 A;  1AYM 3;  3VUO A;  1YUD A;  5GLU A;  4CU9 A;  1O3S A;  2I07 B;  3HBK A;  3RDI A;  1CPM A;  1R64 A;  3FUQ A;  1QJY 3;  3BOP A;  2B4K A;  2RMU 3;  3HEI A;  2ZGT A;  3DYP A;  4XF0 A;  5DAW A;  1QF3 A;  2R1D A;  1K5J A;  3O1V A;  4P9I A;  2AR6 A;  1RUG 1;  2CGN A;  4O61 A;  1V6I A;  5FZ7 A;  1TVG A;  3WW1 A;  1QU0 A;  2VNR A;  2WFF 1;  4IEU A;  5FKC A;  4G9S B;  1PNG A;  4CDW A;  2RDN A;  3ZN6 B;  1ZRE A;  2ZXQ A;  2A6W A;  4LKE A;  1EV1 3;  3BU7 A;  3GJA A;  1QQP 2;  4LPL A;  1GWL A;  3POW A;  4UWD A;  5A7P A;  5BNO C;  1WCU A;  1NAE A;  1T2X A;  4LO4 B;  3EB7 A;  3JZV A;  1O4Y A;  4W65 A;  2Q1F A;  2XJV A;  4DO0 A;  2XR4 A;  3OBA A;  4YWA A;  2DVD A;  3VKO A;  1JZ7 A;  3OGR A;  5FK7 A;  1JOJ A;  4RYD A;  2P2K A;  4LE4 A;  4X6R B;  1W6N B;  1AYN 1;  1NCQ A;  4CEY A;  1W03 A;  4V1P A;  4Z07 A;  5LK7 B;  1YLL A;  5LY1 A;  4X8N A;  1X36 A;  3VBO B;  2I45 A;  4NPL A;  5I91 A;  1P8J A;  1S0G A;  2JE8 A;  1EUT A;  1ENS A;  5T50 A;  2IFW A;  3LIG A;  2WS9 1;  1Y7B A;  2QFE A;  2JG8 C;  2VZS A;  3O1O A;  3CJI C;  4LKF A;  4S2F A;  1W9T A;  3NVC A;  3TNQ A;  1KQR A;  1SCR A;  3VD5 A;  1W90 A;  2GZW A;  3VBF A;  2WSV A;  1EY2 A;  1WBL A;  2R0F A;  3NNF A;  1MAC A;  4C0B A;  1JHN A;  4NAM A;  1N3P A;  3PJQ A;  4D69 A;  3S7E A;  2O1Q A;  4O9E A;  3KLS A;  1TME 3;  2HWD 1;  4PBO A;  3H3U A;  3QCW A;  1H1I A;  4PJY A;  1JU4 A;  3HR9 A;  3CJI B;  5BPX A;  1H8T B;  2HWB 1;  4Y5T A;  5FP4 A;  2PA7 A;  4XQ4 A;  1BVV A;  2EXH A;  1AR9 2;  2K0G A;  1SAC A;  1SHW B;  3WUC A;  1RMU 1;  3WG1 A;  1YQ2 A;  4D94 A;  1RUJ 1;  2C5D A;  2ZPX A;  5F9T A;  2ZTN A;  4YW7 A;  3KZ4 C;  3MI8 A;  3SC7 X;  4AF9 A;  2JDZ A;  4QHZ A;  4PLM A;  1AR7 2;  3LFI A;  1POQ A;  4E27 A;  5KXE A;  1DF0 A;  1RUC 3;  2YHJ A;  3RWK X;  3BOW A;  4WVZ A;  1RGS A;  3PUS A;  2C1F A;  4DFS A;  4OHX A;  3JXS A;  1RUG 2;  3PUQ A;  1JXN A;  1NT0 A;  2VZ3 A;  2XJT A;  3JCI A;  4OHW A;  5FZO B;  2IXH A;  1K3I A;  1SZB A;  1SBD A;  3KV9 A;  3M3I A;  4BLJ A;  1S0D A;  5FMO S;  5C5U A;  5LZ6 A;  1UKR A;  2IVJ A;  2Z69 A;  4ET7 A;  3DPR C;  3JD7 1;  1IGO A;  2RS5 1;  2W0X A;  3CMG A;  2CV6 A;  3EBR A;  2BPA 2;  1OA4 A;  1Z7S 3;  1H4H A;  1LOC A;  2ZGO A;  1COV 1;  1US2 A;  3EQE A;  3GHM A;  4MO3 M;  2BZD A;  1BBT 2;  3A21 A;  4NJ4 A;  2JDN A;  4XAE A;  3ZXA C;  3OGS A;  2GP3 A;  3VDA A;  1WD4 A;  5A3O A;  3WLU A;  3AC0 A;  3ILN A;  5FYV A;  1DQ5 A;  3ZFF B;  1YQ8 A;  2W46 A;  4YM3 A;  3U4X A;  2Y6G A;  1V6K A;  4RA0 A;  4HBN A;  2J1V A;  2QZ3 A;  3OD4 A;  5I0D A;  2OX0 A;  2ZAC A;  2EA7 A;  4IGP A;  1F5F A;  1AX2 A;  2PHT A;  2YZ4 A;  2VOT A;  4MGK E;  3ROU A;  1MZ6 A;  2RE9 A;  1V6J A;  5KHG A;  2LRO A;  1Z0H A;  3RNS A;  4QQO A;  1NG0 A;  4C1X A;  3O1P A;  1W2O A;  4GKY A;  5C4W A;  2LUW A;  3OOX A;  3M4F A;  4HET A;  4X6Q B;  2RG4 A;  3PIJ A;  3R4D B;  1UPS A;  3BN6 A;  3WT3 A;  3ZXJ A;  4YZ2 A;  1W6Q A;  2RS3 3;  2TEP A;  3KM5 A;  1OOP A;  2R04 2;  3NWK A;  4XF4 A;  5GM0 A;  1OA2 A;  2UYA A;  4KNC A;  4RS5 A;  5F3C A;  2Y6L A;  3AMP A;  1SFY A;  2BBA A;  3KV5 A;  4AI2 A;  2AEY A;  1F8V A;  2D6N A;  1YFX A;  3AZX A;  1VBA 2;  1YI7 A;  2FZ1 A;  3M2M A;  1KD7 A;  4O7X A;  2D5H A;  5DZG A;  4CDW B;  1LEM A;  1UF2 C;  1G86 A;  1WLD A;  2LS6 A;  2X5I A;  3ME2 A;  4DXT A;  2SLI A;  1RMU 2;  2WII B;  2VH9 A;  3OPZ A;  2O14 A;  3WF3 A;  4XHB A;  3ZYF A;  2BBV A;  3PUR A;  2CSG A;  1HB4 A;  1RUF 2;  2HEY F;  2X09 A;  1BQP A;  3ZFE C;  4L9B A;  5I0R A;  3R05 A;  1IHM A;  3NQH A;  4ATF A;  4NE9 A;  5A3T A;  2BV4 A;  4Q27 A;  4W50 A;  3USU A;  3V0A A;  1YQ5 A;  2OQ7 A;  3ZYJ B;  1UYZ A;  4HT1 T;  4KGQ A;  5F2W A;  5DZE A;  2BUK A;  3Q8E A;  1KXG A;  4BE3 A;  3N36 A;  3KMH A;  2Q0A A;  3WP5 A;  3UK9 A;  3B5L B;  2DCK A;  2AAC A;  4H2A A;  3L9J T;  5EXO A;  4CVU A;  1NCQ B;  4CEY B;  5AVA A;  3PVB B;  2R1B A;  4K9S A;  1JZ4 A;  1S0B A;  1K45 A;  5IVY A;  4XDP A;  4QXK A;  1GZT A;  2VBD A;  3NAP A;  4AEK A;  5LRS A;  1DGR A;  2RS5 2;  1NUK A;  4IE7 A;  4FBF A;  1RIR A;  3ATG A;  3SHR A;  1AR8 1;  2BGP A;  3AXE A;  4FXK B;  2JB4 A;  5DN2 A;  3ZSL A;  4LHK A;  4D6Q A;  2WN2 A;  1ULG A;  3VBF B;  2G19 A;  3CZU A;  5FXV A;  3IKW A;  4MHR A;  2ZEZ A;  4HKW A;  3BUC A;  2Y26 A;  4IEQ A;  4YVS A;  2HWE 3;  4RN5 A;  3BKZ A;  2YBK A;  2ZKN A;  2EIE A;  1HXS 2;  3WCR A;  5LEJ A;  3RFR A;  1G8W A;  4Y5S A;  3ZSK A;  4NUB A;  1KDK A;  1CON A;  1J58 A;  1RUD 3;  5ANN A;  4COW A;  3WR0 A;  3IWZ A;  2VMC A;  1WCK A;  2E26 A;  2RS1 2;  4R9B A;  5JMC A;  4QQL A;  3NV3 A;  2ZEW A;  5KR7 A;  1UX6 A;  4ZY9 A;  4D3W A;  1OLR A;  2UU8 A;  3KVA A;  4XQW A;  3OPW A;  1MEC 2;  3I2H A;  1A78 A;  4QGL A;  3GM8 A;  5FZK A;  1W9S A;  4B4Q A;  2R07 2;  3IAQ A;  1ACC A;  2QE3 A;  4IGO A;  1QHD A; 
#chains in the Genus database with same CATH homology
 3KHB A;  4MG2 A;  4NJ4 A;  4IE5 A;  3O1T A;  4NRM A;  3I3Q A;  4ZS3 A;  3O1V A;  4NRP A;  4O61 A;  3O1P A;  4IDZ A;  3H8X A;  4IE0 A;  2FDG A;  3T4V A;  3O1R A;  3O1U A;  4NIG A;  3BIE A;  3RZG A;  4OCT A;  5F8P A;  4O7X A;  3I2O A;  4QKB A;  2FDF A;  3BI3 A;  2FDK A;  3T3Y A;  3RZH A;  3KHC A;  4NRO A;  4NPL A;  3LFM A;  3H8O A;  4ZS2 A;  3O1O A;  4CXX A;  5DAB A;  3RZM A;  3RZK A;  4NPM A;  2FD8 A;  2IUW A;  3S5A A;  3RZJ A;  4IE7 A;  4NII A;  3H8R A;  2FDH A;  4NIH A;  4IE4 A;  4CXY A;  3T4H B;  3O1M A;  4JHT A;  4MGT A;  3O1S A;  3S57 A;  4IE6 A;  3I3M A;  3BUC A;  3BTZ A;  3BKZ A;  3RZL A;  4RFR B;  3BTY A;  2FDJ A;  4CXW A;  4QKN A;  4QKD A;  3BTX A;  4ZHN A;  3BU0 A;  4NID A;  4QHO A;  4QKF A;  2FDI A;  3I49 A;  4NRQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...