3BU0A

Crystal structure of human abh2 cross-linked to dsdna with cofactors
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
203
structure length
203
Chain Sequence
SWRHIRAEGLDSSYTVLFGKAEADEIFQELEKEVEYFTGALARVQVFGKWHSVPRKQATYGDAGLTYTFSGLTLSPKPWIPVLERIRDHVSGVTGQTFNFVLINRYKDGSDHIGEHRDDCRELAPGSPIASVSFGASRDFVFRHKDSRGKSPSRRVAVVRLPLAHGSLLMMNHPTNTHWYHSLPVRKKVLAPRVNLTFRKILL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-ketoglutarate-dependent dioxygenase alkB homolog 2
publication title Crystal structures of DNA/RNA repair enzymes AlkB and ABH2 bound to dsDNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/dna
total genus 52
structure length 203
sequence length 203
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2007-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13532 2OG-FeII_Oxy_2 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 3bu0A00
3BIEA 3I2OA 4OCTA 4IE4A 4JHTA 3I49A 4RFRB 4NIIA 3RZKA 4QHOA 4QKFA 4QKDA 2FD8A 3O1VA 3O1OA 4CXWA 3KHBA 4NRPA 2FDGA 3I3MA 4NROA 4O7XA 3BTXA 3T4HB 4QKBA 3RZMA 3O1UA 4NIHA 4IE6A 4ZS3A 4NRQA 4IE0A 5DABA 3KHCA 3O1PA 3O1SA 3O1RA 3RZHA 4NRMA 5F8PA 2FDJA 3BUCA 3RZJA 3T3YA 3BI3A 4O61A 4IE7A 3S5AA 4CXYA 3T4VA 3O1MA 3RZLA 4QKNA 3H8RA 4NJ4A 2FDFA 3H8XA 4IDZA 4NIGA 3H8OA 4NPMA 4IE5A 4CXXA 3BTYA 2FDHA 3BKZA 4ZS2A 3RZGA 4ZHNA 4NPLA 3S57A 2FDIA 2IUWA 3BTZA 3I3QA 3O1TA 3LFMA 4MG2A 3BU0A 4MGTA 2FDKA 4NIDA
chains in the Genus database with same CATH superfamily
3HN3A 5C3OA 1G8WA 1YQ5A 3LPFA 4OHVA 1BCXA 1LGNA 1RUE2 2DUPA 4UF0B 5FZ0A 5JZGA 3TEXA 1RUH1 4FQZA 4NAMA 4FP2A 4Q4V1 1D2SA 3TEZA 4QM9A 5FK7A 3LDRA 5FV3A 3K4ZA 1GZWA 1J59A 3UKNA 5FY0A 4MV2A 4BZ4A 1QJY2 2V4VA 3AKSA 3VBSB 5JMOA 2O8QA 1HXS2 1WCKA 2LTNA 5ANNA 2JIJA 1HQNA 4RHV1 2JWPA 3KLSA 5JXHA 1ND2B 2C24A 2JG9B 3AK0A 4I3PA 3OJBA 4Q4V3 1AHSA 5HCFA 2XJRA 2OQ6A 3CKHA 4D94A 2ZKLA 3A21A 3MDPA 2R7EB 2QKDA 2VUAA 4LE4A 5I93A 5FLIA 2JDAA 3TEYA 3NNMA 4XJ9A 4ISRA 3ES4A 5L19A 3OBTA 1DGRA 1W6QA 1GUIA 4QXBA 4RHV3 4C90A 3VBSC 3WF1A 3VLBB 1RUNA 3WY6A 2B39A 1ZRRA 4XJ8A 2EIDA 3R0RA 4ET7A 2ZTNA 1RUI2 3O14A 1I6XA 2Z69A 5FYUA 3AP7A 3HD8B 4HT1T 1ND2C 2JG9C 5GM0A 3HBKA 3ZYBA 1OFNA 1PMIA 1XNCA 1I1EA 1ZRIA 3FMGA 4FFIA 5LY2A 3FBMA 4PIYA 4BMBA 1JZ3A 5K0UA 4G4FA 3E6DA 4G9SB 1YUDA 2CWSA 2A6XA 2BNMA 5JIUA 2Y8KA 4B1MA 4LT5A 3NJVA 4XUQA 3PTYA 4J25A 1LHOA 3ZDVA 5GJ6A 3AKPA 2GALA 1EAH1 1DGLA 4BE3A 1Y3TA 3BCWA 3WNPA 2NPIA 4YM3A 4CP9A 4EWAA 2RJKA 4RR3A 4YZ4A 2O14A 3ZKYA 3FUQA 2K0GA 5FR3A 1JZ4A 3W9AA 2ERFA 3NNJA 4UF0A 2XKPA 5BPXA 1RITA 1VPHA 3KZ4C 3KM5A 4IETA 1FAYA 4O61A 3RYPA 3GCWA 4MGSA 3RFRA 5EJZB 3SCFA 2GNTA 2J1EA 5I91A 1UZWA 4GJZA 1JMUB 1V0AA 5L9RA 2QQWA 2R042 1XC6A 2DVGA 1PNFA 2JDPA 2IXLA 4BLIA 4Z8BA 4COUA 1KD7A 2G9GA 4CTEA 2ZEYA 3POJA 2ZGMA 4RQPC 4NHYA 1DZRA 1ENXA 2OX0A 3MICA 4Q4Y2 5FZ4A 5A7WA 5BNOB 5C4WB 3KF5A 5LA1A 1X9TA 1QQP2 2AUYA 1BEV3 3JCIA 3PUQA 1VE0A 4MGZE 4RSUA 4UWDA 2BW8A 4W4ZA 3HNYM 5K4LA 3A0KA 4AE2A 3OYWB 5AVAA 3LOBA 3BYWA 1H2LA 2E9QA 2IXHA 2JB8A 3D5OA 1V6NA 3JBG1 3MW2A 4HK9A 4Q27A 4EN6B 3WNKA 1W2TA 4KGQA 4LHLA 4TTGA 2A1XA 4JQRA 3WSOA 1R1A3 2D6NA 4IGOA 2VXRA 1G9DA 4ASLA 2X53S 5C4WC 3BIEA 1GWLA 4N9HA 4QM8A 4P08A 4DFSA 4QQPA 4EN0A 1TZOA 1O59A 2XHNA 1H9PA 2ZMKA 3JBG3 5IVFA 5IVYA 3A7QA 3T2OA 4M00A 2BJSA 1Q8SA 1UU6A 2WFF2 3NMBA 4MX3A 3S7EA 3KHBA 4AZZA 1FX5A 3R4UA 3MIGA 1XYNA 4XJZA 3WNXA 3ALQA 5I0DA 3Q8AA 4E8CA 4IEQA 3U4SA 3I2DA 5APAA 5FY5A 1CIYA 4NPRA 1FXZA 2FMDA 1W03A 2PLV1 2RR11 4AI0A 3MHZA 4CDQA 1JOPA 3ATGA 4JRAA 4M0NA 2NQYA 4MZUA 2ZABA 4BQWA 3MUZ1 2LROA 3RMYA 4IESA 1JI6A 1Y9MA 1PMJX 2WFPA 3KCCA 4D69A 3DXTA 4DS0A 5HCAA 1VMFA 3P3NA 4NIHA 2P3YA 4XIOA 4IE6A 3V56A 3NNLA 3E5XA 3E5QA 2NMOA 3BOPA 2DCJA 5IK5A 2W52A 3MPPG 2PLV3 2RVAA 1RHI2 1I5PA 5C4WA 5BNOA 2WQ8A 3IN9A 4JTOA 1N1VA 3PLQA 3JB8A 3VHRA 5DZEA 5HBAA 5C8WA 1C57A 1XJAA 2WWSA 2WAOA 1RUC1 3AYDA 1AX0A 3CJXA 4XUTA 5FTTC 5LBFA 3UV9A 1OLMA 4FPCA 1ASJ1 4GJYA 1UW8A 3IB3A 1W8ZA 3I97A 2FDJA 2VR4A 3W20A 1W8WA 3J4UH 3CZUA 4WV8A 3KF3A 2D6MA 1A8MA 5C71A 1RUC3 3RZZA 2E63A 4XFHA 5IVCA 5F3EA 4RFT0 4MUVA 3W5MA 2DCTA 4QX8A 2GDFA 5FJKA 5IAXA 1LCLA 4CXYA 2JDUA 2G9FA 4RGGA 5FWJA 3QOPA 1SEFA 4IV3B 2I07B 2EVXA 4ARXA 1GZ9A 1OQ1A 4IEPA 3IDAA 4D6QA 5HXMA 2RS51 4KI5M 4GZ9A 3K75B 3RI9A 1LOGA 1YFUA 2WUHA 1BBT3 4AHXA 1S0BA 1LHNA 2HEWF 1Y43B 3DN7A 2YBPA 4IEUA 4KNCA 3VBFC 5K9YA 3MIFA 4AFCA 1K5JA 1FNYA 5G04L 4AGGA 3V0AB 3ZKUA 5ERLA 5C8CB 5KXCA 4ZS2A 1X33A 1WBLA 2E7QA 4XFBA 2XWJB 4MOAA 2BNNA 3GALA 4HVOA 4C91A 4M4PA 1DP0A 4DQAA 2AH2A 5ANQA 3JZVA 5CZKA 1AYM2 2E51A 2HBUA 3LFMA 4E2QA 1URXA 1P8JA 2VMCA 1JHJA 4ASKA 5A7QA 2JB4A 4Y4RA 1CAVA 4FVVA 2VPVA 2YB7A 4KBZA 4UFMA 2FDKA 2ES3A 2XJUA 3RYKA 2D6PA 1QF3A 2QQVA 2R1DA 4C0BA 2W87A 2XL7A 5KHKA 1GOGA 4LORA 1JXNA 5C8CC 1W3XA 5FUPA 4JHTA 4Y1XA 1RUH2 1UOJA 3K4AA 4OMDA 3IDEA 4Q4V2 4OI1A 5F2WA 3GF6A 4WM7A 3WDWA 3USUB 4N43B 1BVVA 1XNTA 3BODA 3VKOA 1QOTA 1LEMA 3MLKA 3L9JT 5FZLA 5IWFA 1OKOA 1W6PB 4BU2A 5C70A 3PL0A 2HWE3 4B29A 2W47A 5C9AB 2Q8CA 3RS6A 5L73A 5JR2A 2VMDA 4XF0A 1PVC2 1IHMA 2FDGA 1HLCA 1UPIA 2JDYA 3C7EA 3LF7A 3WVJA 3ZO0B 5CB7A 2EICA 2Y64A 3D82A 1HV1A 5DZGA 1AR82 2FBEA 2OPKA 5I0UA 3U0ZA 3T0BA 1U5YA 4IV3A 2VMFA 1YEWA 3FBYA 1D4VB 2JDNA 2JJ6A 5EV7A 1POV1 3ORJA 3AZVA 3AMMA 2D6OX 2Q4SA 3MFAA 5A3NA 1COV3 3AL6A 4N43C 2KD7A 1HN0A 3X29B 4FPJA 4TXWA 1RIRA 2EA7A 4BM8A 3M7AA 2WO3A 3V0AA 1JBCA 3H9AA 5FIXA 2OZJA 5C8CA 1O6UA 2VBPA 1M06G 2OW4A 2A70A 2OZ6A 2VULA 4A45A 4AF9A 2BWAA 3NJXA 2I74A 4CCNA 1KS5A 3MUY1 5D8AB 3BGAA 1A3KA 4FFFA 2A71A 3R05A 2AREA 1ENRA 3J26N 1KGYA 1NLRA 3NV4A 2GC2A 3DYOA 2Q0AA 3DKQA 3S7IA 2QCSB 3N7LA 3GGLA 2HEVF 1EAH2 2ET7A 4L11A 2W46A 4XFAA 5A33B 1MS1A 4CU7A 4NOTA 1RGSA 2HLEA 1W6MB 2PA7A 4JCKA 5GLWA 3V65A 3VD4A 2ZKNA 3GZUC 2V72A 5FFOC 1PGSA 3K48A 2ZCWA 3EO6A 2R0FA 5ABJB 3PVNA 4YARA 2A73B 2Q1FA 3ILFA 3B94A 5D8AC 4NHXA 5AC91 2DCKA 3IMMA 4Q26A 1POV0 4QGNA 1KFXL 1XBFA 3USUA 1Q3EA 2BBVA 3U78A 4NIAA 5FQ0A 1VBC1 2VVFA 4G3YC 3OG2A 1C8M2 4XCBA 1Z7S1 5FYTA 5FZ3A 1LTEA 2VUCA 2WA3A 4X8NA 4Y1YA 5FO7B 2WWUA 3AM2A 5C9AA 3N4MA 1SLTA 2P1BA 3WG4A 2GZWA 2RDRA 2X29A 1J1TA 5E6HA 4CXXA 5FZIA 1R083 1DYOA 2H6CA 4YZ2A 2FDHA 2ARXA 2DVFA 2VZUA 5FYHA 3APBA 1VBC3 1VBE2 5ABJC 1D4M1 4FPYA 3CEWA 3DPRB 4NPLA 2AENA 3THTA 3NAPB 2OVUA 1Z7S3 4XHXA 5KHJA 4SBVA 5A7PA 1YQ2A 2IUWA 1CONA 1E5SA 4IGPA 3OD4A 3WF0A 5F5CA 2CL2A 1MR5A 1O3QA 1W99A 4MG2A 1QJX3 2C26A 3MO4A 4QHBA 1W06A 3JBG2 1W28A 1GMMA 1MEC1 2RV9A 4BQXA 4V2WA 4WVMB 5FZ1A 2MPFA 4D7SA 1LU1A 3MF9A 2FMYA 4W50A 5F6KA 4A6SA 3T2TA 3IPVB 4FPGA 1OVSA 4MH0E 1IS5A 5FXWA 1YC61 2X10A 2R30A 4KGGA 4OHZA 3WV6A 4R9DA 4HETA 2UYAA 4CDUC 1TNFA 3WP4A 3RVHA 1REFA 3NVCA 3H1YA 3NNFA 3E6CC 2R32A 2Y33A 4GAZA 4HOOA 3O1SA 2KXLA 1H0BA 5A33A 3M4FA 2NMNA 4H3WA 2WO7A 1W6MA 3AL5A 5FREA 5FKCA 1LNSA 2J7MA 1YXWA 2QQMA 4WVWA 2LW8A 4AXOA 3UNPA 1CX1A 5L9BA 1IPJA 3LB9A 4I01A 3T4HB 1W9WA 1RVF3 4ARYA 2RR12 5FMOL 4CU9A 1Q43A 1UYPA 4LE3A 2PFWA 3FLRA 3KB5A 1UL9A 3ZR5A 4E4SA 1JZ6A 1ZA7A 3OTFA 4ZU7A 1ACCA 2CDOA 1XNDA 2XXZA 5FP3A 4DXZA 1O5UA 1QJU3 1U5XA 2E32A 5FPLA 1MPXA 5GZCA 2IFWA 4N9IA 3OPTA 3VZLA 4D7YA 2C0ZA 1PZ7A 2UWCA 3PDQA 4KMQA 3KHCA 1OA4A 4AGVA 4K8FA 1PX4A 2DU0A 1V70A 2RDSA 2R063 3FLTA 3JQWA 1SBFA 3DPRA 4EROA 1ZBE3 3NAPA 4PJYA 4TLFA 4AAPA 4YVSB 4COZA 1OUSA 1Z0HA 1MS0A 2DTYA 4IV1B 2RS31 4NHMA 4EN9B 1ASJ2 1OD3A 5FZKA 2VUJA 1RUF1 2YY1A 3THPA 3ETPA 2VOTA 2A6VA 1LKNA 5E1RA 4UW5A 4WVMA 2HWD1 3OF1A 5CFCB 1R093 3O0WA 3IPVA 3NL1A 2F4LA 4GIQA 2F4PA 3OUHA 3CLPA 1ZZCA 3FC0A 3GZAA 2IWGB 1MS9A 2KM2A 1UKRA 3O1MA 3VB9A 5JI9A 4YVSC 4DOUA 4IV1C 1ALYA 1W6OB 2WRAA 2ZGRA 3H8RA 1ST8A 3LIGA 4DRVA 1A8DA 2HWD3 4JDOA 5JWPA 1SBEA 3TN92 4A6OA 1IQDC 1DQ0A 2WT0A 1KITA 2RS52 3F95A 1OQEA 4LPLA 4OVEA 3HT1A 4C1WA 3PVBB 1XYOA 2WNVC 4LHSA 4LUKA 1JOBA 1F8VA 2ZEZA 1YWKA 4PLNA 1G86A 1XNBA 4LUMA 1B35C 2HWC1 2VZQA 2WINB 4AHZA 4KWJA 2PYTA 4YW3A 5GLZA 5IVVA 3HVDA 1PM4A 4FSJA 2DFBA 2FDIA 1IGOA 2HWF1 4CCOA 2R0HA 2R073 1JZ8A 4A44A 1JZ5A 3LD8A 4GKYA 4H14A 3GNEA 1W90A 2E6VA 4QB1A 5EJ1B 3VZJA 3FFZA 3UL2A 2PTMA 3C7OA 2CGOA 2A5ZA 2NM1A 3EMRA 3K2OA 1AUYA 2BYVE 1NOVA 2VCAA 3MBWA 3NKGA 3NW4A 4HVRA 1E57A 4ORFA 4Y3OA 2D5HA 4ZKTB 1POQA 5C3RA 1KEXA 1PO11 2WS93 3MV01 5F32A 2HWF3 1QOOA 2RM23 2Q1MA 4FPEA 4GA9A 1NUKA 4YVSA 1FV2A 3B93A 2WSUA 2X5IA 4IQPA 3KT4A 5AFEA 2RS12 4BK4A 5JPMB 2OA2A 4A7KA 3WCSA 1IS6A 5FP9A 1NXMA 3TYJA 1Y7BA 5T50A 1WA4A 5A1AA 1CVNA 5FMOS 1HRV3 3IT8A 2YC2A 5FPVA 5CFCA 2D6LX 5BNNC 5KC5A 2WT2A 2YC0A 2PAMA 5JOXA 1N1SA 1KS4A 1VBA3 4ZPIA 3B02A 5FZEA 2UU8A 1HRI1 2WN3A 3T08A 2BOJA 3WD5A 4GALA 3DCQA 1W6OA 4Y22A 4K6BA 3ACFA 3RRDA 2QQLA 1UU4A 4R9AA 2YPDA 1OPMA 4IEYA 3ECQA 4LKDA 3LA2A 2AEZA 4MGIE 2C1FA 2ZHLA 5DDJ1 1YHFA 4YVWB 3VBUC 3WQ1A 2PHXA 4CCDA 1HRI3 2DVDA 1CGPA 5DABA 3O1PA 5LA9A 4KWKA 1UZVA 3AJYA 4GMP1 4XE9A 3VZNA 4BQ1A 2WO2A 3WG2A 3MGUA 2IXIA 1EPZA 5FCCA 3EB7A 1QXJA 3WP6A 1DQ2A 3HAGA 1VLNA 2A6ZA 5C3PA 5F8PA 4AEMA 3M3IA 1V9U1 3ZYJB 2UWBA 3FWEA 2JE7A 3JB4C 3AKQA 4QQOA 5ISLA 3WDVA 1UY1A 1AL21 4BA6A 2C6SA 3WCRA 1WW4A 3LEGA 4NHLA 1AR63 4CEYB 5FDBA 4DIQA 1H8TB 2HKXA 1PO21 2D5FA 2Z4FA 3FX3A 3U14A 5JXJA 2W39A 4XIKA 3WF2A 1OQDA 3D0JA 5A6YA 5GKAC 5AC92 1LJ7A 3B7MA 1H4GA 1G9FA 1ZZBA 3K46A 5AVPA 1C3HA 5EZWA 1AX1A 1RXGA 1VRH1 1CPNA 5DUXA 1HB3A 5A32B 1PO23 2VW2A 4ZY9A 1O4ZA 1JYWA 1AYN1 2P3JA 2VAUA 2VZSA 4IEZA 1TG7A 2N7GA 5DG2A 2FZ2A 3P1IA 4JGZA 4NUBA 4GMP0 5SV5A 1LOBA 1H8TC 2XH6A 1ULGA 4L0PA 2CV6A 1J1LA 1QDCA 2ATFA 1D4M2 1VRH3 4ZHNA 1UPSA 1OA2A 2FCUA 1ND3B 2VOWA 4YGEA 2W3JA 3DYMA 1K12A 4BQYA 5J96B 4D6SA 3SQOA 1C5HA 1GP4A 1RC6A 1XSQA 2VNGA 3LGRA 3PUIA 3VBRA 1BMV2 4YVWA 1CZSA 1F9KA 1UOGA 2Q5TA 3POWA 1WMEA 4FFGA 1MEC2 2X8KA 2P6CA 4QPGB 2ARBA 1SLCA 1GQHA 4A7YA 5L36A 5JMCA 1DHKB 1VAMA 3VD3A 4OUSA 5A3LA 2RMU3 5E16A 5FPXA 2Y6JA 4LIVA 3DXUA 4RFRB 3ZYGA 3PIJA 4LEJA 4ZONA 1ENSA 3EXUA 4OHXA 4XFGA 1WD3A 3MIDA 4QPIB 1RUG3 1WUVA 4QPWA 1S0EA 3SHRA 2PHLA 2CSGA 5JVVA 5FPUA 4CEYA 1KJRA 2XUEA 5FZ6A 2WN2A 4QPGC 5DXDA 3I3MA 1IG0A 1OXCA 3J7HA 3E97A 4O7XA 4F7ZA 4LBOA 1NA1B 4XAAA 2HJIA 2TNFA 1GOFA 5IVEA 2O0OA 3W59A 4JDMA 4CP9B 5A6XA 4YW2A 2GNMA 4IXLA 5LASA 1ZYBA 2XBO1 4JC1A 4BQ4A 1ZVFA 4D8MA 1WMDA 3ITQA 4XDOA 5A32A 5FZHA 3WUCA 1ZZ7A 1FYUA 1UXXX 5F3GA 4XDPA 5FY9A 1NCRB 1GANA 2JDMA 5K0UC 3WNOA 3CJIB 2QTWB 3WF4A 4XF1A 1LOEA 2QQIA 3GXUA 4QQHA 1W2NA 2YZ4A 3EHKA 2XBO3 1WCUA 1QH6A 4D3WA 2Z42A 1ND3A 4RR3C 3N3HA 5FY1A 3ZXLA 4AEJA 4UFKA 2XPJA 1ZBA3 2RS32 1B09A 4XF4A 3R4DB 2PAKA 4NRMA 4PQ9A 5A7WB 3CL1A 3LIHA 4YYOA 4HMZA 1RUD3 3Q8EA 2GN7A 4K40A 4BQ3A 1RUF2 4IEVA 3IIAA 3U1XA 4M3CF 3LPGA 4QPGA 3J8F3 2A6WA 5DAQA 2BQPA 3KV6A 5T5JA 2D43A 2PMWB 2EXHA 4OULA 1U5ZA 2W1QA 1AF9A 1QY4A 4RD7A 4COYA 2Z5WA 5J36A 3OBRA 3OD0A 4CUGA 1YJKA 4MLOA 5GLTA 3UYJA 4Q8LA 4QPIA 2F6BA 2W9XA 1O3RA 4DUVA 1XYPA 3VD5A 2CYFA 2ZAAA 4LA3A 5JUVA 3TAYA 4IW3A 2AC1A 4AVTA 3R6SA 1TME3 4JHZA 4X8PA 1WCQA 3ZLIA 1NA1A 3MLJA 3KD4A 1IQAA 1GP5A 3ZYHA 2HWC2 1GLHA 3O0XA 3BKZA 4BIFA 1CD3G 4JKLA 3RZGA 1QWRA 4XCAA 1F4HA 3U10A 4DUXA 2JECA 2VU9A 4OQ8A 2HWF2 1RUJ3 2HYXA 2V73A 5DPNA 1ZZ6A 4LO5B 1N1YA 3AXEA 4XF9A 4CCLA 4A4AA 4COVA 1GQPA 5FUIA 2VGDA 5IK8A 4HLTA 1NLQA 2JD9A 4CYDA 1NCRA 3GBWA 4CDQB 1EV11 1LB2A 2CGPA 3CJIA 4LO7A 3VKFC 5F37A 1BEV1 1IG3A 4XBLA 5FYVA 2P17A 3LFIA 2SBAA 1ZA4A 2E7AA 2H0VA 1PO12 4YZ5A 2DVAA 4LHNA 4FBFA 1LOCA 2D3PA 4IE4A 3ST7A 1WZXA 5FRAA 1CAUA 3RMXA 3NJYA 1EV13 4OMCA 4P9IA 1AXKA 2VECA 2VCBA 4H55A 5F5QA 4OFGA 5A6ZA 3RGBA 3MW3A 1R1A1 1YYNA 4FPLA 3DYPA 4UFLA 2ZGPA 3SLIA 3IDCB 4QDRA 1QEXA 4RYDA 4CDQC 4M3CA 4LK6A 3BPZA 2P37A 4I09A 2YGMA 5FZFA 3POGA 3TOJA 3M3CA 1X9PA 3SEEA 2P3IA 1UF2C 1RMU2 1EUUA 2WZR3 5BUVA 4AI9A 2NYYA 4JRLA 3D4KA 3N7MA 4FCAA 5A3UA 5T54A 3SEPA 5IT6A 5BNOC 2J1AA 3RI8A 2WSVA 4OI2A 1CAWB 2XLGA 1WWYA 1GWKA 4GB33 5DDJ2 3GBFA 1H1AA 2XLAA 1QJFA 5HCHA 5FBZA 2E33A 2AZ5A 3PUHA 1SFNA 1VJ2A 3S6PA 4AL9A 3LSDA 1UIJA 2C9AA 4BDVB 3OEBA 1BXHA 3AP6A 1PIV3 1Q56A 3ZSKA 5T5PA 4ES8A 4GULA 4Y5SA 1V9U2 2IFRA 4DINB 4BHPA 4Q5OA 2VOKA 3MIHA 2VZ3A 3S0MA 5CBLA 2BEOA 1YIFA 2W1UA 2XQRA 5LRSA 4O9GA 3HIFA 3ZM8A 3EYPA 3J7MA 1AL22 1Y4WA 2MNGA 3CZJA 1W2OA 3SNMA 2CGNA 3OOXA 1UY3A 1XE7A 2NN8A 1CAVB 1D0GA 3BI3A 3FHAA 4N7UA 2BV4A 1V6KA 1PK6A 1VBD2 1SQ4A 1VBB3 3U75A 4K3UA 4XJUA 3GHMA 3OPZA 4P14A 4DO0A 4QKNA 2VVEA 1IKPA 4QXKA 4B7KA 5DMYA 2QZ3A 3LQCA 1LEDA 3GJBA 3AX4A 4AOCA 1LHVA 1FPN3 1GNYA 1CIWA 3PJYA 3ACLA 1AYN2 2HWB3 4EN7B 1W39A 3AFGA 4WM7B 3E1F1 3TNPB 1DCSA 1IOAA 3SKVA 3OEAA 2J42A 4N53B 4QAWA 4C0HA 4Z1VA 2EXKA 4Z92B 3AFKA 1WGPA 1LODA 2J1TA 4K1YA 1FOD1 2TUNA 3T0AA 5FYBA 1FI2A 1QJEA 1OSGA 2DBNA 4QX5A 5DAPA 4AWDA 2JE8A 1BJQA 1BBT1 2O8OA 5ACA3 5HV0A 4W8JA 1CAWA 4CDWB 2DUOA 2WNEA 2D97A 1LOAA 5DN2A 3L2YA 2VZ1A 1J3PA 3K3OA 5FYIA 2UY8A 4L99A 5IHRA 3ACGA 4JX0A 4MGTA 2YFZA 4YM1A 2ZGLA 1DLCA 5H9QA 2OIIA 3E6BA 4WM7C 1HJGA 4LQRA 1FOD3 3OGVA 4YW1A 4CEWB 1YO8A 4PBPA 5SV8A 5A3MA 4Y4YA 2RJ2A 3ES1A 2A75A 3ON7A 4JGYA 4XJAA 4IEXA 4WM8B 4ZU4A 2VQUA 5FO8B 3N35A 3DGTA 1HW5A 1LRHA 1AR91 3NQHA 2BGCA 4K21A 4L8QA 1OUXA 1HB2A 1NKGA 3LDKA 4QHOA 2MEV3 4QDSA 4XMAA 5FPZA 2G9ZA 2DF7A 1D7PM 4EN8B 2CDPA 4BXSV 4IV3C 4UOJA 1O91A 1OFSA 5T3NA 5CA6A 4JZRA 4Q4W3 4UT5A 2QJVA 1YIPA 2XWBB 4XBQA 5FAXA 4CEWC 4SLIA 4MVTA 1AR93 1JU3A 1HDKA 1F31A 2XJQA 4QHZA 3RG0A 3I3DA 1KJLA 3I2JA 1OT5A 5LW9A 1E5RA 2RG4A 1NLSA 1AR73 1QU0A 4AFDA 1QJZA 2HWE1 5FUNA 1OURA 3QH7A 2D3SA 4LULA 4A2UA 4YZ3A 2XBO2 2R16A 2ZGQA 2AGSA 1S1AA 4EZHA 1O4YA 1DQ5A 5H9SA 4EE2A 5FPAA 5J48A 1KQRA 4CPBA 3VKNA 4OLLA 4MADA 4N53A 5FQ0B 5J1XA 2VMHA 4YWAA 2GC3A 5EJ3A 3B5LB 1REEA 2VZPA 3IIIA 1COV1 3MIEA 4DPNA 4RHV2 4LR4A 2YMZA 2ZACA 4LO8A 3C7HA 2A6YA 4CDWA 2Y0IA 3PJQA 3CF6E 2QE3A 2GMMA 1EPWA 4YW4A 1KXGA 4FTSA 4Q29A 4Y5TA 2NZ9A 4EJRA 2WJSA 4LA2A 5F2SA 3VN4A 2BVVA 4JTNA 4HONA 1UZ0A 4M3CE 4FTEA 3HOBA 3CMGA 4YNIA 2B8MA 5A6QA 2FCVA 2Y6LA 2BTVC 3PU8A 3Q8BA 4CEWA 2PQQA 5K7PA 4A3ZA 1DYPA 4N8MA 1X8MA 3UGGA 1AX2A 3B9CA 5C5UA 2D44A 2VW0A 1U12A 1UZYA 4WM8A 4Y24A 3ZXJA 4EWDA 5C9AC 5KHGA 3N36A 1KDKA 3DF0A 3EBRA 4JV4A 1LOFC 4HG6B 2RDNA 2VZTA 3L2HA 2VOVA 2ZX2A 3NV3A 4MHUA 3H8XA 4IDZA 1LU2A 2GN3A 3ZPYA 3PIGA 1W0OA 4Q8KA 1GR3A 1WKYA 2BGOA 2GC0A 4RGAA 2WYFA 5DZFA 3KCXA 2ORXA 4R52A 3IM0A 4Q0SA 2QZ2A 1GSLA 3V0BB 1YNAA 2G1MA 1UO9A 3M1HA 4Q4X1 1FV3A 5E89A 1NT0A 1DG6A 3FN9A 2BDRA 4HL0A 3AP4A 5H9PA 3DL3A 3HN1A 1MZ5A 2VQAA 2VW1A 2QQNA 1JODA 1DIWA 3AB0A 1R081 4AFAA 5FY4A 1AJOA 2VM9A 1Y9QA 1DGWX 1JH5A 5BYNA 4N90A 4Q4X3 3JD71 2WL1A 4P9WA 4KG0A 5A70A 1BEV2 3QD6A 3AMPA 2OKXA 5L9VA 3S5QA 5CIRA 3LE0A 4RA0A 2W91A 1H9WA 1LOFA 1S2EA 2JKBA 3HT2A 4HANA 4OUEA 1NCQB 1QJX1 1X36A 1A78A 3WP3A 1OLME 3WX5A 4R4XA 4LJHA 4UAPA 2XKOA 3JD73 4E4DX 3I7DA 1R1A2 4CCCA 2P6HA 1SPPB 1F35A 4NO4A 1FMD3 3QLQA 3VD7A 2XONA 4NRPA 3VGIA 3SITA 4KU7A 3ZFGB 2CU5A 1UYXA 3OUJA 4CP2A 4K20A 3CBNA 1VB2A 2WIIB 2ZHNA 1US2A 2Y60A 1TMF3 1BLZA 2J1SA 3M70A 5DUUA 4HXCA 5IVBA 3O1UA 1TNRA 2ZZJA 5IAVA 2VOXA 3FHQA 4FPOB 2O1QA 4IGQA 2JDKA 4L92A 1D2QA 1QNYA 2HEYF 3THCA 4AEDB 4LLOA 1MVQA 1C4RA 3CO2A 3NO8A 3DPRC 3ACIA 1WLDA 3NAPC 5J7MA 1RJ7A 2DU1A 4WVVA 5FP4A 4XOGA 1RVF1 3PUSA 2YGLA 4CP1A 5I8YA 3ENRA 5FZCA 3V0BA 1QH7A 2BFUL 2DFCA 4BWOA 2JICA 2XQXA 2B42B 1H4HA 4HKOA 3CU7A 3MV11 4NAOA 3UESA 4DEQA 5A3PA 4P00B 2X09A 1AXZA 1D0HA 4B4QA 4DMIA 3Q8CA 3QH6A 3N9MA 4GWNA 2K2SA 1QJU1 1ZRFA 1H8VA 3ZFFB 2ZMLA 3I3EA 5FZ9A 3OY8A 4CDXB 1OBNA 1YFWA 1Q8VA 1ODNA 2PLV2 3TRSB 4AEDC 5C6CA 3ZIXA 3ZXDA 5LBEA 4H7MA 4XW3A 3N9OA 4WZCA 4YM0A 2R061 4COWA 2WLPA 3OCPA 4UBHA 1ZBE1 5FMDA 2WABA 4LBNA 1XNAA 2BGPA 4KG8A 5EPAA 3SMHA 3ZOIA 3CHXA 4HKWA 4ZZ8A 5IYYA 4URTA 1NCQA 1CX4A 5JR7B 1O3SA 1S0IA 4QWNA 2DV9A 2OYZA 3MZHA 5J98B 4BB3A 1L3JA 2Q1ZB 1L7QA 3EQEA 1R091 1RUC2 5FXXA 1LGCA 2RE9A 2WZ8A 4OHWA 1SPPA 1U5IA 2WDBA 2ZHMA 4RS5A 2X5IB 3J7NA 1VRBA 5EHDA 3ZFGA 3B00A 3AJZA 4Y20A 1O8PA 4DUWA 2BP6A 2VC9A 4OI4A 3KMHA 1PNGA 4CU8A 5L7OA 1G7YA 4YFWA 2VNOA 5DAXA 2QQPA 1QJY1 5JOWA 5LK7B 4HBNA 3HEIA 1FOD2 1HXS1 5F1RA 3K3NA 3KT7A 1W8HA 3BIWE 4QDQA 4UW6A 5DUVA 2YYOA 4AEDA 1BBT2 1J84A 3QACA 1RUE3 3T1MA 3WNNA 4AK3A 5AFBA 3NRUA 3K51A 3IAPA 4INDA 3WQ0A 1W2AX 3VDDB 2J1UA 4RL7A 1HN1A 4Y22B 2X5IC 4QGMA 1QJY3 5CADA 3UETA 1W8FA 2GSYA 1HXS3 5FJHA 1W6NB 2ZA9A 2R071 4O9EA 1CJPA 1W9TA 2JDZA 1N3OA 4BK5A 4TZDA 5EXOA 1G9CA 3MIBA 5CFCC 3ZFFA 1LR5A 4Y5Z0 1AVBA 1ULOA 4S2HA 4CDXA 1AR92 5KC6A 3HQRA 1JYNA 2WS91 3RQ0A 2B7YA 2R49A 4K8RB 2RM21 4QX1A 4MGYE 4NVPA 4XBNA 2MHFA 1XU1A 3R4SA 4Q2FA 1WLCA 2KR2A 4FT8A 1LULA 3SC7X 4NROA 4V1PA 1JZ2A 1YFXA 2AYHA 2OUJA 3OPWA 4GWMA 3LKJA 4F8AA 4LBQB 1VR3A 2BWCA 1RUI3 4Y26A 4F3JA 3GHNA 4P02B 1OLQA 2JEMA 1HRV1 5F3IA 3NV1A 2HWE2 3WHTA 3P3PA 3T30A 1CZTA 4CU6A 2UY9A 4CPBD 1UIKA 5CEHA 3WG1A 4E2GA 1VBA1 4A41A 1UMIA 5DG1A 4AEKA 3VZMA 2CTVA 1SLBA 3M2MA 4BIOA 1GBGA 1XQNA 1PZ8A 2VMGA 4W65A 1OVPA 4B1LA 1RUOA 1LESA 2QQOA 1K5MB 3IWZA 4RN5A 3RWKX 1SHWB 2R041 1SDWA 3POIA 3KQRA 1HKDA 2BVBA 1MQTB 2TBVA 1COV2 4XVHA 5GZEA 3ZYFA 3IKWA 4A42A 3I8TA 1UY2A 4JGZB 2VBBA 1G9AA 3C7FA 3KT1A 1IZ3A 4C1XA 2J1RA 3HWJA 1UNBA 4BJ0A 2FZ1A 3VDDA 2VY0A 3IBMA 3ZFEA 3N9PA 2VUDA 3ZXAC 1STMA 3POBA 1PM7A 2B46X 2K9ZA 2OT7A 3IMNA 5EQUA 5BV6A 2HYKA 2R043 4L2NA 1QQP1 3SKJE 1W6NA 1S0FA 5LB6A 3VBRB 4AI1A 4ATEA 4UI9L 5BXXA 2NLRA 4MXWB 5FMBA 4LBJA 1JU4A 1K5MC 1WW6A 3ZXFA 3GDBA 5F7UA 3RNSA 4AVCA 5IK7A 4Q4Y3 4JGZC 2CAVA 4XEZA 4ZZ5A 1QIQA 5FXVA 1W8TA 1TEIA 2DTWA 3GBGA 1QQP3 1AR61 3ETQA 4DY5A 1G9BA 1WD4A 1JYCA 2ILMA 5IFTA 3K77A 5KHHA 4EV0A 4NR1A 4LBLA 3ZXKA 1UWWA 5JOZA 3MLLA 4AGRA 1ODMA 4HFSA 1CPMA 4Q0PA 4OHYA 1J83A 3VBRC 5BNPB 3J9SA 2PXJA 2OS2A 4LBQA 4YVWC 5A7OA 4Q4X2 2IVJA 2ZGKA 4P5HA 5EP9A 1BK1A 1XB9A 3S57A 2ARCA 5JPNB 4B4PA 1DLLA 4J6GA 1UN1A 2WFF1 2XR4A 4FOVA 2IC1A 3KS7A 4MHRA 1HV0A 3IZOA 1W8NA 1GNZA 2VZVA 4R4ZA 3UK9A 4AI3A 2DDUA 4DRRA 2BOIA 4KL1A 1JZ7A 1R082 1AZDA 3POEA 4MSVA 4PCRA 1UU5A 1O3TA 1I9RA 2LALA 3I4IA 3C2UA 3W58A 1GICA 1VBC2 4D6RA 1BVP1 1TE1B 2E26A 2Q8EA 2QQUA 1NAEA 1OOPB 4LHKA 1Z7S2 1K5MA 3LSEA 4GWJA 4JAAA 2JXAA 2YBKA 4PHZA 3WLUA 5IK4A 2WFF3 1E5HA 2NP0A 5FZOB 1MQTA 2QBXA 3CDZB 4IL7A 1GFF2 1PZ9A 2VBDA 1QJX2 4CEYC 1QXPA 4ATFA 2YC4A 5LA0A 2VMEA 2ZEXA 4NIIA 3JUUA 1JYTA 3RZKA 2QUOA 4HSLA 5M0TA 4QKFA 1BZWA 2Y38A 1RINA 4XAEA 2UYBA 3AVRA 1RYYA 1O8SA 4AQ2A 4P9XA 2H6BA 4FAGA 2RMU1 4FXKB 2W95A 4HN1A 4DB5A 1W04A 2WZEA 4MXWA 3C3VA 4CRQA 2V4AA 2D3RA 2FHRA 3HJRA 1J3QA 3MYXA 1RHI3 1RUG1 5I0TA 3JQXA 5CISA 3ZN6A 2K46A 1PX3A 4YM2A 2BUKA 5A80A 4TWTA 1H1MA 1NZCA 3AZWA 4YGCA 5C3SA 1I5ZA 5CG8A 4XFIA 1ND3C 4NRQA 4AI8A 4I02A 1RVF2 3OGRA 4XXPA 5J3UA 4IE0A 4HVQA 4UBGA 1NZIA 2VE1A 2WR9A 4MYEA 4YW5A 2YU2A 2W68A 5BNPA 2XMLA 3AKTA 4NHKA 1JUIA 5JDBA 2QVSB 5GLUA 2VZRA 3W5NA 3P5BA 3RDIA 1QJU2 4XPVA 1VAVA 1UY4A 2LM3A 3G6JB 4BH9A 3VV1A 1X50A 3VBHA 5KXEA 3HNMA 3ZVXA 4NWVA 3C7GA 1GQGA 3BUCA 2R062 5A3TA 1F5JA 1SG3A 1ZBE2 1OOPA 1MZ6A 2ZGUA 1CR7A 1SMVA 4XFFA 4XMIA 2PELA 3B01A 3OGGA 4QPIC 1ZBA1 5FZOA 1DBNA 3ZN4A 3T3YA 3BB6A 5IVJA 3ZSLA 1RUD1 1AYM1 1VP6A 5LK5A 4GH4B 2XJTA 5JXIA 3U11A 3RZLA 3AMNA 3JU9A 1QDOA 1UMZA 4CA9A 4YPJA 3J8F1 5FZDA 1NA1C 1WMXA 1R092 4Q0VA 4MGKE 2GC1A 4B4RA 4LTAA 1CAUB 4NPMA 4YG3A 1AYM3 2IXJA 4HZFA 4IEWA 3SISA 5C7GA 4QB2A 5CAZA 1NYWA 2IXCA 4DEVA 3THDA 3UT0A 3BTYA 2RJLA 5JXGA 4X6RB 1NCRC 2HWD2 1E5IA 3VKMA 2SLIA 3CJIC 1QNWA 4GH4C 4M3CB 3VL8A 4UYBA 4LKEA 4PT6A 2W92A 3B9IA 3LDBA 1ZZ8A 2WO1A 4CZSA 2PAEA 1PVC1 1TME1 3ZYRA 4C8DA 5KXBA 1RUH3 4YLZA 4ZXEA 5JI7A 2X05A 1HJFA 2YUEA 4FPHA 1N3QA 1YQ8A 5T5OA 1AR81 4Z07A 1VB4A 2YXSA 1H2KA 4QD2A 3UGFA 3MPBA 4FOYA 3N9LA 2B9UA 1SDDB 4CCMA 4META 3WT3A 3WW4A 1DF0A 1RUJ1 3ZPOA 3E5UA 1ULFA 2R072 4AQSA 1M4WA 4WVZA 4OCTA 5FP7A 1PVC3 5F6LB 4AI2A 4Q1PA 1H2NA 2YDEA 5KR7A 3ZSJA 1H2MA 2BNOA 4GD4A 1AR83 1GV9A 2JG8A 1A6CA 2W08A 2WS92 1SLIA 1S0DA 3UKVA 3W21A 4XF3A 4XURA 2FD8A 1CWPA 3BVCA 2RM22 4E9KA 4CXWA 2Y6KA 3ZSEA 3ZYPA 4QX2A 2KA3A 1HB1A 1XPWA 3FE5A 3ZXGA 2I45A 3OUIA 5I0SA 1HQLA 1XXNA 4GH4A 3A4UA 3BTXA 3T1LA 1WCSA 4XC9A 1UYYA 4GXLA 3OGSA 4QKBA 4EZ4A 1JW6A 3VBOB 4QX3A 3TNQA 2ORZA 4YG6A 4AHWA 1HRV2 1ZM1A 1FT9A 3H8UA 4YFZA 3T0DA 1LHWA 3AP9A 4RQPB 1DDLA 2B45X 3KV9A 4E27A 3HQUA 3G7DA 1WMFA 1PK6B 1VBA2 5I8TA 1C5IA 2WBKA 5FXZA 3I2FA 2WZR1 3KWVA 1KRIA 2W2IA 2ZX3A 3WNMA 1W9FA 1GP6A 1EAH3 3I54A 1N47A 1VMHA 3FZ3A 4HSJA 5HXVA 5CG9A 3KV4A 4FP3A 2XHKA 4FPFA 4OZXA 3VBSA 1C8M1 5BNQA 3HMYA 3M3OA 2WZPP 3SH5A 2YPJA 4GB31 3VBOC 3PVOA 1QXRA 1HRI2 1MVEA 1OKQA 1ND2A 2JG9A 1X82A 4MGQA 3I2GA 3WW1A 1XRUA 3HR9A 5I0RA 4LMFA 1PK6C 3AYCA 2PHDA 1V6MA 2CNAA 1VBE1 2ADDA 2XVKA 4URAA 5FZ8A 3LA7A 3RYRA 1C8M3 1PIV1 4MXVA 2L9LA 4HN0A 5D1IA 3FUOA 1GWMA 2JX9A 1DGRN 3N9QA 2ZXQA 4AQ6A 3NSTA 3ZN5A 5IUQA 2DURA 2R1BA 1MZEA 2EIEA 2VH9A 5LWBA 3VHOA 1T6BX 3WEZA 1APNA 2WC2A 1DZTA 1YFYA 1OF3A 1VBE3 4LKFA 3GZTB 4BQ2A 4JGYB 5HPOA 2D98A 1AR62 3KSCA 3BALA 4HPKB 4TYSA 4LBQD 3H7YA 3TBDA 1MZFA 1VBB1 4I0WB 4XQ4A 4E8DA 3H42B 5F5IA 4AVBA 2GP3A 5LRRA 2B9VA 5LZ6A 4IEOA 1U0AA 3GYDA 3INAA 1BQPA 5GALA 3WZ1A 5EYXA 1JYVA 2YU1A 1HQWA 3VBOA 4BPZA 2JE9A 4LK7A 4FFHA 4J1XA 5F5AA 1SCSA 1FPN1 2XLFA 1PO22 4TLGA 2VTXA 2ETEA 2HWB1 5E8AA 2ZGSA 4PQQA 4RQPA 5FYMA 3O1TA 1A34A 5FZ7A 4LNVA 4PDWB 1GZTA 1XE8A 2BBAA 1IS4A 4FO9A 3D8CA 3AZXA 4JGYC 4XHBA 4DNYA 2V09A 5CKQA 4OZOA 4CUAA 2XDVA 4PLMA 1VRH2 2GH2A 1YI7A 2ZOEB 4CCEA 2P5BA 3NKTA 1EYBA 5ACA1 3PMEA 3I2OA 2XJVA 4Z2AA 2Q8OA 1IPSA 5F9TA 1WW7A 3KQ4B 3S30A 4Q0QA 3WG3A 4YSFA 1UQXA 3BTAA 1W8OA 4CE8A 2IXKA 2YBSA 3HQXA 2WWJA 2RR13 5GLVA 5FOJB 4PDWC 1C1FA 1HX6A 1V6LA 3AXDA 2IVIB 4QKDA 4V2VA 1C1LA 5KXDA 2Q8DA 1MACA 3O1OA 1NE6A 1DGWA 4IERA 1QHDA 2RMU2 5FY8A 3OB8A 3VKLA 3WDTA 3PVEA 2J22A 2WQ4A 5FLJA 1HIXA 4QB6A 1UOBA 4FI9A 4B3NA 3OYWA 2GH8A 5DUWA 3SH3A 3WQBA 2MEV1 2VNVA 3VUOA 3RZMA 1DFQA 1O4TA 1RUG2 1NQDA 2C9KA 5CKNA 2OUHA 4N53C 3GZEA 1TQ5A 1NE4A 3TB0A 2A3YA 4HK8A 3VBFB 3IDBB 4Q4W1 3N7JA 1NY71 2C5DA 3H50A 1PVXA 3J7LA 4HPKA 1W3VA 4DY3A 2GMEA 1ASJ3 1SZBA 2HH9A 3DUIA 2VJXA 3AZYA 4CDWC 4M4RA 5FYSA 4JDNA 5FP8A 1AR71 5D21A 2DCZA 5HI0A 1SACA 4MO3M 5DQ0A 5JSRA 4I3GA 3I59B 5C33A 1VIWB 1G6NA 3M3EA 3TN91 2VL4A 3RZHA 1PHMA 5F3CA 1UOFA 5IATA 2PHUA 1UKGA 2RHPA 3GM8A 1K3IA 4PDWA 1ULCA 1AXYA 1W0PA 3IAQA 3LEIA 2XVGA 1IS3A 2DYCA 2J1VA 4WM8C 3VZKA 4K1ZA 5FZAA 3VDAA 3RWNA 2DVBA 4FTBA 2ZX4A 3PMSA 1OPOA 1CESA 2V5YA 4L9BA 4AHYA 3WHUA 2ZAHA 3TEWA 2QDRA 3ABZA 4U2AA 3RSJA 3TN93 4Z2WA 4QGLA 4YZ1A 2F17A 2RS53 2ZGTA 1REDA 1ZBA2 4LKSA 4NN0A 5A1FA 5GZGA 3FJSA 5LATA 5KHIA 5B4NA 4XTPA 1RUD2 4PLOA 4Q1RA 2ZPXA 5FZGA 4UW3A 1KFUL 3S5AA 1RB8G 1SBDA 5K8SA 4Y1ZA 1MS8A 1BKZA 1XNKA 3KV5A 3I2IA 4QPYA 1ZRCA 5JSPA 5CKMA 3D6EA 3J8F2 3OBZA 4I0BA 1Q8PA 1VALA 1Q8QA 1C28A 3AC0A 2ZJCA 3H1MA 2P34A 3H8OA 4X6QB 1S2KA 2XUMA 1UAIA 4IE5A 5D2AA 2JKXA 2GNDA 5HCBA 4XQWA 4JVAA 5BY5A 1S0GA 2RS11 1H1IA 2ID4A 3AVSA 2E31A 2P2KA 4DZGA 5KWRA 4CCJA 3I3BA 4UXAA 2Y6HA 2B5HA 2PHRA 5GZFA 3BN6A 4M01A 4Q0UA 3SCHA 4CUCA 5LEKA 3LA3A 5DAWA 3VBFA 3VZOA 4S2GA 3H3LA 4LIUA 1TME2 3AYEA 2Z2SB 4PF5A 1AL0G 4Z82A 3VL9A 5T52A 3BU0A 3DECA 2RS13 2Y6FA 1IPKA 4FXGB 4QX0A 5H9RA 1W8UA 5JSOA 4U36A 4RGKA 2AEYA 5A7SA 2UURA 1RTVA 2VQTA 3QBQA 3VHPA 4BOWA 2WA4A 1ZZ9A 5FYZA 1RUJ2 3I59A 4H2AA 1X7NA 1PGW1 1GZCA 2WKKA 3ZXEA 4CCKA 5TSWA 3OBAA 4EYUA 3H1WA 3O7OA 3WP5A 3I49A 5IW0A 5JCTA 2HBTA 2V5DA 2Z79A 1W05A 4CP0A 3VDBA 4ZU5A 4B8EA 1YQCA 2PHWA 2W1WA 3NJZA 3U4XA 1POV3 3WDYA 3OY8B 3CIHA 5F39A 4BMEA 4LOSA 4BQ5A 1X8EA 1ONAA 4TSVA 1FATA 1JHNA 1KDMA 4LITA 1EV12 2QQJA 3VDCA 4AVAA 4F83A 3BPSA 3FHIB 3M3QA 1RJ8A 2VZOA 1OH3A 2D7FA 3ZMOA 1UXZA 3T2QA 5LBBA 2A3WA 3ELNA 2XJPA 1FMD1 3WOGA 5FYCA 4QX7A 5J09A 3V64A 2Y26A 2FCTA 2JDHA 3OGJA 4AAXA 1ZREA 3D3AA 2EALA 1F4AA 1S0CA 2D93A 2YFUA 2G4IA 4KQ7A 4GWIA 2I2SA 1N3PA 1OF4A 1QOSA 2UWAA 3H3UA 3AKRA 3HNBM 5CVRA 2GNBA 2WZR2 4QXHA 1TMF1 5EWSA 2G19A 1QGLA 5CYYA 3QCWA 1CN1A 1H6XA 1R64A 4KBBA 4R9BA 5EFUA 5FWEA 2P4EA 2VTXJ 2W94A 3LWCA 2W1SA 4KU8A 1Y9GA 4N43A 4RS5B 1Q8OA 1UD1A 1W9YA 3WINE 2D40A 4XACA 3ZMNA 4A7ZA 5C3QA 5CNAA 2BZDA 1H30A 4Y20B 3URFA 1W6PA 4ISQA 2QFEA 5A1LA 1QMJA 2XL9A 4GB32 3LEKA 5L7OB 1ZRDA 3POFA 4FAHA 3ILRA 4UW4A 1YQ6A 1T2XA 4P9GA 1OI6A 4ITCA 1NCQC 5AC93 3CNAA 4YGDA 1V00A 2EAKA 1DU3D 4PBOA 4EWEA 1S2BA 2E53A 4CDUB 4AR2A 1PIV2 2JIGA 4UFIA 2H0BA 1LHUA 4RS5C 2JENA 2QDNA 3RJ2X 4IE7A 3GJAA 1GNHA 2XJSA 5LA2A 3ZFGC 1BMV1 1F5FA 4UFJA 2Y6GA 2ZHKA 3OSDA 4XTMA 5L7OC 1LAJA 1V6IA 4NJ4A 1UMHA 1PGL1 1JOJA 5I8SA 2YG0A 1J3RA 1D4M3 2DUQA 3DEMA 1BHGA 2ZGOA 5LCWL 4PI2A 4NIGA 1MS5A 4XQDA 1R1ZA 5D8AA 5FK8A 1JYXA 2A7AA 3ILNA 1VBB2 4AFBA 1JTZX 4W6XA 5LBCA 4YGBA 4O65A 1WW5A 2ZZQA 1LECA 2VNRA 3PNAA 1O7FA 4K9SA 5JLVA 1MEC3 1EUTA 1JS9A 5A3OA 3LCPA 4E4ZA 5EIYB 3VHNA 1FPN2 1L7RA 1GYKA 1UX6A 3KGLA 2HWB2 4XFCA 4D7TA 5LEJA 4DXSA 3ASIA 4JQTA 4WZFA 5C5TA 1S0JA 5A3WA 2ZX1A 5EYYA 1IKQA 4LBKA 4AVVA 3ZFFC 5ABJA 4XDQA 2BU9A 3N9NA 3WR0A 2WAAA 4CDXC 2EF6A 1YLLA 4NIDA 5FMCA 3KVAA 3FLPA 4NMIA 5FZBA 3A23A 5ACA2 1RUE1 2PQSA 4LXLA 1JYIA 1Q5OA 2GP5A 2ZEWA 2B4KA 3D0SA 3NWKA 1NXD1 3Q9OA 4AW7A 4ES9A 4S2FA 1SLAA 3HPNA 1QKQA 3H3ZA 1T6GC 4NWWA 4PIXA 3SH4A 2IZWA 2VD7A 2XG3A 2EXJA 1MS4A 5G05L 1CZVA 1WLWA 1YCIA 1Z78A 4CDUA 4E2SA 4FOQA 1N1TA 1UY0A 4LBMA 3ZFEB 4QQLA 3PU3A 4UFHA 5JAXA 4A3XA 4NE9A 5J37A 4AVSA 1S55A 1V6OA 2MEV2 1XSRA 4Y1VA 4YW6A 4H7LA 3U37A 2WNVB 1SFYA 3A0NA 3BU7A 3F2ZA 4Q4W2 1WBFA 4AG4A 1NY72 3CQOA 1B35B 4ZS3A 5LY1A 1NX9A 2RS33 2ZGNA 2RDQA 2XGXA 4PIZA 5T55A 4OQ9A 3AMHA 1OD5A 1RUI1 4XXAA 2YV8A 1L7LA 3NV2A 2GMPA 4LLFA 3T09A 4PF1A 1AR72 1RUF3 1ENQA 3VDDC 3ZFEC 4CUBA 3PURA 4XUPA 5DAVA 1FNZA 2A3XA 1WCDJ 3RJRA 4YG0A 1GOHA 3WF3A 3U07A 3O5SA 3AZZA 2EAAA 3ME2A 4LO4B 1VAKA 2PHTA 3TWIA 1WLTA 2ZBJA 2VXJA 3ACHA 3ZDSA 2BFUS 4P9LA 2ET1A 3M8LA 2ARAA 4QU1A 3RZJA 1CAXB 4ASMB 1H6YA 4PI0A 1CJDA 3MI8A 4OI0A 2OQ7A 1LENA 2FQPA 3WDXA 3WDUA 3WW3A 1LGBA 4JKMA 1MS3A 1SCRA 2GU9A 1ULDA 2W0XA 3LAGA 4QU2A 5FZMA 4QXCA 4XZUG 3MW4A 2W5FA 1YJLA 2HWC3 4BYYA 4BXFA 5BNNB 3KGZA 3WXPA 1XE0A 1BYHA 2EIGA 3ZR6A 3HBZA 2XVLA 2XOMA 2VMIA 3K4DA 2C4XA 1PMHX 3BOWA 3PTRB 4IUGA 1ULEA 1W9SA 2GAUA 1DZQA 4XUNA 5FYYA 4IV1A 5CFDB 1DYKA 2QNKA 4Q4Y1 3B69A 3N7KA 3MFCA 3UJQA 1K45A 2WQZC 3DV8A 3ZSMA 2WNUB 1UCXA 4WBBA 1OH4A 1PO13 4YRDA 3VBUB 2WNOA 2WNVA 1JUHA 2ZX0A 1W2UA 3FL7A 3I3QA 3MEPA 4P9JA 3BTZA 1UYZA 3C8XA 4QT6A 2Y0OA 1MQTC 2DWRA 3ZX7A 1B35A 1YRZA 1RMU1 3ZN6B 5KBFA 1BK0A 3AYAA 4K7JA 2VG9A 5B4XA 2YROA 1EP0A 2AACA 5T5LA 4KWUA 5CFDC 4R8HA 2CWMA 4FQ4A 3RPQA 2ZS6B 4EQVA 4I0AA 3ZIWA 1PGW2 4P9YA 4LOTA 5FBJA 2ADEA 2WNUC 1AJKA 1F2NA 4S2DA 1RMU3 1OMIA 2PN5A 2P3KA 3NNGA 3ROUA 3H7JA 4ONUA 5FKBA 2E7TA 4CSWA 2VCCA 3O1VA 1CAXA 1K42A 4KWLA 2LS6A 1WA6X 3FFQA 4YW7A 2LUWA 4GQ7A 4I30A 1RL3A 2ENRA 2WT1A 4Y1UA 1CQ9A 3VBHB 2LRPA 5DDJ3 2EIBA 4DXRA 2Q30A 2D6KA 3A22A 3I2KA 3JD72 5GZDA 5JOYA 4BISA 4GKXA 3T2PA 1NG0A 3AP5A 5BNNA 2BERA 4GMP3 5BNPC 1DQ1A 1FMD2 3JXSA 2WLQA 3PUAA 5IJRA 4W6WA 4FOWA 1ULPA 1W0NA 1GU3A 4J1WA 2VVDA 4I2OA 2VQ0A 5CFDA 1TMF2 1RHI1 1V9U3 1VBD1 4OYUA 5FOBB 3LEMA 4P5YA 3VBHC 4B7EA 4AYUA 3DKWA 3ZYIB 2WNUA 3MF6A 4XILA 5HV4A 1OHFA 3O1RA 1OA3A 2VO5A 5FO9B 1AL23 1UX7A 4XYXA 1YI9A 1DQ4A 5FLHA 3VBUA 1OOPC 1RXFA 5JZGB 3UKTA 3PHMA 4QMAA 5CU1A 1I3HA 1HB4A 4XZPA 5A7NA 4ZXKA 2VCMA 1VMJA 1J58A 1GZWB 2CHHA 1VBD3 4Y33A 4N7IA 2DBIA 1SFPA 1UZZA 2EXIA 5IFPA 3LOIA 4CVUA 4L97A 4AQTA 1DQ6A 5JIAA 2VTFA 3WW2A 2DCYA 2WYSA 4QQ2A 3SXWA 2BPA2 1ZX5A 5B2GB 3GCXA 1AYN3 3POSA 2JD4A 3O12A 3KCYA 3T4VA 4D0QA 3SCGA 4XJWA 1OC1A 5JZGC 3AMQA 3B3QE 2Y34A 2FDFA 1PGL2 1US3A 3WQ7A 1W6QB 4OUMA 3USSA 2ZMNA 4W6YA 3I2HA 2YHJA 3LZZA 2JG8B 2OPWA 4M0HA 1JN2P 4JKKA 1GKBA 4DXTA 1OLRA 4XETA 4XUOA 3WUDA 4R9CA 2AR6A 1XU2A 1TVGA 2OXBA 3POYA 4LO6B 3H0OA 4TN7A 4AFMA 3WNLA 2QQKA 2CY6A 1XOYA 4HKLA 4E4HA 1F15A 1EY2A 2XB6C 5FY7A 3UGHA 5K0UB 3EJKA 3VD9A 3KVBA 1H8TA 3O0VA 2TEPA 2CAUA 2R6QA 5FPBA 2PHFA 2BRTA 4BLJA 1ZNPA 1SLLA 1V6JA 4XABA 4BCUA 4FPKA 4KH9A 1O5LA 3P6BA 3Q8FA 5E88A 4RR3B 3UJOA 1NQJA 2JG8C 1C8NA 1S4CA
chains in the Genus database with same CATH topology
3BIEA 3I2OA 4OCTA 4IE4A 4JHTA 3I49A 4RFRB 4NIIA 3RZKA 4QHOA 4QKFA 4QKDA 2FD8A 3O1VA 3O1OA 4CXWA 3KHBA 4NRPA 2FDGA 3I3MA 4NROA 4O7XA 3BTXA 3T4HB 4QKBA 3RZMA 3O1UA 4NIHA 4IE6A 4ZS3A 4NRQA 4IE0A 5DABA 3KHCA 3O1PA 3O1SA 3O1RA 3RZHA 4NRMA 5F8PA 2FDJA 3BUCA 3RZJA 3T3YA 3BI3A 4O61A 4IE7A 3S5AA 4CXYA 3T4VA 3O1MA 3RZLA 4QKNA 3H8RA 4NJ4A 2FDFA 3H8XA 4IDZA 4NIGA 3H8OA 4NPMA 4IE5A 4CXXA 3BTYA 2FDHA 3BKZA 4ZS2A 3RZGA 4ZHNA 4NPLA 3S57A 2FDIA 2IUWA 3BTZA 3I3QA 3O1TA 3LFMA 4MG2A 3BU0A 4MGTA 2FDKA 4NIDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BIE A;  3I2O A;  4OCT A;  4IE4 A;  4JHT A;  3I49 A;  4RFR B;  4NII A;  3RZK A;  4QHO A;  4QKF A;  4QKD A;  2FD8 A;  3O1V A;  3O1O A;  4CXW A;  3KHB A;  4NRP A;  2FDG A;  3I3M A;  4NRO A;  4O7X A;  3BTX A;  3T4H B;  4QKB A;  3RZM A;  3O1U A;  4NIH A;  4IE6 A;  4ZS3 A;  4NRQ A;  4IE0 A;  5DAB A;  3KHC A;  3O1P A;  3O1S A;  3O1R A;  3RZH A;  4NRM A;  5F8P A;  2FDJ A;  3BUC A;  3RZJ A;  3T3Y A;  3BI3 A;  4O61 A;  4IE7 A;  3S5A A;  4CXY A;  3T4V A;  3O1M A;  3RZL A;  4QKN A;  3H8R A;  4NJ4 A;  2FDF A;  3H8X A;  4IDZ A;  4NIG A;  3H8O A;  4NPM A;  4IE5 A;  4CXX A;  3BTY A;  2FDH A;  3BKZ A;  4ZS2 A;  3RZG A;  4ZHN A;  4NPL A;  3S57 A;  2FDI A;  2IUW A;  3BTZ A;  3I3Q A;  3O1T A;  3LFM A;  4MG2 A;  3BU0 A;  4MGT A;  2FDK A;  4NID A; 
#chains in the Genus database with same CATH topology
 3HN3 A;  5C3O A;  1G8W A;  1YQ5 A;  3LPF A;  4OHV A;  1BCX A;  1LGN A;  1RUE 2;  2DUP A;  4UF0 B;  5FZ0 A;  5JZG A;  3TEX A;  1RUH 1;  4FQZ A;  4NAM A;  4FP2 A;  4Q4V 1;  1D2S A;  3TEZ A;  4QM9 A;  5FK7 A;  3LDR A;  5FV3 A;  3K4Z A;  1GZW A;  1J59 A;  3UKN A;  5FY0 A;  4MV2 A;  4BZ4 A;  1QJY 2;  2V4V A;  3AKS A;  3VBS B;  5JMO A;  2O8Q A;  1HXS 2;  1WCK A;  2LTN A;  5ANN A;  2JIJ A;  1HQN A;  4RHV 1;  2JWP A;  3KLS A;  5JXH A;  1ND2 B;  2C24 A;  2JG9 B;  3AK0 A;  4I3P A;  3OJB A;  4Q4V 3;  1AHS A;  5HCF A;  2XJR A;  2OQ6 A;  3CKH A;  4D94 A;  2ZKL A;  3A21 A;  3MDP A;  2R7E B;  2QKD A;  2VUA A;  4LE4 A;  5I93 A;  5FLI A;  2JDA A;  3TEY A;  3NNM A;  4XJ9 A;  4ISR A;  3ES4 A;  5L19 A;  3OBT A;  1DGR A;  1W6Q A;  1GUI A;  4QXB A;  4RHV 3;  4C90 A;  3VBS C;  3WF1 A;  3VLB B;  1RUN A;  3WY6 A;  2B39 A;  1ZRR A;  4XJ8 A;  2EID A;  3R0R A;  4ET7 A;  2ZTN A;  1RUI 2;  3O14 A;  1I6X A;  2Z69 A;  5FYU A;  3AP7 A;  3HD8 B;  4HT1 T;  1ND2 C;  2JG9 C;  5GM0 A;  3HBK A;  3ZYB A;  1OFN A;  1PMI A;  1XNC A;  1I1E A;  1ZRI A;  3FMG A;  4FFI A;  5LY2 A;  3FBM A;  4PIY A;  4BMB A;  1JZ3 A;  5K0U A;  4G4F A;  3E6D A;  4G9S B;  1YUD A;  2CWS A;  2A6X A;  2BNM A;  5JIU A;  2Y8K A;  4B1M A;  4LT5 A;  3NJV A;  4XUQ A;  3PTY A;  4J25 A;  1LHO A;  3ZDV A;  5GJ6 A;  3AKP A;  2GAL A;  1EAH 1;  1DGL A;  4BE3 A;  1Y3T A;  3BCW A;  3WNP A;  2NPI A;  4YM3 A;  4CP9 A;  4EWA A;  2RJK A;  4RR3 A;  4YZ4 A;  2O14 A;  3ZKY A;  3FUQ A;  2K0G A;  5FR3 A;  1JZ4 A;  3W9A A;  2ERF A;  3NNJ A;  4UF0 A;  2XKP A;  5BPX A;  1RIT A;  1VPH A;  3KZ4 C;  3KM5 A;  4IET A;  1FAY A;  4O61 A;  3RYP A;  3GCW A;  4MGS A;  3RFR A;  5EJZ B;  3SCF A;  2GNT A;  2J1E A;  5I91 A;  1UZW A;  4GJZ A;  1JMU B;  1V0A A;  5L9R A;  2QQW A;  2R04 2;  1XC6 A;  2DVG A;  1PNF A;  2JDP A;  2IXL A;  4BLI A;  4Z8B A;  4COU A;  1KD7 A;  2G9G A;  4CTE A;  2ZEY A;  3POJ A;  2ZGM A;  4RQP C;  4NHY A;  1DZR A;  1ENX A;  2OX0 A;  3MIC A;  4Q4Y 2;  5FZ4 A;  5A7W A;  5BNO B;  5C4W B;  3KF5 A;  5LA1 A;  1X9T A;  1QQP 2;  2AUY A;  1BEV 3;  3JCI A;  3PUQ A;  1VE0 A;  4MGZ E;  4RSU A;  4UWD A;  2BW8 A;  4W4Z A;  3HNY M;  5K4L A;  3A0K A;  4AE2 A;  3OYW B;  5AVA A;  3LOB A;  3BYW A;  1H2L A;  2E9Q A;  2IXH A;  2JB8 A;  3D5O A;  1V6N A;  3JBG 1;  3MW2 A;  4HK9 A;  4Q27 A;  4EN6 B;  3WNK A;  1W2T A;  4KGQ A;  4LHL A;  4TTG A;  2A1X A;  4JQR A;  3WSO A;  1R1A 3;  2D6N A;  4IGO A;  2VXR A;  1G9D A;  4ASL A;  2X53 S;  5C4W C;  3BIE A;  1GWL A;  4N9H A;  4QM8 A;  4P08 A;  4DFS A;  4QQP A;  4EN0 A;  1TZO A;  1O59 A;  2XHN A;  1H9P A;  2ZMK A;  3JBG 3;  5IVF A;  5IVY A;  3A7Q A;  3T2O A;  4M00 A;  2BJS A;  1Q8S A;  1UU6 A;  2WFF 2;  3NMB A;  4MX3 A;  3S7E A;  3KHB A;  4AZZ A;  1FX5 A;  3R4U A;  3MIG A;  1XYN A;  4XJZ A;  3WNX A;  3ALQ A;  5I0D A;  3Q8A A;  4E8C A;  4IEQ A;  3U4S A;  3I2D A;  5APA A;  5FY5 A;  1CIY A;  4NPR A;  1FXZ A;  2FMD A;  1W03 A;  2PLV 1;  2RR1 1;  4AI0 A;  3MHZ A;  4CDQ A;  1JOP A;  3ATG A;  4JRA A;  4M0N A;  2NQY A;  4MZU A;  2ZAB A;  4BQW A;  3MUZ 1;  2LRO A;  3RMY A;  4IES A;  1JI6 A;  1Y9M A;  1PMJ X;  2WFP A;  3KCC A;  4D69 A;  3DXT A;  4DS0 A;  5HCA A;  1VMF A;  3P3N A;  4NIH A;  2P3Y A;  4XIO A;  4IE6 A;  3V56 A;  3NNL A;  3E5X A;  3E5Q A;  2NMO A;  3BOP A;  2DCJ A;  5IK5 A;  2W52 A;  3MPP G;  2PLV 3;  2RVA A;  1RHI 2;  1I5P A;  5C4W A;  5BNO A;  2WQ8 A;  3IN9 A;  4JTO A;  1N1V A;  3PLQ A;  3JB8 A;  3VHR A;  5DZE A;  5HBA A;  5C8W A;  1C57 A;  1XJA A;  2WWS A;  2WAO A;  1RUC 1;  3AYD A;  1AX0 A;  3CJX A;  4XUT A;  5FTT C;  5LBF A;  3UV9 A;  1OLM A;  4FPC A;  1ASJ 1;  4GJY A;  1UW8 A;  3IB3 A;  1W8Z A;  3I97 A;  2FDJ A;  2VR4 A;  3W20 A;  1W8W A;  3J4U H;  3CZU A;  4WV8 A;  3KF3 A;  2D6M A;  1A8M A;  5C71 A;  1RUC 3;  3RZZ A;  2E63 A;  4XFH A;  5IVC A;  5F3E A;  4RFT 0;  4MUV A;  3W5M A;  2DCT A;  4QX8 A;  2GDF A;  5FJK A;  5IAX A;  1LCL A;  4CXY A;  2JDU A;  2G9F A;  4RGG A;  5FWJ A;  3QOP A;  1SEF A;  4IV3 B;  2I07 B;  2EVX A;  4ARX A;  1GZ9 A;  1OQ1 A;  4IEP A;  3IDA A;  4D6Q A;  5HXM A;  2RS5 1;  4KI5 M;  4GZ9 A;  3K75 B;  3RI9 A;  1LOG A;  1YFU A;  2WUH A;  1BBT 3;  4AHX A;  1S0B A;  1LHN A;  2HEW F;  1Y43 B;  3DN7 A;  2YBP A;  4IEU A;  4KNC A;  3VBF C;  5K9Y A;  3MIF A;  4AFC A;  1K5J A;  1FNY A;  5G04 L;  4AGG A;  3V0A B;  3ZKU A;  5ERL A;  5C8C B;  5KXC A;  4ZS2 A;  1X33 A;  1WBL A;  2E7Q A;  4XFB A;  2XWJ B;  4MOA A;  2BNN A;  3GAL A;  4HVO A;  4C91 A;  4M4P A;  1DP0 A;  4DQA A;  2AH2 A;  5ANQ A;  3JZV A;  5CZK A;  1AYM 2;  2E51 A;  2HBU A;  3LFM A;  4E2Q A;  1URX A;  1P8J A;  2VMC A;  1JHJ A;  4ASK A;  5A7Q A;  2JB4 A;  4Y4R A;  1CAV A;  4FVV A;  2VPV A;  2YB7 A;  4KBZ A;  4UFM A;  2FDK A;  2ES3 A;  2XJU A;  3RYK A;  2D6P A;  1QF3 A;  2QQV A;  2R1D A;  4C0B A;  2W87 A;  2XL7 A;  5KHK A;  1GOG A;  4LOR A;  1JXN A;  5C8C C;  1W3X A;  5FUP A;  4JHT A;  4Y1X A;  1RUH 2;  1UOJ A;  3K4A A;  4OMD A;  3IDE A;  4Q4V 2;  4OI1 A;  5F2W A;  3GF6 A;  4WM7 A;  3WDW A;  3USU B;  4N43 B;  1BVV A;  1XNT A;  3BOD A;  3VKO A;  1QOT A;  1LEM A;  3MLK A;  3L9J T;  5FZL A;  5IWF A;  1OKO A;  1W6P B;  4BU2 A;  5C70 A;  3PL0 A;  2HWE 3;  4B29 A;  2W47 A;  5C9A B;  2Q8C A;  3RS6 A;  5L73 A;  5JR2 A;  2VMD A;  4XF0 A;  1PVC 2;  1IHM A;  2FDG A;  1HLC A;  1UPI A;  2JDY A;  3C7E A;  3LF7 A;  3WVJ A;  3ZO0 B;  5CB7 A;  2EIC A;  2Y64 A;  3D82 A;  1HV1 A;  5DZG A;  1AR8 2;  2FBE A;  2OPK A;  5I0U A;  3U0Z A;  3T0B A;  1U5Y A;  4IV3 A;  2VMF A;  1YEW A;  3FBY A;  1D4V B;  2JDN A;  2JJ6 A;  5EV7 A;  1POV 1;  3ORJ A;  3AZV A;  3AMM A;  2D6O X;  2Q4S A;  3MFA A;  5A3N A;  1COV 3;  3AL6 A;  4N43 C;  2KD7 A;  1HN0 A;  3X29 B;  4FPJ A;  4TXW A;  1RIR A;  2EA7 A;  4BM8 A;  3M7A A;  2WO3 A;  3V0A A;  1JBC A;  3H9A A;  5FIX A;  2OZJ A;  5C8C A;  1O6U A;  2VBP A;  1M06 G;  2OW4 A;  2A70 A;  2OZ6 A;  2VUL A;  4A45 A;  4AF9 A;  2BWA A;  3NJX A;  2I74 A;  4CCN A;  1KS5 A;  3MUY 1;  5D8A B;  3BGA A;  1A3K A;  4FFF A;  2A71 A;  3R05 A;  2ARE A;  1ENR A;  3J26 N;  1KGY A;  1NLR A;  3NV4 A;  2GC2 A;  3DYO A;  2Q0A A;  3DKQ A;  3S7I A;  2QCS B;  3N7L A;  3GGL A;  2HEV F;  1EAH 2;  2ET7 A;  4L11 A;  2W46 A;  4XFA A;  5A33 B;  1MS1 A;  4CU7 A;  4NOT A;  1RGS A;  2HLE A;  1W6M B;  2PA7 A;  4JCK A;  5GLW A;  3V65 A;  3VD4 A;  2ZKN A;  3GZU C;  2V72 A;  5FFO C;  1PGS A;  3K48 A;  2ZCW A;  3EO6 A;  2R0F A;  5ABJ B;  3PVN A;  4YAR A;  2A73 B;  2Q1F A;  3ILF A;  3B94 A;  5D8A C;  4NHX A;  5AC9 1;  2DCK A;  3IMM A;  4Q26 A;  1POV 0;  4QGN A;  1KFX L;  1XBF A;  3USU A;  1Q3E A;  2BBV A;  3U78 A;  4NIA A;  5FQ0 A;  1VBC 1;  2VVF A;  4G3Y C;  3OG2 A;  1C8M 2;  4XCB A;  1Z7S 1;  5FYT A;  5FZ3 A;  1LTE A;  2VUC A;  2WA3 A;  4X8N A;  4Y1Y A;  5FO7 B;  2WWU A;  3AM2 A;  5C9A A;  3N4M A;  1SLT A;  2P1B A;  3WG4 A;  2GZW A;  2RDR A;  2X29 A;  1J1T A;  5E6H A;  4CXX A;  5FZI A;  1R08 3;  1DYO A;  2H6C A;  4YZ2 A;  2FDH A;  2ARX A;  2DVF A;  2VZU A;  5FYH A;  3APB A;  1VBC 3;  1VBE 2;  5ABJ C;  1D4M 1;  4FPY A;  3CEW A;  3DPR B;  4NPL A;  2AEN A;  3THT A;  3NAP B;  2OVU A;  1Z7S 3;  4XHX A;  5KHJ A;  4SBV A;  5A7P A;  1YQ2 A;  2IUW A;  1CON A;  1E5S A;  4IGP A;  3OD4 A;  3WF0 A;  5F5C A;  2CL2 A;  1MR5 A;  1O3Q A;  1W99 A;  4MG2 A;  1QJX 3;  2C26 A;  3MO4 A;  4QHB A;  1W06 A;  3JBG 2;  1W28 A;  1GMM A;  1MEC 1;  2RV9 A;  4BQX A;  4V2W A;  4WVM B;  5FZ1 A;  2MPF A;  4D7S A;  1LU1 A;  3MF9 A;  2FMY A;  4W50 A;  5F6K A;  4A6S A;  3T2T A;  3IPV B;  4FPG A;  1OVS A;  4MH0 E;  1IS5 A;  5FXW A;  1YC6 1;  2X10 A;  2R30 A;  4KGG A;  4OHZ A;  3WV6 A;  4R9D A;  4HET A;  2UYA A;  4CDU C;  1TNF A;  3WP4 A;  3RVH A;  1REF A;  3NVC A;  3H1Y A;  3NNF A;  3E6C C;  2R32 A;  2Y33 A;  4GAZ A;  4HOO A;  3O1S A;  2KXL A;  1H0B A;  5A33 A;  3M4F A;  2NMN A;  4H3W A;  2WO7 A;  1W6M A;  3AL5 A;  5FRE A;  5FKC A;  1LNS A;  2J7M A;  1YXW A;  2QQM A;  4WVW A;  2LW8 A;  4AXO A;  3UNP A;  1CX1 A;  5L9B A;  1IPJ A;  3LB9 A;  4I01 A;  3T4H B;  1W9W A;  1RVF 3;  4ARY A;  2RR1 2;  5FMO L;  4CU9 A;  1Q43 A;  1UYP A;  4LE3 A;  2PFW A;  3FLR A;  3KB5 A;  1UL9 A;  3ZR5 A;  4E4S A;  1JZ6 A;  1ZA7 A;  3OTF A;  4ZU7 A;  1ACC A;  2CDO A;  1XND A;  2XXZ A;  5FP3 A;  4DXZ A;  1O5U A;  1QJU 3;  1U5X A;  2E32 A;  5FPL A;  1MPX A;  5GZC A;  2IFW A;  4N9I A;  3OPT A;  3VZL A;  4D7Y A;  2C0Z A;  1PZ7 A;  2UWC A;  3PDQ A;  4KMQ A;  3KHC A;  1OA4 A;  4AGV A;  4K8F A;  1PX4 A;  2DU0 A;  1V70 A;  2RDS A;  2R06 3;  3FLT A;  3JQW A;  1SBF A;  3DPR A;  4ERO A;  1ZBE 3;  3NAP A;  4PJY A;  4TLF A;  4AAP A;  4YVS B;  4COZ A;  1OUS A;  1Z0H A;  1MS0 A;  2DTY A;  4IV1 B;  2RS3 1;  4NHM A;  4EN9 B;  1ASJ 2;  1OD3 A;  5FZK A;  2VUJ A;  1RUF 1;  2YY1 A;  3THP A;  3ETP A;  2VOT A;  2A6V A;  1LKN A;  5E1R A;  4UW5 A;  4WVM A;  2HWD 1;  3OF1 A;  5CFC B;  1R09 3;  3O0W A;  3IPV A;  3NL1 A;  2F4L A;  4GIQ A;  2F4P A;  3OUH A;  3CLP A;  1ZZC A;  3FC0 A;  3GZA A;  2IWG B;  1MS9 A;  2KM2 A;  1UKR A;  3O1M A;  3VB9 A;  5JI9 A;  4YVS C;  4DOU A;  4IV1 C;  1ALY A;  1W6O B;  2WRA A;  2ZGR A;  3H8R A;  1ST8 A;  3LIG A;  4DRV A;  1A8D A;  2HWD 3;  4JDO A;  5JWP A;  1SBE A;  3TN9 2;  4A6O A;  1IQD C;  1DQ0 A;  2WT0 A;  1KIT A;  2RS5 2;  3F95 A;  1OQE A;  4LPL A;  4OVE A;  3HT1 A;  4C1W A;  3PVB B;  1XYO A;  2WNV C;  4LHS A;  4LUK A;  1JOB A;  1F8V A;  2ZEZ A;  1YWK A;  4PLN A;  1G86 A;  1XNB A;  4LUM A;  1B35 C;  2HWC 1;  2VZQ A;  2WIN B;  4AHZ A;  4KWJ A;  2PYT A;  4YW3 A;  5GLZ A;  5IVV A;  3HVD A;  1PM4 A;  4FSJ A;  2DFB A;  2FDI A;  1IGO A;  2HWF 1;  4CCO A;  2R0H A;  2R07 3;  1JZ8 A;  4A44 A;  1JZ5 A;  3LD8 A;  4GKY A;  4H14 A;  3GNE A;  1W90 A;  2E6V A;  4QB1 A;  5EJ1 B;  3VZJ A;  3FFZ A;  3UL2 A;  2PTM A;  3C7O A;  2CGO A;  2A5Z A;  2NM1 A;  3EMR A;  3K2O A;  1AUY A;  2BYV E;  1NOV A;  2VCA A;  3MBW A;  3NKG A;  3NW4 A;  4HVR A;  1E57 A;  4ORF A;  4Y3O A;  2D5H A;  4ZKT B;  1POQ A;  5C3R A;  1KEX A;  1PO1 1;  2WS9 3;  3MV0 1;  5F32 A;  2HWF 3;  1QOO A;  2RM2 3;  2Q1M A;  4FPE A;  4GA9 A;  1NUK A;  4YVS A;  1FV2 A;  3B93 A;  2WSU A;  2X5I A;  4IQP A;  3KT4 A;  5AFE A;  2RS1 2;  4BK4 A;  5JPM B;  2OA2 A;  4A7K A;  3WCS A;  1IS6 A;  5FP9 A;  1NXM A;  3TYJ A;  1Y7B A;  5T50 A;  1WA4 A;  5A1A A;  1CVN A;  5FMO S;  1HRV 3;  3IT8 A;  2YC2 A;  5FPV A;  5CFC A;  2D6L X;  5BNN C;  5KC5 A;  2WT2 A;  2YC0 A;  2PAM A;  5JOX A;  1N1S A;  1KS4 A;  1VBA 3;  4ZPI A;  3B02 A;  5FZE A;  2UU8 A;  1HRI 1;  2WN3 A;  3T08 A;  2BOJ A;  3WD5 A;  4GAL A;  3DCQ A;  1W6O A;  4Y22 A;  4K6B A;  3ACF A;  3RRD A;  2QQL A;  1UU4 A;  4R9A A;  2YPD A;  1OPM A;  4IEY A;  3ECQ A;  4LKD A;  3LA2 A;  2AEZ A;  4MGI E;  2C1F A;  2ZHL A;  5DDJ 1;  1YHF A;  4YVW B;  3VBU C;  3WQ1 A;  2PHX A;  4CCD A;  1HRI 3;  2DVD A;  1CGP A;  5DAB A;  3O1P A;  5LA9 A;  4KWK A;  1UZV A;  3AJY A;  4GMP 1;  4XE9 A;  3VZN A;  4BQ1 A;  2WO2 A;  3WG2 A;  3MGU A;  2IXI A;  1EPZ A;  5FCC A;  3EB7 A;  1QXJ A;  3WP6 A;  1DQ2 A;  3HAG A;  1VLN A;  2A6Z A;  5C3P A;  5F8P A;  4AEM A;  3M3I A;  1V9U 1;  3ZYJ B;  2UWB A;  3FWE A;  2JE7 A;  3JB4 C;  3AKQ A;  4QQO A;  5ISL A;  3WDV A;  1UY1 A;  1AL2 1;  4BA6 A;  2C6S A;  3WCR A;  1WW4 A;  3LEG A;  4NHL A;  1AR6 3;  4CEY B;  5FDB A;  4DIQ A;  1H8T B;  2HKX A;  1PO2 1;  2D5F A;  2Z4F A;  3FX3 A;  3U14 A;  5JXJ A;  2W39 A;  4XIK A;  3WF2 A;  1OQD A;  3D0J A;  5A6Y A;  5GKA C;  5AC9 2;  1LJ7 A;  3B7M A;  1H4G A;  1G9F A;  1ZZB A;  3K46 A;  5AVP A;  1C3H A;  5EZW A;  1AX1 A;  1RXG A;  1VRH 1;  1CPN A;  5DUX A;  1HB3 A;  5A32 B;  1PO2 3;  2VW2 A;  4ZY9 A;  1O4Z A;  1JYW A;  1AYN 1;  2P3J A;  2VAU A;  2VZS A;  4IEZ A;  1TG7 A;  2N7G A;  5DG2 A;  2FZ2 A;  3P1I A;  4JGZ A;  4NUB A;  4GMP 0;  5SV5 A;  1LOB A;  1H8T C;  2XH6 A;  1ULG A;  4L0P A;  2CV6 A;  1J1L A;  1QDC A;  2ATF A;  1D4M 2;  1VRH 3;  4ZHN A;  1UPS A;  1OA2 A;  2FCU A;  1ND3 B;  2VOW A;  4YGE A;  2W3J A;  3DYM A;  1K12 A;  4BQY A;  5J96 B;  4D6S A;  3SQO A;  1C5H A;  1GP4 A;  1RC6 A;  1XSQ A;  2VNG A;  3LGR A;  3PUI A;  3VBR A;  1BMV 2;  4YVW A;  1CZS A;  1F9K A;  1UOG A;  2Q5T A;  3POW A;  1WME A;  4FFG A;  1MEC 2;  2X8K A;  2P6C A;  4QPG B;  2ARB A;  1SLC A;  1GQH A;  4A7Y A;  5L36 A;  5JMC A;  1DHK B;  1VAM A;  3VD3 A;  4OUS A;  5A3L A;  2RMU 3;  5E16 A;  5FPX A;  2Y6J A;  4LIV A;  3DXU A;  4RFR B;  3ZYG A;  3PIJ A;  4LEJ A;  4ZON A;  1ENS A;  3EXU A;  4OHX A;  4XFG A;  1WD3 A;  3MID A;  4QPI B;  1RUG 3;  1WUV A;  4QPW A;  1S0E A;  3SHR A;  2PHL A;  2CSG A;  5JVV A;  5FPU A;  4CEY A;  1KJR A;  2XUE A;  5FZ6 A;  2WN2 A;  4QPG C;  5DXD A;  3I3M A;  1IG0 A;  1OXC A;  3J7H A;  3E97 A;  4O7X A;  4F7Z A;  4LBO A;  1NA1 B;  4XAA A;  2HJI A;  2TNF A;  1GOF A;  5IVE A;  2O0O A;  3W59 A;  4JDM A;  4CP9 B;  5A6X A;  4YW2 A;  2GNM A;  4IXL A;  5LAS A;  1ZYB A;  2XBO 1;  4JC1 A;  4BQ4 A;  1ZVF A;  4D8M A;  1WMD A;  3ITQ A;  4XDO A;  5A32 A;  5FZH A;  3WUC A;  1ZZ7 A;  1FYU A;  1UXX X;  5F3G A;  4XDP A;  5FY9 A;  1NCR B;  1GAN A;  2JDM A;  5K0U C;  3WNO A;  3CJI B;  2QTW B;  3WF4 A;  4XF1 A;  1LOE A;  2QQI A;  3GXU A;  4QQH A;  1W2N A;  2YZ4 A;  3EHK A;  2XBO 3;  1WCU A;  1QH6 A;  4D3W A;  2Z42 A;  1ND3 A;  4RR3 C;  3N3H A;  5FY1 A;  3ZXL A;  4AEJ A;  4UFK A;  2XPJ A;  1ZBA 3;  2RS3 2;  1B09 A;  4XF4 A;  3R4D B;  2PAK A;  4NRM A;  4PQ9 A;  5A7W B;  3CL1 A;  3LIH A;  4YYO A;  4HMZ A;  1RUD 3;  3Q8E A;  2GN7 A;  4K40 A;  4BQ3 A;  1RUF 2;  4IEV A;  3IIA A;  3U1X A;  4M3C F;  3LPG A;  4QPG A;  3J8F 3;  2A6W A;  5DAQ A;  2BQP A;  3KV6 A;  5T5J A;  2D43 A;  2PMW B;  2EXH A;  4OUL A;  1U5Z A;  2W1Q A;  1AF9 A;  1QY4 A;  4RD7 A;  4COY A;  2Z5W A;  5J36 A;  3OBR A;  3OD0 A;  4CUG A;  1YJK A;  4MLO A;  5GLT A;  3UYJ A;  4Q8L A;  4QPI A;  2F6B A;  2W9X A;  1O3R A;  4DUV A;  1XYP A;  3VD5 A;  2CYF A;  2ZAA A;  4LA3 A;  5JUV A;  3TAY A;  4IW3 A;  2AC1 A;  4AVT A;  3R6S A;  1TME 3;  4JHZ A;  4X8P A;  1WCQ A;  3ZLI A;  1NA1 A;  3MLJ A;  3KD4 A;  1IQA A;  1GP5 A;  3ZYH A;  2HWC 2;  1GLH A;  3O0X A;  3BKZ A;  4BIF A;  1CD3 G;  4JKL A;  3RZG A;  1QWR A;  4XCA A;  1F4H A;  3U10 A;  4DUX A;  2JEC A;  2VU9 A;  4OQ8 A;  2HWF 2;  1RUJ 3;  2HYX A;  2V73 A;  5DPN A;  1ZZ6 A;  4LO5 B;  1N1Y A;  3AXE A;  4XF9 A;  4CCL A;  4A4A A;  4COV A;  1GQP A;  5FUI A;  2VGD A;  5IK8 A;  4HLT A;  1NLQ A;  2JD9 A;  4CYD A;  1NCR A;  3GBW A;  4CDQ B;  1EV1 1;  1LB2 A;  2CGP A;  3CJI A;  4LO7 A;  3VKF C;  5F37 A;  1BEV 1;  1IG3 A;  4XBL A;  5FYV A;  2P17 A;  3LFI A;  2SBA A;  1ZA4 A;  2E7A A;  2H0V A;  1PO1 2;  4YZ5 A;  2DVA A;  4LHN A;  4FBF A;  1LOC A;  2D3P A;  4IE4 A;  3ST7 A;  1WZX A;  5FRA A;  1CAU A;  3RMX A;  3NJY A;  1EV1 3;  4OMC A;  4P9I A;  1AXK A;  2VEC A;  2VCB A;  4H55 A;  5F5Q A;  4OFG A;  5A6Z A;  3RGB A;  3MW3 A;  1R1A 1;  1YYN A;  4FPL A;  3DYP A;  4UFL A;  2ZGP A;  3SLI A;  3IDC B;  4QDR A;  1QEX A;  4RYD A;  4CDQ C;  4M3C A;  4LK6 A;  3BPZ A;  2P37 A;  4I09 A;  2YGM A;  5FZF A;  3POG A;  3TOJ A;  3M3C A;  1X9P A;  3SEE A;  2P3I A;  1UF2 C;  1RMU 2;  1EUU A;  2WZR 3;  5BUV A;  4AI9 A;  2NYY A;  4JRL A;  3D4K A;  3N7M A;  4FCA A;  5A3U A;  5T54 A;  3SEP A;  5IT6 A;  5BNO C;  2J1A A;  3RI8 A;  2WSV A;  4OI2 A;  1CAW B;  2XLG A;  1WWY A;  1GWK A;  4GB3 3;  5DDJ 2;  3GBF A;  1H1A A;  2XLA A;  1QJF A;  5HCH A;  5FBZ A;  2E33 A;  2AZ5 A;  3PUH A;  1SFN A;  1VJ2 A;  3S6P A;  4AL9 A;  3LSD A;  1UIJ A;  2C9A A;  4BDV B;  3OEB A;  1BXH A;  3AP6 A;  1PIV 3;  1Q56 A;  3ZSK A;  5T5P A;  4ES8 A;  4GUL A;  4Y5S A;  1V9U 2;  2IFR A;  4DIN B;  4BHP A;  4Q5O A;  2VOK A;  3MIH A;  2VZ3 A;  3S0M A;  5CBL A;  2BEO A;  1YIF A;  2W1U A;  2XQR A;  5LRS A;  4O9G A;  3HIF A;  3ZM8 A;  3EYP A;  3J7M A;  1AL2 2;  1Y4W A;  2MNG A;  3CZJ A;  1W2O A;  3SNM A;  2CGN A;  3OOX A;  1UY3 A;  1XE7 A;  2NN8 A;  1CAV B;  1D0G A;  3BI3 A;  3FHA A;  4N7U A;  2BV4 A;  1V6K A;  1PK6 A;  1VBD 2;  1SQ4 A;  1VBB 3;  3U75 A;  4K3U A;  4XJU A;  3GHM A;  3OPZ A;  4P14 A;  4DO0 A;  4QKN A;  2VVE A;  1IKP A;  4QXK A;  4B7K A;  5DMY A;  2QZ3 A;  3LQC A;  1LED A;  3GJB A;  3AX4 A;  4AOC A;  1LHV A;  1FPN 3;  1GNY A;  1CIW A;  3PJY A;  3ACL A;  1AYN 2;  2HWB 3;  4EN7 B;  1W39 A;  3AFG A;  4WM7 B;  3E1F 1;  3TNP B;  1DCS A;  1IOA A;  3SKV A;  3OEA A;  2J42 A;  4N53 B;  4QAW A;  4C0H A;  4Z1V A;  2EXK A;  4Z92 B;  3AFK A;  1WGP A;  1LOD A;  2J1T A;  4K1Y A;  1FOD 1;  2TUN A;  3T0A A;  5FYB A;  1FI2 A;  1QJE A;  1OSG A;  2DBN A;  4QX5 A;  5DAP A;  4AWD A;  2JE8 A;  1BJQ A;  1BBT 1;  2O8O A;  5ACA 3;  5HV0 A;  4W8J A;  1CAW A;  4CDW B;  2DUO A;  2WNE A;  2D97 A;  1LOA A;  5DN2 A;  3L2Y A;  2VZ1 A;  1J3P A;  3K3O A;  5FYI A;  2UY8 A;  4L99 A;  5IHR A;  3ACG A;  4JX0 A;  4MGT A;  2YFZ A;  4YM1 A;  2ZGL A;  1DLC A;  5H9Q A;  2OII A;  3E6B A;  4WM7 C;  1HJG A;  4LQR A;  1FOD 3;  3OGV A;  4YW1 A;  4CEW B;  1YO8 A;  4PBP A;  5SV8 A;  5A3M A;  4Y4Y A;  2RJ2 A;  3ES1 A;  2A75 A;  3ON7 A;  4JGY A;  4XJA A;  4IEX A;  4WM8 B;  4ZU4 A;  2VQU A;  5FO8 B;  3N35 A;  3DGT A;  1HW5 A;  1LRH A;  1AR9 1;  3NQH A;  2BGC A;  4K21 A;  4L8Q A;  1OUX A;  1HB2 A;  1NKG A;  3LDK A;  4QHO A;  2MEV 3;  4QDS A;  4XMA A;  5FPZ A;  2G9Z A;  2DF7 A;  1D7P M;  4EN8 B;  2CDP A;  4BXS V;  4IV3 C;  4UOJ A;  1O91 A;  1OFS A;  5T3N A;  5CA6 A;  4JZR A;  4Q4W 3;  4UT5 A;  2QJV A;  1YIP A;  2XWB B;  4XBQ A;  5FAX A;  4CEW C;  4SLI A;  4MVT A;  1AR9 3;  1JU3 A;  1HDK A;  1F31 A;  2XJQ A;  4QHZ A;  3RG0 A;  3I3D A;  1KJL A;  3I2J A;  1OT5 A;  5LW9 A;  1E5R A;  2RG4 A;  1NLS A;  1AR7 3;  1QU0 A;  4AFD A;  1QJZ A;  2HWE 1;  5FUN A;  1OUR A;  3QH7 A;  2D3S A;  4LUL A;  4A2U A;  4YZ3 A;  2XBO 2;  2R16 A;  2ZGQ A;  2AGS A;  1S1A A;  4EZH A;  1O4Y A;  1DQ5 A;  5H9S A;  4EE2 A;  5FPA A;  5J48 A;  1KQR A;  4CPB A;  3VKN A;  4OLL A;  4MAD A;  4N53 A;  5FQ0 B;  5J1X A;  2VMH A;  4YWA A;  2GC3 A;  5EJ3 A;  3B5L B;  1REE A;  2VZP A;  3III A;  1COV 1;  3MIE A;  4DPN A;  4RHV 2;  4LR4 A;  2YMZ A;  2ZAC A;  4LO8 A;  3C7H A;  2A6Y A;  4CDW A;  2Y0I A;  3PJQ A;  3CF6 E;  2QE3 A;  2GMM A;  1EPW A;  4YW4 A;  1KXG A;  4FTS A;  4Q29 A;  4Y5T A;  2NZ9 A;  4EJR A;  2WJS A;  4LA2 A;  5F2S A;  3VN4 A;  2BVV A;  4JTN A;  4HON A;  1UZ0 A;  4M3C E;  4FTE A;  3HOB A;  3CMG A;  4YNI A;  2B8M A;  5A6Q A;  2FCV A;  2Y6L A;  2BTV C;  3PU8 A;  3Q8B A;  4CEW A;  2PQQ A;  5K7P A;  4A3Z A;  1DYP A;  4N8M A;  1X8M A;  3UGG A;  1AX2 A;  3B9C A;  5C5U A;  2D44 A;  2VW0 A;  1U12 A;  1UZY A;  4WM8 A;  4Y24 A;  3ZXJ A;  4EWD A;  5C9A C;  5KHG A;  3N36 A;  1KDK A;  3DF0 A;  3EBR A;  4JV4 A;  1LOF C;  4HG6 B;  2RDN A;  2VZT A;  3L2H A;  2VOV A;  2ZX2 A;  3NV3 A;  4MHU A;  3H8X A;  4IDZ A;  1LU2 A;  2GN3 A;  3ZPY A;  3PIG A;  1W0O A;  4Q8K A;  1GR3 A;  1WKY A;  2BGO A;  2GC0 A;  4RGA A;  2WYF A;  5DZF A;  3KCX A;  2ORX A;  4R52 A;  3IM0 A;  4Q0S A;  2QZ2 A;  1GSL A;  3V0B B;  1YNA A;  2G1M A;  1UO9 A;  3M1H A;  4Q4X 1;  1FV3 A;  5E89 A;  1NT0 A;  1DG6 A;  3FN9 A;  2BDR A;  4HL0 A;  3AP4 A;  5H9P A;  3DL3 A;  3HN1 A;  1MZ5 A;  2VQA A;  2VW1 A;  2QQN A;  1JOD A;  1DIW A;  3AB0 A;  1R08 1;  4AFA A;  5FY4 A;  1AJO A;  2VM9 A;  1Y9Q A;  1DGW X;  1JH5 A;  5BYN A;  4N90 A;  4Q4X 3;  3JD7 1;  2WL1 A;  4P9W A;  4KG0 A;  5A70 A;  1BEV 2;  3QD6 A;  3AMP A;  2OKX A;  5L9V A;  3S5Q A;  5CIR A;  3LE0 A;  4RA0 A;  2W91 A;  1H9W A;  1LOF A;  1S2E A;  2JKB A;  3HT2 A;  4HAN A;  4OUE A;  1NCQ B;  1QJX 1;  1X36 A;  1A78 A;  3WP3 A;  1OLM E;  3WX5 A;  4R4X A;  4LJH A;  4UAP A;  2XKO A;  3JD7 3;  4E4D X;  3I7D A;  1R1A 2;  4CCC A;  2P6H A;  1SPP B;  1F35 A;  4NO4 A;  1FMD 3;  3QLQ A;  3VD7 A;  2XON A;  4NRP A;  3VGI A;  3SIT A;  4KU7 A;  3ZFG B;  2CU5 A;  1UYX A;  3OUJ A;  4CP2 A;  4K20 A;  3CBN A;  1VB2 A;  2WII B;  2ZHN A;  1US2 A;  2Y60 A;  1TMF 3;  1BLZ A;  2J1S A;  3M70 A;  5DUU A;  4HXC A;  5IVB A;  3O1U A;  1TNR A;  2ZZJ A;  5IAV A;  2VOX A;  3FHQ A;  4FPO B;  2O1Q A;  4IGQ A;  2JDK A;  4L92 A;  1D2Q A;  1QNY A;  2HEY F;  3THC A;  4AED B;  4LLO A;  1MVQ A;  1C4R A;  3CO2 A;  3NO8 A;  3DPR C;  3ACI A;  1WLD A;  3NAP C;  5J7M A;  1RJ7 A;  2DU1 A;  4WVV A;  5FP4 A;  4XOG A;  1RVF 1;  3PUS A;  2YGL A;  4CP1 A;  5I8Y A;  3ENR A;  5FZC A;  3V0B A;  1QH7 A;  2BFU L;  2DFC A;  4BWO A;  2JIC A;  2XQX A;  2B42 B;  1H4H A;  4HKO A;  3CU7 A;  3MV1 1;  4NAO A;  3UES A;  4DEQ A;  5A3P A;  4P00 B;  2X09 A;  1AXZ A;  1D0H A;  4B4Q A;  4DMI A;  3Q8C A;  3QH6 A;  3N9M A;  4GWN A;  2K2S A;  1QJU 1;  1ZRF A;  1H8V A;  3ZFF B;  2ZML A;  3I3E A;  5FZ9 A;  3OY8 A;  4CDX B;  1OBN A;  1YFW A;  1Q8V A;  1ODN A;  2PLV 2;  3TRS B;  4AED C;  5C6C A;  3ZIX A;  3ZXD A;  5LBE A;  4H7M A;  4XW3 A;  3N9O A;  4WZC A;  4YM0 A;  2R06 1;  4COW A;  2WLP A;  3OCP A;  4UBH A;  1ZBE 1;  5FMD A;  2WAB A;  4LBN A;  1XNA A;  2BGP A;  4KG8 A;  5EPA A;  3SMH A;  3ZOI A;  3CHX A;  4HKW A;  4ZZ8 A;  5IYY A;  4URT A;  1NCQ A;  1CX4 A;  5JR7 B;  1O3S A;  1S0I A;  4QWN A;  2DV9 A;  2OYZ A;  3MZH A;  5J98 B;  4BB3 A;  1L3J A;  2Q1Z B;  1L7Q A;  3EQE A;  1R09 1;  1RUC 2;  5FXX A;  1LGC A;  2RE9 A;  2WZ8 A;  4OHW A;  1SPP A;  1U5I A;  2WDB A;  2ZHM A;  4RS5 A;  2X5I B;  3J7N A;  1VRB A;  5EHD A;  3ZFG A;  3B00 A;  3AJZ A;  4Y20 A;  1O8P A;  4DUW A;  2BP6 A;  2VC9 A;  4OI4 A;  3KMH A;  1PNG A;  4CU8 A;  5L7O A;  1G7Y A;  4YFW A;  2VNO A;  5DAX A;  2QQP A;  1QJY 1;  5JOW A;  5LK7 B;  4HBN A;  3HEI A;  1FOD 2;  1HXS 1;  5F1R A;  3K3N A;  3KT7 A;  1W8H A;  3BIW E;  4QDQ A;  4UW6 A;  5DUV A;  2YYO A;  4AED A;  1BBT 2;  1J84 A;  3QAC A;  1RUE 3;  3T1M A;  3WNN A;  4AK3 A;  5AFB A;  3NRU A;  3K51 A;  3IAP A;  4IND A;  3WQ0 A;  1W2A X;  3VDD B;  2J1U A;  4RL7 A;  1HN1 A;  4Y22 B;  2X5I C;  4QGM A;  1QJY 3;  5CAD A;  3UET A;  1W8F A;  2GSY A;  1HXS 3;  5FJH A;  1W6N B;  2ZA9 A;  2R07 1;  4O9E A;  1CJP A;  1W9T A;  2JDZ A;  1N3O A;  4BK5 A;  4TZD A;  5EXO A;  1G9C A;  3MIB A;  5CFC C;  3ZFF A;  1LR5 A;  4Y5Z 0;  1AVB A;  1ULO A;  4S2H A;  4CDX A;  1AR9 2;  5KC6 A;  3HQR A;  1JYN A;  2WS9 1;  3RQ0 A;  2B7Y A;  2R49 A;  4K8R B;  2RM2 1;  4QX1 A;  4MGY E;  4NVP A;  4XBN A;  2MHF A;  1XU1 A;  3R4S A;  4Q2F A;  1WLC A;  2KR2 A;  4FT8 A;  1LUL A;  3SC7 X;  4NRO A;  4V1P A;  1JZ2 A;  1YFX A;  2AYH A;  2OUJ A;  3OPW A;  4GWM A;  3LKJ A;  4F8A A;  4LBQ B;  1VR3 A;  2BWC A;  1RUI 3;  4Y26 A;  4F3J A;  3GHN A;  4P02 B;  1OLQ A;  2JEM A;  1HRV 1;  5F3I A;  3NV1 A;  2HWE 2;  3WHT A;  3P3P A;  3T30 A;  1CZT A;  4CU6 A;  2UY9 A;  4CPB D;  1UIK A;  5CEH A;  3WG1 A;  4E2G A;  1VBA 1;  4A41 A;  1UMI A;  5DG1 A;  4AEK A;  3VZM A;  2CTV A;  1SLB A;  3M2M A;  4BIO A;  1GBG A;  1XQN A;  1PZ8 A;  2VMG A;  4W65 A;  1OVP A;  4B1L A;  1RUO A;  1LES A;  2QQO A;  1K5M B;  3IWZ A;  4RN5 A;  3RWK X;  1SHW B;  2R04 1;  1SDW A;  3POI A;  3KQR A;  1HKD A;  2BVB A;  1MQT B;  2TBV A;  1COV 2;  4XVH A;  5GZE A;  3ZYF A;  3IKW A;  4A42 A;  3I8T A;  1UY2 A;  4JGZ B;  2VBB A;  1G9A A;  3C7F A;  3KT1 A;  1IZ3 A;  4C1X A;  2J1R A;  3HWJ A;  1UNB A;  4BJ0 A;  2FZ1 A;  3VDD A;  2VY0 A;  3IBM A;  3ZFE A;  3N9P A;  2VUD A;  3ZXA C;  1STM A;  3POB A;  1PM7 A;  2B46 X;  2K9Z A;  2OT7 A;  3IMN A;  5EQU A;  5BV6 A;  2HYK A;  2R04 3;  4L2N A;  1QQP 1;  3SKJ E;  1W6N A;  1S0F A;  5LB6 A;  3VBR B;  4AI1 A;  4ATE A;  4UI9 L;  5BXX A;  2NLR A;  4MXW B;  5FMB A;  4LBJ A;  1JU4 A;  1K5M C;  1WW6 A;  3ZXF A;  3GDB A;  5F7U A;  3RNS A;  4AVC A;  5IK7 A;  4Q4Y 3;  4JGZ C;  2CAV A;  4XEZ A;  4ZZ5 A;  1QIQ A;  5FXV A;  1W8T A;  1TEI A;  2DTW A;  3GBG A;  1QQP 3;  1AR6 1;  3ETQ A;  4DY5 A;  1G9B A;  1WD4 A;  1JYC A;  2ILM A;  5IFT A;  3K77 A;  5KHH A;  4EV0 A;  4NR1 A;  4LBL A;  3ZXK A;  1UWW A;  5JOZ A;  3MLL A;  4AGR A;  1ODM A;  4HFS A;  1CPM A;  4Q0P A;  4OHY A;  1J83 A;  3VBR C;  5BNP B;  3J9S A;  2PXJ A;  2OS2 A;  4LBQ A;  4YVW C;  5A7O A;  4Q4X 2;  2IVJ A;  2ZGK A;  4P5H A;  5EP9 A;  1BK1 A;  1XB9 A;  3S57 A;  2ARC A;  5JPN B;  4B4P A;  1DLL A;  4J6G A;  1UN1 A;  2WFF 1;  2XR4 A;  4FOV A;  2IC1 A;  3KS7 A;  4MHR A;  1HV0 A;  3IZO A;  1W8N A;  1GNZ A;  2VZV A;  4R4Z A;  3UK9 A;  4AI3 A;  2DDU A;  4DRR A;  2BOI A;  4KL1 A;  1JZ7 A;  1R08 2;  1AZD A;  3POE A;  4MSV A;  4PCR A;  1UU5 A;  1O3T A;  1I9R A;  2LAL A;  3I4I A;  3C2U A;  3W58 A;  1GIC A;  1VBC 2;  4D6R A;  1BVP 1;  1TE1 B;  2E26 A;  2Q8E A;  2QQU A;  1NAE A;  1OOP B;  4LHK A;  1Z7S 2;  1K5M A;  3LSE A;  4GWJ A;  4JAA A;  2JXA A;  2YBK A;  4PHZ A;  3WLU A;  5IK4 A;  2WFF 3;  1E5H A;  2NP0 A;  5FZO B;  1MQT A;  2QBX A;  3CDZ B;  4IL7 A;  1GFF 2;  1PZ9 A;  2VBD A;  1QJX 2;  4CEY C;  1QXP A;  4ATF A;  2YC4 A;  5LA0 A;  2VME A;  2ZEX A;  4NII A;  3JUU A;  1JYT A;  3RZK A;  2QUO A;  4HSL A;  5M0T A;  4QKF A;  1BZW A;  2Y38 A;  1RIN A;  4XAE A;  2UYB A;  3AVR A;  1RYY A;  1O8S A;  4AQ2 A;  4P9X A;  2H6B A;  4FAG A;  2RMU 1;  4FXK B;  2W95 A;  4HN1 A;  4DB5 A;  1W04 A;  2WZE A;  4MXW A;  3C3V A;  4CRQ A;  2V4A A;  2D3R A;  2FHR A;  3HJR A;  1J3Q A;  3MYX A;  1RHI 3;  1RUG 1;  5I0T A;  3JQX A;  5CIS A;  3ZN6 A;  2K46 A;  1PX3 A;  4YM2 A;  2BUK A;  5A80 A;  4TWT A;  1H1M A;  1NZC A;  3AZW A;  4YGC A;  5C3S A;  1I5Z A;  5CG8 A;  4XFI A;  1ND3 C;  4NRQ A;  4AI8 A;  4I02 A;  1RVF 2;  3OGR A;  4XXP A;  5J3U A;  4IE0 A;  4HVQ A;  4UBG A;  1NZI A;  2VE1 A;  2WR9 A;  4MYE A;  4YW5 A;  2YU2 A;  2W68 A;  5BNP A;  2XML A;  3AKT A;  4NHK A;  1JUI A;  5JDB A;  2QVS B;  5GLU A;  2VZR A;  3W5N A;  3P5B A;  3RDI A;  1QJU 2;  4XPV A;  1VAV A;  1UY4 A;  2LM3 A;  3G6J B;  4BH9 A;  3VV1 A;  1X50 A;  3VBH A;  5KXE A;  3HNM A;  3ZVX A;  4NWV A;  3C7G A;  1GQG A;  3BUC A;  2R06 2;  5A3T A;  1F5J A;  1SG3 A;  1ZBE 2;  1OOP A;  1MZ6 A;  2ZGU A;  1CR7 A;  1SMV A;  4XFF A;  4XMI A;  2PEL A;  3B01 A;  3OGG A;  4QPI C;  1ZBA 1;  5FZO A;  1DBN A;  3ZN4 A;  3T3Y A;  3BB6 A;  5IVJ A;  3ZSL A;  1RUD 1;  1AYM 1;  1VP6 A;  5LK5 A;  4GH4 B;  2XJT A;  5JXI A;  3U11 A;  3RZL A;  3AMN A;  3JU9 A;  1QDO A;  1UMZ A;  4CA9 A;  4YPJ A;  3J8F 1;  5FZD A;  1NA1 C;  1WMX A;  1R09 2;  4Q0V A;  4MGK E;  2GC1 A;  4B4R A;  4LTA A;  1CAU B;  4NPM A;  4YG3 A;  1AYM 3;  2IXJ A;  4HZF A;  4IEW A;  3SIS A;  5C7G A;  4QB2 A;  5CAZ A;  1NYW A;  2IXC A;  4DEV A;  3THD A;  3UT0 A;  3BTY A;  2RJL A;  5JXG A;  4X6R B;  1NCR C;  2HWD 2;  1E5I A;  3VKM A;  2SLI A;  3CJI C;  1QNW A;  4GH4 C;  4M3C B;  3VL8 A;  4UYB A;  4LKE A;  4PT6 A;  2W92 A;  3B9I A;  3LDB A;  1ZZ8 A;  2WO1 A;  4CZS A;  2PAE A;  1PVC 1;  1TME 1;  3ZYR A;  4C8D A;  5KXB A;  1RUH 3;  4YLZ A;  4ZXE A;  5JI7 A;  2X05 A;  1HJF A;  2YUE A;  4FPH A;  1N3Q A;  1YQ8 A;  5T5O A;  1AR8 1;  4Z07 A;  1VB4 A;  2YXS A;  1H2K A;  4QD2 A;  3UGF A;  3MPB A;  4FOY A;  3N9L A;  2B9U A;  1SDD B;  4CCM A;  4MET A;  3WT3 A;  3WW4 A;  1DF0 A;  1RUJ 1;  3ZPO A;  3E5U A;  1ULF A;  2R07 2;  4AQS A;  1M4W A;  4WVZ A;  4OCT A;  5FP7 A;  1PVC 3;  5F6L B;  4AI2 A;  4Q1P A;  1H2N A;  2YDE A;  5KR7 A;  3ZSJ A;  1H2M A;  2BNO A;  4GD4 A;  1AR8 3;  1GV9 A;  2JG8 A;  1A6C A;  2W08 A;  2WS9 2;  1SLI A;  1S0D A;  3UKV A;  3W21 A;  4XF3 A;  4XUR A;  2FD8 A;  1CWP A;  3BVC A;  2RM2 2;  4E9K A;  4CXW A;  2Y6K A;  3ZSE A;  3ZYP A;  4QX2 A;  2KA3 A;  1HB1 A;  1XPW A;  3FE5 A;  3ZXG A;  2I45 A;  3OUI A;  5I0S A;  1HQL A;  1XXN A;  4GH4 A;  3A4U A;  3BTX A;  3T1L A;  1WCS A;  4XC9 A;  1UYY A;  4GXL A;  3OGS A;  4QKB A;  4EZ4 A;  1JW6 A;  3VBO B;  4QX3 A;  3TNQ A;  2ORZ A;  4YG6 A;  4AHW A;  1HRV 2;  1ZM1 A;  1FT9 A;  3H8U A;  4YFZ A;  3T0D A;  1LHW A;  3AP9 A;  4RQP B;  1DDL A;  2B45 X;  3KV9 A;  4E27 A;  3HQU A;  3G7D A;  1WMF A;  1PK6 B;  1VBA 2;  5I8T A;  1C5I A;  2WBK A;  5FXZ A;  3I2F A;  2WZR 1;  3KWV A;  1KRI A;  2W2I A;  2ZX3 A;  3WNM A;  1W9F A;  1GP6 A;  1EAH 3;  3I54 A;  1N47 A;  1VMH A;  3FZ3 A;  4HSJ A;  5HXV A;  5CG9 A;  3KV4 A;  4FP3 A;  2XHK A;  4FPF A;  4OZX A;  3VBS A;  1C8M 1;  5BNQ A;  3HMY A;  3M3O A;  2WZP P;  3SH5 A;  2YPJ A;  4GB3 1;  3VBO C;  3PVO A;  1QXR A;  1HRI 2;  1MVE A;  1OKQ A;  1ND2 A;  2JG9 A;  1X82 A;  4MGQ A;  3I2G A;  3WW1 A;  1XRU A;  3HR9 A;  5I0R A;  4LMF A;  1PK6 C;  3AYC A;  2PHD A;  1V6M A;  2CNA A;  1VBE 1;  2ADD A;  2XVK A;  4URA A;  5FZ8 A;  3LA7 A;  3RYR A;  1C8M 3;  1PIV 1;  4MXV A;  2L9L A;  4HN0 A;  5D1I A;  3FUO A;  1GWM A;  2JX9 A;  1DGR N;  3N9Q A;  2ZXQ A;  4AQ6 A;  3NST A;  3ZN5 A;  5IUQ A;  2DUR A;  2R1B A;  1MZE A;  2EIE A;  2VH9 A;  5LWB A;  3VHO A;  1T6B X;  3WEZ A;  1APN A;  2WC2 A;  1DZT A;  1YFY A;  1OF3 A;  1VBE 3;  4LKF A;  3GZT B;  4BQ2 A;  4JGY B;  5HPO A;  2D98 A;  1AR6 2;  3KSC A;  3BAL A;  4HPK B;  4TYS A;  4LBQ D;  3H7Y A;  3TBD A;  1MZF A;  1VBB 1;  4I0W B;  4XQ4 A;  4E8D A;  3H42 B;  5F5I A;  4AVB A;  2GP3 A;  5LRR A;  2B9V A;  5LZ6 A;  4IEO A;  1U0A A;  3GYD A;  3INA A;  1BQP A;  5GAL A;  3WZ1 A;  5EYX A;  1JYV A;  2YU1 A;  1HQW A;  3VBO A;  4BPZ A;  2JE9 A;  4LK7 A;  4FFH A;  4J1X A;  5F5A A;  1SCS A;  1FPN 1;  2XLF A;  1PO2 2;  4TLG A;  2VTX A;  2ETE A;  2HWB 1;  5E8A A;  2ZGS A;  4PQQ A;  4RQP A;  5FYM A;  3O1T A;  1A34 A;  5FZ7 A;  4LNV A;  4PDW B;  1GZT A;  1XE8 A;  2BBA A;  1IS4 A;  4FO9 A;  3D8C A;  3AZX A;  4JGY C;  4XHB A;  4DNY A;  2V09 A;  5CKQ A;  4OZO A;  4CUA A;  2XDV A;  4PLM A;  1VRH 2;  2GH2 A;  1YI7 A;  2ZOE B;  4CCE A;  2P5B A;  3NKT A;  1EYB A;  5ACA 1;  3PME A;  3I2O A;  2XJV A;  4Z2A A;  2Q8O A;  1IPS A;  5F9T A;  1WW7 A;  3KQ4 B;  3S30 A;  4Q0Q A;  3WG3 A;  4YSF A;  1UQX A;  3BTA A;  1W8O A;  4CE8 A;  2IXK A;  2YBS A;  3HQX A;  2WWJ A;  2RR1 3;  5GLV A;  5FOJ B;  4PDW C;  1C1F A;  1HX6 A;  1V6L A;  3AXD A;  2IVI B;  4QKD A;  4V2V A;  1C1L A;  5KXD A;  2Q8D A;  1MAC A;  3O1O A;  1NE6 A;  1DGW A;  4IER A;  1QHD A;  2RMU 2;  5FY8 A;  3OB8 A;  3VKL A;  3WDT A;  3PVE A;  2J22 A;  2WQ4 A;  5FLJ A;  1HIX A;  4QB6 A;  1UOB A;  4FI9 A;  4B3N A;  3OYW A;  2GH8 A;  5DUW A;  3SH3 A;  3WQB A;  2MEV 1;  2VNV A;  3VUO A;  3RZM A;  1DFQ A;  1O4T A;  1RUG 2;  1NQD A;  2C9K A;  5CKN A;  2OUH A;  4N53 C;  3GZE A;  1TQ5 A;  1NE4 A;  3TB0 A;  2A3Y A;  4HK8 A;  3VBF B;  3IDB B;  4Q4W 1;  3N7J A;  1NY7 1;  2C5D A;  3H50 A;  1PVX A;  3J7L A;  4HPK A;  1W3V A;  4DY3 A;  2GME A;  1ASJ 3;  1SZB A;  2HH9 A;  3DUI A;  2VJX A;  3AZY A;  4CDW C;  4M4R A;  5FYS A;  4JDN A;  5FP8 A;  1AR7 1;  5D21 A;  2DCZ A;  5HI0 A;  1SAC A;  4MO3 M;  5DQ0 A;  5JSR A;  4I3G A;  3I59 B;  5C33 A;  1VIW B;  1G6N A;  3M3E A;  3TN9 1;  2VL4 A;  3RZH A;  1PHM A;  5F3C A;  1UOF A;  5IAT A;  2PHU A;  1UKG A;  2RHP A;  3GM8 A;  1K3I A;  4PDW A;  1ULC A;  1AXY A;  1W0P A;  3IAQ A;  3LEI A;  2XVG A;  1IS3 A;  2DYC A;  2J1V A;  4WM8 C;  3VZK A;  4K1Z A;  5FZA A;  3VDA A;  3RWN A;  2DVB A;  4FTB A;  2ZX4 A;  3PMS A;  1OPO A;  1CES A;  2V5Y A;  4L9B A;  4AHY A;  3WHU A;  2ZAH A;  3TEW A;  2QDR A;  3ABZ A;  4U2A A;  3RSJ A;  3TN9 3;  4Z2W A;  4QGL A;  4YZ1 A;  2F17 A;  2RS5 3;  2ZGT A;  1RED A;  1ZBA 2;  4LKS A;  4NN0 A;  5A1F A;  5GZG A;  3FJS A;  5LAT A;  5KHI A;  5B4N A;  4XTP A;  1RUD 2;  4PLO A;  4Q1R A;  2ZPX A;  5FZG A;  4UW3 A;  1KFU L;  3S5A A;  1RB8 G;  1SBD A;  5K8S A;  4Y1Z A;  1MS8 A;  1BKZ A;  1XNK A;  3KV5 A;  3I2I A;  4QPY A;  1ZRC A;  5JSP A;  5CKM A;  3D6E A;  3J8F 2;  3OBZ A;  4I0B A;  1Q8P A;  1VAL A;  1Q8Q A;  1C28 A;  3AC0 A;  2ZJC A;  3H1M A;  2P34 A;  3H8O A;  4X6Q B;  1S2K A;  2XUM A;  1UAI A;  4IE5 A;  5D2A A;  2JKX A;  2GND A;  5HCB A;  4XQW A;  4JVA A;  5BY5 A;  1S0G A;  2RS1 1;  1H1I A;  2ID4 A;  3AVS A;  2E31 A;  2P2K A;  4DZG A;  5KWR A;  4CCJ A;  3I3B A;  4UXA A;  2Y6H A;  2B5H A;  2PHR A;  5GZF A;  3BN6 A;  4M01 A;  4Q0U A;  3SCH A;  4CUC A;  5LEK A;  3LA3 A;  5DAW A;  3VBF A;  3VZO A;  4S2G A;  3H3L A;  4LIU A;  1TME 2;  3AYE A;  2Z2S B;  4PF5 A;  1AL0 G;  4Z82 A;  3VL9 A;  5T52 A;  3BU0 A;  3DEC A;  2RS1 3;  2Y6F A;  1IPK A;  4FXG B;  4QX0 A;  5H9R A;  1W8U A;  5JSO A;  4U36 A;  4RGK A;  2AEY A;  5A7S A;  2UUR A;  1RTV A;  2VQT A;  3QBQ A;  3VHP A;  4BOW A;  2WA4 A;  1ZZ9 A;  5FYZ A;  1RUJ 2;  3I59 A;  4H2A A;  1X7N A;  1PGW 1;  1GZC A;  2WKK A;  3ZXE A;  4CCK A;  5TSW A;  3OBA A;  4EYU A;  3H1W A;  3O7O A;  3WP5 A;  3I49 A;  5IW0 A;  5JCT A;  2HBT A;  2V5D A;  2Z79 A;  1W05 A;  4CP0 A;  3VDB A;  4ZU5 A;  4B8E A;  1YQC A;  2PHW A;  2W1W A;  3NJZ A;  3U4X A;  1POV 3;  3WDY A;  3OY8 B;  3CIH A;  5F39 A;  4BME A;  4LOS A;  4BQ5 A;  1X8E A;  1ONA A;  4TSV A;  1FAT A;  1JHN A;  1KDM A;  4LIT A;  1EV1 2;  2QQJ A;  3VDC A;  4AVA A;  4F83 A;  3BPS A;  3FHI B;  3M3Q A;  1RJ8 A;  2VZO A;  1OH3 A;  2D7F A;  3ZMO A;  1UXZ A;  3T2Q A;  5LBB A;  2A3W A;  3ELN A;  2XJP A;  1FMD 1;  3WOG A;  5FYC A;  4QX7 A;  5J09 A;  3V64 A;  2Y26 A;  2FCT A;  2JDH A;  3OGJ A;  4AAX A;  1ZRE A;  3D3A A;  2EAL A;  1F4A A;  1S0C A;  2D93 A;  2YFU A;  2G4I A;  4KQ7 A;  4GWI A;  2I2S A;  1N3P A;  1OF4 A;  1QOS A;  2UWA A;  3H3U A;  3AKR A;  3HNB M;  5CVR A;  2GNB A;  2WZR 2;  4QXH A;  1TMF 1;  5EWS A;  2G19 A;  1QGL A;  5CYY A;  3QCW A;  1CN1 A;  1H6X A;  1R64 A;  4KBB A;  4R9B A;  5EFU A;  5FWE A;  2P4E A;  2VTX J;  2W94 A;  3LWC A;  2W1S A;  4KU8 A;  1Y9G A;  4N43 A;  4RS5 B;  1Q8O A;  1UD1 A;  1W9Y A;  3WIN E;  2D40 A;  4XAC A;  3ZMN A;  4A7Z A;  5C3Q A;  5CNA A;  2BZD A;  1H30 A;  4Y20 B;  3URF A;  1W6P A;  4ISQ A;  2QFE A;  5A1L A;  1QMJ A;  2XL9 A;  4GB3 2;  3LEK A;  5L7O B;  1ZRD A;  3POF A;  4FAH A;  3ILR A;  4UW4 A;  1YQ6 A;  1T2X A;  4P9G A;  1OI6 A;  4ITC A;  1NCQ C;  5AC9 3;  3CNA A;  4YGD A;  1V00 A;  2EAK A;  1DU3 D;  4PBO A;  4EWE A;  1S2B A;  2E53 A;  4CDU B;  4AR2 A;  1PIV 2;  2JIG A;  4UFI A;  2H0B A;  1LHU A;  4RS5 C;  2JEN A;  2QDN A;  3RJ2 X;  4IE7 A;  3GJA A;  1GNH A;  2XJS A;  5LA2 A;  3ZFG C;  1BMV 1;  1F5F A;  4UFJ A;  2Y6G A;  2ZHK A;  3OSD A;  4XTM A;  5L7O C;  1LAJ A;  1V6I A;  4NJ4 A;  1UMH A;  1PGL 1;  1JOJ A;  5I8S A;  2YG0 A;  1J3R A;  1D4M 3;  2DUQ A;  3DEM A;  1BHG A;  2ZGO A;  5LCW L;  4PI2 A;  4NIG A;  1MS5 A;  4XQD A;  1R1Z A;  5D8A A;  5FK8 A;  1JYX A;  2A7A A;  3ILN A;  1VBB 2;  4AFB A;  1JTZ X;  4W6X A;  5LBC A;  4YGB A;  4O65 A;  1WW5 A;  2ZZQ A;  1LEC A;  2VNR A;  3PNA A;  1O7F A;  4K9S A;  5JLV A;  1MEC 3;  1EUT A;  1JS9 A;  5A3O A;  3LCP A;  4E4Z A;  5EIY B;  3VHN A;  1FPN 2;  1L7R A;  1GYK A;  1UX6 A;  3KGL A;  2HWB 2;  4XFC A;  4D7T A;  5LEJ A;  4DXS A;  3ASI A;  4JQT A;  4WZF A;  5C5T A;  1S0J A;  5A3W A;  2ZX1 A;  5EYY A;  1IKQ A;  4LBK A;  4AVV A;  3ZFF C;  5ABJ A;  4XDQ A;  2BU9 A;  3N9N A;  3WR0 A;  2WAA A;  4CDX C;  2EF6 A;  1YLL A;  4NID A;  5FMC A;  3KVA A;  3FLP A;  4NMI A;  5FZB A;  3A23 A;  5ACA 2;  1RUE 1;  2PQS A;  4LXL A;  1JYI A;  1Q5O A;  2GP5 A;  2ZEW A;  2B4K A;  3D0S A;  3NWK A;  1NXD 1;  3Q9O A;  4AW7 A;  4ES9 A;  4S2F A;  1SLA A;  3HPN A;  1QKQ A;  3H3Z A;  1T6G C;  4NWW A;  4PIX A;  3SH4 A;  2IZW A;  2VD7 A;  2XG3 A;  2EXJ A;  1MS4 A;  5G05 L;  1CZV A;  1WLW A;  1YCI A;  1Z78 A;  4CDU A;  4E2S A;  4FOQ A;  1N1T A;  1UY0 A;  4LBM A;  3ZFE B;  4QQL A;  3PU3 A;  4UFH A;  5JAX A;  4A3X A;  4NE9 A;  5J37 A;  4AVS A;  1S55 A;  1V6O A;  2MEV 2;  1XSR A;  4Y1V A;  4YW6 A;  4H7L A;  3U37 A;  2WNV B;  1SFY A;  3A0N A;  3BU7 A;  3F2Z A;  4Q4W 2;  1WBF A;  4AG4 A;  1NY7 2;  3CQO A;  1B35 B;  4ZS3 A;  5LY1 A;  1NX9 A;  2RS3 3;  2ZGN A;  2RDQ A;  2XGX A;  4PIZ A;  5T55 A;  4OQ9 A;  3AMH A;  1OD5 A;  1RUI 1;  4XXA A;  2YV8 A;  1L7L A;  3NV2 A;  2GMP A;  4LLF A;  3T09 A;  4PF1 A;  1AR7 2;  1RUF 3;  1ENQ A;  3VDD C;  3ZFE C;  4CUB A;  3PUR A;  4XUP A;  5DAV A;  1FNZ A;  2A3X A;  1WCD J;  3RJR A;  4YG0 A;  1GOH A;  3WF3 A;  3U07 A;  3O5S A;  3AZZ A;  2EAA A;  3ME2 A;  4LO4 B;  1VAK A;  2PHT A;  3TWI A;  1WLT A;  2ZBJ A;  2VXJ A;  3ACH A;  3ZDS A;  2BFU S;  4P9L A;  2ET1 A;  3M8L A;  2ARA A;  4QU1 A;  3RZJ A;  1CAX B;  4ASM B;  1H6Y A;  4PI0 A;  1CJD A;  3MI8 A;  4OI0 A;  2OQ7 A;  1LEN A;  2FQP A;  3WDX A;  3WDU A;  3WW3 A;  1LGB A;  4JKM A;  1MS3 A;  1SCR A;  2GU9 A;  1ULD A;  2W0X A;  3LAG A;  4QU2 A;  5FZM A;  4QXC A;  4XZU G;  3MW4 A;  2W5F A;  1YJL A;  2HWC 3;  4BYY A;  4BXF A;  5BNN B;  3KGZ A;  3WXP A;  1XE0 A;  1BYH A;  2EIG A;  3ZR6 A;  3HBZ A;  2XVL A;  2XOM A;  2VMI A;  3K4D A;  2C4X A;  1PMH X;  3BOW A;  3PTR B;  4IUG A;  1ULE A;  1W9S A;  2GAU A;  1DZQ A;  4XUN A;  5FYY A;  4IV1 A;  5CFD B;  1DYK A;  2QNK A;  4Q4Y 1;  3B69 A;  3N7K A;  3MFC A;  3UJQ A;  1K45 A;  2WQZ C;  3DV8 A;  3ZSM A;  2WNU B;  1UCX A;  4WBB A;  1OH4 A;  1PO1 3;  4YRD A;  3VBU B;  2WNO A;  2WNV A;  1JUH A;  2ZX0 A;  1W2U A;  3FL7 A;  3I3Q A;  3MEP A;  4P9J A;  3BTZ A;  1UYZ A;  3C8X A;  4QT6 A;  2Y0O A;  1MQT C;  2DWR A;  3ZX7 A;  1B35 A;  1YRZ A;  1RMU 1;  3ZN6 B;  5KBF A;  1BK0 A;  3AYA A;  4K7J A;  2VG9 A;  5B4X A;  2YRO A;  1EP0 A;  2AAC A;  5T5L A;  4KWU A;  5CFD C;  4R8H A;  2CWM A;  4FQ4 A;  3RPQ A;  2ZS6 B;  4EQV A;  4I0A A;  3ZIW A;  1PGW 2;  4P9Y A;  4LOT A;  5FBJ A;  2ADE A;  2WNU C;  1AJK A;  1F2N A;  4S2D A;  1RMU 3;  1OMI A;  2PN5 A;  2P3K A;  3NNG A;  3ROU A;  3H7J A;  4ONU A;  5FKB A;  2E7T A;  4CSW A;  2VCC A;  3O1V A;  1CAX A;  1K42 A;  4KWL A;  2LS6 A;  1WA6 X;  3FFQ A;  4YW7 A;  2LUW A;  4GQ7 A;  4I30 A;  1RL3 A;  2ENR A;  2WT1 A;  4Y1U A;  1CQ9 A;  3VBH B;  2LRP A;  5DDJ 3;  2EIB A;  4DXR A;  2Q30 A;  2D6K A;  3A22 A;  3I2K A;  3JD7 2;  5GZD A;  5JOY A;  4BIS A;  4GKX A;  3T2P A;  1NG0 A;  3AP5 A;  5BNN A;  2BER A;  4GMP 3;  5BNP C;  1DQ1 A;  1FMD 2;  3JXS A;  2WLQ A;  3PUA A;  5IJR A;  4W6W A;  4FOW A;  1ULP A;  1W0N A;  1GU3 A;  4J1W A;  2VVD A;  4I2O A;  2VQ0 A;  5CFD A;  1TMF 2;  1RHI 1;  1V9U 3;  1VBD 1;  4OYU A;  5FOB B;  3LEM A;  4P5Y A;  3VBH C;  4B7E A;  4AYU A;  3DKW A;  3ZYI B;  2WNU A;  3MF6 A;  4XIL A;  5HV4 A;  1OHF A;  3O1R A;  1OA3 A;  2VO5 A;  5FO9 B;  1AL2 3;  1UX7 A;  4XYX A;  1YI9 A;  1DQ4 A;  5FLH A;  3VBU A;  1OOP C;  1RXF A;  5JZG B;  3UKT A;  3PHM A;  4QMA A;  5CU1 A;  1I3H A;  1HB4 A;  4XZP A;  5A7N A;  4ZXK A;  2VCM A;  1VMJ A;  1J58 A;  1GZW B;  2CHH A;  1VBD 3;  4Y33 A;  4N7I A;  2DBI A;  1SFP A;  1UZZ A;  2EXI A;  5IFP A;  3LOI A;  4CVU A;  4L97 A;  4AQT A;  1DQ6 A;  5JIA A;  2VTF A;  3WW2 A;  2DCY A;  2WYS A;  4QQ2 A;  3SXW A;  2BPA 2;  1ZX5 A;  5B2G B;  3GCX A;  1AYN 3;  3POS A;  2JD4 A;  3O12 A;  3KCY A;  3T4V A;  4D0Q A;  3SCG A;  4XJW A;  1OC1 A;  5JZG C;  3AMQ A;  3B3Q E;  2Y34 A;  2FDF A;  1PGL 2;  1US3 A;  3WQ7 A;  1W6Q B;  4OUM A;  3USS A;  2ZMN A;  4W6Y A;  3I2H A;  2YHJ A;  3LZZ A;  2JG8 B;  2OPW A;  4M0H A;  1JN2 P;  4JKK A;  1GKB A;  4DXT A;  1OLR A;  4XET A;  4XUO A;  3WUD A;  4R9C A;  2AR6 A;  1XU2 A;  1TVG A;  2OXB A;  3POY A;  4LO6 B;  3H0O A;  4TN7 A;  4AFM A;  3WNL A;  2QQK A;  2CY6 A;  1XOY A;  4HKL A;  4E4H A;  1F15 A;  1EY2 A;  2XB6 C;  5FY7 A;  3UGH A;  5K0U B;  3EJK A;  3VD9 A;  3KVB A;  1H8T A;  3O0V A;  2TEP A;  2CAU A;  2R6Q A;  5FPB A;  2PHF A;  2BRT A;  4BLJ A;  1ZNP A;  1SLL A;  1V6J A;  4XAB A;  4BCU A;  4FPK A;  4KH9 A;  1O5L A;  3P6B A;  3Q8F A;  5E88 A;  4RR3 B;  3UJO A;  1NQJ A;  2JG8 C;  1C8N A;  1S4C A; 
#chains in the Genus database with same CATH homology
 3BIE A;  3I2O A;  4OCT A;  4IE4 A;  4JHT A;  3I49 A;  4RFR B;  4NII A;  3RZK A;  4QHO A;  4QKF A;  4QKD A;  2FD8 A;  3O1V A;  3O1O A;  4CXW A;  3KHB A;  4NRP A;  2FDG A;  3I3M A;  4NRO A;  4O7X A;  3BTX A;  3T4H B;  4QKB A;  3RZM A;  3O1U A;  4NIH A;  4IE6 A;  4ZS3 A;  4NRQ A;  4IE0 A;  5DAB A;  3KHC A;  3O1P A;  3O1S A;  3O1R A;  3RZH A;  4NRM A;  5F8P A;  2FDJ A;  3BUC A;  3RZJ A;  3T3Y A;  3BI3 A;  4O61 A;  4IE7 A;  3S5A A;  4CXY A;  3T4V A;  3O1M A;  3RZL A;  4QKN A;  3H8R A;  4NJ4 A;  2FDF A;  3H8X A;  4IDZ A;  4NIG A;  3H8O A;  4NPM A;  4IE5 A;  4CXX A;  3BTY A;  2FDH A;  3BKZ A;  4ZS2 A;  3RZG A;  4ZHN A;  4NPL A;  3S57 A;  2FDI A;  2IUW A;  3BTZ A;  3I3Q A;  3O1T A;  3LFM A;  4MG2 A;  3BU0 A;  4MGT A;  2FDK A;  4NID A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...