3BU0A

Crystal structure of human abh2 cross-linked to dsdna with cofactors
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
203
structure length
203
Chain Sequence
SWRHIRAEGLDSSYTVLFGKAEADEIFQELEKEVEYFTGALARVQVFGKWHSVPRKQATYGDAGLTYTFSGLTLSPKPWIPVLERIRDHVSGVTGQTFNFVLINRYKDGSDHIGEHRDDCRELAPGSPIASVSFGASRDFVFRHKDSRGKSPSRRVAVVRLPLAHGSLLMMNHPTNTHWYHSLPVRKKVLAPRVNLTFRKILL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-ketoglutarate-dependent dioxygenase alkB homolog 2
publication title Crystal structures of DNA/RNA repair enzymes AlkB and ABH2 bound to dsDNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/dna
total genus 52
structure length 203
sequence length 203
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2007-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13532 2OG-FeII_Oxy_2 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 3bu0A00
3LFMA 4MG2A 4NRMA 3I49A 3S5AA 5F8PA 4ZS3A 4QKFA 3O1RA 3RZMA 4IE0A 3I3QA 4IE4A 4OCTA 4QKBA 3O1MA 2FDIA 3H8OA 3BTZA 3H8XA 4O61A 3O1VA 4QKNA 2FDFA 3BIEA 4CXXA 3BTXA 3RZJA 2FDJA 3RZKA 3T3YA 3O1PA 4NIIA 4RFRB 4IDZA 3BUCA 3KHCA 4CXYA 3O1OA 3BU0A 4JHTA 4NPMA 4IE5A 3I3MA 3T4HB 3RZLA 2FDHA 2FD8A 3BI3A 3O1UA 4NJ4A 4IE6A 3KHBA 2FDKA 4NRPA 3RZGA 4ZHNA 2FDGA 4QKDA 4ZS2A 4O7XA 3H8RA 4NRQA 2IUWA 4NPLA 3O1TA 3S57A 4CXWA 4NIHA 3BTYA 3T4VA 4NIGA 4NROA 5DABA 3BKZA 3I2OA 4MGTA 4NIDA 3O1SA 4IE7A 4QHOA 3RZHA
chains in the Genus database with same CATH superfamily
4N53B 4WM7C 3BN6A 1OPOA 4C0BA 2SBAA 3B3QE 4UAPA 5FP3A 3WP6A 4LO5B 5KR7A 4CCNA 3UJQA 4ZPIA 2GC0A 1CONA 3MLKA 1C3HA 4N43A 1RUE1 1BYHA 3ASIA 3PU3A 2ET1A 5I0DA 5BPXA 3PUQA 4MZUA 2R1DA 1JW6A 4YVSC 2VOTA 1B35A 4Q27A 4XAAA 4CDWC 4P9JA 2D93A 1SPPB 4XF4A 2HWF3 1R093 4FPLA 4IE0A 1CJDA 1X9TA 3O5SA 3TWIA 4D6SA 5A6XA 1AJKA 5KXBA 3M1HA 2A6YA 5F39A 4BMEA 1HLCA 4YG6A 1VBE3 2BGOA 3ZN6A 4YGBA 2RJLA 4EE2A 1BBT2 2ZOEB 2Q30A 5A1FA 1YYNA 3VBSA 5FMBA 1O5LA 5A7NA 3RDIA 4YM0A 3RQ0A 4X8NA 3HN1A 5CFDA 3IMMA 2DFBA 2QQIA 4QD2A 1ZM1A 3CNAA 1O3SA 4XETA 2IWGB 4QKNA 2IXKA 3VBRB 4Z2WA 3DF0A 3RYRA 3BIEA 4YFWA 3T08A 3NVCA 4FCAA 4IEOA 2GALA 2JENA 3C8XA 4MXWA 3O1PA 2X10A 1QMJA 1BMV2 4Z1VA 5DQ0A 3KD4A 3EB7A 4AYUA 1DCSA 2IFRA 1SG3A 2BBAA 4PHZA 1XE8A 4D3WA 2ADDA 2RHPA 5KBFA 4N8MA 1WD3A 3VBOC 1W9FA 5A7PA 3TOJA 4CA9A 2VNOA 1AR61 4AI8A 4GQ7A 3HNYM 3BGAA 2G19A 4YSFA 1K42A 4DUXA 1GYKA 1OOPB 1LRHA 4AI2A 5B4NA 4YPJA 2A3YA 5C5TA 2VZVA 2D6OX 2R0HA 4M3CA 1HXS3 3W5NA 1NKGA 4P02B 4L99A 4DINB 1H2KA 1MQTB 1SACA 3IWZA 4A3ZA 5JOZA 1UU5A 4FXGB 4XBQA 2AC1A 3OGVA 1BQPA 4GMP0 1ZBA2 4AGGA 4A42A 4IEVA 5K0UC 2GH2A 4Y1UA 3DPRA 1ALYA 1OUXA 4LO8A 5JZGC 1QEXA 4GMP3 4PI0A 3HAGA 1ND3B 4BE3A 1OQDA 1QWRA 1H8VA 1AL22 3UNPA 2WQ4A 4KWJA 4NPLA 2W5FA 1RL3A 4PDWA 2XWJB 2GSYA 4Q4W1 1CJPA 4RQPB 1SEFA 1Q5OA 4QQPA 2WUHA 4K8RB 5KHGA 1F31A 5A7QA 1IHMA 2LM3A 3BPZA 3DKWA 5FK7A 1VMHA 5BV6A 2MNGA 3CDZB 4QM9A 1LENA 3SNMA 3MICA 3X29B 4EWDA 1UYYA 3H7YA 3OEBA 5F37A 3ZKUA 3O0XA 1QH7A 2GAUA 3ZMNA 5CFCB 2E7AA 4GH4A 4N43B 2D6PA 3A0KA 5FP8A 5JLVA 2QVSB 2O8OA 4N7UA 1PM7A 2XBO2 4LLOA 2ZX1A 4CEYB 1LHNA 3NNMA 1RIRA 3NW4A 1U5ZA 4OI0A 3JU9A 2YY1A 4ZU4A 3O1RA 1LU2A 1EAH1 1PGW2 4E2QA 3RZMA 1R1A1 2GMMA 3ZXFA 4EWEA 4E4HA 3DYMA 3D5OA 2Q0AA 3RJRA 2R073 3NJXA 1CAXA 1COV1 4LBQD 4LEJA 3VBSB 3LPFA 3ZYIB 3VD5A 1E5HA 3VD7A 4AVSA 4A4AA 1U5YA 1GZCA 1X8EA 4XJWA 3ZM8A 1GBGA 5SV8A 4MX3A 5ACA1 3VBUC 2VQAA 4IQPA 4URTA 5F32A 5BNPC 1DG6A 1GQGA 2PAEA 3MUZ1 3J7MA 2W94A 4MXVA 3WD5A 1RMU3 5LBEA 5J3UA 1WCUA 1CAWA 2OA2A 4FFHA 4KGGA 5F3GA 2D3PA 1LOAA 1DQ5A 1WUVA 1RVF3 2C4XA 2WSUA 3ATGA 4MXWB 1SLBA 5J48A 2HWF1 5FIXA 1R091 1VR3A 2Y0OA 1RUD2 3KT4A 4ISRA 2YG0A 1F9KA 3MIHA 3F95A 2YFZA 1UMZA 2GNTA 2IC1A 4M0HA 4M00A 2IXJA 1NXMA 3O1OA 2Z69A 1H8TA 2VZUA 2MEV3 2XJPA 2ZGNA 1JZ5A 1S1AA 2VW2A 3AX4A 4R9CA 3KV5A 1SZBA 1D7PM 2ORXA 4F3JA 1VAMA 2BOJA 1AL0G 1KGYA 1UKRA 3E6BA 1W0PA 2BQPA 1AYN3 1UZYA 2AREA 1W8WA 2WQ8A 2VXRA 1RUJ2 5L9RA 4YM3A 2P3YA 1FT9A 4GB33 4M3CB 5CA6A 4DXTA 1PO23 4OQ9A 3VDDA 5K4LA 3KHBA 5IVVA 2VC9A 1YQ5A 2ARAA 5BXXA 1W9TA 1UY1A 2ES3A 4LBQA 1QJY2 3RI9A 2ZJCA 2J22A 1W05A 4I30A 1AXYA 1IGOA 3SCGA 1JUIA 3U78A 4CDQC 1TME1 5C3QA 4XFGA 5FZ8A 2PQSA 1WCDJ 2HBTA 1PMIA 2JB4A 2GC2A 2VCMA 5HBAA 1JN2P 2CAUA 3PJQA 2FCUA 1MZEA 3T2QA 4OI1A 4DXZA 5FY1A 2W1SA 4CUGA 4DZGA 1W04A 2WYFA 1US2A 1WZXA 3HPNA 2IXHA 4ATEA 2HWB2 4FTBA 3OPWA 2QNKA 4M0NA 1W6QA 2D6NA 2JG9A 5G05L 1DQ2A 3FBMA 4I01A 3RMXA 2ZAHA 3BTYA 4KU8A 2DVGA 2DVFA 2C1FA 3GJBA 3WQ7A 2KM2A 3ZFEC 1HXS1 2CDPA 1XNTA 5IWFA 4HVQA 1AYM1 1W9WA 2QQKA 5EQUA 5L73A 1IPSA 2YHJA 4NAMA 1FYUA 1RUH3 2CWSA 2JDAA 2XXZA 3GBGA 4RS5A 4CUBA 5FKCA 3B7MA 3EBRA 4FP3A 1JI6A 2B42B 3FE5A 4GMP1 1AR92 1FNYA 1UN1A 1UOGA 1OURA 1HB3A 3D6EA 4FQZA 2WFF2 3OG2A 2HWE2 2VMIA 4LBLA 1NLSA 1ODMA 1ZA7A 4KU7A 4PLMA 4BLJA 1C28A 5CG9A 3ZSKA 3EXUA 3H3UA 4UYBA 4EZ4A 3LB9A 4CE8A 4EYUA 2VO5A 3GBWA 3ORJA 4HPKA 3ZMOA 2WINB 3G7DA 1S0DA 3AKRA 2JECA 3SH5A 5A7WA 3AL6A 4B7EA 3VD9A 1PVC1 1EPWA 4Q4Y1 4Q29A 4DY3A 1GFF2 1W8UA 5DAWA 1BVP1 4A45A 3D4KA 2XGXA 2B8MA 3I54A 4BISA 4CDXB 4MYEA 3H3ZA 5D2AA 3H8OA 4QX3A 3FFZA 2WNOA 4AOCA 5FYMA 4BQWA 1IQAA 2ILMA 1W0OA 2E32A 2VCAA 4P9LA 1ZNPA 5D8AB 3MLLA 2JKBA 4B4RA 2VE1A 5DAVA 4JV4A 2HLEA 3HMYA 3VBRC 3KQRA 1EUTA 1RUI2 3KM5A 1RUF1 2YROA 3NKTA 4ITCA 4AFMA 1PGL1 5LA9A 2JDPA 2YZ4A 4Q4X1 1NY71 1G9CA 3B02A 3CQOA 5JUVA 1DYKA 2VUAA 3PMEA 1SBFA 5FZLA 3OF1A 4FOWA 1YO8A 1STMA 3QLQA 3VUOA 5FZOB 1GKBA 5FZ7A 2VVDA 3WR0A 2NMOA 3M3CA 2HWD2 1CZVA 4Y4RA 3NV1A 2UY8A 2RM22 1TZOA 3F2ZA 4XUPA 5FCCA 2VMEA 3VDDB 1GNZA 2ZGPA 1ENQA 1RVF1 2VMHA 4XQ4A 3GZAA 2RR12 5GZDA 1UY0A 2WO3A 4J1XA 5FFOC 3POBA 4DQAA 1S0BA 2DUOA 5CG8A 1RUC2 5FY5A 4CU6A 2NP0A 4R9DA 4QPIA 4IEXA 1WBFA 1MQTC 1PIV3 4AHXA 2X8KA 5FYUA 1PZ9A 4FTSA 3ZDVA 3HBZA 2XVKA 4LBJA 2QJVA 4JRAA 3WUDA 3U11A 1OHFA 4NRQA 1W6PA 1QHDA 2QQUA 1OXCA 1JS9A 3HEIA 4LIVA 5E88A 1ND3C 4HANA 2WNUB 4XYXA 2GMEA 2JXAA 1NAEA 4COUA 1PO21 3J26N 4PJYA 5F5CA 3E5XA 1UIKA 2Z79A 5FP4A 1CAUB 3U37A 3WF2A 4CCDA 5FZGA 2D44A 1QJX3 2B4KA 2Q1FA 2XKPA 1RGSA 4IETA 1W8TA 2NM1A 2JB8A 3GCWA 5I8SA 3B00A 4L97A 1JYWA 2J1EA 4MOAA 4C1WA 1SLTA 3WNPA 5LCWL 3K48A 3N36A 5GLWA 2OW4A 2KD7A 1ZA4A 4S2DA 4XJZA 1NCRA 1XNAA 5IUQA 5CFCC 4NN0A 4N43C 1JYCA 5LWBA 2WQZC 3MV01 1XYNA 4PF1A 5DN2A 3DV8A 1NCQB 2WS93 1XXNA 1QGLA 1IS5A 5F8PA 2ETEA 1AHSA 2WNVB 3CIHA 1V9U3 3OBTA 4JKMA 1JU3A 1K5JA 2DTYA 4QXCA 4XFAA 1PMJX 3MHZA 3WP5A 4CU9A 5IVCA 5HI0A 3MGUA 4D0QA 2X5IA 4DUVA 2PLV2 1DHKB 3I8TA 4XTMA 1Z7S2 4Q4V1 4Y1VA 3THDA 5K7PA 1GWMA 3R4DB 5A3OA 3WW3A 4KMQA 4FPEA 2VNRA 2P6CA 4Q1PA 3MEPA 1C8M2 1NE6A 3GCXA 2P5BA 3VBSC 3ZR6A 5I0SA 2FDIA 5GLZA 5FZIA 4LE4A 2WAAA 4XEZA 2ID4A 4JRLA 5J96B 3WG4A 3C7EA 4Y24A 3NV2A 5T5JA 2KR2A 4RGAA 1YI9A 2GC3A 2WNEA 4COWA 1Y9GA 5C9AA 2YU2A 3O1VA 5ANNA 3FFQA 1C5HA 2L9LA 1NT0A 3MIFA 3J7LA 3T1MA 2CYFA 5FZ3A 2YPDA 2Y6JA 2WZR1 3V0AA 1NLQA 2PHWA 4BM8A 1ZRRA 3PVNA 4IUGA 3JBG1 4LHKA 4CXYA 1UX6A 2ZGTA 3HN3A 1P8JA 1VB4A 3NAPA 2PN5A 5CNAA 1QJU1 2PMWB 3KMHA 1OT5A 1VALA 4HOOA 1OLRA 1SDWA 4TYSA 1LOFC 1V6OA 4UF0B 2VTXA 1UPIA 3USUB 1VBC3 3H1MA 4JX0A 5GZCA 3NL1A 5EPAA 1Y43B 1MZFA 4XZPA 4CYDA 2VW1A 3O7OA 3V64A 1O6UA 3AMNA 3MBWA 2A73B 1K5MB 4U2AA 1ZZ7A 2LROA 3IBMA 4EN0A 1AUYA 2BPA2 2C0ZA 2VMFA 1HRI2 2A6WA 1HN0A 3FHIB 3LOIA 4FO9A 3ETQA 3N9LA 4QXKA 1WMXA 4WZFA 4ET7A 2G9GA 1OVPA 1G9AA 3AFGA 5H9PA 5JAXA 1RUG3 3POYA 1BEV2 3A23A 3DPRC 4QKDA 4BLIA 1BZWA 5FXWA 5IVEA 1RJ7A 1A3KA 3CO2A 2DV9A 4R8HA 1J1TA 5C70A 1TQ5A 5FUPA 5C8CA 1SLCA 2VZPA 1AR72 3WSOA 3O1TA 4XQWA 2VG9A 4OUMA 1D2QA 1HIXA 4IW3A 3ROUA 3S7IA 3OY8A 3I59A 3UGFA 2DF7A 2W1WA 3LEKA 2AACA 2DURA 1VRH3 2IVIB 3RMYA 4RHV3 2JDZA 2LS6A 3GZUC 4LO4B 2CV6A 2BNMA 1SQ4A 3DUIA 1RUOA 1EY2A 2P3KA 3BB6A 1SCSA 2NPIA 1ASJ3 3KS7A 1POQA 4LPLA 1I3HA 1RHI3 4XUNA 4GKYA 4D94A 2R072 4ES8A 5JSOA 3R05A 5FYHA 1KJRA 2YBPA 3H50A 3U4XA 1O3RA 4GWMA 3TN93 4EZHA 3FUQA 4A6SA 2R042 1ZRCA 2WWUA 2D6KA 1HB2A 2RE9A 3JQWA 4FPGA 1XU2A 4SBVA 3CU7A 2VQTA 1FPN3 1KDKA 1ZBE2 3OGSA 2V73A 1RUE3 3S6PA 3T0DA 1HW5A 3WXPA 4EN6B 2WZ8A 4L92A 4K21A 2GH8A 3FLTA 1QJX1 4QU2A 1PK6B 5BNOB 1RB8G 4BK5A 5M0TA 2BBVA 4FQ4A 5FXVA 1OA3A 3KF3A 3RJ2X 4TTGA 3APBA 2Q4SA 4WVZA 1DFQA 1VRBA 3K46A 3AYCA 2MEV2 3AVSA 1Q8OA 4QB2A 5A6YA 1NA1A 3CEWA 5A3UA 3ZFFA 5JOXA 1ND2A 1NG0A 2D3RA 1WLDA 1XPWA 2HWC2 4CDXC 2QBXA 4I02A 3A0NA 4QX0A 5IAVA 1UYPA 1YQ8A 2F4PA 2Z42A 4DIQA 2O0OA 1XC6A 2DTWA 2I45A 3VZOA 4Z8BA 1QNYA 2WS91 4GB32 4P9GA 4RR3B 5A33A 3VZMA 4NAOA 2TNFA 1PO12 1SLLA 2ATFA 3H8UA 3UYJA 3IDBB 3POIA 3V0AB 4Q1RA 3PUHA 5FXXA 5KC6A 4B29A 3T2TA 2KXLA 2UU8A 5E1RA 5FP7A 4UFHA 1CPMA 1KS4A 1QH6A 1WW7A 4CP0A 5C8WA 5FZBA 3ZXGA 4QDSA 2ZBJA 1BLZA 5EJZB 4E4SA 4MO3M 1HQWA 4HT1T 5JI7A 5DAQA 3VBUB 2ZX4A 5FZHA 5BNPB 4AXOA 3POGA 4EWAA 3N7JA 4PIZA 4RFT0 4NJ4A 1GLHA 3ZXJA 4AE2A 3I4IA 5HCBA 1GUIA 2DU0A 2RDNA 4I09A 2P1BA 4PQ9A 3W21A 1IOAA 3VDDC 1DGRN 2VAUA 1OSGA 4XBNA 2OZ6A 3WQ1A 2PHXA 1FMD3 1M06G 3VL9A 4NHMA 1ZBA1 3SKJE 4HSJA 2WZEA 4YW6A 4ISQA 4Z82A 2SLIA 3ALQA 2HEVF 1UOBA 3BIWE 2D3SA 5FY9A 3LSEA 2HYKA 3A7QA 3N9QA 3PU8A 1FV3A 1JZ6A 5FBJA 1YQCA 1XB9A 1DIWA 3FHQA 5FZ0A 3U75A 1W06A 2PELA 1XOYA 2R062 3POFA 1VBC1 3MI8A 2ORZA 2VUCA 3LIHA 3DYPA 1FNZA 2QTWB 4FXKB 5FMCA 2XDVA 1O4TA 5J09A 2WNUC 2ARXA 3SH4A 1VBB3 5A6QA 3ILFA 1OPMA 1WLCA 3IT8A 3ZX7A 4JDOA 1Y9QA 1X36A 5FBZA 1YFUA 2UURA 2PQQA 3I2OA 4XXPA 3PVEA 4IESA 3Q9OA 3DKQA 4L8QA 1IPJA 2ZABA 2PTMA 3RYKA 3HNMA 4MUVA 1RUG1 3E6CC 1RXFA 4DEQA 1V00A 3AP7A 3RZHA 3LZZA 1S2BA 3LDKA 2FZ1A 2BV4A 3FLRA 5CZKA 2WSVA 1OD3A 1RTVA 3QD6A 5FV3A 4C8DA 2VOVA 4S2FA 2V09A 1DQ1A 5FMDA 1DBNA 1C57A 1HRV3 2P3JA 2EXKA 3L2HA 4UFIA 5FZ6A 5AFBA 3GF6A 2F17A 3NNGA 1TNFA 2ZS6B 3B93A 1XQNA 4Q0VA 1Y9MA 4RHV1 5GZFA 3VZNA 1PGW1 4FFFA 4RYDA 3UETA 1JYIA 1NCQC 4EN8B 5FOJB 1HJFA 1YFWA 2BNNA 3AYAA 2Z5WA 1UU4A 4P5HA 3PUSA 4UFKA 1EAH3 5LRSA 1RHI1 1YUDA 3OUIA 4X6QB 4YW1A 1RINA 3T2OA 3SCFA 3AP9A 2PYTA 1I6XA 2JJ6A 1O8SA 3IMNA 4H7LA 3WDXA 1J59A 2J1AA 1COV3 2TBVA 2PHFA 1WA6X 2BERA 4KL1A 5ABJB 1UW8A 3BPSA 4W4ZA 4YM1A 5ACA3 1JOJA 4QXHA 3NJZA 5F7UA 1MEC1 1X9PA 1IS4A 1FPN1 3L9JT 4I0WB 4LUMA 5I0TA 1QY4A 2QE3A 4YNIA 5FYYA 2Q1MA 3GHNA 1RUD1 1GP4A 3ZYGA 4JDNA 4PBPA 5CB7A 1IPKA 4NPRA 3RZKA 1FAYA 5A80A 3U4SA 4N9HA 4DO0A 4S2HA 2H0BA 1W9YA 1FOD3 1NX9A 3DYOA 1VBA3 4WVWA 2CDOA 3I2FA 4I2OA 3E5UA 1FX5A 2VVFA 2RS32 3SCHA 2O1QA 5APAA 2OQ6A 3TBDA 2CAVA 4B1LA 3PMSA 3SH3A 5FPBA 4WM8B 2OYZA 1UZWA 5HXMA 1RUJ1 2ZZQA 2QQPA 4M01A 4QT6A 3ZSLA 4QPYA 3KV4A 3VKMA 3ZFGB 3RVHA 2ZEXA 2P2KA 2X05A 2WR9A 1GP6A 2PA7A 4EQVA 3ZSMA 5IVFA 1K5MC 3B9CA 4JTOA 3CKHA 2AGSA 1YJKA 4HFSA 1ONAA 4JGZA 5FPAA 2WDBA 1W3XA 3Q8CA 2CWMA 2EXHA 1G9DA 2QZ2A 4NRPA 2OS2A 1DU3D 3IKWA 5AVPA 5FPUA 3NO8A 4P5YA 5T55A 5A1LA 4FPYA 1TME3 4Q0SA 4YZ1A 5GALA 5FYTA 2FDGA 4LK6A 3AKSA 2YBKA 5LK5A 4OVEA 3ZYFA 4FFIA 5LA1A 5C4WB 4RA0A 5JDBA 4FP2A 3P6BA 5GKAC 5A7OA 3FMGA 2VPVA 1LGCA 3OPTA 3MDPA 4CEWA 2YGMA 3FL7A 3U1XA 4CXWA 5GZGA 1G86A 1X8MA 4XCBA 1FMD1 4C0HA 4BQXA 1TE1B 2EIGA 3HR9A 1JZ3A 3BKZA 1AYM3 5T3NA 1JZ2A 1CX4A 1ODNA 2D5FA 4FI9A 4FOYA 4MSVA 2XLAA 1EV12 5L7OA 4D6QA 1AR91 4QHOA 1ULPA 3V65A 1W6OA 2ZTNA 5SV5A 3VBFB 5I8YA 5A32B 3ZO0B 5CIRA 3WINE 1FXZA 5AC92 2YU1A 4M3CF 2YV8A 1MS8A 2HWE1 3BYWA 4TWTA 4BQYA 2JD9A 1VMFA 3OEAA 3FX3A 5DDJ2 1YQ2A 3KZ4C 5H9SA 3C3VA 4H2AA 5BNQA 4Y22B 1QQP3 2UWBA 1VBB1 5JIUA 1OLME 4CCCA 1YXWA 2WBKA 5C3SA 4MGYE 2A3WA 1YRZA 4OLLA 1BKZA 2Y34A 2J1RA 4IGPA 3ES4A 3ELNA 1OH4A 5JI9A 2X5IC 5BNOC 1KXGA 1PK6C 1YFYA 3TYJA 3QH6A 4LOTA 4IE4A 1IG3A 1PVC3 3M70A 3KWVA 4IEPA 4Q4Y3 3U10A 1LESA 4LBMA 1NLRA 1WW5A 3N7KA 3O1MA 1N1YA 1LEMA 2PHDA 4CCKA 3P5BA 2EVXA 4GKXA 1TMF2 3OGRA 1HRV1 4NVPA 1HX6A 3IIIA 4XXAA 3H8XA 1JYTA 1YFXA 3MV11 4FPFA 5FP9A 1B35B 1RC6A 4LTAA 5J36A 2RMU2 3CZUA 1LHOA 3JCIA 3POJA 5T50A 4NUBA 2A6XA 2BP6A 1KQRA 3LF7A 4RR3C 1H2MA 1A8DA 1UD1A 4UXAA 4COYA 4KGQA 1W28A 1RUF3 1LULA 3ZSEA 1QOOA 2BJSA 3HD8B 3ZN6B 4Q4X3 2WO7A 4QHBA 1V6IA 3NAPC 1GZ9A 1NQDA 4PQQA 5AFEA 3RZLA 3J8F3 2R1BA 4LLFA 4N7IA 3WOGA 1LKNA 2RM21 1ENSA 1WBLA 4HK9A 5CFDB 1G9FA 3ACHA 3QCWA 3VZKA 1UKGA 2EXIA 5I93A 2RR11 2HH9A 3UL2A 4CTEA 4DXRA 1UY3A 1W9SA 5KHHA 4ORFA 1H2LA 4BIFA 4P08A 1VRH2 3T0AA 1DGLA 1RUC1 4OUSA 3BCWA 5FYVA 4QX2A 2V5YA 1U0AA 2RDRA 2XJTA 3FUOA 3NJVA 3AL5A 3ABZA 3T2PA 1FOD1 1VBA1 3RZGA 4JGYA 2DUPA 2E53A 2HEWF 4NR1A 4SLIA 4EROA 4KQ7A 4OHYA 1SHWB 4CP1A 4QX5A 4HG6B 1O3TA 2HEYF 4UFLA 1OLMA 4PIXA 5FLHA 3LCPA 5JVVA 4TN7A 2VD7A 2C9KA 2FMDA 1RUE2 2ZGOA 5F6LB 1OKOA 1S4CA 1WA4A 4Q8KA 1I1EA 4FAHA 1XRUA 2XLFA 2ZX2A 3A22A 5L7OB 2XVLA 3P3PA 3WHUA 4EN9B 5JXJA 3SISA 3DPRB 4KNCA 4D7SA 4Z92B 1W39A 2P37A 2OPKA 4S2GA 2ZACA 1H2NA 4RSUA 2HKXA 1JHNA 4QPWA 4QXBA 2FHRA 4PDWB 3WW1A 4QM8A 1UWWA 3GDBA 2YUEA 4NHLA 3JQXA 1WGPA 2IXLA 1F15A 1H1IA 3D82A 4B8EA 4LBOA 3WG2A 5JWPA 3I49A 5C6CA 1C1LA 1ZX5A 2RS53 2Z4FA 5IJRA 4Y3OA 2RDSA 5FXZA 1GU3A 4CCJA 5LY1A 3H42B 1YWKA 1ENRA 5F6KA 1LNSA 3D0JA 1PNFA 5JXIA 4NIAA 5ISLA 2GMPA 2P17A 2C5DA 4OCTA 3NV4A 1S0CA 3PURA 4PCRA 4B1MA 4XMIA 4Q4V3 5LRRA 5HV4A 4C1XA 3MFAA 1R64A 1JH5A 1JOBA 1I5PA 1L7RA 1ND2C 2WT2A 4GH4B 3WG3A 2Q8EA 2OPWA 1W6MA 3BU7A 5D21A 4CDUA 1ZZ6A 4AI3A 3W59A 5JOWA 1E5IA 3S30A 4ONUA 4IEUA 1MVEA 5ABJC 1QQP1 5C7GA 1IS3A 2EALA 4QAWA 5FQ0A 1AR62 3CJIA 2J42A 4F8AA 1N3OA 1CESA 5E6HA 2Y38A 3W20A 5ANQA 3ITQA 5T52A 4DMIA 3PDQA 2JEMA 1N3QA 5BYNA 1QDCA 2E9QA 5JIAA 2VOWA 1XE7A 2WZR3 4K20A 2VJXA 1CAXB 3FN9A 4XDPA 4Z07A 1M4WA 4QQ2A 2J7MA 3JBG3 4XE9A 2OQ7A 1YQ6A 2RS13 1WLTA 2WC2A 4XF3A 2R16A 4XFFA 1XYOA 1QXRA 2BTVC 2GNDA 4BQ1A 1QJU3 3J7NA 4IERA 1GOHA 1LAJA 3PVOA 4O9GA 4YARA 4WM8C 1YCIA 4X6RB 1CAWB 3LA2A 2ZX3A 5A70A 1HRI1 5EJ1B 4DUWA 4Q4W2 3ETPA 5KXDA 4XFHA 4IEWA 4AGVA 4QDRA 4L11A 2WA4A 1RITA 3ZFGC 3WG1A 3SMHA 1PX4A 5KXCA 1JHJA 1BEV1 4WV8A 1POV0 1O4YA 1REFA 1H8TB 3FJSA 3KCXA 3UT0A 2R32A 4MLOA 2GP3A 4WM7A 1F4HA 3ME2A 3ZYPA 3LAGA 4MGQA 2VZRA 3AKTA 3J8F1 4QGLA 4URAA 2AEZA 2YGLA 1GR3A 1AR71 2VZ3A 5FYZA 5DZEA 1UXXX 2DVBA 1R083 2PHUA 3JD72 5F5AA 5C4WC 4MGKE 1MS4A 2ZCWA 2PHLA 5C33A 1AF9A 2WO1A 5E16A 4MV2A 2NQYA 4JC1A 4YVSA 5JR7B 2ARCA 2CGPA 1SFNA 5DPNA 3HQRA 4IGQA 4YVWA 3T4VA 2WJSA 4HKLA 4NIGA 4LBQB 5F3EA 3ZN4A 4AVBA 4BZ4A 3G6JB 4XFIA 4META 4AVTA 4MGTA 1AR82 2G9ZA 2GNMA 4GULA 3VHOA 4NIDA 1W8ZA 4BH9A 3J7HA 2XB6C 3UKTA 3V56A 1R1A2 2X29A 2RV9A 2HBUA 4ZZ5A 1OMIA 2R041 4AQTA 1J3QA 1HB4A 3MW3A 1L7QA 3VBFC 4COZA 1COV2 3WNLA 1W99A 4COVA 3E1F1 3KCCA 1W6QB 2JG9B 2WYSA 1XE0A 4B3NA 5ACA2 2ZGLA 4K8FA 3VZLA 4A7YA 3GZEA 3K4AA 4AFDA 2JDMA 4BMBA 4CCLA 3LKJA 2K46A 4PT6A 4AI1A 4LULA 4RN5A 4W6WA 4E9KA 2VZ1A 2IVJA 2UWAA 2VULA 4BQ4A 4RS5B 3IPVA 1GQHA 2HWF2 3WQ0A 1R092 4AAXA 1A8MA 1NXD1 3MFCA 1UCXA 2JIJA 3EO6A 4RGGA 1IG0A 4AI0A 1HJGA 2WWSA 2YC0A 3PIGA 4HN0A 4KG8A 1BBT3 4QKBA 2XWBB 1N47A 3QOPA 2G9FA 4UW4A 1H9PA 4XTPA 4Q5OA 1VBE2 2HJIA 2EICA 2QQWA 3VBOA 4R52A 2ZHNA 1UZVA 2VM9A 3OUJA 5FWEA 3UK9A 1QIQA 2A3XA 4NO4A 3J4UH 4YW3A 4DB5A 4HL0A 1PO11 3WT3A 1SDDB 3CZJA 4Q0UA 3NV3A 2UY9A 4XVHA 1QXPA 2RS51 4HPKB 1B35C 3VBHA 5FYIA 3BTXA 1H4GA 4FT8A 4K3UA 4PF5A 4QMAA 4V1PA 3MF6A 1TG7A 5A7WB 4AF9A 4ASMB 1N3PA 2P6HA 5JXGA 1S55A 3ACIA 2W9XA 3I2DA 3R0RA 2JDNA 2K0GA 1ST8A 4NPMA 3TN91 3VKFC 1D4M1 1MPXA 1OC1A 1MS9A 5C71A 5JZGA 1ZZ9A 2ZX0A 5J98B 3THCA 5FO9B 3HBKA 4AK3A 4CSWA 4LKFA 3IM0A 5GLTA 2VR4A 2FD8A 2R49A 2B7YA 5E89A 3FBYA 1YC61 3WNNA 2A71A 5CFDC 4K6BA 3JUUA 5IVYA 1W8OA 5A1AA 1CWPA 1UQXA 4HLTA 3SEEA 1XNBA 4HSLA 3DEMA 5IW0A 2BYVE 3OYWA 4ATFA 2X53S 3AYDA 5J37A 4LR4A 1HXS2 1O5UA 4ES9A 4TSVA 4BHPA 2P34A 2XH6A 1I9RA 4D6RA 1ZBA3 3VHRA 5A3PA 1OFNA 1ZRDA 1MACA 1JZ8A 1IKPA 3DN7A 1VB2A 1OBNA 2YXSA 3D8CA 3WEZA 4AVCA 2NLRA 3KCYA 4CPBD 1LHVA 2R061 2RS11 4K40A 5A3MA 2OVUA 4QX8A 1E5SA 3EHKA 1UYZA 1KRIA 2IFWA 1IS6A 1AL23 3KB5A 3H8RA 2IUWA 1H9WA 1S0GA 1OKQA 2ZGSA 4JQTA 3AK0A 1ULCA 4HONA 4MGSA 3LPGA 2ZMKA 1UY2A 2VW0A 4XJAA 5FZAA 3ZN5A 4AQ6A 4YVWB 3S57A 1LOBA 3S5AA 3PUAA 3I2HA 2D6MA 5HCHA 4YGCA 1PM4A 2B9VA 1PNGA 4AEDA 1WW6A 3SXWA 4FFGA 1DDLA 5FYBA 1DF0A 2JD4A 2ZGUA 1LGBA 3VDCA 4QPIB 3I2KA 3T0BA 4DS0A 2CY6A 3O1SA 3IN9A 2QCSB 3RRDA 2WA3A 5L7OC 2EAKA 4ZU5A 4NWWA 1Q8QA 2XQRA 4PBOA 4QU1A 3RZZA 4Y20A 4Z2AA 3K2OA 5FOBB 4B4QA 1QJFA 1SLIA 3HVDA 1W6PB 1VBD1 2VY0A 3Q8BA 1UXZA 1QOSA 1R081 4JDMA 1BVVA 2XUMA 3MIEA 4MHUA 2XBO3 4PDWC 1F5FA 4YZ3A 4HBNA 3PTYA 5K8SA 3IAQA 3AM2A 1LHUA 1Z0HA 2EF6A 3EJKA 4NRMA 3B69A 1ULGA 2VH9A 5FZ4A 5JSPA 2BNOA 3AXDA 4EJRA 1MR5A 3OD4A 4YRDA 2QDNA 3TRSB 4RD7A 1WLWA 2JWPA 4GA9A 4CPBA 5FWJA 4G4FA 2I07B 5FRAA 5LB6A 2WN2A 2A75A 5A3WA 1DYOA 3OTFA 1KJLA 2WABA 2AR6A 3SKVA 4CU7A 4KI5M 3LA7A 1NY72 4P9XA 2JKXA 1Q8VA 2EAAA 1LHWA 3ENRA 4IV1A 4MGIE 5T5PA 4FVVA 1AX0A 1NCRB 1PZ7A 4XJ8A 4BA6A 2YFUA 4GH4C 4OHVA 3VD3A 2GDFA 1DYPA 3TEWA 1O3QA 4N90A 1SFYA 1RMU2 1UU6A 3MW4A 4ASKA 1MEC3 1LEDA 3GYDA 4LIUA 3VBHB 3IIAA 3RNSA 2ZZJA 4KH9A 5J7MA 3VD4A 5BNNB 4IV3A 3K4DA 1RVF2 3KQ4B 2QDRA 3IZOA 3N7LA 1RUD3 2N7GA 3AXEA 4GZ9A 4W6XA 4DNYA 5GZEA 2FDJA 4I3GA 2W08A 4CDQA 4GALA 4K1YA 3LDBA 3URFA 2X5IB 4YW5A 2DDUA 2WT0A 4LT5A 3POEA 3BUCA 4DOUA 3KGZA 3BU0A 1BBT1 2W68A 2A6ZA 4QGMA 3IDCB 4LBNA 3AKPA 1RJ8A 3S5QA 1LOCA 3I97A 4RL7A 5C3PA 2FDHA 4UBHA 2NN8A 4A44A 4BJ0A 3BI3A 3PJYA 2YDEA 4XUOA 5C9AB 5L9VA 1D0HA 1KDMA 1RUJ3 2GU9A 2VQ0A 2ZGQA 2AH2A 5B4XA 1QU0A 3ST7A 5H9RA 1AYN2 3FWEA 3PNAA 1ZRFA 2UWCA 2QQNA 4XCAA 3PIJA 4HMZA 1GWKA 1DZTA 1PO22 4Q2FA 5LBBA 3WW2A 1QJY3 3B01A 1BMV1 1DP0A 1Q8PA 3VL8A 1MZ5A 4E4ZA 2FBEA 1K45A 4ZY9A 1UF2C 3R4SA 1PMHX 3NAPB 4JTNA 3BVCA 4Q26A 4BYYA 2D97A 4CRQA 5DMYA 5HCAA 2EA7A 5FAXA 1H8TC 3NMBA 1T6BX 3GZTB 5IK5A 1LB2A 1WMDA 4N53A 1W8FA 2A7AA 1JZ7A 1QOTA 2C6SA 2HWB3 5I0RA 3N9MA 1QF3A 3AMQA 1O4ZA 2Y6GA 3ZLIA 2GN7A 3U14A 4DPNA 2Q1ZB 5CAZA 4QQHA 3IB3A 4AEDB 5HPOA 2VCBA 2E26A 5FMOL 2XL7A 3DXUA 5FZ9A 3SLIA 1GICA 4A6OA 3VDBA 1UPSA 3LA3A 3ZR5A 1JYVA 3MO4A 1UIJA 3PHMA 3J9SA 4LUKA 4TZDA 4HKWA 1DZRA 1UOFA 4F83A 4Y20B 1K12A 1RUH2 2D7FA 2R30A 1D4VB 5F5IA 1B09A 3WDUA 4AFAA 3M7AA 1AR93 3NJYA 4Y1ZA 4OMCA 1AL21 2W91A 4BQ2A 5C8CB 4GWIA 2PFWA 3WVJA 1MS3A 2HWE3 2VTFA 2W95A 2VCCA 4K1ZA 3OY8B 1QXJA 2JG9C 3I59B 2CNAA 4FTEA 5A7SA 3M3OA 1OQEA 4GJZA 3LIGA 3C7OA 1CIYA 1N1VA 2ZGKA 3HQXA 2XJSA 1SBEA 3S0MA 4E2SA 1YIFA 1F8VA 1CZSA 3C7FA 1OFSA 3NWKA 2J1TA 2QQLA 3CMGA 1X82A 2WZR2 4RS5C 5ERLA 2AYHA 3NNLA 3AVRA 4IV1B 5FZ1A 3NSTA 1HKDA 1URXA 1UY4A 4YW2A 5K9YA 2DU1A 3BALA 4K7JA 3SEPA 2ZHMA 4IGOA 4XBLA 4W8JA 3V0BA 1WCSA 1LGNA 3POSA 1WCKA 3LOBA 1V70A 5FMOS 4B7KA 2XBO1 1C5IA 3W9AA 1W0NA 1JUHA 4Y5SA 4OFGA 4NWVA 1REEA 1PGSA 1ZRIA 1F35A 3ZXEA 3JB8A 3AFKA 3USSA 1OOPA 3UGGA 3QBQA 5JMCA 1F5JA 5KWRA 1GNHA 3QH7A 2Z2SB 4I3PA 1BJQA 1YIPA 3MW2A 5FREA 1ZVFA 1AVBA 2GNBA 4NIIA 4JVAA 1CIWA 2XONA 5KC5A 1GZWA 4AVAA 2XPJA 3KHCA 2LALA 5F3IA 5G04L 1NA1B 2BU9A 3NKGA 5FZCA 1ENXA 3ZKYA 4CP2A 2JDKA 4OHWA 1AX2A 3AP5A 1ND2B 2UYAA 4JKLA 5DUUA 3ZFFB 5A3TA 3ZPOA 1AX1A 1V6JA 1ND3A 5FR3A 2RM23 4Q8LA 1WD4A 1S2EA 1DQ6A 5A33B 4IE6A 5DXDA 2RR13 1HQLA 2EIDA 1MVQA 3R4UA 4CVUA 4RQPA 4XQDA 4NHYA 4OHXA 3MYXA 4BWOA 2FZ2A 4U36A 1RUC3 2OZJA 1ULOA 3AKQA 3K3NA 1U5IA 4M3CE 4H3WA 1VE0A 4FPHA 5FZKA 1V6LA 1E57A 1PIV2 3HNBM 2VNGA 5JOYA 2XJVA 2XMLA 1RXGA 3BOWA 4ZS2A 1UOJA 2BWAA 1SMVA 1DGWA 2A1XA 4DFSA 1WMFA 2DBNA 4HKOA 4LKDA 1VP6A 2JDHA 3RG0A 3RWKX 5CFCA 3HT2A 2DCJA 2NMNA 3VKOA 4XOGA 3W5MA 2ZKNA 3B9IA 2E51A 5D1IA 4IEQA 2R0FA 4I0BA 4X8PA 4CEYA 1G6NA 4YVWC 1QJY1 4DXSA 3Q8FA 4LXLA 3HJRA 4NHKA 1OQ1A 1ZZ8A 2W2IA 2YMZA 3C2UA 4IE7A 4QQOA 1QJX2 1ZZCA 5CKQA 1JTZX 3O0VA 4OULA 4QPIC 2W3JA 2WKKA 2Y64A 3ZYJB 3THTA 3OPZA 4QX7A 2QFEA 3ZYHA 1RYYA 4P9YA 1MS0A 1KEXA 5GJ6A 4AEKA 3N7MA 2XKOA 3VZJA 2HWB1 1CPNA 1T2XA 3ZPYA 2WLQA 2Q8CA 1XSQA 3H7JA 2WFPA 5KXEA 3VKNA 1LOEA 3WUCA 3U07A 5JPNB 1LCLA 1SFPA 1PX3A 3CL1A 4AWDA 3KT1A 4UFJA 1UL9A 3E6DA 1L3JA 5JMOA 2WS92 5LK7B 1H1MA 2PAKA 4LBKA 1V9U2 1SBDA 1V0AA 3AP6A 1A34A 4FAGA 5BUVA 2PLV3 5A3LA 2ARBA 1YLLA 1Z7S3 2RG4A 2YYOA 2VUDA 3V0BB 4A41A 5I91A 2C24A 5FTTC 3AZVA 1C8M3 1WMEA 3H1WA 3KSCA 2CTVA 5CYYA 2BWCA 1LOFA 3UKNA 4CCEA 2QQVA 5FZEA 2WFF1 1EYBA 4KBZA 2TEPA 5EYXA 2E7QA 1PHMA 1FATA 3N9PA 4KWUA 2OT7A 3ECQA 1NCRC 2RDQA 4OZOA 4XPVA 5A3NA 4J6GA 2FQPA 4D7YA 5LBFA 3M2MA 4AVVA 1W03A 2EIEA 5FKBA 3VBHC 2WRAA 1J3PA 2ZEYA 4YFZA 2E6VA 1IKQA 3MIGA 1GZWB 4XW3A 4YW7A 3T3YA 5BNNC 2BDRA 3OGJA 4PIYA 4XFCA 3WDYA 2CGOA 1F4AA 3KV9A 3DCQA 3H0OA 4LJHA 4JHTA 5I8TA 1XU1A 5HXVA 1BK0A 2JIGA 3K51A 3D3AA 3FZ3A 4BCUA 3UKVA 2VBDA 1WW4A 2VXJA 4KG0A 1VBC2 4PLOA 2W52A 2MPFA 3B5LB 4K9SA 3AZZA 4CUCA 5C9AC 2A6VA 3Q8EA 3ZYBA 1W8NA 3TB0A 1G7YA 1HRI3 1RUI1 3HT1A 4NHXA 3WDVA 4XZUG 4AHYA 4UT5A 3M3EA 4XFBA 3IDAA 4TXWA 3ZSJA 3WDWA 3T30A 4W50A 2EIBA 3I2IA 3OBRA 4L9BA 1S0EA 1X50A 2ZHLA 3GM8A 2Q8DA 1BEV3 2QQJA 2BUKA 4XUTA 4IEZA 4BB3A 3WF1A 4CP9A 1RUG2 5IAXA 3AZXA 2PAMA 3OSDA 3JD71 4CUAA 2D98A 2B9UA 2HWD1 5IK7A 3R6SA 3AZWA 4YW4A 3UV9A 2V5DA 2VBPA 3M8LA 3OB8A 4R9BA 1AR73 2A70A 5EV7A 4HXCA 4N9IA 5F5QA 5C3OA 1JYXA 2CL2A 2VMCA 1KITA 4LA2A 4YZ2A 5LEJA 1O7FA 2QKDA 3ZXLA 4Y5Z0 1MS5A 4OYUA 4G9SB 1UNBA 1H1AA 1W2AX 4OZXA 1KFXL 1NQJA 2CGNA 2ZGMA 2VZOA 3WP4A 1AR81 4AEDC 4CU8A 2RJ2A 4E2GA 4JGZB 1YJLA 2PHTA 5DABA 2DCZA 4RHV2 3KVAA 5FUNA 4H7MA 5F9TA 3WNOA 4YM2A 3RYPA 3DECA 1JOPA 5GLUA 2VMGA 1ASJ2 4UBGA 1NE4A 1X33A 2Y6KA 1KS5A 4M4PA 1RHI2 4QGNA 4EN7B 4BOWA 5IYYA 4LQRA 2YPJA 2R043 1GMMA 3MLJA 3TN92 5LASA 2KA3A 1CVNA 1YI7A 1JODA 3AMPA 3PL0A 5FYSA 4CEWB 4CDXA 5LA0A 4HZFA 5C8CC 4CCMA 2NYYA 1JMUB 1ZBE3 2YBSA 2IZWA 3ACFA 3WW4A 1YNAA 5T5OA 1MEC2 1NZIA 1FPN2 2YC4A 5D8AA 2E31A 4YGEA 2WLPA 4PLNA 5FPVA 1JZ4A 3ZXDA 1VMJA 2VZTA 4XHBA 2OKXA 1D0GA 2VGDA 4QKFA 1Y4WA 1W3VA 4QB6A 3DGTA 1AZDA 3K4ZA 5DUVA 2LW8A 4W6YA 2K2SA 3I3QA 1W6OB 1VBE1 1JXNA 2VQUA 1DQ4A 1OA4A 1S0JA 3ILRA 2JG8A 1QKQA 4IV1C 4AL9A 4LORA 2VL4A 2HWC3 5EFUA 5HV0A 3LEMA 1VAKA 5FZOA 1VIWB 4XF9A 4XJUA 4QPGA 3P1IA 1CGPA 2BVVA 2ZAAA 3EMRA 3SC7X 1ACCA 1PVXA 2W39A 2ET7A 5F2WA 3VDAA 2WT1A 1PO13 4ARXA 2FDFA 4J1WA 3B94A 5L9BA 4IV3C 1XNCA 2I2SA 2W1QA 2YB7A 3H3LA 5DAPA 3VB9A 5FO8B 2G4IA 4QWNA 2VBBA 1EUUA 1N1SA 2WO2A 4NOTA 2PLV1 3CBNA 4XF0A 1HV0A 5KHJA 1I5ZA 1Z7S1 1Q56A 2HYXA 2Y60A 1UZ0A 4LA3A 2E63A 3AJYA 4IE5A 4E8DA 1HN1A 3ON7A 4BXSV 1C8M1 4E4DX 1S0IA 2BOIA 1D4M3 4G3YC 4GXLA 4AQSA 2XHKA 1NA1C 2B45X 5LY2A 1C8NA 3ZFFC 4R9AA 3WDTA 1H6YA 2OXBA 1UAIA 5CISA 1GOGA 3SHRA 1QNWA 4ARYA 1U12A 2WNUA 4MADA 5IHRA 3HWJA 2VOKA 1QJEA 2XVGA 1A78A 5CEHA 1XNKA 2VECA 5DUWA 1T6GC 2H6CA 3UJOA 4BDVB 1LTEA 1CAUA 1FMD2 3K77A 5T54A 4BQ3A 3I3DA 4E27A 4V2VA 3JB4C 1REDA 3TEXA 3H9AA 3VN4A 4L0PA 4CP9B 1Z78A 2DBIA 2XQXA 1V6KA 2CSGA 3IDEA 3RPQA 3OJBA 3N9OA 1MS1A 4JCKA 1JU4A 4KWKA 3GBFA 1GP5A 3AC0A 2ZKLA 4QHZA 4N53C 2R063 4O7XA 1CN1A 4W65A 1ULEA 5KHIA 1OLQA 1TNRA 2LUWA 2RVAA 2Y33A 2WIIB 3ZYRA 4A2UA 2W46A 4H14A 1VBB2 4XUQA 4ZU7A 1NCQA 3TNQA 2J1UA 3LFIA 2VVEA 4Q0PA 2WNVA 3WCSA 2XJRA 4JGYB 4XIKA 5EWSA 2ZXQA 5T5LA 1A6CA 4Y5TA 4OHZA 2XR4A 1GZTA 1V6MA 1BK1A 2V72A 1GNYA 2LTNA 2JDUA 2VZQA 2CU5A 2XHNA 1U5XA 5IFPA 1H4HA 4LKSA 4L2NA 1E5RA 1POV3 3S7EA 4ASLA 2A5ZA 5GLVA 1AXZA 1VBD3 2ZMLA 4NMIA 4YWAA 2BZDA 5AVAA 4P00B 3WCRA 1LOGA 1QJZA 1UZZA 5CKNA 2WAOA 5F3CA 1HRV2 2QQMA 3WF4A 5L19A 4AHZA 1J3RA 5DAXA 5DG2A 4QX1A 2DVDA 5EP9A 1W6NA 3T1LA 4CDWA 1CAVA 4C90A 4ZS3A 3WNXA 3BOPA 1DLCA 1OF3A 5LZ6A 3KV6A 2DCKA 5EIYB 2R071 2I74A 5F1RA 2D6LX 2JG8B 4XACA 1EAH2 5TSWA 2WZPP 5FPZA 4P9WA 3TNPB 4QPGB 2ZEWA 2WWJA 4JQRA 4YZ5A 1RMU1 1CD3G 1HV1A 4UF0A 2JDYA 3USUA 1FI2A 5H9QA 1ZBE1 4AFBA 4IXLA 2J1VA 5DG1A 3BTZA 1XBFA 4LHSA 3JZVA 1EPZA 1R1ZA 4GWJA 4AEMA 3TEYA 2QZ3A 3AB0A 5IVJA 2AEYA 3CHXA 5IK8A 1OOPC 4NE9A 1HDKA 1K5MA 4R4ZA 4PI2A 3GHMA 4CXXA 3RZJA 4YG0A 3WZ1A 4DEVA 2P3IA 4YLZA 4RFRB 4LKEA 1O8PA 4WZCA 1UMIA 2UYBA 2RS33 1FOD2 1XJAA 2MEV1 2W1UA 1VBA2 2VTXJ 4JKKA 3I3MA 1XYPA 4J25A 4AHWA 2ZGRA 5I0UA 2HWC1 5C3RA 2YC2A 3I2GA 1W6MB 4BU2A 1ULFA 4CDUB 4AG4A 1GQPA 1MZ6A 3O1UA 1AYN1 3L2YA 4OI2A 1OD5A 1G8WA 3I2JA 5FQ0B 5IATA 3CJIB 3P3NA 3LWCA 4GB31 4BQ5A 3GJAA 1J58A 4YGDA 2O14A 4Y1XA 2EXJA 1V6NA 3LSDA 3PVBB 2XJUA 3KVBA 4RQPC 4LO7A 4MVTA 1L7LA 3WX5A 4XDOA 3WLUA 1ZREA 3TEZA 2ENRA 3ZDSA 2OUJA 2JE9A 4Y4YA 3MF9A 1GOFA 4JAAA 4ZONA 1XSRA 3QACA 4UI9L 3OBZA 2Y6LA 3O0WA 4ZHNA 1WCQA 2F6BA 3AYEA 3MIDA 5CVRA 1BCXA 5K0UA 1TME2 5JSRA 3LDRA 4WVVA 4DRRA 5LW9A 1ZZBA 1AJOA 5EHDA 4A3XA 4XURA 5LA2A 1UMHA 5FLJA 3LQCA 4GWNA 3CLPA 3NQHA 5FZMA 5CBLA 4Q0QA 1IQDC 2Q8OA 3ZIWA 3AMMA 4XABA 4CEYC 2BRTA 4UW3A 3NRUA 3ZIXA 3GALA 2JE7A 2WN3A 1N1TA 1TEIA 1YHFA 4NROA 3UESA 1TVGA 5JCTA 3MPBA 5BNNA 1RUH1 2J1SA 1EV13 3NNJA 4JGZC 4D8MA 1AYM2 4V2WA 5BNOA 5JPMB 1PK6A 3AJZA 4UW5A 4WM7B 2VU9A 3M3IA 2JX9A 2E33A 5IK4A 5CADA 4ZXKA 5AC93 5BY5A 4GJYA 1H6XA 3I7DA 5FY7A 3DL3A 5DDJ3 5FPLA 4XMAA 2Y6FA 4MHRA 2D43A 4D7TA 1OF4A 2X09A 4YVSB 1W6NB 5DZGA 4CEWC 5B2GB 4MG2A 4CDWB 4MGZE 1CAVB 2B39A 3SITA 5FY0A 1QQP2 2PHRA 4FPCA 3LD8A 4RR3A 2AENA 1H30A 2ZPXA 2DYCA 2W92A 3MPPG 4BK4A 2BFUL 1RUNA 4GIQA 1OI6A 2Y6HA 3KF5A 4JZRA 2FCTA 1IZ3A 2P4EA 1KFUL 4GAZA 2OIIA 1PVC2 1W2UA 4XF1A 1POV1 4Q4Y2 1DGRA 2W47A 2ZEZA 3RS6A 1TMF3 3VBUA 1FV2A 3LE0A 5BNPA 3PUIA 5L36A 3FHAA 1VPHA 4DY5A 2BGCA 2E7TA 3OD0A 4YG3A 1HQNA 2H0VA 1SCRA 2IXCA 2VOXA 3I3BA 1WWYA 3UGHA 2RMU3 1PZ8A 1H0BA 5FLIA 3MUY1 2DUQA 4HVRA 1NUKA 4GD4A 2GZWA 1NOVA 3D0SA 1QDOA 1UX7A 3LEGA 3IPVB 2FCVA 3GNEA 4INDA 5IVBA 3LGRA 3RI8A 1OUSA 3N35A 3VHPA 3A21A 1CX1A 4FPKA 4OMDA 2VNVA 1RUF2 1PGL2 3O12A 4FPOB 4AGRA 1CZTA 5EYYA 5JXHA 3K75B 4QDQA 4XAEA 1HB1A 1K3IA 4Q4X2 4XILA 3VBOB 1J1LA 5FJKA 1Q3EA 2XJQA 2AZ5A 3ILNA 3T09A 3BTAA 3J8F2 4LO6B 1AXKA 2Q5TA 2O8QA 2JICA 1W8HA 2V4AA 2W0XA 3NNFA 3POWA 3OBAA 5F2SA 5IFTA 4XDQA 2DCTA 4AEJA 3U0ZA 2GC1A 2BFUS 4UW6A 4AZZA 3WNKA 4M4RA 5FDBA 5IT6A 3FC0A 1C1FA 4OUEA 4E8CA 4BXFA 1GWLA 3BODA 2XL9A 4QB1A 1OVSA 2FDKA 2QUOA 4XC9A 4WVMA 4ZKTB 1DLLA 3KGLA 2ZMNA 4RGKA 1C4RA 1PIV1 5K0UB 2RS31 4XJ9A 1GANA 3OCPA 2DWRA 5JZGB 3ES1A 1UO9A 3I3EA 4LK7A 5LATA 2Y26A 2C9AA 5FPXA 4LE3A 1LECA 1Q43A 3LEIA 5FY8A 2DCYA 1VLNA 1DQ0A 3HOBA 2D5HA 1D2SA 3GXUA 4NIHA 1WKYA 3OYWB 2B46X 1LJ7A 5FJHA 3ZFEA 4OQ8A 5LEKA 5FY4A 1S0FA 3HIFA 2R6QA 5LBCA 3Q8AA 5C5UA 3AMHA 3MIBA 1O91A 3PTRB 1UYXA 4JGYC 4JHZA 3GGLA 3AZYA 3N9NA 1O59A 3IAPA 1F2NA 5JR2A 3WNMA 4QQLA 4HVOA 3OOXA 5EZWA 3LFMA 3HQUA 2ZHKA 4FPJA 5KHKA 2AUYA 4KBBA 1VJ2A 3E5QA 4R4XA 1S2KA 4DRVA 5ABJA 4AW7A 1GSLA 2VZSA 4XIOA 3VKLA 1YEWA 4ZXEA 4IEYA 2VMDA 5D8AC 3WP3A 3ZVXA 1V9U1 3WHTA 4YZ4A 5CU1A 4O9EA 2RS52 3C7HA 1Y3TA 1EV11 3A4UA 4O65A 1G9BA 3WQBA 2RJKA 4AI9A 4LOSA 1SPPA 3ZOIA 1J84A 1CR7A 2B5HA 4AFCA 1W2TA 5E8AA 5AC91 2OUHA 1LU1A 1OA2A 5FZDA 4P9IA 1LODA 3MZHA 2XLGA 1W90A 2GN3A 2JG8C 1CQ9A 1D4M2 3RGBA 4Q4V2 4WBBA 4AQ2A 5DDJ1 4A7KA 4UFMA 1OH3A 2BGPA 4QPGC 4WM8A 5CKMA 2QQOA 2WFF3 2F4LA 4Y33A 4MH0E 2FMYA 3KLSA 4LNVA 1AR63 4TLGA 1BXHA 3EQEA 4FBFA 4O61A 4XHXA 2GP5A 2ADEA 3CF6E 3OUHA 2BVBA 3WV6A 4ZZ8A 3C7GA 3M3QA 2XOMA 4LITA 3DXTA 4Y26A 3VBRA 3K3OA 1US3A 3ZFGA 1W2NA 1KD7A 5A6ZA 4C91A 2DFCA 2Y0IA 1GV9A 1JBCA 4IDZA 4B4PA 3E97A 4D69A 2D40A 4UOJA 3N4MA 2PXJA 4H55A 2W87A 3THPA 4AAPA 3T4HB 3JBG2 4F7ZA 1TMF1 1XNDA 2RS12 3INAA 3M4FA 5FYCA 5C4WA 3CJXA 1ULDA 4P14A 1QJU2 4HN1A 4CDUC 3RWNA 1EP0A 2BW8A 4LHNA 4AR2A 1VAVA 4HK8A 2IXIA 2K9ZA 2RMU1 3VV1A 1JYNA 2LRPA 4BIOA 4Q4W3 4FSJA 3CJIC 4IV3B 3ZXKA 3WY6A 2NZ9A 3WF0A 2XG3A 2ZA9A 2ERFA 4UWDA 4WVMB 4FOQA 4CDQB 4FOVA 5DUXA 1RUI3 3KT7A 2JE8A 2CHHA 2C26A 1BHGA 4CCOA 3OGGA 1DZQA 4LHLA 1Y7BA 5DZFA 4TLFA 1X7NA 1MQTA 3FLPA 5FO7B 5FZFA 4YYOA 3RSJA 4HETA 3JXSA 3RFRA 5FUIA 2BEOA 4A7ZA 5EJ3A 2MHFA 3ACGA 4KWLA 3VBFA 5A32A 2G1MA 1W2OA 2WL1A 3TAYA 3AP4A 3JD73 2HWD3 2OX0A 1VBD2 4EV0A 1SLAA 1DGWX 1R082 3EYPA 1ZYBA 2DVAA 2H6BA 3WF3A 1VRH1 1J83A 3ZFEB 5J1XA 1NZCA 5EXOA 2TUNA 4Y22A 1LR5A 3H1YA 3ZXAC 4CZSA 1Q8SA 3VHNA 2V4VA 2XUEA 1APNA 4IL7A 4I0AA 2Y8KA 1AR83 4LMFA 2WNVC 5FK8A 3ACLA 2R7EB 1ASJ1 3N3HA 3SQOA 4OI4A 1NYWA 3PLQA 5GM0A 4BPZA 3O14A 1R1A3 5HCFA 3W58A 3VGIA 4Y1YA 3VLBB 2VUJA
chains in the Genus database with same CATH topology
3LFMA 4MG2A 4NRMA 3I49A 3S5AA 5F8PA 4ZS3A 4QKFA 3O1RA 3RZMA 4IE0A 3I3QA 4IE4A 4OCTA 4QKBA 3O1MA 2FDIA 3H8OA 3BTZA 3H8XA 4O61A 3O1VA 4QKNA 2FDFA 3BIEA 4CXXA 3BTXA 3RZJA 2FDJA 3RZKA 3T3YA 3O1PA 4NIIA 4RFRB 4IDZA 3BUCA 3KHCA 4CXYA 3O1OA 3BU0A 4JHTA 4NPMA 4IE5A 3I3MA 3T4HB 3RZLA 2FDHA 2FD8A 3BI3A 3O1UA 4NJ4A 4IE6A 3KHBA 2FDKA 4NRPA 3RZGA 4ZHNA 2FDGA 4QKDA 4ZS2A 4O7XA 3H8RA 4NRQA 2IUWA 4NPLA 3O1TA 3S57A 4CXWA 4NIHA 3BTYA 3T4VA 4NIGA 4NROA 5DABA 3BKZA 3I2OA 4MGTA 4NIDA 3O1SA 4IE7A 4QHOA 3RZHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LFM A;  4MG2 A;  4NRM A;  3I49 A;  3S5A A;  5F8P A;  4ZS3 A;  4QKF A;  3O1R A;  3RZM A;  4IE0 A;  3I3Q A;  4IE4 A;  4OCT A;  4QKB A;  3O1M A;  2FDI A;  3H8O A;  3BTZ A;  3H8X A;  4O61 A;  3O1V A;  4QKN A;  2FDF A;  3BIE A;  4CXX A;  3BTX A;  3RZJ A;  2FDJ A;  3RZK A;  3T3Y A;  3O1P A;  4NII A;  4RFR B;  4IDZ A;  3BUC A;  3KHC A;  4CXY A;  3O1O A;  3BU0 A;  4JHT A;  4NPM A;  4IE5 A;  3I3M A;  3T4H B;  3RZL A;  2FDH A;  2FD8 A;  3BI3 A;  3O1U A;  4NJ4 A;  4IE6 A;  3KHB A;  2FDK A;  4NRP A;  3RZG A;  4ZHN A;  2FDG A;  4QKD A;  4ZS2 A;  4O7X A;  3H8R A;  4NRQ A;  2IUW A;  4NPL A;  3O1T A;  3S57 A;  4CXW A;  4NIH A;  3BTY A;  3T4V A;  4NIG A;  4NRO A;  5DAB A;  3BKZ A;  3I2O A;  4MGT A;  4NID A;  3O1S A;  4IE7 A;  4QHO A;  3RZH A; 
#chains in the Genus database with same CATH topology
 4N53 B;  4WM7 C;  3BN6 A;  1OPO A;  4C0B A;  2SBA A;  3B3Q E;  4UAP A;  5FP3 A;  3WP6 A;  4LO5 B;  5KR7 A;  4CCN A;  3UJQ A;  4ZPI A;  2GC0 A;  1CON A;  3MLK A;  1C3H A;  4N43 A;  1RUE 1;  1BYH A;  3ASI A;  3PU3 A;  2ET1 A;  5I0D A;  5BPX A;  3PUQ A;  4MZU A;  2R1D A;  1JW6 A;  4YVS C;  2VOT A;  1B35 A;  4Q27 A;  4XAA A;  4CDW C;  4P9J A;  2D93 A;  1SPP B;  4XF4 A;  2HWF 3;  1R09 3;  4FPL A;  4IE0 A;  1CJD A;  1X9T A;  3O5S A;  3TWI A;  4D6S A;  5A6X A;  1AJK A;  5KXB A;  3M1H A;  2A6Y A;  5F39 A;  4BME A;  1HLC A;  4YG6 A;  1VBE 3;  2BGO A;  3ZN6 A;  4YGB A;  2RJL A;  4EE2 A;  1BBT 2;  2ZOE B;  2Q30 A;  5A1F A;  1YYN A;  3VBS A;  5FMB A;  1O5L A;  5A7N A;  3RDI A;  4YM0 A;  3RQ0 A;  4X8N A;  3HN1 A;  5CFD A;  3IMM A;  2DFB A;  2QQI A;  4QD2 A;  1ZM1 A;  3CNA A;  1O3S A;  4XET A;  2IWG B;  4QKN A;  2IXK A;  3VBR B;  4Z2W A;  3DF0 A;  3RYR A;  3BIE A;  4YFW A;  3T08 A;  3NVC A;  4FCA A;  4IEO A;  2GAL A;  2JEN A;  3C8X A;  4MXW A;  3O1P A;  2X10 A;  1QMJ A;  1BMV 2;  4Z1V A;  5DQ0 A;  3KD4 A;  3EB7 A;  4AYU A;  1DCS A;  2IFR A;  1SG3 A;  2BBA A;  4PHZ A;  1XE8 A;  4D3W A;  2ADD A;  2RHP A;  5KBF A;  4N8M A;  1WD3 A;  3VBO C;  1W9F A;  5A7P A;  3TOJ A;  4CA9 A;  2VNO A;  1AR6 1;  4AI8 A;  4GQ7 A;  3HNY M;  3BGA A;  2G19 A;  4YSF A;  1K42 A;  4DUX A;  1GYK A;  1OOP B;  1LRH A;  4AI2 A;  5B4N A;  4YPJ A;  2A3Y A;  5C5T A;  2VZV A;  2D6O X;  2R0H A;  4M3C A;  1HXS 3;  3W5N A;  1NKG A;  4P02 B;  4L99 A;  4DIN B;  1H2K A;  1MQT B;  1SAC A;  3IWZ A;  4A3Z A;  5JOZ A;  1UU5 A;  4FXG B;  4XBQ A;  2AC1 A;  3OGV A;  1BQP A;  4GMP 0;  1ZBA 2;  4AGG A;  4A42 A;  4IEV A;  5K0U C;  2GH2 A;  4Y1U A;  3DPR A;  1ALY A;  1OUX A;  4LO8 A;  5JZG C;  1QEX A;  4GMP 3;  4PI0 A;  3HAG A;  1ND3 B;  4BE3 A;  1OQD A;  1QWR A;  1H8V A;  1AL2 2;  3UNP A;  2WQ4 A;  4KWJ A;  4NPL A;  2W5F A;  1RL3 A;  4PDW A;  2XWJ B;  2GSY A;  4Q4W 1;  1CJP A;  4RQP B;  1SEF A;  1Q5O A;  4QQP A;  2WUH A;  4K8R B;  5KHG A;  1F31 A;  5A7Q A;  1IHM A;  2LM3 A;  3BPZ A;  3DKW A;  5FK7 A;  1VMH A;  5BV6 A;  2MNG A;  3CDZ B;  4QM9 A;  1LEN A;  3SNM A;  3MIC A;  3X29 B;  4EWD A;  1UYY A;  3H7Y A;  3OEB A;  5F37 A;  3ZKU A;  3O0X A;  1QH7 A;  2GAU A;  3ZMN A;  5CFC B;  2E7A A;  4GH4 A;  4N43 B;  2D6P A;  3A0K A;  5FP8 A;  5JLV A;  2QVS B;  2O8O A;  4N7U A;  1PM7 A;  2XBO 2;  4LLO A;  2ZX1 A;  4CEY B;  1LHN A;  3NNM A;  1RIR A;  3NW4 A;  1U5Z A;  4OI0 A;  3JU9 A;  2YY1 A;  4ZU4 A;  3O1R A;  1LU2 A;  1EAH 1;  1PGW 2;  4E2Q A;  3RZM A;  1R1A 1;  2GMM A;  3ZXF A;  4EWE A;  4E4H A;  3DYM A;  3D5O A;  2Q0A A;  3RJR A;  2R07 3;  3NJX A;  1CAX A;  1COV 1;  4LBQ D;  4LEJ A;  3VBS B;  3LPF A;  3ZYI B;  3VD5 A;  1E5H A;  3VD7 A;  4AVS A;  4A4A A;  1U5Y A;  1GZC A;  1X8E A;  4XJW A;  3ZM8 A;  1GBG A;  5SV8 A;  4MX3 A;  5ACA 1;  3VBU C;  2VQA A;  4IQP A;  4URT A;  5F32 A;  5BNP C;  1DG6 A;  1GQG A;  2PAE A;  3MUZ 1;  3J7M A;  2W94 A;  4MXV A;  3WD5 A;  1RMU 3;  5LBE A;  5J3U A;  1WCU A;  1CAW A;  2OA2 A;  4FFH A;  4KGG A;  5F3G A;  2D3P A;  1LOA A;  1DQ5 A;  1WUV A;  1RVF 3;  2C4X A;  2WSU A;  3ATG A;  4MXW B;  1SLB A;  5J48 A;  2HWF 1;  5FIX A;  1R09 1;  1VR3 A;  2Y0O A;  1RUD 2;  3KT4 A;  4ISR A;  2YG0 A;  1F9K A;  3MIH A;  3F95 A;  2YFZ A;  1UMZ A;  2GNT A;  2IC1 A;  4M0H A;  4M00 A;  2IXJ A;  1NXM A;  3O1O A;  2Z69 A;  1H8T A;  2VZU A;  2MEV 3;  2XJP A;  2ZGN A;  1JZ5 A;  1S1A A;  2VW2 A;  3AX4 A;  4R9C A;  3KV5 A;  1SZB A;  1D7P M;  2ORX A;  4F3J A;  1VAM A;  2BOJ A;  1AL0 G;  1KGY A;  1UKR A;  3E6B A;  1W0P A;  2BQP A;  1AYN 3;  1UZY A;  2ARE A;  1W8W A;  2WQ8 A;  2VXR A;  1RUJ 2;  5L9R A;  4YM3 A;  2P3Y A;  1FT9 A;  4GB3 3;  4M3C B;  5CA6 A;  4DXT A;  1PO2 3;  4OQ9 A;  3VDD A;  5K4L A;  3KHB A;  5IVV A;  2VC9 A;  1YQ5 A;  2ARA A;  5BXX A;  1W9T A;  1UY1 A;  2ES3 A;  4LBQ A;  1QJY 2;  3RI9 A;  2ZJC A;  2J22 A;  1W05 A;  4I30 A;  1AXY A;  1IGO A;  3SCG A;  1JUI A;  3U78 A;  4CDQ C;  1TME 1;  5C3Q A;  4XFG A;  5FZ8 A;  2PQS A;  1WCD J;  2HBT A;  1PMI A;  2JB4 A;  2GC2 A;  2VCM A;  5HBA A;  1JN2 P;  2CAU A;  3PJQ A;  2FCU A;  1MZE A;  3T2Q A;  4OI1 A;  4DXZ A;  5FY1 A;  2W1S A;  4CUG A;  4DZG A;  1W04 A;  2WYF A;  1US2 A;  1WZX A;  3HPN A;  2IXH A;  4ATE A;  2HWB 2;  4FTB A;  3OPW A;  2QNK A;  4M0N A;  1W6Q A;  2D6N A;  2JG9 A;  5G05 L;  1DQ2 A;  3FBM A;  4I01 A;  3RMX A;  2ZAH A;  3BTY A;  4KU8 A;  2DVG A;  2DVF A;  2C1F A;  3GJB A;  3WQ7 A;  2KM2 A;  3ZFE C;  1HXS 1;  2CDP A;  1XNT A;  5IWF A;  4HVQ A;  1AYM 1;  1W9W A;  2QQK A;  5EQU A;  5L73 A;  1IPS A;  2YHJ A;  4NAM A;  1FYU A;  1RUH 3;  2CWS A;  2JDA A;  2XXZ A;  3GBG A;  4RS5 A;  4CUB A;  5FKC A;  3B7M A;  3EBR A;  4FP3 A;  1JI6 A;  2B42 B;  3FE5 A;  4GMP 1;  1AR9 2;  1FNY A;  1UN1 A;  1UOG A;  1OUR A;  1HB3 A;  3D6E A;  4FQZ A;  2WFF 2;  3OG2 A;  2HWE 2;  2VMI A;  4LBL A;  1NLS A;  1ODM A;  1ZA7 A;  4KU7 A;  4PLM A;  4BLJ A;  1C28 A;  5CG9 A;  3ZSK A;  3EXU A;  3H3U A;  4UYB A;  4EZ4 A;  3LB9 A;  4CE8 A;  4EYU A;  2VO5 A;  3GBW A;  3ORJ A;  4HPK A;  3ZMO A;  2WIN B;  3G7D A;  1S0D A;  3AKR A;  2JEC A;  3SH5 A;  5A7W A;  3AL6 A;  4B7E A;  3VD9 A;  1PVC 1;  1EPW A;  4Q4Y 1;  4Q29 A;  4DY3 A;  1GFF 2;  1W8U A;  5DAW A;  1BVP 1;  4A45 A;  3D4K A;  2XGX A;  2B8M A;  3I54 A;  4BIS A;  4CDX B;  4MYE A;  3H3Z A;  5D2A A;  3H8O A;  4QX3 A;  3FFZ A;  2WNO A;  4AOC A;  5FYM A;  4BQW A;  1IQA A;  2ILM A;  1W0O A;  2E32 A;  2VCA A;  4P9L A;  1ZNP A;  5D8A B;  3MLL A;  2JKB A;  4B4R A;  2VE1 A;  5DAV A;  4JV4 A;  2HLE A;  3HMY A;  3VBR C;  3KQR A;  1EUT A;  1RUI 2;  3KM5 A;  1RUF 1;  2YRO A;  3NKT A;  4ITC A;  4AFM A;  1PGL 1;  5LA9 A;  2JDP A;  2YZ4 A;  4Q4X 1;  1NY7 1;  1G9C A;  3B02 A;  3CQO A;  5JUV A;  1DYK A;  2VUA A;  3PME A;  1SBF A;  5FZL A;  3OF1 A;  4FOW A;  1YO8 A;  1STM A;  3QLQ A;  3VUO A;  5FZO B;  1GKB A;  5FZ7 A;  2VVD A;  3WR0 A;  2NMO A;  3M3C A;  2HWD 2;  1CZV A;  4Y4R A;  3NV1 A;  2UY8 A;  2RM2 2;  1TZO A;  3F2Z A;  4XUP A;  5FCC A;  2VME A;  3VDD B;  1GNZ A;  2ZGP A;  1ENQ A;  1RVF 1;  2VMH A;  4XQ4 A;  3GZA A;  2RR1 2;  5GZD A;  1UY0 A;  2WO3 A;  4J1X A;  5FFO C;  3POB A;  4DQA A;  1S0B A;  2DUO A;  5CG8 A;  1RUC 2;  5FY5 A;  4CU6 A;  2NP0 A;  4R9D A;  4QPI A;  4IEX A;  1WBF A;  1MQT C;  1PIV 3;  4AHX A;  2X8K A;  5FYU A;  1PZ9 A;  4FTS A;  3ZDV A;  3HBZ A;  2XVK A;  4LBJ A;  2QJV A;  4JRA A;  3WUD A;  3U11 A;  1OHF A;  4NRQ A;  1W6P A;  1QHD A;  2QQU A;  1OXC A;  1JS9 A;  3HEI A;  4LIV A;  5E88 A;  1ND3 C;  4HAN A;  2WNU B;  4XYX A;  2GME A;  2JXA A;  1NAE A;  4COU A;  1PO2 1;  3J26 N;  4PJY A;  5F5C A;  3E5X A;  1UIK A;  2Z79 A;  5FP4 A;  1CAU B;  3U37 A;  3WF2 A;  4CCD A;  5FZG A;  2D44 A;  1QJX 3;  2B4K A;  2Q1F A;  2XKP A;  1RGS A;  4IET A;  1W8T A;  2NM1 A;  2JB8 A;  3GCW A;  5I8S A;  3B00 A;  4L97 A;  1JYW A;  2J1E A;  4MOA A;  4C1W A;  1SLT A;  3WNP A;  5LCW L;  3K48 A;  3N36 A;  5GLW A;  2OW4 A;  2KD7 A;  1ZA4 A;  4S2D A;  4XJZ A;  1NCR A;  1XNA A;  5IUQ A;  5CFC C;  4NN0 A;  4N43 C;  1JYC A;  5LWB A;  2WQZ C;  3MV0 1;  1XYN A;  4PF1 A;  5DN2 A;  3DV8 A;  1NCQ B;  2WS9 3;  1XXN A;  1QGL A;  1IS5 A;  5F8P A;  2ETE A;  1AHS A;  2WNV B;  3CIH A;  1V9U 3;  3OBT A;  4JKM A;  1JU3 A;  1K5J A;  2DTY A;  4QXC A;  4XFA A;  1PMJ X;  3MHZ A;  3WP5 A;  4CU9 A;  5IVC A;  5HI0 A;  3MGU A;  4D0Q A;  2X5I A;  4DUV A;  2PLV 2;  1DHK B;  3I8T A;  4XTM A;  1Z7S 2;  4Q4V 1;  4Y1V A;  3THD A;  5K7P A;  1GWM A;  3R4D B;  5A3O A;  3WW3 A;  4KMQ A;  4FPE A;  2VNR A;  2P6C A;  4Q1P A;  3MEP A;  1C8M 2;  1NE6 A;  3GCX A;  2P5B A;  3VBS C;  3ZR6 A;  5I0S A;  2FDI A;  5GLZ A;  5FZI A;  4LE4 A;  2WAA A;  4XEZ A;  2ID4 A;  4JRL A;  5J96 B;  3WG4 A;  3C7E A;  4Y24 A;  3NV2 A;  5T5J A;  2KR2 A;  4RGA A;  1YI9 A;  2GC3 A;  2WNE A;  4COW A;  1Y9G A;  5C9A A;  2YU2 A;  3O1V A;  5ANN A;  3FFQ A;  1C5H A;  2L9L A;  1NT0 A;  3MIF A;  3J7L A;  3T1M A;  2CYF A;  5FZ3 A;  2YPD A;  2Y6J A;  2WZR 1;  3V0A A;  1NLQ A;  2PHW A;  4BM8 A;  1ZRR A;  3PVN A;  4IUG A;  3JBG 1;  4LHK A;  4CXY A;  1UX6 A;  2ZGT A;  3HN3 A;  1P8J A;  1VB4 A;  3NAP A;  2PN5 A;  5CNA A;  1QJU 1;  2PMW B;  3KMH A;  1OT5 A;  1VAL A;  4HOO A;  1OLR A;  1SDW A;  4TYS A;  1LOF C;  1V6O A;  4UF0 B;  2VTX A;  1UPI A;  3USU B;  1VBC 3;  3H1M A;  4JX0 A;  5GZC A;  3NL1 A;  5EPA A;  1Y43 B;  1MZF A;  4XZP A;  4CYD A;  2VW1 A;  3O7O A;  3V64 A;  1O6U A;  3AMN A;  3MBW A;  2A73 B;  1K5M B;  4U2A A;  1ZZ7 A;  2LRO A;  3IBM A;  4EN0 A;  1AUY A;  2BPA 2;  2C0Z A;  2VMF A;  1HRI 2;  2A6W A;  1HN0 A;  3FHI B;  3LOI A;  4FO9 A;  3ETQ A;  3N9L A;  4QXK A;  1WMX A;  4WZF A;  4ET7 A;  2G9G A;  1OVP A;  1G9A A;  3AFG A;  5H9P A;  5JAX A;  1RUG 3;  3POY A;  1BEV 2;  3A23 A;  3DPR C;  4QKD A;  4BLI A;  1BZW A;  5FXW A;  5IVE A;  1RJ7 A;  1A3K A;  3CO2 A;  2DV9 A;  4R8H A;  1J1T A;  5C70 A;  1TQ5 A;  5FUP A;  5C8C A;  1SLC A;  2VZP A;  1AR7 2;  3WSO A;  3O1T A;  4XQW A;  2VG9 A;  4OUM A;  1D2Q A;  1HIX A;  4IW3 A;  3ROU A;  3S7I A;  3OY8 A;  3I59 A;  3UGF A;  2DF7 A;  2W1W A;  3LEK A;  2AAC A;  2DUR A;  1VRH 3;  2IVI B;  3RMY A;  4RHV 3;  2JDZ A;  2LS6 A;  3GZU C;  4LO4 B;  2CV6 A;  2BNM A;  1SQ4 A;  3DUI A;  1RUO A;  1EY2 A;  2P3K A;  3BB6 A;  1SCS A;  2NPI A;  1ASJ 3;  3KS7 A;  1POQ A;  4LPL A;  1I3H A;  1RHI 3;  4XUN A;  4GKY A;  4D94 A;  2R07 2;  4ES8 A;  5JSO A;  3R05 A;  5FYH A;  1KJR A;  2YBP A;  3H50 A;  3U4X A;  1O3R A;  4GWM A;  3TN9 3;  4EZH A;  3FUQ A;  4A6S A;  2R04 2;  1ZRC A;  2WWU A;  2D6K A;  1HB2 A;  2RE9 A;  3JQW A;  4FPG A;  1XU2 A;  4SBV A;  3CU7 A;  2VQT A;  1FPN 3;  1KDK A;  1ZBE 2;  3OGS A;  2V73 A;  1RUE 3;  3S6P A;  3T0D A;  1HW5 A;  3WXP A;  4EN6 B;  2WZ8 A;  4L92 A;  4K21 A;  2GH8 A;  3FLT A;  1QJX 1;  4QU2 A;  1PK6 B;  5BNO B;  1RB8 G;  4BK5 A;  5M0T A;  2BBV A;  4FQ4 A;  5FXV A;  1OA3 A;  3KF3 A;  3RJ2 X;  4TTG A;  3APB A;  2Q4S A;  4WVZ A;  1DFQ A;  1VRB A;  3K46 A;  3AYC A;  2MEV 2;  3AVS A;  1Q8O A;  4QB2 A;  5A6Y A;  1NA1 A;  3CEW A;  5A3U A;  3ZFF A;  5JOX A;  1ND2 A;  1NG0 A;  2D3R A;  1WLD A;  1XPW A;  2HWC 2;  4CDX C;  2QBX A;  4I02 A;  3A0N A;  4QX0 A;  5IAV A;  1UYP A;  1YQ8 A;  2F4P A;  2Z42 A;  4DIQ A;  2O0O A;  1XC6 A;  2DTW A;  2I45 A;  3VZO A;  4Z8B A;  1QNY A;  2WS9 1;  4GB3 2;  4P9G A;  4RR3 B;  5A33 A;  3VZM A;  4NAO A;  2TNF A;  1PO1 2;  1SLL A;  2ATF A;  3H8U A;  3UYJ A;  3IDB B;  3POI A;  3V0A B;  4Q1R A;  3PUH A;  5FXX A;  5KC6 A;  4B29 A;  3T2T A;  2KXL A;  2UU8 A;  5E1R A;  5FP7 A;  4UFH A;  1CPM A;  1KS4 A;  1QH6 A;  1WW7 A;  4CP0 A;  5C8W A;  5FZB A;  3ZXG A;  4QDS A;  2ZBJ A;  1BLZ A;  5EJZ B;  4E4S A;  4MO3 M;  1HQW A;  4HT1 T;  5JI7 A;  5DAQ A;  3VBU B;  2ZX4 A;  5FZH A;  5BNP B;  4AXO A;  3POG A;  4EWA A;  3N7J A;  4PIZ A;  4RFT 0;  4NJ4 A;  1GLH A;  3ZXJ A;  4AE2 A;  3I4I A;  5HCB A;  1GUI A;  2DU0 A;  2RDN A;  4I09 A;  2P1B A;  4PQ9 A;  3W21 A;  1IOA A;  3VDD C;  1DGR N;  2VAU A;  1OSG A;  4XBN A;  2OZ6 A;  3WQ1 A;  2PHX A;  1FMD 3;  1M06 G;  3VL9 A;  4NHM A;  1ZBA 1;  3SKJ E;  4HSJ A;  2WZE A;  4YW6 A;  4ISQ A;  4Z82 A;  2SLI A;  3ALQ A;  2HEV F;  1UOB A;  3BIW E;  2D3S A;  5FY9 A;  3LSE A;  2HYK A;  3A7Q A;  3N9Q A;  3PU8 A;  1FV3 A;  1JZ6 A;  5FBJ A;  1YQC A;  1XB9 A;  1DIW A;  3FHQ A;  5FZ0 A;  3U75 A;  1W06 A;  2PEL A;  1XOY A;  2R06 2;  3POF A;  1VBC 1;  3MI8 A;  2ORZ A;  2VUC A;  3LIH A;  3DYP A;  1FNZ A;  2QTW B;  4FXK B;  5FMC A;  2XDV A;  1O4T A;  5J09 A;  2WNU C;  2ARX A;  3SH4 A;  1VBB 3;  5A6Q A;  3ILF A;  1OPM A;  1WLC A;  3IT8 A;  3ZX7 A;  4JDO A;  1Y9Q A;  1X36 A;  5FBZ A;  1YFU A;  2UUR A;  2PQQ A;  3I2O A;  4XXP A;  3PVE A;  4IES A;  3Q9O A;  3DKQ A;  4L8Q A;  1IPJ A;  2ZAB A;  2PTM A;  3RYK A;  3HNM A;  4MUV A;  1RUG 1;  3E6C C;  1RXF A;  4DEQ A;  1V00 A;  3AP7 A;  3RZH A;  3LZZ A;  1S2B A;  3LDK A;  2FZ1 A;  2BV4 A;  3FLR A;  5CZK A;  2WSV A;  1OD3 A;  1RTV A;  3QD6 A;  5FV3 A;  4C8D A;  2VOV A;  4S2F A;  2V09 A;  1DQ1 A;  5FMD A;  1DBN A;  1C57 A;  1HRV 3;  2P3J A;  2EXK A;  3L2H A;  4UFI A;  5FZ6 A;  5AFB A;  3GF6 A;  2F17 A;  3NNG A;  1TNF A;  2ZS6 B;  3B93 A;  1XQN A;  4Q0V A;  1Y9M A;  4RHV 1;  5GZF A;  3VZN A;  1PGW 1;  4FFF A;  4RYD A;  3UET A;  1JYI A;  1NCQ C;  4EN8 B;  5FOJ B;  1HJF A;  1YFW A;  2BNN A;  3AYA A;  2Z5W A;  1UU4 A;  4P5H A;  3PUS A;  4UFK A;  1EAH 3;  5LRS A;  1RHI 1;  1YUD A;  3OUI A;  4X6Q B;  4YW1 A;  1RIN A;  3T2O A;  3SCF A;  3AP9 A;  2PYT A;  1I6X A;  2JJ6 A;  1O8S A;  3IMN A;  4H7L A;  3WDX A;  1J59 A;  2J1A A;  1COV 3;  2TBV A;  2PHF A;  1WA6 X;  2BER A;  4KL1 A;  5ABJ B;  1UW8 A;  3BPS A;  4W4Z A;  4YM1 A;  5ACA 3;  1JOJ A;  4QXH A;  3NJZ A;  5F7U A;  1MEC 1;  1X9P A;  1IS4 A;  1FPN 1;  3L9J T;  4I0W B;  4LUM A;  5I0T A;  1QY4 A;  2QE3 A;  4YNI A;  5FYY A;  2Q1M A;  3GHN A;  1RUD 1;  1GP4 A;  3ZYG A;  4JDN A;  4PBP A;  5CB7 A;  1IPK A;  4NPR A;  3RZK A;  1FAY A;  5A80 A;  3U4S A;  4N9H A;  4DO0 A;  4S2H A;  2H0B A;  1W9Y A;  1FOD 3;  1NX9 A;  3DYO A;  1VBA 3;  4WVW A;  2CDO A;  3I2F A;  4I2O A;  3E5U A;  1FX5 A;  2VVF A;  2RS3 2;  3SCH A;  2O1Q A;  5APA A;  2OQ6 A;  3TBD A;  2CAV A;  4B1L A;  3PMS A;  3SH3 A;  5FPB A;  4WM8 B;  2OYZ A;  1UZW A;  5HXM A;  1RUJ 1;  2ZZQ A;  2QQP A;  4M01 A;  4QT6 A;  3ZSL A;  4QPY A;  3KV4 A;  3VKM A;  3ZFG B;  3RVH A;  2ZEX A;  2P2K A;  2X05 A;  2WR9 A;  1GP6 A;  2PA7 A;  4EQV A;  3ZSM A;  5IVF A;  1K5M C;  3B9C A;  4JTO A;  3CKH A;  2AGS A;  1YJK A;  4HFS A;  1ONA A;  4JGZ A;  5FPA A;  2WDB A;  1W3X A;  3Q8C A;  2CWM A;  2EXH A;  1G9D A;  2QZ2 A;  4NRP A;  2OS2 A;  1DU3 D;  3IKW A;  5AVP A;  5FPU A;  3NO8 A;  4P5Y A;  5T55 A;  5A1L A;  4FPY A;  1TME 3;  4Q0S A;  4YZ1 A;  5GAL A;  5FYT A;  2FDG A;  4LK6 A;  3AKS A;  2YBK A;  5LK5 A;  4OVE A;  3ZYF A;  4FFI A;  5LA1 A;  5C4W B;  4RA0 A;  5JDB A;  4FP2 A;  3P6B A;  5GKA C;  5A7O A;  3FMG A;  2VPV A;  1LGC A;  3OPT A;  3MDP A;  4CEW A;  2YGM A;  3FL7 A;  3U1X A;  4CXW A;  5GZG A;  1G86 A;  1X8M A;  4XCB A;  1FMD 1;  4C0H A;  4BQX A;  1TE1 B;  2EIG A;  3HR9 A;  1JZ3 A;  3BKZ A;  1AYM 3;  5T3N A;  1JZ2 A;  1CX4 A;  1ODN A;  2D5F A;  4FI9 A;  4FOY A;  4MSV A;  2XLA A;  1EV1 2;  5L7O A;  4D6Q A;  1AR9 1;  4QHO A;  1ULP A;  3V65 A;  1W6O A;  2ZTN A;  5SV5 A;  3VBF B;  5I8Y A;  5A32 B;  3ZO0 B;  5CIR A;  3WIN E;  1FXZ A;  5AC9 2;  2YU1 A;  4M3C F;  2YV8 A;  1MS8 A;  2HWE 1;  3BYW A;  4TWT A;  4BQY A;  2JD9 A;  1VMF A;  3OEA A;  3FX3 A;  5DDJ 2;  1YQ2 A;  3KZ4 C;  5H9S A;  3C3V A;  4H2A A;  5BNQ A;  4Y22 B;  1QQP 3;  2UWB A;  1VBB 1;  5JIU A;  1OLM E;  4CCC A;  1YXW A;  2WBK A;  5C3S A;  4MGY E;  2A3W A;  1YRZ A;  4OLL A;  1BKZ A;  2Y34 A;  2J1R A;  4IGP A;  3ES4 A;  3ELN A;  1OH4 A;  5JI9 A;  2X5I C;  5BNO C;  1KXG A;  1PK6 C;  1YFY A;  3TYJ A;  3QH6 A;  4LOT A;  4IE4 A;  1IG3 A;  1PVC 3;  3M70 A;  3KWV A;  4IEP A;  4Q4Y 3;  3U10 A;  1LES A;  4LBM A;  1NLR A;  1WW5 A;  3N7K A;  3O1M A;  1N1Y A;  1LEM A;  2PHD A;  4CCK A;  3P5B A;  2EVX A;  4GKX A;  1TMF 2;  3OGR A;  1HRV 1;  4NVP A;  1HX6 A;  3III A;  4XXA A;  3H8X A;  1JYT A;  1YFX A;  3MV1 1;  4FPF A;  5FP9 A;  1B35 B;  1RC6 A;  4LTA A;  5J36 A;  2RMU 2;  3CZU A;  1LHO A;  3JCI A;  3POJ A;  5T50 A;  4NUB A;  2A6X A;  2BP6 A;  1KQR A;  3LF7 A;  4RR3 C;  1H2M A;  1A8D A;  1UD1 A;  4UXA A;  4COY A;  4KGQ A;  1W28 A;  1RUF 3;  1LUL A;  3ZSE A;  1QOO A;  2BJS A;  3HD8 B;  3ZN6 B;  4Q4X 3;  2WO7 A;  4QHB A;  1V6I A;  3NAP C;  1GZ9 A;  1NQD A;  4PQQ A;  5AFE A;  3RZL A;  3J8F 3;  2R1B A;  4LLF A;  4N7I A;  3WOG A;  1LKN A;  2RM2 1;  1ENS A;  1WBL A;  4HK9 A;  5CFD B;  1G9F A;  3ACH A;  3QCW A;  3VZK A;  1UKG A;  2EXI A;  5I93 A;  2RR1 1;  2HH9 A;  3UL2 A;  4CTE A;  4DXR A;  1UY3 A;  1W9S A;  5KHH A;  4ORF A;  1H2L A;  4BIF A;  4P08 A;  1VRH 2;  3T0A A;  1DGL A;  1RUC 1;  4OUS A;  3BCW A;  5FYV A;  4QX2 A;  2V5Y A;  1U0A A;  2RDR A;  2XJT A;  3FUO A;  3NJV A;  3AL5 A;  3ABZ A;  3T2P A;  1FOD 1;  1VBA 1;  3RZG A;  4JGY A;  2DUP A;  2E53 A;  2HEW F;  4NR1 A;  4SLI A;  4ERO A;  4KQ7 A;  4OHY A;  1SHW B;  4CP1 A;  4QX5 A;  4HG6 B;  1O3T A;  2HEY F;  4UFL A;  1OLM A;  4PIX A;  5FLH A;  3LCP A;  5JVV A;  4TN7 A;  2VD7 A;  2C9K A;  2FMD A;  1RUE 2;  2ZGO A;  5F6L B;  1OKO A;  1S4C A;  1WA4 A;  4Q8K A;  1I1E A;  4FAH A;  1XRU A;  2XLF A;  2ZX2 A;  3A22 A;  5L7O B;  2XVL A;  3P3P A;  3WHU A;  4EN9 B;  5JXJ A;  3SIS A;  3DPR B;  4KNC A;  4D7S A;  4Z92 B;  1W39 A;  2P37 A;  2OPK A;  4S2G A;  2ZAC A;  1H2N A;  4RSU A;  2HKX A;  1JHN A;  4QPW A;  4QXB A;  2FHR A;  4PDW B;  3WW1 A;  4QM8 A;  1UWW A;  3GDB A;  2YUE A;  4NHL A;  3JQX A;  1WGP A;  2IXL A;  1F15 A;  1H1I A;  3D82 A;  4B8E A;  4LBO A;  3WG2 A;  5JWP A;  3I49 A;  5C6C A;  1C1L A;  1ZX5 A;  2RS5 3;  2Z4F A;  5IJR A;  4Y3O A;  2RDS A;  5FXZ A;  1GU3 A;  4CCJ A;  5LY1 A;  3H42 B;  1YWK A;  1ENR A;  5F6K A;  1LNS A;  3D0J A;  1PNF A;  5JXI A;  4NIA A;  5ISL A;  2GMP A;  2P17 A;  2C5D A;  4OCT A;  3NV4 A;  1S0C A;  3PUR A;  4PCR A;  4B1M A;  4XMI A;  4Q4V 3;  5LRR A;  5HV4 A;  4C1X A;  3MFA A;  1R64 A;  1JH5 A;  1JOB A;  1I5P A;  1L7R A;  1ND2 C;  2WT2 A;  4GH4 B;  3WG3 A;  2Q8E A;  2OPW A;  1W6M A;  3BU7 A;  5D21 A;  4CDU A;  1ZZ6 A;  4AI3 A;  3W59 A;  5JOW A;  1E5I A;  3S30 A;  4ONU A;  4IEU A;  1MVE A;  5ABJ C;  1QQP 1;  5C7G A;  1IS3 A;  2EAL A;  4QAW A;  5FQ0 A;  1AR6 2;  3CJI A;  2J42 A;  4F8A A;  1N3O A;  1CES A;  5E6H A;  2Y38 A;  3W20 A;  5ANQ A;  3ITQ A;  5T52 A;  4DMI A;  3PDQ A;  2JEM A;  1N3Q A;  5BYN A;  1QDC A;  2E9Q A;  5JIA A;  2VOW A;  1XE7 A;  2WZR 3;  4K20 A;  2VJX A;  1CAX B;  3FN9 A;  4XDP A;  4Z07 A;  1M4W A;  4QQ2 A;  2J7M A;  3JBG 3;  4XE9 A;  2OQ7 A;  1YQ6 A;  2RS1 3;  1WLT A;  2WC2 A;  4XF3 A;  2R16 A;  4XFF A;  1XYO A;  1QXR A;  2BTV C;  2GND A;  4BQ1 A;  1QJU 3;  3J7N A;  4IER A;  1GOH A;  1LAJ A;  3PVO A;  4O9G A;  4YAR A;  4WM8 C;  1YCI A;  4X6R B;  1CAW B;  3LA2 A;  2ZX3 A;  5A70 A;  1HRI 1;  5EJ1 B;  4DUW A;  4Q4W 2;  3ETP A;  5KXD A;  4XFH A;  4IEW A;  4AGV A;  4QDR A;  4L11 A;  2WA4 A;  1RIT A;  3ZFG C;  3WG1 A;  3SMH A;  1PX4 A;  5KXC A;  1JHJ A;  1BEV 1;  4WV8 A;  1POV 0;  1O4Y A;  1REF A;  1H8T B;  3FJS A;  3KCX A;  3UT0 A;  2R32 A;  4MLO A;  2GP3 A;  4WM7 A;  1F4H A;  3ME2 A;  3ZYP A;  3LAG A;  4MGQ A;  2VZR A;  3AKT A;  3J8F 1;  4QGL A;  4URA A;  2AEZ A;  2YGL A;  1GR3 A;  1AR7 1;  2VZ3 A;  5FYZ A;  5DZE A;  1UXX X;  2DVB A;  1R08 3;  2PHU A;  3JD7 2;  5F5A A;  5C4W C;  4MGK E;  1MS4 A;  2ZCW A;  2PHL A;  5C33 A;  1AF9 A;  2WO1 A;  5E16 A;  4MV2 A;  2NQY A;  4JC1 A;  4YVS A;  5JR7 B;  2ARC A;  2CGP A;  1SFN A;  5DPN A;  3HQR A;  4IGQ A;  4YVW A;  3T4V A;  2WJS A;  4HKL A;  4NIG A;  4LBQ B;  5F3E A;  3ZN4 A;  4AVB A;  4BZ4 A;  3G6J B;  4XFI A;  4MET A;  4AVT A;  4MGT A;  1AR8 2;  2G9Z A;  2GNM A;  4GUL A;  3VHO A;  4NID A;  1W8Z A;  4BH9 A;  3J7H A;  2XB6 C;  3UKT A;  3V56 A;  1R1A 2;  2X29 A;  2RV9 A;  2HBU A;  4ZZ5 A;  1OMI A;  2R04 1;  4AQT A;  1J3Q A;  1HB4 A;  3MW3 A;  1L7Q A;  3VBF C;  4COZ A;  1COV 2;  3WNL A;  1W99 A;  4COV A;  3E1F 1;  3KCC A;  1W6Q B;  2JG9 B;  2WYS A;  1XE0 A;  4B3N A;  5ACA 2;  2ZGL A;  4K8F A;  3VZL A;  4A7Y A;  3GZE A;  3K4A A;  4AFD A;  2JDM A;  4BMB A;  4CCL A;  3LKJ A;  2K46 A;  4PT6 A;  4AI1 A;  4LUL A;  4RN5 A;  4W6W A;  4E9K A;  2VZ1 A;  2IVJ A;  2UWA A;  2VUL A;  4BQ4 A;  4RS5 B;  3IPV A;  1GQH A;  2HWF 2;  3WQ0 A;  1R09 2;  4AAX A;  1A8M A;  1NXD 1;  3MFC A;  1UCX A;  2JIJ A;  3EO6 A;  4RGG A;  1IG0 A;  4AI0 A;  1HJG A;  2WWS A;  2YC0 A;  3PIG A;  4HN0 A;  4KG8 A;  1BBT 3;  4QKB A;  2XWB B;  1N47 A;  3QOP A;  2G9F A;  4UW4 A;  1H9P A;  4XTP A;  4Q5O A;  1VBE 2;  2HJI A;  2EIC A;  2QQW A;  3VBO A;  4R52 A;  2ZHN A;  1UZV A;  2VM9 A;  3OUJ A;  5FWE A;  3UK9 A;  1QIQ A;  2A3X A;  4NO4 A;  3J4U H;  4YW3 A;  4DB5 A;  4HL0 A;  1PO1 1;  3WT3 A;  1SDD B;  3CZJ A;  4Q0U A;  3NV3 A;  2UY9 A;  4XVH A;  1QXP A;  2RS5 1;  4HPK B;  1B35 C;  3VBH A;  5FYI A;  3BTX A;  1H4G A;  4FT8 A;  4K3U A;  4PF5 A;  4QMA A;  4V1P A;  3MF6 A;  1TG7 A;  5A7W B;  4AF9 A;  4ASM B;  1N3P A;  2P6H A;  5JXG A;  1S55 A;  3ACI A;  2W9X A;  3I2D A;  3R0R A;  2JDN A;  2K0G A;  1ST8 A;  4NPM A;  3TN9 1;  3VKF C;  1D4M 1;  1MPX A;  1OC1 A;  1MS9 A;  5C71 A;  5JZG A;  1ZZ9 A;  2ZX0 A;  5J98 B;  3THC A;  5FO9 B;  3HBK A;  4AK3 A;  4CSW A;  4LKF A;  3IM0 A;  5GLT A;  2VR4 A;  2FD8 A;  2R49 A;  2B7Y A;  5E89 A;  3FBY A;  1YC6 1;  3WNN A;  2A71 A;  5CFD C;  4K6B A;  3JUU A;  5IVY A;  1W8O A;  5A1A A;  1CWP A;  1UQX A;  4HLT A;  3SEE A;  1XNB A;  4HSL A;  3DEM A;  5IW0 A;  2BYV E;  3OYW A;  4ATF A;  2X53 S;  3AYD A;  5J37 A;  4LR4 A;  1HXS 2;  1O5U A;  4ES9 A;  4TSV A;  4BHP A;  2P34 A;  2XH6 A;  1I9R A;  4D6R A;  1ZBA 3;  3VHR A;  5A3P A;  1OFN A;  1ZRD A;  1MAC A;  1JZ8 A;  1IKP A;  3DN7 A;  1VB2 A;  1OBN A;  2YXS A;  3D8C A;  3WEZ A;  4AVC A;  2NLR A;  3KCY A;  4CPB D;  1LHV A;  2R06 1;  2RS1 1;  4K40 A;  5A3M A;  2OVU A;  4QX8 A;  1E5S A;  3EHK A;  1UYZ A;  1KRI A;  2IFW A;  1IS6 A;  1AL2 3;  3KB5 A;  3H8R A;  2IUW A;  1H9W A;  1S0G A;  1OKQ A;  2ZGS A;  4JQT A;  3AK0 A;  1ULC A;  4HON A;  4MGS A;  3LPG A;  2ZMK A;  1UY2 A;  2VW0 A;  4XJA A;  5FZA A;  3ZN5 A;  4AQ6 A;  4YVW B;  3S57 A;  1LOB A;  3S5A A;  3PUA A;  3I2H A;  2D6M A;  5HCH A;  4YGC A;  1PM4 A;  2B9V A;  1PNG A;  4AED A;  1WW6 A;  3SXW A;  4FFG A;  1DDL A;  5FYB A;  1DF0 A;  2JD4 A;  2ZGU A;  1LGB A;  3VDC A;  4QPI B;  3I2K A;  3T0B A;  4DS0 A;  2CY6 A;  3O1S A;  3IN9 A;  2QCS B;  3RRD A;  2WA3 A;  5L7O C;  2EAK A;  4ZU5 A;  4NWW A;  1Q8Q A;  2XQR A;  4PBO A;  4QU1 A;  3RZZ A;  4Y20 A;  4Z2A A;  3K2O A;  5FOB B;  4B4Q A;  1QJF A;  1SLI A;  3HVD A;  1W6P B;  1VBD 1;  2VY0 A;  3Q8B A;  1UXZ A;  1QOS A;  1R08 1;  4JDM A;  1BVV A;  2XUM A;  3MIE A;  4MHU A;  2XBO 3;  4PDW C;  1F5F A;  4YZ3 A;  4HBN A;  3PTY A;  5K8S A;  3IAQ A;  3AM2 A;  1LHU A;  1Z0H A;  2EF6 A;  3EJK A;  4NRM A;  3B69 A;  1ULG A;  2VH9 A;  5FZ4 A;  5JSP A;  2BNO A;  3AXD A;  4EJR A;  1MR5 A;  3OD4 A;  4YRD A;  2QDN A;  3TRS B;  4RD7 A;  1WLW A;  2JWP A;  4GA9 A;  4CPB A;  5FWJ A;  4G4F A;  2I07 B;  5FRA A;  5LB6 A;  2WN2 A;  2A75 A;  5A3W A;  1DYO A;  3OTF A;  1KJL A;  2WAB A;  2AR6 A;  3SKV A;  4CU7 A;  4KI5 M;  3LA7 A;  1NY7 2;  4P9X A;  2JKX A;  1Q8V A;  2EAA A;  1LHW A;  3ENR A;  4IV1 A;  4MGI E;  5T5P A;  4FVV A;  1AX0 A;  1NCR B;  1PZ7 A;  4XJ8 A;  4BA6 A;  2YFU A;  4GH4 C;  4OHV A;  3VD3 A;  2GDF A;  1DYP A;  3TEW A;  1O3Q A;  4N90 A;  1SFY A;  1RMU 2;  1UU6 A;  3MW4 A;  4ASK A;  1MEC 3;  1LED A;  3GYD A;  4LIU A;  3VBH B;  3IIA A;  3RNS A;  2ZZJ A;  4KH9 A;  5J7M A;  3VD4 A;  5BNN B;  4IV3 A;  3K4D A;  1RVF 2;  3KQ4 B;  2QDR A;  3IZO A;  3N7L A;  1RUD 3;  2N7G A;  3AXE A;  4GZ9 A;  4W6X A;  4DNY A;  5GZE A;  2FDJ A;  4I3G A;  2W08 A;  4CDQ A;  4GAL A;  4K1Y A;  3LDB A;  3URF A;  2X5I B;  4YW5 A;  2DDU A;  2WT0 A;  4LT5 A;  3POE A;  3BUC A;  4DOU A;  3KGZ A;  3BU0 A;  1BBT 1;  2W68 A;  2A6Z A;  4QGM A;  3IDC B;  4LBN A;  3AKP A;  1RJ8 A;  3S5Q A;  1LOC A;  3I97 A;  4RL7 A;  5C3P A;  2FDH A;  4UBH A;  2NN8 A;  4A44 A;  4BJ0 A;  3BI3 A;  3PJY A;  2YDE A;  4XUO A;  5C9A B;  5L9V A;  1D0H A;  1KDM A;  1RUJ 3;  2GU9 A;  2VQ0 A;  2ZGQ A;  2AH2 A;  5B4X A;  1QU0 A;  3ST7 A;  5H9R A;  1AYN 2;  3FWE A;  3PNA A;  1ZRF A;  2UWC A;  2QQN A;  4XCA A;  3PIJ A;  4HMZ A;  1GWK A;  1DZT A;  1PO2 2;  4Q2F A;  5LBB A;  3WW2 A;  1QJY 3;  3B01 A;  1BMV 1;  1DP0 A;  1Q8P A;  3VL8 A;  1MZ5 A;  4E4Z A;  2FBE A;  1K45 A;  4ZY9 A;  1UF2 C;  3R4S A;  1PMH X;  3NAP B;  4JTN A;  3BVC A;  4Q26 A;  4BYY A;  2D97 A;  4CRQ A;  5DMY A;  5HCA A;  2EA7 A;  5FAX A;  1H8T C;  3NMB A;  1T6B X;  3GZT B;  5IK5 A;  1LB2 A;  1WMD A;  4N53 A;  1W8F A;  2A7A A;  1JZ7 A;  1QOT A;  2C6S A;  2HWB 3;  5I0R A;  3N9M A;  1QF3 A;  3AMQ A;  1O4Z A;  2Y6G A;  3ZLI A;  2GN7 A;  3U14 A;  4DPN A;  2Q1Z B;  5CAZ A;  4QQH A;  3IB3 A;  4AED B;  5HPO A;  2VCB A;  2E26 A;  5FMO L;  2XL7 A;  3DXU A;  5FZ9 A;  3SLI A;  1GIC A;  4A6O A;  3VDB A;  1UPS A;  3LA3 A;  3ZR5 A;  1JYV A;  3MO4 A;  1UIJ A;  3PHM A;  3J9S A;  4LUK A;  4TZD A;  4HKW A;  1DZR A;  1UOF A;  4F83 A;  4Y20 B;  1K12 A;  1RUH 2;  2D7F A;  2R30 A;  1D4V B;  5F5I A;  1B09 A;  3WDU A;  4AFA A;  3M7A A;  1AR9 3;  3NJY A;  4Y1Z A;  4OMC A;  1AL2 1;  2W91 A;  4BQ2 A;  5C8C B;  4GWI A;  2PFW A;  3WVJ A;  1MS3 A;  2HWE 3;  2VTF A;  2W95 A;  2VCC A;  4K1Z A;  3OY8 B;  1QXJ A;  2JG9 C;  3I59 B;  2CNA A;  4FTE A;  5A7S A;  3M3O A;  1OQE A;  4GJZ A;  3LIG A;  3C7O A;  1CIY A;  1N1V A;  2ZGK A;  3HQX A;  2XJS A;  1SBE A;  3S0M A;  4E2S A;  1YIF A;  1F8V A;  1CZS A;  3C7F A;  1OFS A;  3NWK A;  2J1T A;  2QQL A;  3CMG A;  1X82 A;  2WZR 2;  4RS5 C;  5ERL A;  2AYH A;  3NNL A;  3AVR A;  4IV1 B;  5FZ1 A;  3NST A;  1HKD A;  1URX A;  1UY4 A;  4YW2 A;  5K9Y A;  2DU1 A;  3BAL A;  4K7J A;  3SEP A;  2ZHM A;  4IGO A;  4XBL A;  4W8J A;  3V0B A;  1WCS A;  1LGN A;  3POS A;  1WCK A;  3LOB A;  1V70 A;  5FMO S;  4B7K A;  2XBO 1;  1C5I A;  3W9A A;  1W0N A;  1JUH A;  4Y5S A;  4OFG A;  4NWV A;  1REE A;  1PGS A;  1ZRI A;  1F35 A;  3ZXE A;  3JB8 A;  3AFK A;  3USS A;  1OOP A;  3UGG A;  3QBQ A;  5JMC A;  1F5J A;  5KWR A;  1GNH A;  3QH7 A;  2Z2S B;  4I3P A;  1BJQ A;  1YIP A;  3MW2 A;  5FRE A;  1ZVF A;  1AVB A;  2GNB A;  4NII A;  4JVA A;  1CIW A;  2XON A;  5KC5 A;  1GZW A;  4AVA A;  2XPJ A;  3KHC A;  2LAL A;  5F3I A;  5G04 L;  1NA1 B;  2BU9 A;  3NKG A;  5FZC A;  1ENX A;  3ZKY A;  4CP2 A;  2JDK A;  4OHW A;  1AX2 A;  3AP5 A;  1ND2 B;  2UYA A;  4JKL A;  5DUU A;  3ZFF B;  5A3T A;  3ZPO A;  1AX1 A;  1V6J A;  1ND3 A;  5FR3 A;  2RM2 3;  4Q8L A;  1WD4 A;  1S2E A;  1DQ6 A;  5A33 B;  4IE6 A;  5DXD A;  2RR1 3;  1HQL A;  2EID A;  1MVQ A;  3R4U A;  4CVU A;  4RQP A;  4XQD A;  4NHY A;  4OHX A;  3MYX A;  4BWO A;  2FZ2 A;  4U36 A;  1RUC 3;  2OZJ A;  1ULO A;  3AKQ A;  3K3N A;  1U5I A;  4M3C E;  4H3W A;  1VE0 A;  4FPH A;  5FZK A;  1V6L A;  1E57 A;  1PIV 2;  3HNB M;  2VNG A;  5JOY A;  2XJV A;  2XML A;  1RXG A;  3BOW A;  4ZS2 A;  1UOJ A;  2BWA A;  1SMV A;  1DGW A;  2A1X A;  4DFS A;  1WMF A;  2DBN A;  4HKO A;  4LKD A;  1VP6 A;  2JDH A;  3RG0 A;  3RWK X;  5CFC A;  3HT2 A;  2DCJ A;  2NMN A;  3VKO A;  4XOG A;  3W5M A;  2ZKN A;  3B9I A;  2E51 A;  5D1I A;  4IEQ A;  2R0F A;  4I0B A;  4X8P A;  4CEY A;  1G6N A;  4YVW C;  1QJY 1;  4DXS A;  3Q8F A;  4LXL A;  3HJR A;  4NHK A;  1OQ1 A;  1ZZ8 A;  2W2I A;  2YMZ A;  3C2U A;  4IE7 A;  4QQO A;  1QJX 2;  1ZZC A;  5CKQ A;  1JTZ X;  3O0V A;  4OUL A;  4QPI C;  2W3J A;  2WKK A;  2Y64 A;  3ZYJ B;  3THT A;  3OPZ A;  4QX7 A;  2QFE A;  3ZYH A;  1RYY A;  4P9Y A;  1MS0 A;  1KEX A;  5GJ6 A;  4AEK A;  3N7M A;  2XKO A;  3VZJ A;  2HWB 1;  1CPN A;  1T2X A;  3ZPY A;  2WLQ A;  2Q8C A;  1XSQ A;  3H7J A;  2WFP A;  5KXE A;  3VKN A;  1LOE A;  3WUC A;  3U07 A;  5JPN B;  1LCL A;  1SFP A;  1PX3 A;  3CL1 A;  4AWD A;  3KT1 A;  4UFJ A;  1UL9 A;  3E6D A;  1L3J A;  5JMO A;  2WS9 2;  5LK7 B;  1H1M A;  2PAK A;  4LBK A;  1V9U 2;  1SBD A;  1V0A A;  3AP6 A;  1A34 A;  4FAG A;  5BUV A;  2PLV 3;  5A3L A;  2ARB A;  1YLL A;  1Z7S 3;  2RG4 A;  2YYO A;  2VUD A;  3V0B B;  4A41 A;  5I91 A;  2C24 A;  5FTT C;  3AZV A;  1C8M 3;  1WME A;  3H1W A;  3KSC A;  2CTV A;  5CYY A;  2BWC A;  1LOF A;  3UKN A;  4CCE A;  2QQV A;  5FZE A;  2WFF 1;  1EYB A;  4KBZ A;  2TEP A;  5EYX A;  2E7Q A;  1PHM A;  1FAT A;  3N9P A;  4KWU A;  2OT7 A;  3ECQ A;  1NCR C;  2RDQ A;  4OZO A;  4XPV A;  5A3N A;  4J6G A;  2FQP A;  4D7Y A;  5LBF A;  3M2M A;  4AVV A;  1W03 A;  2EIE A;  5FKB A;  3VBH C;  2WRA A;  1J3P A;  2ZEY A;  4YFZ A;  2E6V A;  1IKQ A;  3MIG A;  1GZW B;  4XW3 A;  4YW7 A;  3T3Y A;  5BNN C;  2BDR A;  3OGJ A;  4PIY A;  4XFC A;  3WDY A;  2CGO A;  1F4A A;  3KV9 A;  3DCQ A;  3H0O A;  4LJH A;  4JHT A;  5I8T A;  1XU1 A;  5HXV A;  1BK0 A;  2JIG A;  3K51 A;  3D3A A;  3FZ3 A;  4BCU A;  3UKV A;  2VBD A;  1WW4 A;  2VXJ A;  4KG0 A;  1VBC 2;  4PLO A;  2W52 A;  2MPF A;  3B5L B;  4K9S A;  3AZZ A;  4CUC A;  5C9A C;  2A6V A;  3Q8E A;  3ZYB A;  1W8N A;  3TB0 A;  1G7Y A;  1HRI 3;  1RUI 1;  3HT1 A;  4NHX A;  3WDV A;  4XZU G;  4AHY A;  4UT5 A;  3M3E A;  4XFB A;  3IDA A;  4TXW A;  3ZSJ A;  3WDW A;  3T30 A;  4W50 A;  2EIB A;  3I2I A;  3OBR A;  4L9B A;  1S0E A;  1X50 A;  2ZHL A;  3GM8 A;  2Q8D A;  1BEV 3;  2QQJ A;  2BUK A;  4XUT A;  4IEZ A;  4BB3 A;  3WF1 A;  4CP9 A;  1RUG 2;  5IAX A;  3AZX A;  2PAM A;  3OSD A;  3JD7 1;  4CUA A;  2D98 A;  2B9U A;  2HWD 1;  5IK7 A;  3R6S A;  3AZW A;  4YW4 A;  3UV9 A;  2V5D A;  2VBP A;  3M8L A;  3OB8 A;  4R9B A;  1AR7 3;  2A70 A;  5EV7 A;  4HXC A;  4N9I A;  5F5Q A;  5C3O A;  1JYX A;  2CL2 A;  2VMC A;  1KIT A;  4LA2 A;  4YZ2 A;  5LEJ A;  1O7F A;  2QKD A;  3ZXL A;  4Y5Z 0;  1MS5 A;  4OYU A;  4G9S B;  1UNB A;  1H1A A;  1W2A X;  4OZX A;  1KFX L;  1NQJ A;  2CGN A;  2ZGM A;  2VZO A;  3WP4 A;  1AR8 1;  4AED C;  4CU8 A;  2RJ2 A;  4E2G A;  4JGZ B;  1YJL A;  2PHT A;  5DAB A;  2DCZ A;  4RHV 2;  3KVA A;  5FUN A;  4H7M A;  5F9T A;  3WNO A;  4YM2 A;  3RYP A;  3DEC A;  1JOP A;  5GLU A;  2VMG A;  1ASJ 2;  4UBG A;  1NE4 A;  1X33 A;  2Y6K A;  1KS5 A;  4M4P A;  1RHI 2;  4QGN A;  4EN7 B;  4BOW A;  5IYY A;  4LQR A;  2YPJ A;  2R04 3;  1GMM A;  3MLJ A;  3TN9 2;  5LAS A;  2KA3 A;  1CVN A;  1YI7 A;  1JOD A;  3AMP A;  3PL0 A;  5FYS A;  4CEW B;  4CDX A;  5LA0 A;  4HZF A;  5C8C C;  4CCM A;  2NYY A;  1JMU B;  1ZBE 3;  2YBS A;  2IZW A;  3ACF A;  3WW4 A;  1YNA A;  5T5O A;  1MEC 2;  1NZI A;  1FPN 2;  2YC4 A;  5D8A A;  2E31 A;  4YGE A;  2WLP A;  4PLN A;  5FPV A;  1JZ4 A;  3ZXD A;  1VMJ A;  2VZT A;  4XHB A;  2OKX A;  1D0G A;  2VGD A;  4QKF A;  1Y4W A;  1W3V A;  4QB6 A;  3DGT A;  1AZD A;  3K4Z A;  5DUV A;  2LW8 A;  4W6Y A;  2K2S A;  3I3Q A;  1W6O B;  1VBE 1;  1JXN A;  2VQU A;  1DQ4 A;  1OA4 A;  1S0J A;  3ILR A;  2JG8 A;  1QKQ A;  4IV1 C;  4AL9 A;  4LOR A;  2VL4 A;  2HWC 3;  5EFU A;  5HV0 A;  3LEM A;  1VAK A;  5FZO A;  1VIW B;  4XF9 A;  4XJU A;  4QPG A;  3P1I A;  1CGP A;  2BVV A;  2ZAA A;  3EMR A;  3SC7 X;  1ACC A;  1PVX A;  2W39 A;  2ET7 A;  5F2W A;  3VDA A;  2WT1 A;  1PO1 3;  4ARX A;  2FDF A;  4J1W A;  3B94 A;  5L9B A;  4IV3 C;  1XNC A;  2I2S A;  2W1Q A;  2YB7 A;  3H3L A;  5DAP A;  3VB9 A;  5FO8 B;  2G4I A;  4QWN A;  2VBB A;  1EUU A;  1N1S A;  2WO2 A;  4NOT A;  2PLV 1;  3CBN A;  4XF0 A;  1HV0 A;  5KHJ A;  1I5Z A;  1Z7S 1;  1Q56 A;  2HYX A;  2Y60 A;  1UZ0 A;  4LA3 A;  2E63 A;  3AJY A;  4IE5 A;  4E8D A;  1HN1 A;  3ON7 A;  4BXS V;  1C8M 1;  4E4D X;  1S0I A;  2BOI A;  1D4M 3;  4G3Y C;  4GXL A;  4AQS A;  2XHK A;  1NA1 C;  2B45 X;  5LY2 A;  1C8N A;  3ZFF C;  4R9A A;  3WDT A;  1H6Y A;  2OXB A;  1UAI A;  5CIS A;  1GOG A;  3SHR A;  1QNW A;  4ARY A;  1U12 A;  2WNU A;  4MAD A;  5IHR A;  3HWJ A;  2VOK A;  1QJE A;  2XVG A;  1A78 A;  5CEH A;  1XNK A;  2VEC A;  5DUW A;  1T6G C;  2H6C A;  3UJO A;  4BDV B;  1LTE A;  1CAU A;  1FMD 2;  3K77 A;  5T54 A;  4BQ3 A;  3I3D A;  4E27 A;  4V2V A;  3JB4 C;  1RED A;  3TEX A;  3H9A A;  3VN4 A;  4L0P A;  4CP9 B;  1Z78 A;  2DBI A;  2XQX A;  1V6K A;  2CSG A;  3IDE A;  3RPQ A;  3OJB A;  3N9O A;  1MS1 A;  4JCK A;  1JU4 A;  4KWK A;  3GBF A;  1GP5 A;  3AC0 A;  2ZKL A;  4QHZ A;  4N53 C;  2R06 3;  4O7X A;  1CN1 A;  4W65 A;  1ULE A;  5KHI A;  1OLQ A;  1TNR A;  2LUW A;  2RVA A;  2Y33 A;  2WII B;  3ZYR A;  4A2U A;  2W46 A;  4H14 A;  1VBB 2;  4XUQ A;  4ZU7 A;  1NCQ A;  3TNQ A;  2J1U A;  3LFI A;  2VVE A;  4Q0P A;  2WNV A;  3WCS A;  2XJR A;  4JGY B;  4XIK A;  5EWS A;  2ZXQ A;  5T5L A;  1A6C A;  4Y5T A;  4OHZ A;  2XR4 A;  1GZT A;  1V6M A;  1BK1 A;  2V72 A;  1GNY A;  2LTN A;  2JDU A;  2VZQ A;  2CU5 A;  2XHN A;  1U5X A;  5IFP A;  1H4H A;  4LKS A;  4L2N A;  1E5R A;  1POV 3;  3S7E A;  4ASL A;  2A5Z A;  5GLV A;  1AXZ A;  1VBD 3;  2ZML A;  4NMI A;  4YWA A;  2BZD A;  5AVA A;  4P00 B;  3WCR A;  1LOG A;  1QJZ A;  1UZZ A;  5CKN A;  2WAO A;  5F3C A;  1HRV 2;  2QQM A;  3WF4 A;  5L19 A;  4AHZ A;  1J3R A;  5DAX A;  5DG2 A;  4QX1 A;  2DVD A;  5EP9 A;  1W6N A;  3T1L A;  4CDW A;  1CAV A;  4C90 A;  4ZS3 A;  3WNX A;  3BOP A;  1DLC A;  1OF3 A;  5LZ6 A;  3KV6 A;  2DCK A;  5EIY B;  2R07 1;  2I74 A;  5F1R A;  2D6L X;  2JG8 B;  4XAC A;  1EAH 2;  5TSW A;  2WZP P;  5FPZ A;  4P9W A;  3TNP B;  4QPG B;  2ZEW A;  2WWJ A;  4JQR A;  4YZ5 A;  1RMU 1;  1CD3 G;  1HV1 A;  4UF0 A;  2JDY A;  3USU A;  1FI2 A;  5H9Q A;  1ZBE 1;  4AFB A;  4IXL A;  2J1V A;  5DG1 A;  3BTZ A;  1XBF A;  4LHS A;  3JZV A;  1EPZ A;  1R1Z A;  4GWJ A;  4AEM A;  3TEY A;  2QZ3 A;  3AB0 A;  5IVJ A;  2AEY A;  3CHX A;  5IK8 A;  1OOP C;  4NE9 A;  1HDK A;  1K5M A;  4R4Z A;  4PI2 A;  3GHM A;  4CXX A;  3RZJ A;  4YG0 A;  3WZ1 A;  4DEV A;  2P3I A;  4YLZ A;  4RFR B;  4LKE A;  1O8P A;  4WZC A;  1UMI A;  2UYB A;  2RS3 3;  1FOD 2;  1XJA A;  2MEV 1;  2W1U A;  1VBA 2;  2VTX J;  4JKK A;  3I3M A;  1XYP A;  4J25 A;  4AHW A;  2ZGR A;  5I0U A;  2HWC 1;  5C3R A;  2YC2 A;  3I2G A;  1W6M B;  4BU2 A;  1ULF A;  4CDU B;  4AG4 A;  1GQP A;  1MZ6 A;  3O1U A;  1AYN 1;  3L2Y A;  4OI2 A;  1OD5 A;  1G8W A;  3I2J A;  5FQ0 B;  5IAT A;  3CJI B;  3P3N A;  3LWC A;  4GB3 1;  4BQ5 A;  3GJA A;  1J58 A;  4YGD A;  2O14 A;  4Y1X A;  2EXJ A;  1V6N A;  3LSD A;  3PVB B;  2XJU A;  3KVB A;  4RQP C;  4LO7 A;  4MVT A;  1L7L A;  3WX5 A;  4XDO A;  3WLU A;  1ZRE A;  3TEZ A;  2ENR A;  3ZDS A;  2OUJ A;  2JE9 A;  4Y4Y A;  3MF9 A;  1GOF A;  4JAA A;  4ZON A;  1XSR A;  3QAC A;  4UI9 L;  3OBZ A;  2Y6L A;  3O0W A;  4ZHN A;  1WCQ A;  2F6B A;  3AYE A;  3MID A;  5CVR A;  1BCX A;  5K0U A;  1TME 2;  5JSR A;  3LDR A;  4WVV A;  4DRR A;  5LW9 A;  1ZZB A;  1AJO A;  5EHD A;  4A3X A;  4XUR A;  5LA2 A;  1UMH A;  5FLJ A;  3LQC A;  4GWN A;  3CLP A;  3NQH A;  5FZM A;  5CBL A;  4Q0Q A;  1IQD C;  2Q8O A;  3ZIW A;  3AMM A;  4XAB A;  4CEY C;  2BRT A;  4UW3 A;  3NRU A;  3ZIX A;  3GAL A;  2JE7 A;  2WN3 A;  1N1T A;  1TEI A;  1YHF A;  4NRO A;  3UES A;  1TVG A;  5JCT A;  3MPB A;  5BNN A;  1RUH 1;  2J1S A;  1EV1 3;  3NNJ A;  4JGZ C;  4D8M A;  1AYM 2;  4V2W A;  5BNO A;  5JPM B;  1PK6 A;  3AJZ A;  4UW5 A;  4WM7 B;  2VU9 A;  3M3I A;  2JX9 A;  2E33 A;  5IK4 A;  5CAD A;  4ZXK A;  5AC9 3;  5BY5 A;  4GJY A;  1H6X A;  3I7D A;  5FY7 A;  3DL3 A;  5DDJ 3;  5FPL A;  4XMA A;  2Y6F A;  4MHR A;  2D43 A;  4D7T A;  1OF4 A;  2X09 A;  4YVS B;  1W6N B;  5DZG A;  4CEW C;  5B2G B;  4MG2 A;  4CDW B;  4MGZ E;  1CAV B;  2B39 A;  3SIT A;  5FY0 A;  1QQP 2;  2PHR A;  4FPC A;  3LD8 A;  4RR3 A;  2AEN A;  1H30 A;  2ZPX A;  2DYC A;  2W92 A;  3MPP G;  4BK4 A;  2BFU L;  1RUN A;  4GIQ A;  1OI6 A;  2Y6H A;  3KF5 A;  4JZR A;  2FCT A;  1IZ3 A;  2P4E A;  1KFU L;  4GAZ A;  2OII A;  1PVC 2;  1W2U A;  4XF1 A;  1POV 1;  4Q4Y 2;  1DGR A;  2W47 A;  2ZEZ A;  3RS6 A;  1TMF 3;  3VBU A;  1FV2 A;  3LE0 A;  5BNP A;  3PUI A;  5L36 A;  3FHA A;  1VPH A;  4DY5 A;  2BGC A;  2E7T A;  3OD0 A;  4YG3 A;  1HQN A;  2H0V A;  1SCR A;  2IXC A;  2VOX A;  3I3B A;  1WWY A;  3UGH A;  2RMU 3;  1PZ8 A;  1H0B A;  5FLI A;  3MUY 1;  2DUQ A;  4HVR A;  1NUK A;  4GD4 A;  2GZW A;  1NOV A;  3D0S A;  1QDO A;  1UX7 A;  3LEG A;  3IPV B;  2FCV A;  3GNE A;  4IND A;  5IVB A;  3LGR A;  3RI8 A;  1OUS A;  3N35 A;  3VHP A;  3A21 A;  1CX1 A;  4FPK A;  4OMD A;  2VNV A;  1RUF 2;  1PGL 2;  3O12 A;  4FPO B;  4AGR A;  1CZT A;  5EYY A;  5JXH A;  3K75 B;  4QDQ A;  4XAE A;  1HB1 A;  1K3I A;  4Q4X 2;  4XIL A;  3VBO B;  1J1L A;  5FJK A;  1Q3E A;  2XJQ A;  2AZ5 A;  3ILN A;  3T09 A;  3BTA A;  3J8F 2;  4LO6 B;  1AXK A;  2Q5T A;  2O8Q A;  2JIC A;  1W8H A;  2V4A A;  2W0X A;  3NNF A;  3POW A;  3OBA A;  5F2S A;  5IFT A;  4XDQ A;  2DCT A;  4AEJ A;  3U0Z A;  2GC1 A;  2BFU S;  4UW6 A;  4AZZ A;  3WNK A;  4M4R A;  5FDB A;  5IT6 A;  3FC0 A;  1C1F A;  4OUE A;  4E8C A;  4BXF A;  1GWL A;  3BOD A;  2XL9 A;  4QB1 A;  1OVS A;  2FDK A;  2QUO A;  4XC9 A;  4WVM A;  4ZKT B;  1DLL A;  3KGL A;  2ZMN A;  4RGK A;  1C4R A;  1PIV 1;  5K0U B;  2RS3 1;  4XJ9 A;  1GAN A;  3OCP A;  2DWR A;  5JZG B;  3ES1 A;  1UO9 A;  3I3E A;  4LK7 A;  5LAT A;  2Y26 A;  2C9A A;  5FPX A;  4LE3 A;  1LEC A;  1Q43 A;  3LEI A;  5FY8 A;  2DCY A;  1VLN A;  1DQ0 A;  3HOB A;  2D5H A;  1D2S A;  3GXU A;  4NIH A;  1WKY A;  3OYW B;  2B46 X;  1LJ7 A;  5FJH A;  3ZFE A;  4OQ8 A;  5LEK A;  5FY4 A;  1S0F A;  3HIF A;  2R6Q A;  5LBC A;  3Q8A A;  5C5U A;  3AMH A;  3MIB A;  1O91 A;  3PTR B;  1UYX A;  4JGY C;  4JHZ A;  3GGL A;  3AZY A;  3N9N A;  1O59 A;  3IAP A;  1F2N A;  5JR2 A;  3WNM A;  4QQL A;  4HVO A;  3OOX A;  5EZW A;  3LFM A;  3HQU A;  2ZHK A;  4FPJ A;  5KHK A;  2AUY A;  4KBB A;  1VJ2 A;  3E5Q A;  4R4X A;  1S2K A;  4DRV A;  5ABJ A;  4AW7 A;  1GSL A;  2VZS A;  4XIO A;  3VKL A;  1YEW A;  4ZXE A;  4IEY A;  2VMD A;  5D8A C;  3WP3 A;  3ZVX A;  1V9U 1;  3WHT A;  4YZ4 A;  5CU1 A;  4O9E A;  2RS5 2;  3C7H A;  1Y3T A;  1EV1 1;  3A4U A;  4O65 A;  1G9B A;  3WQB A;  2RJK A;  4AI9 A;  4LOS A;  1SPP A;  3ZOI A;  1J84 A;  1CR7 A;  2B5H A;  4AFC A;  1W2T A;  5E8A A;  5AC9 1;  2OUH A;  1LU1 A;  1OA2 A;  5FZD A;  4P9I A;  1LOD A;  3MZH A;  2XLG A;  1W90 A;  2GN3 A;  2JG8 C;  1CQ9 A;  1D4M 2;  3RGB A;  4Q4V 2;  4WBB A;  4AQ2 A;  5DDJ 1;  4A7K A;  4UFM A;  1OH3 A;  2BGP A;  4QPG C;  4WM8 A;  5CKM A;  2QQO A;  2WFF 3;  2F4L A;  4Y33 A;  4MH0 E;  2FMY A;  3KLS A;  4LNV A;  1AR6 3;  4TLG A;  1BXH A;  3EQE A;  4FBF A;  4O61 A;  4XHX A;  2GP5 A;  2ADE A;  3CF6 E;  3OUH A;  2BVB A;  3WV6 A;  4ZZ8 A;  3C7G A;  3M3Q A;  2XOM A;  4LIT A;  3DXT A;  4Y26 A;  3VBR A;  3K3O A;  1US3 A;  3ZFG A;  1W2N A;  1KD7 A;  5A6Z A;  4C91 A;  2DFC A;  2Y0I A;  1GV9 A;  1JBC A;  4IDZ A;  4B4P A;  3E97 A;  4D69 A;  2D40 A;  4UOJ A;  3N4M A;  2PXJ A;  4H55 A;  2W87 A;  3THP A;  4AAP A;  3T4H B;  3JBG 2;  4F7Z A;  1TMF 1;  1XND A;  2RS1 2;  3INA A;  3M4F A;  5FYC A;  5C4W A;  3CJX A;  1ULD A;  4P14 A;  1QJU 2;  4HN1 A;  4CDU C;  3RWN A;  1EP0 A;  2BW8 A;  4LHN A;  4AR2 A;  1VAV A;  4HK8 A;  2IXI A;  2K9Z A;  2RMU 1;  3VV1 A;  1JYN A;  2LRP A;  4BIO A;  4Q4W 3;  4FSJ A;  3CJI C;  4IV3 B;  3ZXK A;  3WY6 A;  2NZ9 A;  3WF0 A;  2XG3 A;  2ZA9 A;  2ERF A;  4UWD A;  4WVM B;  4FOQ A;  4CDQ B;  4FOV A;  5DUX A;  1RUI 3;  3KT7 A;  2JE8 A;  2CHH A;  2C26 A;  1BHG A;  4CCO A;  3OGG A;  1DZQ A;  4LHL A;  1Y7B A;  5DZF A;  4TLF A;  1X7N A;  1MQT A;  3FLP A;  5FO7 B;  5FZF A;  4YYO A;  3RSJ A;  4HET A;  3JXS A;  3RFR A;  5FUI A;  2BEO A;  4A7Z A;  5EJ3 A;  2MHF A;  3ACG A;  4KWL A;  3VBF A;  5A32 A;  2G1M A;  1W2O A;  2WL1 A;  3TAY A;  3AP4 A;  3JD7 3;  2HWD 3;  2OX0 A;  1VBD 2;  4EV0 A;  1SLA A;  1DGW X;  1R08 2;  3EYP A;  1ZYB A;  2DVA A;  2H6B A;  3WF3 A;  1VRH 1;  1J83 A;  3ZFE B;  5J1X A;  1NZC A;  5EXO A;  2TUN A;  4Y22 A;  1LR5 A;  3H1Y A;  3ZXA C;  4CZS A;  1Q8S A;  3VHN A;  2V4V A;  2XUE A;  1APN A;  4IL7 A;  4I0A A;  2Y8K A;  1AR8 3;  4LMF A;  2WNV C;  5FK8 A;  3ACL A;  2R7E B;  1ASJ 1;  3N3H A;  3SQO A;  4OI4 A;  1NYW A;  3PLQ A;  5GM0 A;  4BPZ A;  3O14 A;  1R1A 3;  5HCF A;  3W58 A;  3VGI A;  4Y1Y A;  3VLB B;  2VUJ A; 
#chains in the Genus database with same CATH homology
 3LFM A;  4MG2 A;  4NRM A;  3I49 A;  3S5A A;  5F8P A;  4ZS3 A;  4QKF A;  3O1R A;  3RZM A;  4IE0 A;  3I3Q A;  4IE4 A;  4OCT A;  4QKB A;  3O1M A;  2FDI A;  3H8O A;  3BTZ A;  3H8X A;  4O61 A;  3O1V A;  4QKN A;  2FDF A;  3BIE A;  4CXX A;  3BTX A;  3RZJ A;  2FDJ A;  3RZK A;  3T3Y A;  3O1P A;  4NII A;  4RFR B;  4IDZ A;  3BUC A;  3KHC A;  4CXY A;  3O1O A;  3BU0 A;  4JHT A;  4NPM A;  4IE5 A;  3I3M A;  3T4H B;  3RZL A;  2FDH A;  2FD8 A;  3BI3 A;  3O1U A;  4NJ4 A;  4IE6 A;  3KHB A;  2FDK A;  4NRP A;  3RZG A;  4ZHN A;  2FDG A;  4QKD A;  4ZS2 A;  4O7X A;  3H8R A;  4NRQ A;  2IUW A;  4NPL A;  3O1T A;  3S57 A;  4CXW A;  4NIH A;  3BTY A;  3T4V A;  4NIG A;  4NRO A;  5DAB A;  3BKZ A;  3I2O A;  4MGT A;  4NID A;  3O1S A;  4IE7 A;  4QHO A;  3RZH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...