3BU1A

Crystal structure of monomine-histamine complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
144
structure length
144
Chain Sequence
b'CDTVSAWQSLRGPGTGGYYLFKTTEGGKTDCTYVKGSNFNDAAQTATYTYGNLGSGNQLTQQTASASISGNAIVVGTDHSEVLYSDGSTCDVVRLNGQIELWIHSSATSNTGNLNSCCTDKFNQEKGSRPEHVVYRSTCPNLPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipocalin
publication title Structure, function, and evolution of biogenic amine-binding proteins in soft ticks.
pubmed doi rcsb
source organism Argas monolakensis
molecule tags Ligand binding protein
total genus 32
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2007-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02098 His_binding Tick histamine binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 3bu1A00
1X89A 2LBVA 2MO5A 3TZSA 5H9LA 3HWFA 3BY0A 4ZHHA 3P6GA 4AZNA 4YGZA 2OFRX 4NLJA 4ARHA 4OMXA 3WJFA 3BU9A 5DPQA 1UREA 1OPBA 1R0UA 5EDBA 1NP4A 5HCEC 3I0AA 4A1HA 3FLLA 1GKAA 2FR2A 5IO5A 2AMMX 2L67A 3D96A 4ZHFA 1QFVA 2A2GA 1JYDA 2QM9A 3WVMA 1ERXA 3F9DA 4TJZA 4TKJA 4TKHA 5B29A 1BM5A 1SY2A 1YWCA 5KHPA 1KQWA 3Q6LA 2QO4A 2FT9A 4TLJA 1YWBA 1GX9A 4UU3A 4XMGA 3VG4A 1JJXA 1LF7A 2NP1A 2GC9A 2JU8A 1X8PA 3NX2A 1BRPA 1DZPA 5F7GA 1O8VA 3BX8A 3CQRA 1MUPA 1GXAA 4YBUA 1BWYA 3O19A 4TQ2A 4QAEA 2ACPX 1ZNLA 2N93A 4IB8A 4OS8A 5BVSA 4ZHGA 4ZGUA 1BSYA 3FA8A 3KZAA 2X45A 3JS1A 4Y0QA 1PMPA 1GM6A 1UZ2X 5LJHA 1QY0A 4ZJ0A 1LNMA 1TOWA 2G78A 3FIQA 4ALOA 1E06A 1GT1A 1OBUA 2WEWA 3CR6A 3FA9A 3UEUA 5D45A 2WQAE 4WFUA 2BLGA 3U9PC 2RQ0A 5LJKA 1YWDA 2KT4B 2JN3A 1IFCA 1T8VA 4XMEA 1I06A 5HZ9A 3MBTA 2FS6A 2DM5A 4YFQA 1EIIA 1TVQA 5H9KA 2AL0X 1GGLA 1EPBA 1SXYA 3BX7A 4DQ4A 3BS2A 4ZH6A 2CZUA 1GX8A 1LKEA 3K3LA 1BRQA 4MVLA 1EIOA 2WUTA 4IBAA 4I9RA 3HWDA 1H91A 1AELA 1QQSA 1X8QA 2Q2PA 1CBSA 4LKPA 5CE4A 1IIUA 4AW8A 5HZ5A 4MVKA 1KGLA 1ALBA 3B2JA 4GETA 1X8OA 2FS7A 2JOZA 5L8NA 1CJ5A 4UU2A 4I3CA 1I04A 3WJCA 1CRBA 1EPAA 2A13A 2FR3A 1FDQA 1U18A 4PSQA 1ML7A 5EEEA 4ORYA 4WFVA 3VG6A 4XMDA 1SY3A 2HYSA 1KOIA 1JV4A 1T0VA 1Z24A 1P6PA 1QWDA 2LB6A 2AT8X 4QGXA 1OEKA 5EEDA 5HA1A 1BJ7A 1KXOA 3B2HA 3KQ0A 1MX7A 1GKAB 4XMFA 2POAA 1G85A 4R0BA 1DV9A 4QYPA 5D8JA 2L68A 3KFFA 3DSZA 5EZ2A 3VG7A 1BLRA 1MDCA 1U0XA 1HMRA 1KT6A 5HCCC 4YGHA 2JU7A 2WSJA 4ALBA 1IKJA 2CBRA 1D2UA 4OS0A 2FLJA 2L9CA 4N7CA 3FW4A 5FENA 3P6FA 2MM3A 1IW2A 5HZ6A 5F6BA 4MVIA 1OEJA 5DG4A 2FRSA 1EUOA 4M7MA 3CMPA 3TGCA 1KT7A 2OVAA 4HPBA 2CBSA 3B2LA 3C76X 2AT0X 4QYNA 1A18A 2EU7X 3APVA 4NP1A 2WQ9A 5HCDC 1BSQA 5IO7A 2RD7C 3ZQ3A 1X71A 3BDRA 3O22A 4AZRA 1SXUA 1N0SA 1PM1X 4HFOA 4IMOA 1O1VA 4HPCA 1TOUA 1QABE 2OVEA 3PPTA 1PBOA 1KQXA 3GAQA 3KFGA 3C77X 3U0DA 3NQ3A 2OVDA 1KZXA 1AB0A 1NGLA 4QZTA 1E5PA 4Y0SA 2A3FX 2XKLA 4ES7A 1EALA 2LFOA 2O62A 5L8OA 3QKGA 2F73A 3OJYC 3AKMA 3RZYA 1AVGI 2CZTA 3PH5A 1X8NA 2QO6A 3B2IA 2HZQA 4A1YA 2CM4A 1AQBA 1E02A 3IFBA 1VYGA 3FENA 1JJJA 4KIIA 5FFHA 5EPQA 3TGBA 1ERBA 1KT5A 1SA8A 3BRNA 4YGGA 3TF6A 3ZUIA 4CK4A 1D3SA 3P6HA 4IAXA 4RUUA 3DTQA 5LJDA 4ODDA 1ZNEA 3AKNA 1A2DA 3PH6A 5HTDA 1JZUA 1ZNKA 1VPRA 4IMNA 2WEXA 4EFGA 1ZNDA 3HWGA 1IKEA 2RCQA 1I4UA 3WBGA 2QOSC 1LIFA 2PY1A 3FEPA 2A0AA 3VG5A 1U17A 3STKA 3PECA 1LIDA 3T1DA 3NADA 1TW4A 1YUPA 4LZVA 5F58A 4XMCA 1X8UA 1QG5A 3EYCA 2Q39A 1HN2A 1G74A 2ASNX 2R73A 2JU3A 1LPJA 3NP1A 4N7DA 4OMWA 1YP7A 2X46A 4IB7A 5H8TA 1EXSA 1OBQA 4NNSA 4YFRA 3FMZA 4YMYA 1ZNGA 3CBSA 5D4AA 4LKTA 4YCEA 2R56A 1KZWA 2FTBA 1QY1A 1S44A 2NNQA 3SAOA 4YKMA 1GT5A 3C78X 2MJIA 3FW5A 3CWKA 4GH7A 1S7DA 4BOEA 1FELA 1ADLA 1KT3A 3BU1A 2OZQA 1MX8A 4ORXA 1PEEA 5HA0A 3NQ9A 1XCAA 4HPAA 1LFOA 4EXZA 1CBRA 1EW3A 3P6EA 3P6DA 3F8AA 5KIDA 3L4RA 1T68X 4ORWA 2AT3X 3NX1A 1CBIA 2W2BA 1OEEA 3EBKA 4I9SA 5JR8A 1DZJA 3CQNA 3HWEA 1SXWA 4M6SA 3P6CA 4XMHA 1DZKA 1O1UA 4GKCA 3FEKA 1YWAA 2W2AA 4ORSA 4GNYA 1BBPA 1XKIA 4AYHA 3O2YA 3VG2A 3EM0A 2IFBA 5LJEA 2XSTA 4LZUA 2NNEA 1CBQA 5HWZA 4YBPA 3IA8A 2OFMX 3WXQA 5FAZA 5LKFA 1ACDA 2GTFX 5LKEA 1OBPA 1NP1A 2AKQA 1RLBE 2K23A 1DC9A 5K06A 4AZMA 4WBKA 1B4MA 3BLGA 4I3DA 4YKOA 3NPOA 3FR5A 3APUA 4TNNA 2A2UA 3FA7A 5H9AA 5LJBA 1G7NA 3KFIA 4DQ3A 1LIBA 1LIEA 5F1EA 5BVQA 4I3BA 2ALLX 2FWVA 3APXA 2G7BA 1EQDA 1B0OA 3UEVA 5C0NA 4ORRA 2R74A 3FR4A 4ZHCA 1SY1A 2LKKA 3RSWA 1ZRYA 2ACOA 2CM9A 5AQ6A 3ZUOA 3UEWA 5L8IA 3EBWA 4IB6A 2LBAA 2HZRA 1ICNA 3FR2A 1B56A 4NNTA 1SXXA 3U03A 4ZR2A 5IO6A 2W2FA 3JSQA 4GNWA 2WR6A 4QGVA 1HMTA 4YFPA 2HNXA 3WJGA 1FEMA 1MVGA 4YDBA 2QO5A 5HZ8A 2HLVA 5KICA 1YIVA 5D48A 1IFBA 4GE1A 4NYQA 5HAEA 5LJGA 1KT4A 4A8ZA 4D6AA 3ELZA 1DFVA 3PP6A 1FTPA 4NYRA 2AH7X 3STMX 4EEJA 4AZPA 4BVMA 4Y0RA 1BSOA 1VYFA 3TGAA 2K62A 4ZFXA 4IB9A 1BEBA 4HPDA 5H9NA 4O9SA 1G5WA 1S2PA 5D47A 3HK1A 3FELA 2NNDA 4QGWA 1TXLA 1HQPA 1HBQA 3WJEA 1LICA 1B8EA 3STNA 3BSZE 1A3YA 1E00A 2E4JA 1QY2A 5EDCA 5HZQA 4IAWA 4YDAA 3B2KA 4EDEA 5HBSA 3MVFA 4BQUA 3FA6A 5LJCA 3APWA 2G79A 3I17A 2YG2A 4GRJA 1RBPA 4ORUA 2L5PA 4YCHA 3S26A 1SY0A 2KTDA 3D97A 1FENA 1HBPA 2WWPA 2HMBA 2ANSA 1GT3A 2Q4NA 2GJ5A 3UEXA 4AZOA 2RA6A 3WJBA 5HTEA 1ICMA 1DZMA 4ZCBA 1ZNHA 2RCTA 3D95A 4K19A 2Q2MA 2Q9SA 2AT6X 1OPAA 1GT4A 1L6MA 5BVTA 4NLIA 1I05A 4TKBA 3KFHA 4AZQA 3WJDA 5F6ZA 5B27A 4QZUA 4RUNA 1JYJA 3NR3A 4YH0A 3G7XA 4ZH9A 3CBCA 1DF3A 1HMSA 2P8GA 1A57A 1JBHA 3VG3A 4ZHDA 3ELXA 1YP6A 1FE3A 4OS3A 4Y0PA 3EMMA 3PEDA 4A60A 2AT5X 4D6BA 1QFTA
chains in the Genus database with same CATH superfamily
2IZDB 1X89A 2LBVA 2MO5A 3TZSA 5H9LA 1W4TA 3BY0A 2RTPB 3HWFA 3JQOA 4BX5B 1GX3A 4BX7A 4ZHHA 2ZAIA 3P6GA 4AZNA 1SWHA 4YGZA 4KH8A 2OFRX 4NLJA 5K68A 1SRIA 4ARHA 2OFAA 4OMXA 3WJFA 2Y3FA 3BU9A 5DPQA 1HXZA 3QQ2A 1UREA 1OPBA 1R0UA 2WPUA 1NP4A 4IABA 3I0AA 5EDBA 5HCEC 1VWPB 4GDAA 4A1HA 3FLLA 1GKAA 2FR2A 4Z2VA 5IO5A 2OF9A 5B5FA 2AMMX 2L67A 3D96A 3AUMO 4ZHFA 3RY1A 5B5GA 1QFVA 2RTGB 2A2GA 2IZJA 5B3MO 1JYDA 4ML7B 2QM9A 3MX7A 3WVMA 1ERXA 3F9DA 4TJZA 3T6FA 1SWSA 3PQUA 4TKJA 4TKHA 4CSBA 5B29A 1BM5A 1SY2A 1YWCA 4QRLA 1KQWA 3PQSA 5KHPA 3Q6LA 5CSEA 4GUZA 2QO4A 4O3YA 2FT9A 4TLJA 1YWBA 1GX9A 4UU3A 4XMGA 3VG4A 4Y5DA 1JJXA 1LF7A 2NP1A 2GC9A 1OSPO 4HWMA 4CPEA 1UYOX 2JU8A 1X8PA 3NX2A 1BRPA 1DZPA 4KCAA 5F7GA 2X56A 1O8VA 3BX8A 3CQRA 1MUPA 1GXAA 4Z28A 4YBUA 1NC9A 1SWEA 1SLDB 1BWYA 3O19A 4GGTA 2C1SA 3SZHA 4TQ2A 4QAEA 4BGFA 3OBLA 2ACPX 4QQ1A 1N4JA 1ZNLA 1JMXA 2N93A 4IB8A 4OS8A 5BVSA 4CPHB 4ZGUA 1BSYA 3FA8A 4ZHGA 3KZAA 2X45A 3WOVA 1RXJA 3JS1A 4Y0QA 1PMPA 1SWDA 1GM6A 1UZ2X 2GH7A 4DNEA 4Z2OA 1SLEB 5LJHA 1QY0A 3VGWA 4ZJ0A 1LNMA 1TOWA 2G78A 2VFCA 3FIQA 4ALOA 1E06A 4COTA 1GT1A 1OBUA 2WEWA 3CR6A 3FA9A 3UEUA 5D45A 1MM9A 2WQAE 2BLGA 4WFUA 3U9PC 1SRFA 3LHNA 4DCBA 1SWAA 2RQ0A 3ZI8A 5LJKA 1YWDA 2KT4B 4BJ8A 2JN3A 1FJ1E 1IFCA 2KW1A 1T8VA 4XMEA 1I06A 5HZ9A 3VHHA 1SWOA 3EC5A 2M4LA 3MBTA 2FS6A 2DM5A 4JNJA 4YFQA 1EIIA 1TVQA 5H9KA 2AL0X 4JO6A 5B10O 1GGLA 1EPBA 1SXYA 3BX7A 4DQ4A 2GTLM 3BS2A 4ZH6A 2CZUA 4NV7A 1GX8A 1LKEA 3K3LA 3S60A 4CPIA 1BRQA 1RXKA 4MIRA 4MVLA 1VWLB 4GK9A 4WHIA 2OY5O 1EIOA 2WUTA 4IBAA 4I9RA 3S5XA 3HWDA 1H91A 1AELA 3RDSA 2A5BA 2F09A 1QQSA 1X8QA 3FYFA 2Q2PA 3H3IA 1CBSA 1VYOA 2MF6A 4LKPA 5CE4A 1IIUA 4AW8A 5HZ5A 1PBYA 5B11O 4MVKA 1SRHA 3D4RA 1KGLA 1ALBA 1SRJA 1VWBB 3B2JA 3HOEA 4O3WA 1VWKB 1LDOA 1SLGB 4GETA 1X8OA 2FS7A 4FQBB 3WZOA 2JOZA 5L8NA 1CJ5A 4UU2A 2OYBO 4I3CA 1I04A 2BT9A 3WJCA 1CRBA 1EPAA 1VWNB 2A13A 2FR3A 1FDQA 2HKDA 1U18A 4PSQA 1ML7A 1SREA 5EEEA 4ORYA 2RTIB 4WFVA 3OE3A 4BX7B 3VG6A 4XMDA 2RTRB 3T2WA 1SY3A 2HYSA 1KOIA 1JV4A 1T0VA 5HCDC 3WYQA 4I60A 2VFBA 1Z24A 1P6PA 1QWDA 1N9YA 2AT8X 2LB6A 4QGXA 4JHQA 1OEKA 5EEDA 5HA1A 1BJ7A 2F01A 1KXOA 2X34A 4GZVA 4OELA 3RE5A 3B2HA 3KQ0A 3ZW1A 4B55A 1MX7A 1GKAB 4XMFA 3PK2A 2POAA 1G85A 4R0BA 2IZIA 1DV9A 4KT5A 4QYPA 4U46A 5D8JA 3SZJA 2BSZA 2C4IA 2L68A 2RTOB 3DSZA 3KFFA 3P24A 5EZ2A 1MDCA 3VG7A 1U0XA 1HMRA 1KT6A 1BLRA 5HCCC 1KL5A 2MWHA 4YGHA 5CYBA 2JU7A 2WSJA 1PTSA 1SWLA 4ALBA 1IKJA 1RSUB 2CBRA 1D2UA 4OS0A 4CDFA 2FLJA 1NQMA 2L9CA 3FW4A 4N7CA 5FENA 3P6FA 1SWUA 1SWKA 2MM3A 1IW2A 2FGSA 5F6BA 5HZ6A 5L3YA 3VHMA 1STRB 4MVIA 1OEJA 1LCWA 1VWMB 2RTHB 2FHNX 2IZAA 5DG4A 2FRSA 1EUOA 4MVEA 5FQ6E 3RKGA 4M7MA 3CMPA 4O3XB 2YMSA 3VU1A 3TGCA 2IZKA 1KT7A 2Y3EA 2OVAA 4HPBA 2CBSA 4ZGFA 3B2LA 3C76X 2AT0X 4QYNA 1A18A 2EU7X 3APVA 3NQKA 1VWHB 2WQ9A 4NP1A 1BSQA 1N43A 2KTSA 2RD7C 3ZQ3A 4C5PA 1X71A 3BDRA 3O22A 4AZRA 1SXUA 1N0SA 1PM1X 4HFOA 4IMOA 1O1VA 4HPCA 1TOUA 3SOTA 1QABE 2OVEA 3PPTA 4BX6A 1PBOA 1KQXA 3GAQA 3KFGA 2IZGB 4Z6JA 3C77X 3U0DA 3NQ3A 2OVDA 1KZXA 1AB0A 1NGLA 4QZTA 1E5PA 4Y0SA 2A3FX 1Y55X 1VWAB 1SWPA 2XKLA 4ES7A 1RXHA 1EALA 2LFOA 2O62A 5L8OA 3QKGA 2F73A 2RTDB 3OJYC 3AKMA 3RZYA 2A5CA 1AVGI 2CZTA 3PH5A 1WBIA 4Z27A 1X8NA 1W6FA 2QO6A 2HZQA 3B2IA 3WZPA 3X00A 2CM4A 2IZCB 4A1YA 1AQBA 1JJUA 1E02A 1JIWI 1VYGA 3FENA 3IFBA 2IZLB 4CDEA 4EQAC 1JJJA 4KIIA 3VE2A 5FFHA 5EPQA 2CAMA 1Y0GA 3TGBA 1ERBA 2IZHB 1SWRA 1KT5A 1SA8A 3BRNA 3VHIA 4YGGA 3TF6A 4YVBA 2RTFB 3RDOA 3ZUIA 4CK4A 1Y52X 1D3SA 3P6HA 4IAXA 4RUUA 1VWDB 3DTQA 5LJDA 3RY2A 4ODDA 1ZNEA 3AKNA 1A2DA 3PH6A 4CV7A 5HTDA 3OD9A 4U8UM 1JZUA 3D9WA 1ZNKA 1KL3A 1VPRA 3N91A 4IMNA 2WEXA 4EFGA 2RTQB 1ZNDA 1KFFA 1UYNX 3HWGA 1B4MA 1IKEA 2RCQA 4NV8A 2OY8A 1I4UA 2FHLA 3WBGA 2QOSC 1LIFA 2PY1A 3FEPA 2A0AA 3KVNA 4O49A 3VG5A 2ZSCA 1U17A 3STKA 3PECA 1LIDA 3T1DA 3E3CA 3NADA 3EW2A 1TW4A 2IZEB 1YUPA 4LZVA 5F58A 4XMCA 2BS6A 1X8UA 1QG5A 2I5ZO 3EYCA 2Q39A 3WZQA 1HN2A 1G74A 1SWNA 2ASNX 2R73A 2JU3A 5H9AA 3S5VA 1LPJA 3NP1A 4N7DA 4OMWA 1YP7A 2X46A 4IB7A 5H8TA 1EXSA 1OBQA 2QMIA 4NNSA 2OVSA 5IRUA 3FMZA 4YFRA 2RTJA 4LQZA 2RTMA 4YMYA 3ZW0A 1ZNGA 1K3BA 5IRAA 3CBSA 4O4SA 3SZIA 5D4AA 4LKTA 4YCEA 2R56A 4CPHA 2FTBA 1QY1A 1S44A 2NNQA 4U9CA 3WYPA 1KZWA 3SAOA 4YKMA 1Y53X 1GT5A 3C78X 2MJIA 3FW5A 4CDCA 3CWKA 4Y59A 2BS5A 4GH7A 1IJ8A 4MISA 3T2XA 1S7DA 4BOEA 1FELA 1ADLA 1KT3A 3BU1A 4O3ZA 2OZQA 1MX8A 4ORXA 4JGLA 1PEEA 5HA0A 3NQ9A 2X8TA 1XCAA 4HPAA 1LFOA 4EXZA 2UZ2A 1CBRA 3NBXX 2Z4IA 1VWEB 2MHDA 1JQPA 1E2TA 1EW3A 3P6EA 1DF8A 3P6DA 1I78A 3F8AA 2QCBA 5KIDA 3L4RA 1Y9LA 1T68X 4I95A 4ORWA 3RDXA 2AT3X 3NX1A 1NBXA 1CBIA 2W2BA 1OEEA 3EBKA 3MG5A 4I9SA 5JR8A 4U8UO 1DZJA 4U3QA 2OY1O 3CQNA 1SXWA 3HWEA 4M6SA 3P6CA 4L3RA 4XMHA 5CHKA 3ZW2A 4FBVA 1DZKA 1NDJA 1O1UA 4GKCA 3FEKA 4BX6B 1YWAA 2W2AA 4ORSA 4GNYA 1BBPA 1LCVA 5IRWA 2BC3A 1XKIA 4AYHA 3O2YA 3VG2A 3EM0A 4KC8A 5IXGA 1LELA 2IFBA 5LJEA 2GTLO 2XSTA 1HXLA 4LZUA 2NNEA 5AJCA 1CBQA 5HWZA 3WZNA 2DJFA 4YBPA 2FKGA 3IA8A 2OFMX 3WXQA 4GDZA 1LDQA 3AEHA 2A8GA 1ACDA 4QNIA 1SRGA 5FAZA 5LKFA 1MOYA 2GTFX 5LKEA 1OBPA 1SWBA 1NP1A 1SWQA 2AKQA 1RLBE 2K23A 1JMZA 1DC9A 5K06A 4ON1A 3UAQA 4FBRA 3RDUA 1MK5A 4AZMA 4WBKA 2X8FA 4NW4A 3BLGA 4I3DA 4YKOA 3NPOA 3FR5A 3APUA 1SWJA 2A2UA 3FA7A 4TNNA 5LJBA 1G7NA 3KFIA 4O4XA 1VWFB 4DQ3A 4O4UA 1LIBA 3RDQA 1LIEA 4ID2A 5F1EA 5BVQA 4EKVA 4I3BA 2RTLA 1VWJB 5FQ7E 2ALLX 1WUBA 2FWVA 4GJSA 3ZWEA 1LUQA 3APXA 2G7BA 1EQDA 1B0OA 4FBOA 5AJBA 3UEVA 2Y32A 5C0NA 4ORRA 2R74A 3FR4A 3FIDA 4ZHCA 1I9HA 1SY1A 2BHVA 1N7YA 1ZRYA 2G8CO 2LKKA 2ACOA 4IRWA 2CM9A 5AQ6A 3RSWA 3UEWA 3ZUOA 5K67A 5L8IA 3EBWA 4IB6A 2LBAA 1SWCA 2VDFA 2HZRA 2RTCB 1ICNA 5FQ8E 3FR2A 2JW1A 1B56A 2IZFB 3P02A 4NNTA 3T6LA 1SXXA 3U03A 4ZR2A 5IO6A 2JMBA 2W2FA 3JSQA 4GNWA 2X55A 4KC7A 5AEOA 2WR6A 4BX5A 5IO7A 1NQNA 4QGVA 1HMTA 3LV4A 2HNXA 2OFBA 4FGIB 4YFPA 3WJGA 1FEMA 4BBOA 1VWOB 1VWQB 1MVGA 4YDBA 2QO5A 4GU8A 1SLFB 5HZ8A 3SLTA 2HLVA 2KD2A 3VPJE 3ZW0B 2OL6O 4INNA 3RWXA 5KICA 1YIVA 5D48A 1IFBA 4GE1A 4NYQA 5HAEA 4MEEA 5LJGA 2C1QA 1KT4A 3MM0A 4A8ZA 1HQQA 4D6AA 3ELZA 1DFVA 3PP6A 4OKAA 1FTPA 2OL8O 4NYRA 2AH7X 3SLJA 3STMX 3CKFA 4EEJA 4U8UN 4AZPA 2Z4HA 2ZAGA 4Y0RA 3LTWA 1BSOA 1VYFA 4BVMA 3TGAA 1SMPI 2K62A 1VWGB 4OEMA 4ZFXA 2IZBA 2X4MA 4IB9A 2I5VO 1BEBA 3HPEA 4HPDA 5H9NA 4O9SA 1VWIB 3ZW1B 1G5WA 3F6ZB 1S2PA 5D47A 4GJVA 3HK1A 3FELA 4PJ2A 1HY2A 2NNDA 2GTLN 4QGWA 3ZZVA 1TXLA 1HQPA 4Z2PA 1HBQA 1W5RA 2JGSA 3RE6A 3WJEA 3HTYA 1LICA 3RDMA 1B8EA 2G5LA 3STNA 3BSZE 1STPA 1A3YA 1E00A 2DJGA 2E4JA 1QY2A 5EDCA 5HZQA 4IAWA 3FDCA 4YDAA 3B2KA 4EDEA 5HBSA 3MVFA 3Q34A 4L1NA 4BQUA 1AVDA 2RTNB 3FA6A 2OY7A 5LJCA 3VE1A 3APWA 2G79A 2LA7A 2YG2A 3I17A 1RBPA 4GRJA 2L5PA 4ORUA 4YCHA 1SWTA 3S26A 1SY0A 2RTEB 2KTDA 2RTAA 3RBYA 3D97A 1FENA 1HBPA 1KL4A 1STSB 2WWPA 2HMBA 3PDFA 2ANSA 1VWCB 1GT3A 2Q4NA 3GE2A 2GJ5A 3UEXA 3V8UA 2RA6A 3WJBA 4AZOA 2RTBB 1ICMA 1DZMA 5HTEA 4ZCBA 2PI3O 5B2AO 1LCZA 1ZNHA 2RCTA 4O4OA 4CPFA 2OF8A 3D95A 1AVEA 2AVIA 2OL7A 2QOMA 4K19A 1SWGA 2Q2MA 2Q9SA 2AT6X 4I6SA 1OPAA 5F2BA 1GT4A 1L6MA 1SWFA 4NLIA 1I05A 4TKBA 3KFHA 4AZQA 5BVTA 3WJDA 5F6ZA 5BYPA 1MEPA 3SLOA 1EI5A 1RAVA 5B27A 4QZUA 1VWRB 4RUNA 1JYJA 2RN4A 3NR3A 4YH0A 2AF5A 4GGZA 3G7XA 4GD9A 4ZH9A 3CBCA 4GGRA 1DF3A 1HMSA 2P8GA 1A57A 2X8SA 1JBHA 2RTKA 1K24A 3CKGA 3EW1A 3VG3A 4ZHDA 3ELXA 1YP6A 3HOLA 1N9MA 1FE3A 4OS3A 4Y0PA 3EMMA 1Y9TA 1RSTB 2UYWA 2X32A 3PEDA 2FKJA 4A60A 2AT5X 5JD2A 4BCSA 4CDDA 4D6BA 1QFTA
chains in the Genus database with same CATH topology
1X89A 2LBVA 2MO5A 3TZSA 5H9LA 3HWFA 3BY0A 3JQOA 4ZHHA 2ZAIA 3P6GA 4AZNA 4YGZA 4KH8A 2OFRX 4NLJA 4ARHA 4OMXA 3WJFA 3BU9A 5DPQA 1UREA 1OPBA 1R0UA 5EDBA 1NP4A 4IABA 3I0AA 5HCEC 4A1HA 3FLLA 1GKAA 2FR2A 5IO5A 2AMMX 2L67A 3D96A 4ZHFA 1QFVA 2A2GA 1JYDA 4ML7B 2QM9A 3MX7A 3WVMA 1ERXA 3F9DA 4TJZA 3PQUA 4TKJA 4TKHA 4CSBA 5B29A 1BM5A 1SY2A 1YWCA 4QRLA 1KQWA 3PQSA 5KHPA 3Q6LA 2QO4A 4O3YA 2FT9A 4TLJA 1YWBA 1GX9A 4UU3A 4XMGA 3VG4A 1JJXA 1LF7A 2NP1A 2GC9A 4HWMA 2JU8A 1X8PA 3NX2A 1BRPA 1DZPA 4KCAA 5F7GA 1O8VA 3BX8A 3CQRA 1MUPA 1GXAA 4YBUA 1BWYA 3O19A 4TQ2A 4QAEA 3OBLA 2ACPX 4QQ1A 1ZNLA 2N93A 4IB8A 4OS8A 5BVSA 4ZHGA 4ZGUA 1BSYA 3FA8A 3KZAA 2X45A 3WOVA 3JS1A 4Y0QA 1PMPA 1GM6A 1UZ2X 5LJHA 1QY0A 4ZJ0A 1LNMA 1TOWA 2G78A 3FIQA 4ALOA 1E06A 4COTA 1GT1A 1OBUA 2WEWA 3CR6A 3FA9A 3UEUA 5D45A 2WQAE 4WFUA 2BLGA 3U9PC 3LHNA 2RQ0A 3ZI8A 5LJKA 1YWDA 2KT4B 2JN3A 1IFCA 2KW1A 1T8VA 4XMEA 1I06A 5HZ9A 2M4LA 3MBTA 2FS6A 2DM5A 4YFQA 1EIIA 1TVQA 5H9KA 2AL0X 1GGLA 1EPBA 1SXYA 3BX7A 4DQ4A 2GTLM 3BS2A 4ZH6A 2CZUA 1GX8A 1LKEA 3K3LA 3S60A 1BRQA 4MIRA 4MVLA 4GK9A 4WHIA 1EIOA 2WUTA 4IBAA 4I9RA 3S5XA 3HWDA 1H91A 1AELA 2F09A 1QQSA 1X8QA 3FYFA 2Q2PA 3H3IA 1CBSA 4LKPA 5CE4A 1IIUA 4AW8A 5HZ5A 4MVKA 3D4RA 1KGLA 1ALBA 3HOEA 3B2JA 4O3WA 4GETA 1X8OA 2FS7A 4FQBB 2JOZA 5L8NA 1CJ5A 4UU2A 4I3CA 1I04A 2BT9A 3WJCA 1CRBA 1EPAA 2A13A 2FR3A 1FDQA 1U18A 4PSQA 1ML7A 5EEEA 4ORYA 4WFVA 3OE3A 3VG6A 4XMDA 1SY3A 2HYSA 1KOIA 1JV4A 1T0VA 1Z24A 1P6PA 1QWDA 2LB6A 2AT8X 4QGXA 1OEKA 5EEDA 5HA1A 1BJ7A 1KXOA 4GZVA 3B2HA 3KQ0A 3ZW1A 1MX7A 1GKAB 4XMFA 2POAA 1G85A 4R0BA 1DV9A 4KT5A 4QYPA 5D8JA 2L68A 3KFFA 3P24A 3DSZA 5EZ2A 3VG7A 1BLRA 1MDCA 1U0XA 1HMRA 1KT6A 5HCCC 2MWHA 4YGHA 5CYBA 2JU7A 2WSJA 4ALBA 1IKJA 2CBRA 1D2UA 4OS0A 2FLJA 2L9CA 4N7CA 3FW4A 5FENA 3P6FA 2MM3A 1IW2A 5HZ6A 5F6BA 4MVIA 1OEJA 5DG4A 2FRSA 1EUOA 4MVEA 5FQ6E 3RKGA 4M7MA 3CMPA 4O3XB 2YMSA 3VU1A 3TGCA 1KT7A 2OVAA 4HPBA 2CBSA 4ZGFA 3B2LA 3C76X 2AT0X 4QYNA 1A18A 2EU7X 3APVA 3NQKA 4NP1A 2WQ9A 5HCDC 1BSQA 2KTSA 2RD7C 3ZQ3A 4EQAC 5IO7A 1X71A 3BDRA 3O22A 4AZRA 1SXUA 1N0SA 1PM1X 4HFOA 4IMOA 1O1VA 4HPCA 1TOUA 3SOTA 1QABE 2OVEA 3PPTA 1PBOA 1KQXA 3GAQA 3KFGA 3C77X 3U0DA 3NQ3A 2OVDA 1KZXA 1AB0A 1NGLA 4QZTA 1E5PA 4Y0SA 2A3FX 2XKLA 4ES7A 1EALA 2LFOA 2O62A 5L8OA 3QKGA 2F73A 3OJYC 3AKMA 3RZYA 1AVGI 2CZTA 3PH5A 1X8NA 2QO6A 3B2IA 2HZQA 4A1YA 2CM4A 1AQBA 1E02A 1JIWI 1VYGA 3FENA 3IFBA 1JJJA 4KIIA 3VE2A 5FFHA 5EPQA 3TGBA 1ERBA 1KT5A 1SA8A 3BRNA 4YGGA 3TF6A 3ZUIA 4CK4A 1D3SA 3P6HA 4IAXA 4RUUA 3DTQA 5LJDA 4ODDA 1ZNEA 3AKNA 1A2DA 3PH6A 4CV7A 5HTDA 3OD9A 4U8UM 1JZUA 1ZNKA 1VPRA 3N91A 4IMNA 2WEXA 4EFGA 1ZNDA 1B4MA 3HWGA 1IKEA 2RCQA 1I4UA 3WBGA 2QOSC 1LIFA 2PY1A 3FEPA 2A0AA 4O49A 3VG5A 1U17A 3STKA 3PECA 1LIDA 3T1DA 3E3CA 3NADA 1TW4A 1YUPA 4LZVA 5F58A 4XMCA 2BS6A 1X8UA 1QG5A 3EYCA 2Q39A 1HN2A 1G74A 2ASNX 2R73A 2JU3A 3S5VA 1LPJA 3NP1A 4N7DA 4OMWA 1YP7A 2X46A 4IB7A 5H8TA 1EXSA 1OBQA 2QMIA 4NNSA 2OVSA 4YFRA 3FMZA 4YMYA 4LQZA 3ZW0A 1ZNGA 3CBSA 4O4SA 5D4AA 4LKTA 4YCEA 2R56A 1KZWA 2FTBA 1QY1A 1S44A 2NNQA 4U9CA 3SAOA 4YKMA 1GT5A 3C78X 2MJIA 3FW5A 3CWKA 2BS5A 4GH7A 4MISA 1S7DA 4BOEA 1FELA 1ADLA 1KT3A 3BU1A 4O3ZA 2OZQA 1MX8A 4ORXA 4JGLA 1PEEA 5HA0A 3NQ9A 2X8TA 1XCAA 4HPAA 1LFOA 4EXZA 3NBXX 1CBRA 2Z4IA 2MHDA 1EW3A 3P6EA 3P6DA 3F8AA 5KIDA 3L4RA 1Y9LA 1T68X 4I95A 4ORWA 2AT3X 3NX1A 1CBIA 2W2BA 1OEEA 3EBKA 4I9SA 5JR8A 4U8UO 1DZJA 4U3QA 3CQNA 3HWEA 1SXWA 4M6SA 3P6CA 4L3RA 4XMHA 3ZW2A 4FBVA 1DZKA 1O1UA 4GKCA 3FEKA 1YWAA 2W2AA 4ORSA 4GNYA 1BBPA 1XKIA 4AYHA 3O2YA 3VG2A 3EM0A 4KC8A 2IFBA 5LJEA 2GTLO 2XSTA 4LZUA 2NNEA 5AJCA 1CBQA 5HWZA 4YBPA 3IA8A 2OFMX 3WXQA 4GDZA 5FAZA 5LKFA 4QNIA 1ACDA 2GTFX 5LKEA 1OBPA 1NP1A 2AKQA 1RLBE 2K23A 1DC9A 5K06A 4ON1A 3UAQA 4FBRA 4AZMA 4WBKA 2X8FA 4NW4A 3BLGA 4I3DA 4YKOA 3NPOA 3FR5A 3APUA 4TNNA 2A2UA 3FA7A 5H9AA 5LJBA 1G7NA 3KFIA 4O4XA 4DQ3A 4O4UA 1LIBA 1LIEA 4ID2A 5F1EA 5BVQA 4I3BA 5FQ7E 2ALLX 2FWVA 3ZWEA 3APXA 2G7BA 1EQDA 1B0OA 4FBOA 5AJBA 3UEVA 5C0NA 4ORRA 2R74A 3FR4A 4ZHCA 1SY1A 2BHVA 2LKKA 1ZRYA 3RSWA 2ACOA 2CM9A 5AQ6A 3ZUOA 3UEWA 5L8IA 3EBWA 4IB6A 2LBAA 2HZRA 1ICNA 5FQ8E 3FR2A 2JW1A 1B56A 3P02A 4NNTA 1SXXA 3U03A 4ZR2A 5IO6A 2JMBA 2W2FA 3JSQA 4GNWA 4KC7A 5AEOA 2WR6A 4QGVA 1HMTA 3LV4A 2HNXA 4FGIB 4YFPA 3WJGA 1FEMA 1MVGA 4YDBA 2QO5A 4GU8A 5HZ8A 2HLVA 2KD2A 3VPJE 3ZW0B 4INNA 3RWXA 5KICA 1YIVA 5D48A 1IFBA 4GE1A 4NYQA 5HAEA 5LJGA 1KT4A 4A8ZA 4D6AA 3ELZA 1DFVA 3PP6A 1FTPA 4NYRA 2AH7X 3STMX 4EEJA 4U8UN 4AZPA 2Z4HA 2ZAGA 4Y0RA 4BVMA 1BSOA 1VYFA 3TGAA 1SMPI 2K62A 4ZFXA 4IB9A 1BEBA 4HPDA 5H9NA 4O9SA 3ZW1B 1G5WA 3F6ZB 1S2PA 5D47A 3HK1A 3FELA 4PJ2A 2NNDA 2GTLN 4QGWA 3ZZVA 1TXLA 1HQPA 1HBQA 3WJEA 3HTYA 1LICA 1B8EA 3STNA 3BSZE 1A3YA 1E00A 2E4JA 1QY2A 5EDCA 5HZQA 4IAWA 4YDAA 3B2KA 4EDEA 5HBSA 3MVFA 4L1NA 4BQUA 3FA6A 5LJCA 3VE1A 3APWA 2G79A 2LA7A 2YG2A 3I17A 1RBPA 4GRJA 2L5PA 4ORUA 4YCHA 3S26A 1SY0A 3RBYA 2KTDA 3D97A 1FENA 1HBPA 2WWPA 2HMBA 2ANSA 1GT3A 2Q4NA 3GE2A 2GJ5A 3UEXA 3V8UA 2RA6A 3WJBA 4AZOA 5HTEA 1ICMA 1DZMA 4ZCBA 1ZNHA 2RCTA 4O4OA 3D95A 4K19A 2Q2MA 2Q9SA 2AT6X 4I6SA 1OPAA 1GT4A 1L6MA 5BVTA 4NLIA 1I05A 4TKBA 3KFHA 4AZQA 3WJDA 5F6ZA 5BYPA 1EI5A 5B27A 4QZUA 4RUNA 1JYJA 2RN4A 3NR3A 4YH0A 3G7XA 4ZH9A 3CBCA 1DF3A 1HMSA 2P8GA 1A57A 2X8SA 1JBHA 3VG3A 4ZHDA 3ELXA 1YP6A 3HOLA 1FE3A 4OS3A 4Y0PA 3EMMA 1Y9TA 3PEDA 4A60A 2AT5X 4D6BA 1QFTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X89 A;  2LBV A;  2MO5 A;  3TZS A;  5H9L A;  3HWF A;  3BY0 A;  4ZHH A;  3P6G A;  4AZN A;  4YGZ A;  2OFR X;  4NLJ A;  4ARH A;  4OMX A;  3WJF A;  3BU9 A;  5DPQ A;  1URE A;  1OPB A;  1R0U A;  5EDB A;  1NP4 A;  5HCE C;  3I0A A;  4A1H A;  3FLL A;  1GKA A;  2FR2 A;  5IO5 A;  2AMM X;  2L67 A;  3D96 A;  4ZHF A;  1QFV A;  2A2G A;  1JYD A;  2QM9 A;  3WVM A;  1ERX A;  3F9D A;  4TJZ A;  4TKJ A;  4TKH A;  5B29 A;  1BM5 A;  1SY2 A;  1YWC A;  5KHP A;  1KQW A;  3Q6L A;  2QO4 A;  2FT9 A;  4TLJ A;  1YWB A;  1GX9 A;  4UU3 A;  4XMG A;  3VG4 A;  1JJX A;  1LF7 A;  2NP1 A;  2GC9 A;  2JU8 A;  1X8P A;  3NX2 A;  1BRP A;  1DZP A;  5F7G A;  1O8V A;  3BX8 A;  3CQR A;  1MUP A;  1GXA A;  4YBU A;  1BWY A;  3O19 A;  4TQ2 A;  4QAE A;  2ACP X;  1ZNL A;  2N93 A;  4IB8 A;  4OS8 A;  5BVS A;  4ZHG A;  4ZGU A;  1BSY A;  3FA8 A;  3KZA A;  2X45 A;  3JS1 A;  4Y0Q A;  1PMP A;  1GM6 A;  1UZ2 X;  5LJH A;  1QY0 A;  4ZJ0 A;  1LNM A;  1TOW A;  2G78 A;  3FIQ A;  4ALO A;  1E06 A;  1GT1 A;  1OBU A;  2WEW A;  3CR6 A;  3FA9 A;  3UEU A;  5D45 A;  2WQA E;  4WFU A;  2BLG A;  3U9P C;  2RQ0 A;  5LJK A;  1YWD A;  2KT4 B;  2JN3 A;  1IFC A;  1T8V A;  4XME A;  1I06 A;  5HZ9 A;  3MBT A;  2FS6 A;  2DM5 A;  4YFQ A;  1EII A;  1TVQ A;  5H9K A;  2AL0 X;  1GGL A;  1EPB A;  1SXY A;  3BX7 A;  4DQ4 A;  3BS2 A;  4ZH6 A;  2CZU A;  1GX8 A;  1LKE A;  3K3L A;  1BRQ A;  4MVL A;  1EIO A;  2WUT A;  4IBA A;  4I9R A;  3HWD A;  1H91 A;  1AEL A;  1QQS A;  1X8Q A;  2Q2P A;  1CBS A;  4LKP A;  5CE4 A;  1IIU A;  4AW8 A;  5HZ5 A;  4MVK A;  1KGL A;  1ALB A;  3B2J A;  4GET A;  1X8O A;  2FS7 A;  2JOZ A;  5L8N A;  1CJ5 A;  4UU2 A;  4I3C A;  1I04 A;  3WJC A;  1CRB A;  1EPA A;  2A13 A;  2FR3 A;  1FDQ A;  1U18 A;  4PSQ A;  1ML7 A;  5EEE A;  4ORY A;  4WFV A;  3VG6 A;  4XMD A;  1SY3 A;  2HYS A;  1KOI A;  1JV4 A;  1T0V A;  1Z24 A;  1P6P A;  1QWD A;  2LB6 A;  2AT8 X;  4QGX A;  1OEK A;  5EED A;  5HA1 A;  1BJ7 A;  1KXO A;  3B2H A;  3KQ0 A;  1MX7 A;  1GKA B;  4XMF A;  2POA A;  1G85 A;  4R0B A;  1DV9 A;  4QYP A;  5D8J A;  2L68 A;  3KFF A;  3DSZ A;  5EZ2 A;  3VG7 A;  1BLR A;  1MDC A;  1U0X A;  1HMR A;  1KT6 A;  5HCC C;  4YGH A;  2JU7 A;  2WSJ A;  4ALB A;  1IKJ A;  2CBR A;  1D2U A;  4OS0 A;  2FLJ A;  2L9C A;  4N7C A;  3FW4 A;  5FEN A;  3P6F A;  2MM3 A;  1IW2 A;  5HZ6 A;  5F6B A;  4MVI A;  1OEJ A;  5DG4 A;  2FRS A;  1EUO A;  4M7M A;  3CMP A;  3TGC A;  1KT7 A;  2OVA A;  4HPB A;  2CBS A;  3B2L A;  3C76 X;  2AT0 X;  4QYN A;  1A18 A;  2EU7 X;  3APV A;  4NP1 A;  2WQ9 A;  5HCD C;  1BSQ A;  5IO7 A;  2RD7 C;  3ZQ3 A;  1X71 A;  3BDR A;  3O22 A;  4AZR A;  1SXU A;  1N0S A;  1PM1 X;  4HFO A;  4IMO A;  1O1V A;  4HPC A;  1TOU A;  1QAB E;  2OVE A;  3PPT A;  1PBO A;  1KQX A;  3GAQ A;  3KFG A;  3C77 X;  3U0D A;  3NQ3 A;  2OVD A;  1KZX A;  1AB0 A;  1NGL A;  4QZT A;  1E5P A;  4Y0S A;  2A3F X;  2XKL A;  4ES7 A;  1EAL A;  2LFO A;  2O62 A;  5L8O A;  3QKG A;  2F73 A;  3OJY C;  3AKM A;  3RZY A;  1AVG I;  2CZT A;  3PH5 A;  1X8N A;  2QO6 A;  3B2I A;  2HZQ A;  4A1Y A;  2CM4 A;  1AQB A;  1E02 A;  3IFB A;  1VYG A;  3FEN A;  1JJJ A;  4KII A;  5FFH A;  5EPQ A;  3TGB A;  1ERB A;  1KT5 A;  1SA8 A;  3BRN A;  4YGG A;  3TF6 A;  3ZUI A;  4CK4 A;  1D3S A;  3P6H A;  4IAX A;  4RUU A;  3DTQ A;  5LJD A;  4ODD A;  1ZNE A;  3AKN A;  1A2D A;  3PH6 A;  5HTD A;  1JZU A;  1ZNK A;  1VPR A;  4IMN A;  2WEX A;  4EFG A;  1ZND A;  3HWG A;  1IKE A;  2RCQ A;  1I4U A;  3WBG A;  2QOS C;  1LIF A;  2PY1 A;  3FEP A;  2A0A A;  3VG5 A;  1U17 A;  3STK A;  3PEC A;  1LID A;  3T1D A;  3NAD A;  1TW4 A;  1YUP A;  4LZV A;  5F58 A;  4XMC A;  1X8U A;  1QG5 A;  3EYC A;  2Q39 A;  1HN2 A;  1G74 A;  2ASN X;  2R73 A;  2JU3 A;  1LPJ A;  3NP1 A;  4N7D A;  4OMW A;  1YP7 A;  2X46 A;  4IB7 A;  5H8T A;  1EXS A;  1OBQ A;  4NNS A;  4YFR A;  3FMZ A;  4YMY A;  1ZNG A;  3CBS A;  5D4A A;  4LKT A;  4YCE A;  2R56 A;  1KZW A;  2FTB A;  1QY1 A;  1S44 A;  2NNQ A;  3SAO A;  4YKM A;  1GT5 A;  3C78 X;  2MJI A;  3FW5 A;  3CWK A;  4GH7 A;  1S7D A;  4BOE A;  1FEL A;  1ADL A;  1KT3 A;  3BU1 A;  2OZQ A;  1MX8 A;  4ORX A;  1PEE A;  5HA0 A;  3NQ9 A;  1XCA A;  4HPA A;  1LFO A;  4EXZ A;  1CBR A;  1EW3 A;  3P6E A;  3P6D A;  3F8A A;  5KID A;  3L4R A;  1T68 X;  4ORW A;  2AT3 X;  3NX1 A;  1CBI A;  2W2B A;  1OEE A;  3EBK A;  4I9S A;  5JR8 A;  1DZJ A;  3CQN A;  3HWE A;  1SXW A;  4M6S A;  3P6C A;  4XMH A;  1DZK A;  1O1U A;  4GKC A;  3FEK A;  1YWA A;  2W2A A;  4ORS A;  4GNY A;  1BBP A;  1XKI A;  4AYH A;  3O2Y A;  3VG2 A;  3EM0 A;  2IFB A;  5LJE A;  2XST A;  4LZU A;  2NNE A;  1CBQ A;  5HWZ A;  4YBP A;  3IA8 A;  2OFM X;  3WXQ A;  5FAZ A;  5LKF A;  1ACD A;  2GTF X;  5LKE A;  1OBP A;  1NP1 A;  2AKQ A;  1RLB E;  2K23 A;  1DC9 A;  5K06 A;  4AZM A;  4WBK A;  1B4M A;  3BLG A;  4I3D A;  4YKO A;  3NPO A;  3FR5 A;  3APU A;  4TNN A;  2A2U A;  3FA7 A;  5H9A A;  5LJB A;  1G7N A;  3KFI A;  4DQ3 A;  1LIB A;  1LIE A;  5F1E A;  5BVQ A;  4I3B A;  2ALL X;  2FWV A;  3APX A;  2G7B A;  1EQD A;  1B0O A;  3UEV A;  5C0N A;  4ORR A;  2R74 A;  3FR4 A;  4ZHC A;  1SY1 A;  2LKK A;  3RSW A;  1ZRY A;  2ACO A;  2CM9 A;  5AQ6 A;  3ZUO A;  3UEW A;  5L8I A;  3EBW A;  4IB6 A;  2LBA A;  2HZR A;  1ICN A;  3FR2 A;  1B56 A;  4NNT A;  1SXX A;  3U03 A;  4ZR2 A;  5IO6 A;  2W2F A;  3JSQ A;  4GNW A;  2WR6 A;  4QGV A;  1HMT A;  4YFP A;  2HNX A;  3WJG A;  1FEM A;  1MVG A;  4YDB A;  2QO5 A;  5HZ8 A;  2HLV A;  5KIC A;  1YIV A;  5D48 A;  1IFB A;  4GE1 A;  4NYQ A;  5HAE A;  5LJG A;  1KT4 A;  4A8Z A;  4D6A A;  3ELZ A;  1DFV A;  3PP6 A;  1FTP A;  4NYR A;  2AH7 X;  3STM X;  4EEJ A;  4AZP A;  4BVM A;  4Y0R A;  1BSO A;  1VYF A;  3TGA A;  2K62 A;  4ZFX A;  4IB9 A;  1BEB A;  4HPD A;  5H9N A;  4O9S A;  1G5W A;  1S2P A;  5D47 A;  3HK1 A;  3FEL A;  2NND A;  4QGW A;  1TXL A;  1HQP A;  1HBQ A;  3WJE A;  1LIC A;  1B8E A;  3STN A;  3BSZ E;  1A3Y A;  1E00 A;  2E4J A;  1QY2 A;  5EDC A;  5HZQ A;  4IAW A;  4YDA A;  3B2K A;  4EDE A;  5HBS A;  3MVF A;  4BQU A;  3FA6 A;  5LJC A;  3APW A;  2G79 A;  3I17 A;  2YG2 A;  4GRJ A;  1RBP A;  4ORU A;  2L5P A;  4YCH A;  3S26 A;  1SY0 A;  2KTD A;  3D97 A;  1FEN A;  1HBP A;  2WWP A;  2HMB A;  2ANS A;  1GT3 A;  2Q4N A;  2GJ5 A;  3UEX A;  4AZO A;  2RA6 A;  3WJB A;  5HTE A;  1ICM A;  1DZM A;  4ZCB A;  1ZNH A;  2RCT A;  3D95 A;  4K19 A;  2Q2M A;  2Q9S A;  2AT6 X;  1OPA A;  1GT4 A;  1L6M A;  5BVT A;  4NLI A;  1I05 A;  4TKB A;  3KFH A;  4AZQ A;  3WJD A;  5F6Z A;  5B27 A;  4QZU A;  4RUN A;  1JYJ A;  3NR3 A;  4YH0 A;  3G7X A;  4ZH9 A;  3CBC A;  1DF3 A;  1HMS A;  2P8G A;  1A57 A;  1JBH A;  3VG3 A;  4ZHD A;  3ELX A;  1YP6 A;  1FE3 A;  4OS3 A;  4Y0P A;  3EMM A;  3PED A;  4A60 A;  2AT5 X;  4D6B A;  1QFT A; 
#chains in the Genus database with same CATH topology
 2IZD B;  1X89 A;  2LBV A;  2MO5 A;  3TZS A;  5H9L A;  1W4T A;  3BY0 A;  2RTP B;  3HWF A;  3JQO A;  4BX5 B;  1GX3 A;  4BX7 A;  4ZHH A;  2ZAI A;  3P6G A;  4AZN A;  1SWH A;  4YGZ A;  4KH8 A;  2OFR X;  4NLJ A;  5K68 A;  1SRI A;  4ARH A;  2OFA A;  4OMX A;  3WJF A;  2Y3F A;  3BU9 A;  5DPQ A;  1HXZ A;  3QQ2 A;  1URE A;  1OPB A;  1R0U A;  2WPU A;  1NP4 A;  4IAB A;  3I0A A;  5EDB A;  5HCE C;  1VWP B;  4GDA A;  4A1H A;  3FLL A;  1GKA A;  2FR2 A;  4Z2V A;  5IO5 A;  2OF9 A;  5B5F A;  2AMM X;  2L67 A;  3D96 A;  3AUM O;  4ZHF A;  3RY1 A;  5B5G A;  1QFV A;  2RTG B;  2A2G A;  2IZJ A;  5B3M O;  1JYD A;  4ML7 B;  2QM9 A;  3MX7 A;  3WVM A;  1ERX A;  3F9D A;  4TJZ A;  3T6F A;  1SWS A;  3PQU A;  4TKJ A;  4TKH A;  4CSB A;  5B29 A;  1BM5 A;  1SY2 A;  1YWC A;  4QRL A;  1KQW A;  3PQS A;  5KHP A;  3Q6L A;  5CSE A;  4GUZ A;  2QO4 A;  4O3Y A;  2FT9 A;  4TLJ A;  1YWB A;  1GX9 A;  4UU3 A;  4XMG A;  3VG4 A;  4Y5D A;  1JJX A;  1LF7 A;  2NP1 A;  2GC9 A;  1OSP O;  4HWM A;  4CPE A;  1UYO X;  2JU8 A;  1X8P A;  3NX2 A;  1BRP A;  1DZP A;  4KCA A;  5F7G A;  2X56 A;  1O8V A;  3BX8 A;  3CQR A;  1MUP A;  1GXA A;  4Z28 A;  4YBU A;  1NC9 A;  1SWE A;  1SLD B;  1BWY A;  3O19 A;  4GGT A;  2C1S A;  3SZH A;  4TQ2 A;  4QAE A;  4BGF A;  3OBL A;  2ACP X;  4QQ1 A;  1N4J A;  1ZNL A;  1JMX A;  2N93 A;  4IB8 A;  4OS8 A;  5BVS A;  4CPH B;  4ZGU A;  1BSY A;  3FA8 A;  4ZHG A;  3KZA A;  2X45 A;  3WOV A;  1RXJ A;  3JS1 A;  4Y0Q A;  1PMP A;  1SWD A;  1GM6 A;  1UZ2 X;  2GH7 A;  4DNE A;  4Z2O A;  1SLE B;  5LJH A;  1QY0 A;  3VGW A;  4ZJ0 A;  1LNM A;  1TOW A;  2G78 A;  2VFC A;  3FIQ A;  4ALO A;  1E06 A;  4COT A;  1GT1 A;  1OBU A;  2WEW A;  3CR6 A;  3FA9 A;  3UEU A;  5D45 A;  1MM9 A;  2WQA E;  2BLG A;  4WFU A;  3U9P C;  1SRF A;  3LHN A;  4DCB A;  1SWA A;  2RQ0 A;  3ZI8 A;  5LJK A;  1YWD A;  2KT4 B;  4BJ8 A;  2JN3 A;  1FJ1 E;  1IFC A;  2KW1 A;  1T8V A;  4XME A;  1I06 A;  5HZ9 A;  3VHH A;  1SWO A;  3EC5 A;  2M4L A;  3MBT A;  2FS6 A;  2DM5 A;  4JNJ A;  4YFQ A;  1EII A;  1TVQ A;  5H9K A;  2AL0 X;  4JO6 A;  5B10 O;  1GGL A;  1EPB A;  1SXY A;  3BX7 A;  4DQ4 A;  2GTL M;  3BS2 A;  4ZH6 A;  2CZU A;  4NV7 A;  1GX8 A;  1LKE A;  3K3L A;  3S60 A;  4CPI A;  1BRQ A;  1RXK A;  4MIR A;  4MVL A;  1VWL B;  4GK9 A;  4WHI A;  2OY5 O;  1EIO A;  2WUT A;  4IBA A;  4I9R A;  3S5X A;  3HWD A;  1H91 A;  1AEL A;  3RDS A;  2A5B A;  2F09 A;  1QQS A;  1X8Q A;  3FYF A;  2Q2P A;  3H3I A;  1CBS A;  1VYO A;  2MF6 A;  4LKP A;  5CE4 A;  1IIU A;  4AW8 A;  5HZ5 A;  1PBY A;  5B11 O;  4MVK A;  1SRH A;  3D4R A;  1KGL A;  1ALB A;  1SRJ A;  1VWB B;  3B2J A;  3HOE A;  4O3W A;  1VWK B;  1LDO A;  1SLG B;  4GET A;  1X8O A;  2FS7 A;  4FQB B;  3WZO A;  2JOZ A;  5L8N A;  1CJ5 A;  4UU2 A;  2OYB O;  4I3C A;  1I04 A;  2BT9 A;  3WJC A;  1CRB A;  1EPA A;  1VWN B;  2A13 A;  2FR3 A;  1FDQ A;  2HKD A;  1U18 A;  4PSQ A;  1ML7 A;  1SRE A;  5EEE A;  4ORY A;  2RTI B;  4WFV A;  3OE3 A;  4BX7 B;  3VG6 A;  4XMD A;  2RTR B;  3T2W A;  1SY3 A;  2HYS A;  1KOI A;  1JV4 A;  1T0V A;  5HCD C;  3WYQ A;  4I60 A;  2VFB A;  1Z24 A;  1P6P A;  1QWD A;  1N9Y A;  2AT8 X;  2LB6 A;  4QGX A;  4JHQ A;  1OEK A;  5EED A;  5HA1 A;  1BJ7 A;  2F01 A;  1KXO A;  2X34 A;  4GZV A;  4OEL A;  3RE5 A;  3B2H A;  3KQ0 A;  3ZW1 A;  4B55 A;  1MX7 A;  1GKA B;  4XMF A;  3PK2 A;  2POA A;  1G85 A;  4R0B A;  2IZI A;  1DV9 A;  4KT5 A;  4QYP A;  4U46 A;  5D8J A;  3SZJ A;  2BSZ A;  2C4I A;  2L68 A;  2RTO B;  3DSZ A;  3KFF A;  3P24 A;  5EZ2 A;  1MDC A;  3VG7 A;  1U0X A;  1HMR A;  1KT6 A;  1BLR A;  5HCC C;  1KL5 A;  2MWH A;  4YGH A;  5CYB A;  2JU7 A;  2WSJ A;  1PTS A;  1SWL A;  4ALB A;  1IKJ A;  1RSU B;  2CBR A;  1D2U A;  4OS0 A;  4CDF A;  2FLJ A;  1NQM A;  2L9C A;  3FW4 A;  4N7C A;  5FEN A;  3P6F A;  1SWU A;  1SWK A;  2MM3 A;  1IW2 A;  2FGS A;  5F6B A;  5HZ6 A;  5L3Y A;  3VHM A;  1STR B;  4MVI A;  1OEJ A;  1LCW A;  1VWM B;  2RTH B;  2FHN X;  2IZA A;  5DG4 A;  2FRS A;  1EUO A;  4MVE A;  5FQ6 E;  3RKG A;  4M7M A;  3CMP A;  4O3X B;  2YMS A;  3VU1 A;  3TGC A;  2IZK A;  1KT7 A;  2Y3E A;  2OVA A;  4HPB A;  2CBS A;  4ZGF A;  3B2L A;  3C76 X;  2AT0 X;  4QYN A;  1A18 A;  2EU7 X;  3APV A;  3NQK A;  1VWH B;  2WQ9 A;  4NP1 A;  1BSQ A;  1N43 A;  2KTS A;  2RD7 C;  3ZQ3 A;  4C5P A;  1X71 A;  3BDR A;  3O22 A;  4AZR A;  1SXU A;  1N0S A;  1PM1 X;  4HFO A;  4IMO A;  1O1V A;  4HPC A;  1TOU A;  3SOT A;  1QAB E;  2OVE A;  3PPT A;  4BX6 A;  1PBO A;  1KQX A;  3GAQ A;  3KFG A;  2IZG B;  4Z6J A;  3C77 X;  3U0D A;  3NQ3 A;  2OVD A;  1KZX A;  1AB0 A;  1NGL A;  4QZT A;  1E5P A;  4Y0S A;  2A3F X;  1Y55 X;  1VWA B;  1SWP A;  2XKL A;  4ES7 A;  1RXH A;  1EAL A;  2LFO A;  2O62 A;  5L8O A;  3QKG A;  2F73 A;  2RTD B;  3OJY C;  3AKM A;  3RZY A;  2A5C A;  1AVG I;  2CZT A;  3PH5 A;  1WBI A;  4Z27 A;  1X8N A;  1W6F A;  2QO6 A;  2HZQ A;  3B2I A;  3WZP A;  3X00 A;  2CM4 A;  2IZC B;  4A1Y A;  1AQB A;  1JJU A;  1E02 A;  1JIW I;  1VYG A;  3FEN A;  3IFB A;  2IZL B;  4CDE A;  4EQA C;  1JJJ A;  4KII A;  3VE2 A;  5FFH A;  5EPQ A;  2CAM A;  1Y0G A;  3TGB A;  1ERB A;  2IZH B;  1SWR A;  1KT5 A;  1SA8 A;  3BRN A;  3VHI A;  4YGG A;  3TF6 A;  4YVB A;  2RTF B;  3RDO A;  3ZUI A;  4CK4 A;  1Y52 X;  1D3S A;  3P6H A;  4IAX A;  4RUU A;  1VWD B;  3DTQ A;  5LJD A;  3RY2 A;  4ODD A;  1ZNE A;  3AKN A;  1A2D A;  3PH6 A;  4CV7 A;  5HTD A;  3OD9 A;  4U8U M;  1JZU A;  3D9W A;  1ZNK A;  1KL3 A;  1VPR A;  3N91 A;  4IMN A;  2WEX A;  4EFG A;  2RTQ B;  1ZND A;  1KFF A;  1UYN X;  3HWG A;  1B4M A;  1IKE A;  2RCQ A;  4NV8 A;  2OY8 A;  1I4U A;  2FHL A;  3WBG A;  2QOS C;  1LIF A;  2PY1 A;  3FEP A;  2A0A A;  3KVN A;  4O49 A;  3VG5 A;  2ZSC A;  1U17 A;  3STK A;  3PEC A;  1LID A;  3T1D A;  3E3C A;  3NAD A;  3EW2 A;  1TW4 A;  2IZE B;  1YUP A;  4LZV A;  5F58 A;  4XMC A;  2BS6 A;  1X8U A;  1QG5 A;  2I5Z O;  3EYC A;  2Q39 A;  3WZQ A;  1HN2 A;  1G74 A;  1SWN A;  2ASN X;  2R73 A;  2JU3 A;  5H9A A;  3S5V A;  1LPJ A;  3NP1 A;  4N7D A;  4OMW A;  1YP7 A;  2X46 A;  4IB7 A;  5H8T A;  1EXS A;  1OBQ A;  2QMI A;  4NNS A;  2OVS A;  5IRU A;  3FMZ A;  4YFR A;  2RTJ A;  4LQZ A;  2RTM A;  4YMY A;  3ZW0 A;  1ZNG A;  1K3B A;  5IRA A;  3CBS A;  4O4S A;  3SZI A;  5D4A A;  4LKT A;  4YCE A;  2R56 A;  4CPH A;  2FTB A;  1QY1 A;  1S44 A;  2NNQ A;  4U9C A;  3WYP A;  1KZW A;  3SAO A;  4YKM A;  1Y53 X;  1GT5 A;  3C78 X;  2MJI A;  3FW5 A;  4CDC A;  3CWK A;  4Y59 A;  2BS5 A;  4GH7 A;  1IJ8 A;  4MIS A;  3T2X A;  1S7D A;  4BOE A;  1FEL A;  1ADL A;  1KT3 A;  3BU1 A;  4O3Z A;  2OZQ A;  1MX8 A;  4ORX A;  4JGL A;  1PEE A;  5HA0 A;  3NQ9 A;  2X8T A;  1XCA A;  4HPA A;  1LFO A;  4EXZ A;  2UZ2 A;  1CBR A;  3NBX X;  2Z4I A;  1VWE B;  2MHD A;  1JQP A;  1E2T A;  1EW3 A;  3P6E A;  1DF8 A;  3P6D A;  1I78 A;  3F8A A;  2QCB A;  5KID A;  3L4R A;  1Y9L A;  1T68 X;  4I95 A;  4ORW A;  3RDX A;  2AT3 X;  3NX1 A;  1NBX A;  1CBI A;  2W2B A;  1OEE A;  3EBK A;  3MG5 A;  4I9S A;  5JR8 A;  4U8U O;  1DZJ A;  4U3Q A;  2OY1 O;  3CQN A;  1SXW A;  3HWE A;  4M6S A;  3P6C A;  4L3R A;  4XMH A;  5CHK A;  3ZW2 A;  4FBV A;  1DZK A;  1NDJ A;  1O1U A;  4GKC A;  3FEK A;  4BX6 B;  1YWA A;  2W2A A;  4ORS A;  4GNY A;  1BBP A;  1LCV A;  5IRW A;  2BC3 A;  1XKI A;  4AYH A;  3O2Y A;  3VG2 A;  3EM0 A;  4KC8 A;  5IXG A;  1LEL A;  2IFB A;  5LJE A;  2GTL O;  2XST A;  1HXL A;  4LZU A;  2NNE A;  5AJC A;  1CBQ A;  5HWZ A;  3WZN A;  2DJF A;  4YBP A;  2FKG A;  3IA8 A;  2OFM X;  3WXQ A;  4GDZ A;  1LDQ A;  3AEH A;  2A8G A;  1ACD A;  4QNI A;  1SRG A;  5FAZ A;  5LKF A;  1MOY A;  2GTF X;  5LKE A;  1OBP A;  1SWB A;  1NP1 A;  1SWQ A;  2AKQ A;  1RLB E;  2K23 A;  1JMZ A;  1DC9 A;  5K06 A;  4ON1 A;  3UAQ A;  4FBR A;  3RDU A;  1MK5 A;  4AZM A;  4WBK A;  2X8F A;  4NW4 A;  3BLG A;  4I3D A;  4YKO A;  3NPO A;  3FR5 A;  3APU A;  1SWJ A;  2A2U A;  3FA7 A;  4TNN A;  5LJB A;  1G7N A;  3KFI A;  4O4X A;  1VWF B;  4DQ3 A;  4O4U A;  1LIB A;  3RDQ A;  1LIE A;  4ID2 A;  5F1E A;  5BVQ A;  4EKV A;  4I3B A;  2RTL A;  1VWJ B;  5FQ7 E;  2ALL X;  1WUB A;  2FWV A;  4GJS A;  3ZWE A;  1LUQ A;  3APX A;  2G7B A;  1EQD A;  1B0O A;  4FBO A;  5AJB A;  3UEV A;  2Y32 A;  5C0N A;  4ORR A;  2R74 A;  3FR4 A;  3FID A;  4ZHC A;  1I9H A;  1SY1 A;  2BHV A;  1N7Y A;  1ZRY A;  2G8C O;  2LKK A;  2ACO A;  4IRW A;  2CM9 A;  5AQ6 A;  3RSW A;  3UEW A;  3ZUO A;  5K67 A;  5L8I A;  3EBW A;  4IB6 A;  2LBA A;  1SWC A;  2VDF A;  2HZR A;  2RTC B;  1ICN A;  5FQ8 E;  3FR2 A;  2JW1 A;  1B56 A;  2IZF B;  3P02 A;  4NNT A;  3T6L A;  1SXX A;  3U03 A;  4ZR2 A;  5IO6 A;  2JMB A;  2W2F A;  3JSQ A;  4GNW A;  2X55 A;  4KC7 A;  5AEO A;  2WR6 A;  4BX5 A;  5IO7 A;  1NQN A;  4QGV A;  1HMT A;  3LV4 A;  2HNX A;  2OFB A;  4FGI B;  4YFP A;  3WJG A;  1FEM A;  4BBO A;  1VWO B;  1VWQ B;  1MVG A;  4YDB A;  2QO5 A;  4GU8 A;  1SLF B;  5HZ8 A;  3SLT A;  2HLV A;  2KD2 A;  3VPJ E;  3ZW0 B;  2OL6 O;  4INN A;  3RWX A;  5KIC A;  1YIV A;  5D48 A;  1IFB A;  4GE1 A;  4NYQ A;  5HAE A;  4MEE A;  5LJG A;  2C1Q A;  1KT4 A;  3MM0 A;  4A8Z A;  1HQQ A;  4D6A A;  3ELZ A;  1DFV A;  3PP6 A;  4OKA A;  1FTP A;  2OL8 O;  4NYR A;  2AH7 X;  3SLJ A;  3STM X;  3CKF A;  4EEJ A;  4U8U N;  4AZP A;  2Z4H A;  2ZAG A;  4Y0R A;  3LTW A;  1BSO A;  1VYF A;  4BVM A;  3TGA A;  1SMP I;  2K62 A;  1VWG B;  4OEM A;  4ZFX A;  2IZB A;  2X4M A;  4IB9 A;  2I5V O;  1BEB A;  3HPE A;  4HPD A;  5H9N A;  4O9S A;  1VWI B;  3ZW1 B;  1G5W A;  3F6Z B;  1S2P A;  5D47 A;  4GJV A;  3HK1 A;  3FEL A;  4PJ2 A;  1HY2 A;  2NND A;  2GTL N;  4QGW A;  3ZZV A;  1TXL A;  1HQP A;  4Z2P A;  1HBQ A;  1W5R A;  2JGS A;  3RE6 A;  3WJE A;  3HTY A;  1LIC A;  3RDM A;  1B8E A;  2G5L A;  3STN A;  3BSZ E;  1STP A;  1A3Y A;  1E00 A;  2DJG A;  2E4J A;  1QY2 A;  5EDC A;  5HZQ A;  4IAW A;  3FDC A;  4YDA A;  3B2K A;  4EDE A;  5HBS A;  3MVF A;  3Q34 A;  4L1N A;  4BQU A;  1AVD A;  2RTN B;  3FA6 A;  2OY7 A;  5LJC A;  3VE1 A;  3APW A;  2G79 A;  2LA7 A;  2YG2 A;  3I17 A;  1RBP A;  4GRJ A;  2L5P A;  4ORU A;  4YCH A;  1SWT A;  3S26 A;  1SY0 A;  2RTE B;  2KTD A;  2RTA A;  3RBY A;  3D97 A;  1FEN A;  1HBP A;  1KL4 A;  1STS B;  2WWP A;  2HMB A;  3PDF A;  2ANS A;  1VWC B;  1GT3 A;  2Q4N A;  3GE2 A;  2GJ5 A;  3UEX A;  3V8U A;  2RA6 A;  3WJB A;  4AZO A;  2RTB B;  1ICM A;  1DZM A;  5HTE A;  4ZCB A;  2PI3 O;  5B2A O;  1LCZ A;  1ZNH A;  2RCT A;  4O4O A;  4CPF A;  2OF8 A;  3D95 A;  1AVE A;  2AVI A;  2OL7 A;  2QOM A;  4K19 A;  1SWG A;  2Q2M A;  2Q9S A;  2AT6 X;  4I6S A;  1OPA A;  5F2B A;  1GT4 A;  1L6M A;  1SWF A;  4NLI A;  1I05 A;  4TKB A;  3KFH A;  4AZQ A;  5BVT A;  3WJD A;  5F6Z A;  5BYP A;  1MEP A;  3SLO A;  1EI5 A;  1RAV A;  5B27 A;  4QZU A;  1VWR B;  4RUN A;  1JYJ A;  2RN4 A;  3NR3 A;  4YH0 A;  2AF5 A;  4GGZ A;  3G7X A;  4GD9 A;  4ZH9 A;  3CBC A;  4GGR A;  1DF3 A;  1HMS A;  2P8G A;  1A57 A;  2X8S A;  1JBH A;  2RTK A;  1K24 A;  3CKG A;  3EW1 A;  3VG3 A;  4ZHD A;  3ELX A;  1YP6 A;  3HOL A;  1N9M A;  1FE3 A;  4OS3 A;  4Y0P A;  3EMM A;  1Y9T A;  1RST B;  2UYW A;  2X32 A;  3PED A;  2FKJ A;  4A60 A;  2AT5 X;  5JD2 A;  4BCS A;  4CDD A;  4D6B A;  1QFT A; 
#chains in the Genus database with same CATH homology
 1X89 A;  2LBV A;  2MO5 A;  3TZS A;  5H9L A;  3HWF A;  3BY0 A;  3JQO A;  4ZHH A;  2ZAI A;  3P6G A;  4AZN A;  4YGZ A;  4KH8 A;  2OFR X;  4NLJ A;  4ARH A;  4OMX A;  3WJF A;  3BU9 A;  5DPQ A;  1URE A;  1OPB A;  1R0U A;  5EDB A;  1NP4 A;  4IAB A;  3I0A A;  5HCE C;  4A1H A;  3FLL A;  1GKA A;  2FR2 A;  5IO5 A;  2AMM X;  2L67 A;  3D96 A;  4ZHF A;  1QFV A;  2A2G A;  1JYD A;  4ML7 B;  2QM9 A;  3MX7 A;  3WVM A;  1ERX A;  3F9D A;  4TJZ A;  3PQU A;  4TKJ A;  4TKH A;  4CSB A;  5B29 A;  1BM5 A;  1SY2 A;  1YWC A;  4QRL A;  1KQW A;  3PQS A;  5KHP A;  3Q6L A;  2QO4 A;  4O3Y A;  2FT9 A;  4TLJ A;  1YWB A;  1GX9 A;  4UU3 A;  4XMG A;  3VG4 A;  1JJX A;  1LF7 A;  2NP1 A;  2GC9 A;  4HWM A;  2JU8 A;  1X8P A;  3NX2 A;  1BRP A;  1DZP A;  4KCA A;  5F7G A;  1O8V A;  3BX8 A;  3CQR A;  1MUP A;  1GXA A;  4YBU A;  1BWY A;  3O19 A;  4TQ2 A;  4QAE A;  3OBL A;  2ACP X;  4QQ1 A;  1ZNL A;  2N93 A;  4IB8 A;  4OS8 A;  5BVS A;  4ZHG A;  4ZGU A;  1BSY A;  3FA8 A;  3KZA A;  2X45 A;  3WOV A;  3JS1 A;  4Y0Q A;  1PMP A;  1GM6 A;  1UZ2 X;  5LJH A;  1QY0 A;  4ZJ0 A;  1LNM A;  1TOW A;  2G78 A;  3FIQ A;  4ALO A;  1E06 A;  4COT A;  1GT1 A;  1OBU A;  2WEW A;  3CR6 A;  3FA9 A;  3UEU A;  5D45 A;  2WQA E;  4WFU A;  2BLG A;  3U9P C;  3LHN A;  2RQ0 A;  3ZI8 A;  5LJK A;  1YWD A;  2KT4 B;  2JN3 A;  1IFC A;  2KW1 A;  1T8V A;  4XME A;  1I06 A;  5HZ9 A;  2M4L A;  3MBT A;  2FS6 A;  2DM5 A;  4YFQ A;  1EII A;  1TVQ A;  5H9K A;  2AL0 X;  1GGL A;  1EPB A;  1SXY A;  3BX7 A;  4DQ4 A;  2GTL M;  3BS2 A;  4ZH6 A;  2CZU A;  1GX8 A;  1LKE A;  3K3L A;  3S60 A;  1BRQ A;  4MIR A;  4MVL A;  4GK9 A;  4WHI A;  1EIO A;  2WUT A;  4IBA A;  4I9R A;  3S5X A;  3HWD A;  1H91 A;  1AEL A;  2F09 A;  1QQS A;  1X8Q A;  3FYF A;  2Q2P A;  3H3I A;  1CBS A;  4LKP A;  5CE4 A;  1IIU A;  4AW8 A;  5HZ5 A;  4MVK A;  3D4R A;  1KGL A;  1ALB A;  3HOE A;  3B2J A;  4O3W A;  4GET A;  1X8O A;  2FS7 A;  4FQB B;  2JOZ A;  5L8N A;  1CJ5 A;  4UU2 A;  4I3C A;  1I04 A;  2BT9 A;  3WJC A;  1CRB A;  1EPA A;  2A13 A;  2FR3 A;  1FDQ A;  1U18 A;  4PSQ A;  1ML7 A;  5EEE A;  4ORY A;  4WFV A;  3OE3 A;  3VG6 A;  4XMD A;  1SY3 A;  2HYS A;  1KOI A;  1JV4 A;  1T0V A;  1Z24 A;  1P6P A;  1QWD A;  2LB6 A;  2AT8 X;  4QGX A;  1OEK A;  5EED A;  5HA1 A;  1BJ7 A;  1KXO A;  4GZV A;  3B2H A;  3KQ0 A;  3ZW1 A;  1MX7 A;  1GKA B;  4XMF A;  2POA A;  1G85 A;  4R0B A;  1DV9 A;  4KT5 A;  4QYP A;  5D8J A;  2L68 A;  3KFF A;  3P24 A;  3DSZ A;  5EZ2 A;  3VG7 A;  1BLR A;  1MDC A;  1U0X A;  1HMR A;  1KT6 A;  5HCC C;  2MWH A;  4YGH A;  5CYB A;  2JU7 A;  2WSJ A;  4ALB A;  1IKJ A;  2CBR A;  1D2U A;  4OS0 A;  2FLJ A;  2L9C A;  4N7C A;  3FW4 A;  5FEN A;  3P6F A;  2MM3 A;  1IW2 A;  5HZ6 A;  5F6B A;  4MVI A;  1OEJ A;  5DG4 A;  2FRS A;  1EUO A;  4MVE A;  5FQ6 E;  3RKG A;  4M7M A;  3CMP A;  4O3X B;  2YMS A;  3VU1 A;  3TGC A;  1KT7 A;  2OVA A;  4HPB A;  2CBS A;  4ZGF A;  3B2L A;  3C76 X;  2AT0 X;  4QYN A;  1A18 A;  2EU7 X;  3APV A;  3NQK A;  4NP1 A;  2WQ9 A;  5HCD C;  1BSQ A;  2KTS A;  2RD7 C;  3ZQ3 A;  4EQA C;  5IO7 A;  1X71 A;  3BDR A;  3O22 A;  4AZR A;  1SXU A;  1N0S A;  1PM1 X;  4HFO A;  4IMO A;  1O1V A;  4HPC A;  1TOU A;  3SOT A;  1QAB E;  2OVE A;  3PPT A;  1PBO A;  1KQX A;  3GAQ A;  3KFG A;  3C77 X;  3U0D A;  3NQ3 A;  2OVD A;  1KZX A;  1AB0 A;  1NGL A;  4QZT A;  1E5P A;  4Y0S A;  2A3F X;  2XKL A;  4ES7 A;  1EAL A;  2LFO A;  2O62 A;  5L8O A;  3QKG A;  2F73 A;  3OJY C;  3AKM A;  3RZY A;  1AVG I;  2CZT A;  3PH5 A;  1X8N A;  2QO6 A;  3B2I A;  2HZQ A;  4A1Y A;  2CM4 A;  1AQB A;  1E02 A;  1JIW I;  1VYG A;  3FEN A;  3IFB A;  1JJJ A;  4KII A;  3VE2 A;  5FFH A;  5EPQ A;  3TGB A;  1ERB A;  1KT5 A;  1SA8 A;  3BRN A;  4YGG A;  3TF6 A;  3ZUI A;  4CK4 A;  1D3S A;  3P6H A;  4IAX A;  4RUU A;  3DTQ A;  5LJD A;  4ODD A;  1ZNE A;  3AKN A;  1A2D A;  3PH6 A;  4CV7 A;  5HTD A;  3OD9 A;  4U8U M;  1JZU A;  1ZNK A;  1VPR A;  3N91 A;  4IMN A;  2WEX A;  4EFG A;  1ZND A;  1B4M A;  3HWG A;  1IKE A;  2RCQ A;  1I4U A;  3WBG A;  2QOS C;  1LIF A;  2PY1 A;  3FEP A;  2A0A A;  4O49 A;  3VG5 A;  1U17 A;  3STK A;  3PEC A;  1LID A;  3T1D A;  3E3C A;  3NAD A;  1TW4 A;  1YUP A;  4LZV A;  5F58 A;  4XMC A;  2BS6 A;  1X8U A;  1QG5 A;  3EYC A;  2Q39 A;  1HN2 A;  1G74 A;  2ASN X;  2R73 A;  2JU3 A;  3S5V A;  1LPJ A;  3NP1 A;  4N7D A;  4OMW A;  1YP7 A;  2X46 A;  4IB7 A;  5H8T A;  1EXS A;  1OBQ A;  2QMI A;  4NNS A;  2OVS A;  4YFR A;  3FMZ A;  4YMY A;  4LQZ A;  3ZW0 A;  1ZNG A;  3CBS A;  4O4S A;  5D4A A;  4LKT A;  4YCE A;  2R56 A;  1KZW A;  2FTB A;  1QY1 A;  1S44 A;  2NNQ A;  4U9C A;  3SAO A;  4YKM A;  1GT5 A;  3C78 X;  2MJI A;  3FW5 A;  3CWK A;  2BS5 A;  4GH7 A;  4MIS A;  1S7D A;  4BOE A;  1FEL A;  1ADL A;  1KT3 A;  3BU1 A;  4O3Z A;  2OZQ A;  1MX8 A;  4ORX A;  4JGL A;  1PEE A;  5HA0 A;  3NQ9 A;  2X8T A;  1XCA A;  4HPA A;  1LFO A;  4EXZ A;  3NBX X;  1CBR A;  2Z4I A;  2MHD A;  1EW3 A;  3P6E A;  3P6D A;  3F8A A;  5KID A;  3L4R A;  1Y9L A;  1T68 X;  4I95 A;  4ORW A;  2AT3 X;  3NX1 A;  1CBI A;  2W2B A;  1OEE A;  3EBK A;  4I9S A;  5JR8 A;  4U8U O;  1DZJ A;  4U3Q A;  3CQN A;  3HWE A;  1SXW A;  4M6S A;  3P6C A;  4L3R A;  4XMH A;  3ZW2 A;  4FBV A;  1DZK A;  1O1U A;  4GKC A;  3FEK A;  1YWA A;  2W2A A;  4ORS A;  4GNY A;  1BBP A;  1XKI A;  4AYH A;  3O2Y A;  3VG2 A;  3EM0 A;  4KC8 A;  2IFB A;  5LJE A;  2GTL O;  2XST A;  4LZU A;  2NNE A;  5AJC A;  1CBQ A;  5HWZ A;  4YBP A;  3IA8 A;  2OFM X;  3WXQ A;  4GDZ A;  5FAZ A;  5LKF A;  4QNI A;  1ACD A;  2GTF X;  5LKE A;  1OBP A;  1NP1 A;  2AKQ A;  1RLB E;  2K23 A;  1DC9 A;  5K06 A;  4ON1 A;  3UAQ A;  4FBR A;  4AZM A;  4WBK A;  2X8F A;  4NW4 A;  3BLG A;  4I3D A;  4YKO A;  3NPO A;  3FR5 A;  3APU A;  4TNN A;  2A2U A;  3FA7 A;  5H9A A;  5LJB A;  1G7N A;  3KFI A;  4O4X A;  4DQ3 A;  4O4U A;  1LIB A;  1LIE A;  4ID2 A;  5F1E A;  5BVQ A;  4I3B A;  5FQ7 E;  2ALL X;  2FWV A;  3ZWE A;  3APX A;  2G7B A;  1EQD A;  1B0O A;  4FBO A;  5AJB A;  3UEV A;  5C0N A;  4ORR A;  2R74 A;  3FR4 A;  4ZHC A;  1SY1 A;  2BHV A;  2LKK A;  1ZRY A;  3RSW A;  2ACO A;  2CM9 A;  5AQ6 A;  3ZUO A;  3UEW A;  5L8I A;  3EBW A;  4IB6 A;  2LBA A;  2HZR A;  1ICN A;  5FQ8 E;  3FR2 A;  2JW1 A;  1B56 A;  3P02 A;  4NNT A;  1SXX A;  3U03 A;  4ZR2 A;  5IO6 A;  2JMB A;  2W2F A;  3JSQ A;  4GNW A;  4KC7 A;  5AEO A;  2WR6 A;  4QGV A;  1HMT A;  3LV4 A;  2HNX A;  4FGI B;  4YFP A;  3WJG A;  1FEM A;  1MVG A;  4YDB A;  2QO5 A;  4GU8 A;  5HZ8 A;  2HLV A;  2KD2 A;  3VPJ E;  3ZW0 B;  4INN A;  3RWX A;  5KIC A;  1YIV A;  5D48 A;  1IFB A;  4GE1 A;  4NYQ A;  5HAE A;  5LJG A;  1KT4 A;  4A8Z A;  4D6A A;  3ELZ A;  1DFV A;  3PP6 A;  1FTP A;  4NYR A;  2AH7 X;  3STM X;  4EEJ A;  4U8U N;  4AZP A;  2Z4H A;  2ZAG A;  4Y0R A;  4BVM A;  1BSO A;  1VYF A;  3TGA A;  1SMP I;  2K62 A;  4ZFX A;  4IB9 A;  1BEB A;  4HPD A;  5H9N A;  4O9S A;  3ZW1 B;  1G5W A;  3F6Z B;  1S2P A;  5D47 A;  3HK1 A;  3FEL A;  4PJ2 A;  2NND A;  2GTL N;  4QGW A;  3ZZV A;  1TXL A;  1HQP A;  1HBQ A;  3WJE A;  3HTY A;  1LIC A;  1B8E A;  3STN A;  3BSZ E;  1A3Y A;  1E00 A;  2E4J A;  1QY2 A;  5EDC A;  5HZQ A;  4IAW A;  4YDA A;  3B2K A;  4EDE A;  5HBS A;  3MVF A;  4L1N A;  4BQU A;  3FA6 A;  5LJC A;  3VE1 A;  3APW A;  2G79 A;  2LA7 A;  2YG2 A;  3I17 A;  1RBP A;  4GRJ A;  2L5P A;  4ORU A;  4YCH A;  3S26 A;  1SY0 A;  3RBY A;  2KTD A;  3D97 A;  1FEN A;  1HBP A;  2WWP A;  2HMB A;  2ANS A;  1GT3 A;  2Q4N A;  3GE2 A;  2GJ5 A;  3UEX A;  3V8U A;  2RA6 A;  3WJB A;  4AZO A;  5HTE A;  1ICM A;  1DZM A;  4ZCB A;  1ZNH A;  2RCT A;  4O4O A;  3D95 A;  4K19 A;  2Q2M A;  2Q9S A;  2AT6 X;  4I6S A;  1OPA A;  1GT4 A;  1L6M A;  5BVT A;  4NLI A;  1I05 A;  4TKB A;  3KFH A;  4AZQ A;  3WJD A;  5F6Z A;  5BYP A;  1EI5 A;  5B27 A;  4QZU A;  4RUN A;  1JYJ A;  2RN4 A;  3NR3 A;  4YH0 A;  3G7X A;  4ZH9 A;  3CBC A;  1DF3 A;  1HMS A;  2P8G A;  1A57 A;  2X8S A;  1JBH A;  3VG3 A;  4ZHD A;  3ELX A;  1YP6 A;  3HOL A;  1FE3 A;  4OS3 A;  4Y0P A;  3EMM A;  1Y9T A;  3PED A;  4A60 A;  2AT5 X;  4D6B A;  1QFT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...