3BUEA

Crystal structure of the c-terminal domain hexamer of argr from mycobacterium tuberculosis
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
78
structure length
78
Chain Sequence
GTDRMARLLGELLVSTDDSGNLAVLRTPPGAAHYLASAIDRAALPQVVGTIAGDDTILVVAREPTTGAQLAGMFENLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Arginine repressor ArgR
publication title Structure of the C-terminal domain of the arginine repressor protein from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein
total genus 22
structure length 78
sequence length 78
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3bueA00
1WIHA 3QX3A 4J3NA 4G0WA 1EK8A 4G0UA 3ERED 3V4GA 3NUHA 4KDDA 1IS1A 1B4BA 1WQFA 1F9NA 4DDQA 5CJ9A 3L4KA 2P5MA 4KB2A 1XXCA 1XXAA 4KC6A 3FOFA 1DD5A 1BJTA 2Y3PA 3BUEA 3LAPA 3OPFA 2KWAA 2XCOA 5JVOA 1XXBA 1ZVUA 3LPXA 1WQHA 4KB4A 2PHCB 3OREA 3VA7A 3OEPA 3FHZA 1AB4A 4G0VA 2XCQA 1EH1A 1WQGA 2ZFZA 4KAWX 2XCRB 4FM9A 3L4JA 2RGRA 1ISEA 1GE9A 3MMLB 3CAGA 1B4AA 4GFQA 3FOEA 3LAJA 1BGWA
chains in the Genus database with same CATH superfamily
3HOZK 1O29A 2GSUA 1J98A 3GSIA 4DDQA 3GTOC 4A3LC 3HOVK 1VJEA 2NVYK 5IYCC 3H0GA 2KWAA 3GTJC 1XXBA 4KARA 1I6VA 3HOXK 3H3VL 4BY7C 1IE0A 2R93A 2Y0SD 1KQ4A 3OREA 3GTGA 5IORA 4A3CC 1Y1WC 3RZDK 4BBSC 1TWAC 3GTKC 5HL8A 3GEIA 2E2IC 2NVXA 1V5VA 3QX3A 1R9TA 1O27A 3ERED 5M3MK 4XLNA 1XPPA 2YU9K 3GTPA 2E2HK 2JA6C 1DCPA 1INNA 3CQZK 1TWGA 4GTBA 4A3EC 3GTLA 1O28A 2WAQD 3SZZA 1IBAA 1YNNA 2VUMC 2E2JK 4OIPA 3I4MK 3TTGA 3S1MK 4QIWL 1I6HK 3G4CA 3K7AC 1I3QA 2JA5A 1J6XA 2NVQC 3PO2K 4MQ9A 3HOUC 3NUHA 2WB1L 4P5BA 5EGEA 4KMDA 3S14C 3GTMA 4WJ4A 5M3FK 1USMA 2RH6A 5CHPA 3S17K 1EI6A 5EGHA 3S1RK 3VA7A 2GSNA 3GEHA 4C3JC 1F7UA 5TJ3A 2PMZL 3FOEA 2NVYA 4BBRC 4XCHA 3S16C 1K83C 2A6HA 4OINA 3G4AA 4GTDA 1ZXOA 1O24A 1XXCA 4A3FC 2XCOA 4YFXA 1PJ6A 1DCHA 4LJZA 4BY1K 3AH5A 4QJVB 2O5JA 3GIRA 3A8JA 1I50K 4C2MC 4MEYA 2ZFZA 2R7ZC 4P5AA 3S2HC 3L4JA 2YU9A 4QIWD 3A8KA 4A3LK 4KATA 2E2HA 1EK8A 3JSTA 3CQZA 5IYCK 3GTJK 5CJ9A 1WSRA 1TWFC 4BXXC 1DD5A 1BJTA 3LAPA 4WJ3M 1XZPA 1Y1VC 4C3HC 1VRQC 4Y7NC 1Y1WK 3N0BA 1X31C 2R92A 4BBSK 3GTKK 2JA7K 2E2IK 5IP7C 1EFWA 1SFOK 3M3YC 3H0GC 4KN7A 2ZUEA 1WOPA 2R93C 1IW7A 4A3KK 2V6SA 1C0AA 1XZQA 3S15K 1IL2A 4GZYA 2PPBA 2O5IA 2JA6K 1WQFA 4NOIA 3L4KA 2V6TA 2P5MA 2A68A 5C44C 4A3EK 2Y3PA 2PA8L 3OPFA 5FLMC 3HKZD 1BS2A 2VUMK 1R9TC 4A3GC 3T01A 4G0VA 5IYBK 3GTPC 2B63K 4FM9A 1WCMC 1YX2A 3MMLB 4A3IC 2NVQK 1B4AA 1IQ0A 4YFNA 4LK0A 3S2DC 4LQYA 2CFAA 4G0UA 4AYBL 1F9NA 4A3MK 4KB2A 5TMCA 1TWCA 1I50A 3RZOC 3S1QC 5IP9K 2PHCB 4C3JK 4GTLA 4KM8A 2NVTK 2XCQA 3S16K 3GTMC 3TFIA 1K83K 2GSOA 1YNJA 5IYDC 1VLOA 1WIHA 1PJ7A 1TWHC 4KM9A 1L0WA 1WORA 3AQPA 4A3FK 1Y1WA 1O2BA 1USOA 4C3IC 3GTKA 5C4JC 2JA7A 1ZBSA 4MEXA 2E2IA 4P9SA 3HOVC 2NVYC 3FKIK 1SFOA 1WOOA 3SZYA 4C2MK 2R7ZK 4KMAA 3OEPA 3FHZA 3H3VD 3WODA 4Y52C 1JVIA 3T00A 4OIOA 2JA6A 5E68A 1ISEA 1SMYA 3LAJA 3N0CA 3I4NC 1HI9A 4BXXK 4C3HK 1Y1VK 2D6FC 4Y7NK 1O2AA 4LOWA 3FOFA 1EQRA 3M4OC 2B63A 1ZVUA 2E2HC 2GAGC 1VGXA 4G7ZA 2BE5A 1O2FB 4A3JK 2R93K 1EH1A 4GTFA 4KAWX 4A93C 4PABA 4PAAA 5M5WK 2R92C 1DCOA 3GTQC 4FZBA 5C3EC 3GTOK 4KMUA 5C44K 1VH2A 3EQLA 5FLMK 3PO2C 3AD7C 1JOEA 4BY7K 2FQTA 4XLPA 2Y0SL 4A3GK 2WB1D 4A3CK 1TWAK 3S17C 1WCMK 1JQWA 1J6VA 3S2DK 4GTAA 1YCLA 3AD8C 3GTGC 2PMZD 3FKIA 4A3BC 3S1QK 2R7ZA 3S1NC 4BLAA 2NVXC 2WAQL 5JVOA 2CW0A 3TFJA 4LR2A 1WQHA 2JH3A 1AB4A 4BY1C 5IYDK 3K7AK 4M1XA 1TWHK 1TWCC 1I50C 1Y1VA 4A3DC 1ZQ1C 4ILDA 3DXJA 3HOUK 4C3IK 1G51A 1TWGC 4BLBA 5C4JK 3Q3QA 4G0WA 3GTLC 4X6AC 1J6WA 3HOWC 3S14K 3S0XA 4G7OA 4GTCA 1RU0A 2P8TA 2GAHC 1I3QC 5C4XC 4Y52K 2JA5C 3PO3C 1XZPB 3GDZA 3HOYC 2JA7C 3GTOA 1WQGA 4XSXA 4BBRK 3GEEA 3I4NK 1UV7A 2JA8C 4BKWA 4GFQA 3GTJA 1SFOC 1BGWA 2W7VA 4A3KC 3M4OK 3S15C 3HOZC 1XZQB 3ADAC 1TWAA 1WCMA 1F7VA 3BP8C 5IOSA 4QJVA 4YG2A 3LPXA 2EBBA 2PA8D 4JK1A 3HOXC 2V6UA 3S2HK 4A93K 4GTEA 2R92K 4LLGA 5JFEA 1GE9A 1O26A 3GTQK 5C3EK 5IYBC 3RZDC 3CAGA 2B63C 5D4DA 3BP3A 3HXAA 4KMHA 3V4GA 4KDDA 1TWFK 1ZYRA 2VUMA 4G7HA 1O25A 2CFAB 1XXAA 4RMFA 3BUEA 4AYBD 4A3MC 3AD9C 2YU9C 1F93A 1TWHA 1HQMA 2A69A 5IP7K 5FJ8K 3CQZC 3M3YK 3H0GK 5IP9C 4Q5SA 2RGRA 2NVTC 3A8IA 2E2JC 3GTGK 3I4MC 4C45A 4OIRA 4A3BK 3S1MC 1I6HC 3AQOA 3S1NK 2NVXK 1IS1A 4WILA 3HKZL 3IPJA 5M5XK 1R9TK 4KN4A 2A6EA 4LK1A 4AH6A 3TFHA 4YFKA 1K83A 4KB4A 3FKIC 3GTPK 1TWCK 4A3DK 4OIQA 3T02A 4A3IK 5TMFA 3S1RC 4XSZA 5IOTA 2XCRB 1TWGK 4X6AK 3GTLK 5M5YK 5L46A 3HOWK 1BDFA 4GT9A 4J3NA 4Q4ZA 1WOSA 1B4BA 2FQOA 5IOQA 1I3QK 5C4XK 4KC6A 3RZOK 2JA5K 3PO3K 3HOYK 3GTQA 1PJ5A 3GTMK 2JA8K 1WSVA 3N3YA 4KASA 4O2DA 2ZUFA 1TWFA 4A3JC 4ZH4A
chains in the Genus database with same CATH topology
3N0CA 2E2HA 1O29A 4KATA 1EK8A 2GSUA 3CQZA 4DDQA 5CJ9A 1O2AA 1TWAA 1WCMA 3FOFA 1DD5A 1BJTA 3H0GA 3LAPA 4C3HC 2KWAA 5IOSA 1XXBA 4KARA 2B63A 1ZVUA 3N0BA 2R93A 2R92A 3LPXA 3GTGA 1KQ4A 3OREA 5IORA 4GTEA 1EH1A 4GTFA 1O26A 4KAWX 5JFEA 1GE9A 2NVXA 3CAGA 3QX3A 1R9TA 4FZBA 1O27A 4KMHA 3ERED 3V4GA 4KDDA 1WQFA 2VUMA 3L4KA 1O25A 2CFAB 2P5MA 1XXAA 3GTPA 2Y3PA 3BUEA 3OPFA 1TWHA 1TWGA 4GTBA 3GTLA 1O28A 4G0VA 4FM9A 2RGRA 3MMLB 4GTAA 1B4AA 3G4CA 1I3QA 2JA5A 4LQYA 2CFAA 3AQOA 4G0UA 3FKIA 3NUHA 1IS1A 1F9NA 4P5BA 5EGEA 4KMDA 2R7ZA 4KB2A 4BLAA 3GTMA 1TWCA 1I50A 5JVOA 2RH6A 5CHPA 4LR2A 5EGHA 1K83A 1WQHA 4KB4A 2PHCB 3VA7A 2GSNA 4GTLA 2JH3A 4KM8A 1AB4A 2XCQA 4C3JC 5IOTA 4M1XA 2XCRB 2GSOA 5TJ3A 2YU9A 1Y1VA 4ILDA 3FOEA 2NVYA 1WIHA 4GT9A 4BLBA 3Q3QA 4J3NA 4G0WA 4KM9A 3AQPA 1Y1WA 3G4AA 1O2BA 1B4BA 4GTDA 4C3IC 1ZXOA 3GTKA 5IOQA 3S0XA 2JA7A 1O24A 1XXCA 1ZBSA 4KC6A 2E2IA 4GTCA 2XCOA 1SFOA 3GTQA 3AH5A 4KMAA 3OEPA 3FHZA 3GTOA 4C2MC 1WQGA 2ZFZA 3N3YA 4KASA 4P5AA 1TWFA 3L4JA 1ISEA 2JA6A 4BKWA 4GFQA 3GTJA 3LAJA 1BGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WIH A;  3QX3 A;  4J3N A;  4G0W A;  1EK8 A;  4G0U A;  3ERE D;  3V4G A;  3NUH A;  4KDD A;  1IS1 A;  1B4B A;  1WQF A;  1F9N A;  4DDQ A;  5CJ9 A;  3L4K A;  2P5M A;  4KB2 A;  1XXC A;  1XXA A;  4KC6 A;  3FOF A;  1DD5 A;  1BJT A;  2Y3P A;  3BUE A;  3LAP A;  3OPF A;  2KWA A;  2XCO A;  5JVO A;  1XXB A;  1ZVU A;  3LPX A;  1WQH A;  4KB4 A;  2PHC B;  3ORE A;  3VA7 A;  3OEP A;  3FHZ A;  1AB4 A;  4G0V A;  2XCQ A;  1EH1 A;  1WQG A;  2ZFZ A;  4KAW X;  2XCR B;  4FM9 A;  3L4J A;  2RGR A;  1ISE A;  1GE9 A;  3MML B;  3CAG A;  1B4A A;  4GFQ A;  3FOE A;  3LAJ A;  1BGW A; 
#chains in the Genus database with same CATH topology
 3HOZ K;  1O29 A;  2GSU A;  1J98 A;  3GSI A;  4DDQ A;  3GTO C;  4A3L C;  3HOV K;  1VJE A;  2NVY K;  5IYC C;  3H0G A;  2KWA A;  3GTJ C;  1XXB A;  4KAR A;  1I6V A;  3HOX K;  3H3V L;  4BY7 C;  1IE0 A;  2R93 A;  2Y0S D;  1KQ4 A;  3ORE A;  3GTG A;  5IOR A;  4A3C C;  1Y1W C;  3RZD K;  4BBS C;  1TWA C;  3GTK C;  5HL8 A;  3GEI A;  2E2I C;  2NVX A;  1V5V A;  3QX3 A;  1R9T A;  1O27 A;  3ERE D;  5M3M K;  4XLN A;  1XPP A;  2YU9 K;  3GTP A;  2E2H K;  2JA6 C;  1DCP A;  1INN A;  3CQZ K;  1TWG A;  4GTB A;  4A3E C;  3GTL A;  1O28 A;  2WAQ D;  3SZZ A;  1IBA A;  1YNN A;  2VUM C;  2E2J K;  4OIP A;  3I4M K;  3TTG A;  3S1M K;  4QIW L;  1I6H K;  3G4C A;  3K7A C;  1I3Q A;  2JA5 A;  1J6X A;  2NVQ C;  3PO2 K;  4MQ9 A;  3HOU C;  3NUH A;  2WB1 L;  4P5B A;  5EGE A;  4KMD A;  3S14 C;  3GTM A;  4WJ4 A;  5M3F K;  1USM A;  2RH6 A;  5CHP A;  3S17 K;  1EI6 A;  5EGH A;  3S1R K;  3VA7 A;  2GSN A;  3GEH A;  4C3J C;  1F7U A;  5TJ3 A;  2PMZ L;  3FOE A;  2NVY A;  4BBR C;  4XCH A;  3S16 C;  1K83 C;  2A6H A;  4OIN A;  3G4A A;  4GTD A;  1ZXO A;  1O24 A;  1XXC A;  4A3F C;  2XCO A;  4YFX A;  1PJ6 A;  1DCH A;  4LJZ A;  4BY1 K;  3AH5 A;  4QJV B;  2O5J A;  3GIR A;  3A8J A;  1I50 K;  4C2M C;  4MEY A;  2ZFZ A;  2R7Z C;  4P5A A;  3S2H C;  3L4J A;  2YU9 A;  4QIW D;  3A8K A;  4A3L K;  4KAT A;  2E2H A;  1EK8 A;  3JST A;  3CQZ A;  5IYC K;  3GTJ K;  5CJ9 A;  1WSR A;  1TWF C;  4BXX C;  1DD5 A;  1BJT A;  3LAP A;  4WJ3 M;  1XZP A;  1Y1V C;  4C3H C;  1VRQ C;  4Y7N C;  1Y1W K;  3N0B A;  1X31 C;  2R92 A;  4BBS K;  3GTK K;  2JA7 K;  2E2I K;  5IP7 C;  1EFW A;  1SFO K;  3M3Y C;  3H0G C;  4KN7 A;  2ZUE A;  1WOP A;  2R93 C;  1IW7 A;  4A3K K;  2V6S A;  1C0A A;  1XZQ A;  3S15 K;  1IL2 A;  4GZY A;  2PPB A;  2O5I A;  2JA6 K;  1WQF A;  4NOI A;  3L4K A;  2V6T A;  2P5M A;  2A68 A;  5C44 C;  4A3E K;  2Y3P A;  2PA8 L;  3OPF A;  5FLM C;  3HKZ D;  1BS2 A;  2VUM K;  1R9T C;  4A3G C;  3T01 A;  4G0V A;  5IYB K;  3GTP C;  2B63 K;  4FM9 A;  1WCM C;  1YX2 A;  3MML B;  4A3I C;  2NVQ K;  1B4A A;  1IQ0 A;  4YFN A;  4LK0 A;  3S2D C;  4LQY A;  2CFA A;  4G0U A;  4AYB L;  1F9N A;  4A3M K;  4KB2 A;  5TMC A;  1TWC A;  1I50 A;  3RZO C;  3S1Q C;  5IP9 K;  2PHC B;  4C3J K;  4GTL A;  4KM8 A;  2NVT K;  2XCQ A;  3S16 K;  3GTM C;  3TFI A;  1K83 K;  2GSO A;  1YNJ A;  5IYD C;  1VLO A;  1WIH A;  1PJ7 A;  1TWH C;  4KM9 A;  1L0W A;  1WOR A;  3AQP A;  4A3F K;  1Y1W A;  1O2B A;  1USO A;  4C3I C;  3GTK A;  5C4J C;  2JA7 A;  1ZBS A;  4MEX A;  2E2I A;  4P9S A;  3HOV C;  2NVY C;  3FKI K;  1SFO A;  1WOO A;  3SZY A;  4C2M K;  2R7Z K;  4KMA A;  3OEP A;  3FHZ A;  3H3V D;  3WOD A;  4Y52 C;  1JVI A;  3T00 A;  4OIO A;  2JA6 A;  5E68 A;  1ISE A;  1SMY A;  3LAJ A;  3N0C A;  3I4N C;  1HI9 A;  4BXX K;  4C3H K;  1Y1V K;  2D6F C;  4Y7N K;  1O2A A;  4LOW A;  3FOF A;  1EQR A;  3M4O C;  2B63 A;  1ZVU A;  2E2H C;  2GAG C;  1VGX A;  4G7Z A;  2BE5 A;  1O2F B;  4A3J K;  2R93 K;  1EH1 A;  4GTF A;  4KAW X;  4A93 C;  4PAB A;  4PAA A;  5M5W K;  2R92 C;  1DCO A;  3GTQ C;  4FZB A;  5C3E C;  3GTO K;  4KMU A;  5C44 K;  1VH2 A;  3EQL A;  5FLM K;  3PO2 C;  3AD7 C;  1JOE A;  4BY7 K;  2FQT A;  4XLP A;  2Y0S L;  4A3G K;  2WB1 D;  4A3C K;  1TWA K;  3S17 C;  1WCM K;  1JQW A;  1J6V A;  3S2D K;  4GTA A;  1YCL A;  3AD8 C;  3GTG C;  2PMZ D;  3FKI A;  4A3B C;  3S1Q K;  2R7Z A;  3S1N C;  4BLA A;  2NVX C;  2WAQ L;  5JVO A;  2CW0 A;  3TFJ A;  4LR2 A;  1WQH A;  2JH3 A;  1AB4 A;  4BY1 C;  5IYD K;  3K7A K;  4M1X A;  1TWH K;  1TWC C;  1I50 C;  1Y1V A;  4A3D C;  1ZQ1 C;  4ILD A;  3DXJ A;  3HOU K;  4C3I K;  1G51 A;  1TWG C;  4BLB A;  5C4J K;  3Q3Q A;  4G0W A;  3GTL C;  4X6A C;  1J6W A;  3HOW C;  3S14 K;  3S0X A;  4G7O A;  4GTC A;  1RU0 A;  2P8T A;  2GAH C;  1I3Q C;  5C4X C;  4Y52 K;  2JA5 C;  3PO3 C;  1XZP B;  3GDZ A;  3HOY C;  2JA7 C;  3GTO A;  1WQG A;  4XSX A;  4BBR K;  3GEE A;  3I4N K;  1UV7 A;  2JA8 C;  4BKW A;  4GFQ A;  3GTJ A;  1SFO C;  1BGW A;  2W7V A;  4A3K C;  3M4O K;  3S15 C;  3HOZ C;  1XZQ B;  3ADA C;  1TWA A;  1WCM A;  1F7V A;  3BP8 C;  5IOS A;  4QJV A;  4YG2 A;  3LPX A;  2EBB A;  2PA8 D;  4JK1 A;  3HOX C;  2V6U A;  3S2H K;  4A93 K;  4GTE A;  2R92 K;  4LLG A;  5JFE A;  1GE9 A;  1O26 A;  3GTQ K;  5C3E K;  5IYB C;  3RZD C;  3CAG A;  2B63 C;  5D4D A;  3BP3 A;  3HXA A;  4KMH A;  3V4G A;  4KDD A;  1TWF K;  1ZYR A;  2VUM A;  4G7H A;  1O25 A;  2CFA B;  1XXA A;  4RMF A;  3BUE A;  4AYB D;  4A3M C;  3AD9 C;  2YU9 C;  1F93 A;  1TWH A;  1HQM A;  2A69 A;  5IP7 K;  5FJ8 K;  3CQZ C;  3M3Y K;  3H0G K;  5IP9 C;  4Q5S A;  2RGR A;  2NVT C;  3A8I A;  2E2J C;  3GTG K;  3I4M C;  4C45 A;  4OIR A;  4A3B K;  3S1M C;  1I6H C;  3AQO A;  3S1N K;  2NVX K;  1IS1 A;  4WIL A;  3HKZ L;  3IPJ A;  5M5X K;  1R9T K;  4KN4 A;  2A6E A;  4LK1 A;  4AH6 A;  3TFH A;  4YFK A;  1K83 A;  4KB4 A;  3FKI C;  3GTP K;  1TWC K;  4A3D K;  4OIQ A;  3T02 A;  4A3I K;  5TMF A;  3S1R C;  4XSZ A;  5IOT A;  2XCR B;  1TWG K;  4X6A K;  3GTL K;  5M5Y K;  5L46 A;  3HOW K;  1BDF A;  4GT9 A;  4J3N A;  4Q4Z A;  1WOS A;  1B4B A;  2FQO A;  5IOQ A;  1I3Q K;  5C4X K;  4KC6 A;  3RZO K;  2JA5 K;  3PO3 K;  3HOY K;  3GTQ A;  1PJ5 A;  3GTM K;  2JA8 K;  1WSV A;  3N3Y A;  4KAS A;  4O2D A;  2ZUF A;  1TWF A;  4A3J C;  4ZH4 A; 
#chains in the Genus database with same CATH homology
 3N0C A;  2E2H A;  1O29 A;  4KAT A;  1EK8 A;  2GSU A;  3CQZ A;  4DDQ A;  5CJ9 A;  1O2A A;  1TWA A;  1WCM A;  3FOF A;  1DD5 A;  1BJT A;  3H0G A;  3LAP A;  4C3H C;  2KWA A;  5IOS A;  1XXB A;  4KAR A;  2B63 A;  1ZVU A;  3N0B A;  2R93 A;  2R92 A;  3LPX A;  3GTG A;  1KQ4 A;  3ORE A;  5IOR A;  4GTE A;  1EH1 A;  4GTF A;  1O26 A;  4KAW X;  5JFE A;  1GE9 A;  2NVX A;  3CAG A;  3QX3 A;  1R9T A;  4FZB A;  1O27 A;  4KMH A;  3ERE D;  3V4G A;  4KDD A;  1WQF A;  2VUM A;  3L4K A;  1O25 A;  2CFA B;  2P5M A;  1XXA A;  3GTP A;  2Y3P A;  3BUE A;  3OPF A;  1TWH A;  1TWG A;  4GTB A;  3GTL A;  1O28 A;  4G0V A;  4FM9 A;  2RGR A;  3MML B;  4GTA A;  1B4A A;  3G4C A;  1I3Q A;  2JA5 A;  4LQY A;  2CFA A;  3AQO A;  4G0U A;  3FKI A;  3NUH A;  1IS1 A;  1F9N A;  4P5B A;  5EGE A;  4KMD A;  2R7Z A;  4KB2 A;  4BLA A;  3GTM A;  1TWC A;  1I50 A;  5JVO A;  2RH6 A;  5CHP A;  4LR2 A;  5EGH A;  1K83 A;  1WQH A;  4KB4 A;  2PHC B;  3VA7 A;  2GSN A;  4GTL A;  2JH3 A;  4KM8 A;  1AB4 A;  2XCQ A;  4C3J C;  5IOT A;  4M1X A;  2XCR B;  2GSO A;  5TJ3 A;  2YU9 A;  1Y1V A;  4ILD A;  3FOE A;  2NVY A;  1WIH A;  4GT9 A;  4BLB A;  3Q3Q A;  4J3N A;  4G0W A;  4KM9 A;  3AQP A;  1Y1W A;  3G4A A;  1O2B A;  1B4B A;  4GTD A;  4C3I C;  1ZXO A;  3GTK A;  5IOQ A;  3S0X A;  2JA7 A;  1O24 A;  1XXC A;  1ZBS A;  4KC6 A;  2E2I A;  4GTC A;  2XCO A;  1SFO A;  3GTQ A;  3AH5 A;  4KMA A;  3OEP A;  3FHZ A;  3GTO A;  4C2M C;  1WQG A;  2ZFZ A;  3N3Y A;  4KAS A;  4P5A A;  1TWF A;  3L4J A;  1ISE A;  2JA6 A;  4BKW A;  4GFQ A;  3GTJ A;  3LAJ A;  1BGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...