3BV8A

Crystal structure of the n-terminal domain of tetrahydrodipicolinate acetyltransferase from staphylococcus aureus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
85
structure length
85
Chain Sequence
b'ALTAEEIIQYISDAKKFTPIKVYLNGNFEGITYPESFKVFGSEQSKVIFCEADDWKPFYEAYGSQFEDIEIEMDRRNSAIPLKDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tetrahydrodipicolinate acetyltransferase
molecule tags Transferase
source organism Staphylococcus aureus subsp. aureus
publication title Structure of the N-terminal domain of tetrahydrodipicolinate acetyltransferase from Staphylococcus aureus.
rcsb
total genus 20
structure length 85
sequence length 85
ec nomenclature ec 2.3.1.89: Tetrahydrodipicolinate N-acetyltransferase.
pdb deposition date 2008-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08503 DapH_N Tetrahydrodipicolinate succinyltransferase N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Malonyl-CoA ACP transacylase, ACP-binding 3bv8A00
2QC3A 3R8YA 3CJ8A 4QBUA 5DZ6A 1NM2A 2G2OA 1MLAA 2JFDA 3IM8A 3EZOA 3H0PA 3PTWA 4RL1A 3HHDA 2JFKA 3R97A 3SBMA 3RGIA 2H1YA 3G87A 2CUYA 3TZZA 2G2ZA 3HJVA 3BV8A 3TZXA 3QATA 3K89A 2C2NA 3TZWA 2G1HA 4RR5A 3TZYA 2QJ3A 2G2YA 3TQEA 5DZ7A 3IM9A
chains in the Genus database with same CATH superfamily
2XZTB 5HVFA 3IXQA 3SXLA 2E9TA 4IQXA 3M9MB 5HMXA 1CJKA 2QZ8A 3N5BA 2FHMA 4FNHA 4F4YA 4BC7A 2HVIA 1SXLA 1LK5A 4ZPVR 2HHVA 3BR8A 4OHVA 3ILJA 4ALZA 1FFWB 2GMHA 3H8YA 2XO6A 3I32A 4DL0C 3CC2S 2NXCA 3DOMB 4F0HA 4IG0A 3FSXA 3AOAA 3HHLA 4G1QA 4AUKA 1RCXB 3BS9A 3TQ1A 3C16B 3UD5A 4DWIA 2IM1A 3MMBB 5EWFA 1WOSA 2UP1A 1N33J 4WF9Q 4NYZA 4F4XA 5BR8J 1ZTTA 2ZM6J 5CA5A 4JI7F 2EI5A 1S1TA 5LJ5Y 3K5OA 4PWUA 1F9HA 3OSPA 1U1RA 2OSRA 1N5YA 1EAYC 2VV5A 3DI6A 3R1LA 1QAIA 2VG7B 4FNIA 2C2DA 2MQLA 1VBKA 2XYGB 4ZLLA 1QM9A 4WJBA 1MN7A 1MMDA 3PACA 2G13A 1VS3A 3MM8B 1RI7A 3QWUA 3W66A 5DG9A 2HK3A 2XYPB 4J9VA 2UU9J 4WZQA 3KLFA 3V4IB 1UZDA 3BR9A 4NLDA 4CLPA 3D9BA 1XQIA 4OHWA 3M1VA 2RKIA 1AYEA 2KI2A 2MKJA 2OGUA 4W98A 2ACMA 2JFKA 5KFBA 4KKOB 1NKEA 3MDFA 4DDFA 2IVMA 2NXUA 1GMVA 1RAAB 4OYMA 3A8IA 2ASJA 3C2PA 4Q0BA 3M2UA 2ZM6F 1H2TZ 4JI7J 2VQEF 3CJKB 1BY9A 1E6VA 1RT7A 4PG7A 3PW5A 4A8XA 3MCOA 2RD5C 3OTCA 4ZP9A 2ADCA 2KM8B 3A12A 3MPUB 1RDRA 1SUQA 4KV8A 1REVA 3AJ2A 2R7TA 1BQMA 1L3TA 1TQLA 1RAIB 3HFZB 1HNIB 3J81Y 3BSOA 1RXOB 3HHEA 1PC4A 2OMLA 3PYGA 1QD1A 4LFCJ 3E51A 2KN4A 2DGOA 1UJ4A 2KT3A 2RQ4A 3DM2B 1A7GE 2HNDB 2B3TB 1B4SA 2A2DA 3IRXA 3QNWB 3KK3B 2ZOFA 4OI1A 3Q22A 1J5OA 1R6VA 1XJWB 4JI4J 4FF4A 1G1XA 2IDEA 4LR9A 5DGBA 4ELTA 5BXIA 2CQIA 4JI6J 3OFFA 5CH7B 4LF5F 2FJDB 4YFUA 1REVB 3KNGA 4OX6A 3OQ2A 5AE2A 4TY8B 2XCAA 2BOPA 4J90A 2DHSA 2B8QA 2CQDA 2IC3B 4F67A 1FRMA 2KKHA 2J6SA 2QGFB 2A6MA 1NB2A 2Y3YA 3B6BA 3LP0A 1RAOA 4ANDA 1UEUA 3F56A 2A6OA 4Z37A 5D8HB 4XTTA 4XPEA 2E5IA 2B6AB 2PT0A 3AQOA 3PCOB 3ULHA 3J7A1 5J2NB 1F6TA 1IXKA 3MM9B 4OIXA 4DQRA 2X1GA 4LFAJ 2RH3A 1AW0A 3WIUA 4DUTA 2IRUA 1RAEB 4J9OA 4P2XA 3NMRA 3HVAA 2PMHA 1S79A 1N8RT 2WHOA 2YKNB 3EVWA 1CBKA 1TFYA 4DCJB 2XMWA 2BQ3A 3GMGA 2MLXA 4X64F 4KYZA 2BE2A 5E5NA 4CLTA 1P8GA 3AAWB 4EBDA 4OZJA 3DNCA 4DXLA 1T9TA 2R7OA 1ZM9A 4NEYA 2VFUA 1WF2A 2CIMA 2W1BA 3NGRA 1KOOA 2R8HA 3PEHA 2KT5A 1EQ0A 2ZUGA 4H54A 3CDEA 2C2KB 5KFIA 4YHHJ 2NSCA 4CH1A 3TWZA 9ATCB 2MGZA 1KD1T 2VBWA 1L5UA 2YKNA 4RWXA 3ZTQA 3CPWR 2LQBA 3M8YA 2ROEA 3KUGA 4WIQA 2MZTA 3GIMA 2MZRA 3G82B 3T1HF 5AT1B 1RTJA 4UOFA 4X4PA 2QL7B 2FDNA 1TAUA 5FIIA 2KO1A 3W8GA 3EZOA 4LRDA 2YBVA 3BQ1A 4F4ZA 4J91A 4FDFA 4NLXA 3DYAA 3GSIA 5U47A 5BYSA 1Z4UA 1UZHA 4B9SA 5KFNA 4X4TA 2QA4G 2DRBA 2HMIA 3GWCA 2CFXA 4PRFA 1SIZA 3DOKB 1CJTA 3VAHA 2C3MA 1BQNB 2DR6A 4LQ9A 4RJVA 5THWA 4CP5A 2HFSA 1SV5B 5K8PA 1SL1A 2QG9B 4NOHA 3G82A 3KLGB 1QVGR 4MIBA 2HHHF 4WU3A 4LF7J 5T41A 4IYQA 3KG1A 1LXJA 5G0RA 1U8WA 1VHIA 2Q3PA 4ES1A 1NZAA 2XWYA 2HHTA 3RU0A 4RNMA 3RBZA 2E44A 1NH8A 4CLYA 5LSRA 2B8PA 1OY9A 3M8PA 4NZ7A 3QRPA 4DZ6A 2EBGA 4CO0A 1S9EA 1CJTB 2HBYB 3CJ3A 3MCMA 4PXCA 4ZIWA 5LSLA 1FFGB 1C1BB 2EXUA 3PTWA 4O3NA 3UR3C 3ETMA 4UOGA 3B82A 3MEDA 4MJKA 3DLLQ 2HAFA 2D1CA 3POTA 2DNMA 1RZMA 2ZH6A 2A0FB 2FTRA 3EGZA 2RF2B 3T1HJ 4J9MA 3R6LB 2DO4A 3UNYA 2QMUB 3VGSA 4JI5F 3HVWA 1WOOA 2OPSA 4RW9A 1G2EA 1NLKL 2QMWA 2NR0A 2RDIA 4F4WA 2W01A 1S6UA 3BGLA 2L9DA 3QLHA 1S9EB 2OUGA 2DNYA 1JLAB 2Z0GA 3C66A 4MIAA 2P6TA 4WFXA 1XK8A 2IIHA 5IM0B 4HYKA 2UXCJ 1TL5A 2D69A 1TL7B 4K5SA 2FJWA 3ZTOA 3I0RA 1KP6A 2QA1A 3JSMB 2ZWOA 2YNGB 4BWMA 2D3O1 2AHOB 2WBMA 2C22A 3OTDA 3JB9k 2GQCA 3WHIA 1FRJA 1FEEA 2PSZA 3FFIB 4W4MA 5A8RA 5C25B 2FVSA 2Y8WA 3NCPA 1S59A 4M5NA 4RW8A 4RNFA 2UV8G 2VF3A 2YY3A 2E29A 3UN5A 3CCWA 2P5VA 2QA4S 4GC6A 5L9XA 4J9NA 3CUNA 1V9OA 6FD1A 3MF5A 4OYOA 3BYRA 4AQYF 3QRRA 2OKQA 3FCHA 1S6PB 4Y2AA 4EUVA 3G96A 1RT6B 4DL3A 1LWEA 3DLEA 3N79A 2XMUA 4L75A 1RISA 2CQ2A 2ZOMA 3OBIA 1ZAXA 4NA3A 1VQ7S 2RQCA 2GHPA 2OFHX 1N54B 3KJNB 1BQXA 1NDCA 1SKRA 2CQ0A 4F3OA 4PZVA 1D09B 1GX5A 3D0IE 4NL5A 4J9QA 4ZS6A 1RWMB 4Q44A 3NAHA 1TK5A 1PGZA 4JI1J 4DR3J 5DGAA 4DQPA 4PQUB 2JX2A 1RWVB 2F1FA 2WCXA 1TUGB 2RRNA 1K1QA 2JRSA 1YWXA 2CNNB 4OZ2A 3DRSB 2DO0A 5LSOA 1NU4A 2J0XA 1GAOA 1RT6A 4KR0B 4LREA 3P6YC 3IWNC 4ZJLA 3JYTA 1T0TV 3ADAC 4JUZA 4H4KC 4CYUA 4X4QA 3VAJA 5LM7E 4IFYB 1RT5B 4N47A 4LJMA 2HEKA 2DR5A 2MYFA 1S49A 4QIGA 2QEXS 2H48B 3MD3A 2BJ7A 4Q2LA 5DS7A 4IUFA 3B78A 2FJEB 2GZOA 2KVIA 2W4CA 2NS1B 2I1RA 1VGYA 4YP3A 4M5GA 1U26A 1YDLA 1NNDA 5G4DA 1Q5VA 2UUAF 2M70A 1M5OC 5ETKA 2IA6A 3Q2TC 1UCNA 2F63A 1BC6A 3I6PA 1QSSA 2Z2ZA 2CPEA 4B9MA 1NAQA 1W25A 4JI2J 3ENQA 3SZ2A 4KC5A 3ZTSA 3M9NB 1KQGB 1CJUB 1MROA 4M1KA 3NGDA 3RJMB 3KXDA 1T8EA 4O3RA 3CIZA 3PIPQ 5D3GA 1K0TA 1FK9A 2CQ3A 3N6NA 4KKOA 1Q95G 3UCZP 4NCBA 1HQEB 5ETLA 2WVBA 2G0CA 4DU7A 3BH6B 3WX8A 2MLZA 2AV5A 4KGZB 1QJHA 1YGYA 2O01C 3PY8A 1I3OB 3SSSA 2HNYB 4U7UD 2GO9A 5KFWA 3BKTA 2FUG9 3C14A 2NZCA 2E7WA 2RSQA 2SXLA 2R9LA 2AGPA 1VBZA 3Q8VA 2JL9A 3KLIA 4ECZA 1PO6A 2V67A 4IFVA 3S01A 3TAPA 3UDLA 2GHVC 4LSNA 5A6WA 5EN1A 1N48A 2HW3A 1RGVA 2E5LF 2AF6A 4CNYA 2BANB 1M5VC 2F65A 1RU2A 1JLBB 1KBRA 2E1RA 4G65A 2XLJA 2Y1LB 3GIIA 3MOZA 3S8SA 4OJ1A 4X65J 2IJNA 1J5OB 1S1UA 1FVSA 1FEHA 2WSCC 5GAEU 4LF5J 3VWSA 4WFNQ 3AH6A 4ID5B 3I55S 2NPIA 2RS2A 2D3ZA 3GYXB 2NQPA 3JQJA 5KG5A 4OZ1A 2CPDA 3P3DA 1FO1A 4PWWA 4UQTA 5E3AA 2VHGA 2HWTA 2WW8A 1GFWB 4RBUA 2ZBQA 1HMVB 2QE5A 1H0HB 3MMJA 2CG4A 2Z58B 4D3HA 4R25A 1N32J 4X4UA 2DY1A 1GTHA 2FLOA 2HNZB 3FEYB 3J7Z5 2HQDA 3CCES 5H1SV 1WEZA 2RQKA 1F5CA 1TL1B 2HRYA 3DMJB 2VG5A 3PX4A 4ID5A 1TL3B 4IH7A 3W9IA 3G9CA 3AOCA 3R8YA 1N0UA 3PM9A 1W2BR 4QR2A 2B9WA 2ILYA 4OHXA 3GTYX 2C2RA 1WTBA 5F8NA 2CQGA 3DFEA 1VMBA 5KFLA 3TRGA 3LOUA 7AT1B 2W8KA 3BDPA 4DSKA 1HLWA 2WVDA 3LGNA 2QLFB 1LXNA 2RUGA 1BUXA 1YJWS 3VV2B 1HHTP 3QPIA 3N6MA 3H5SA 3OTEA 2K2PA 3P96A 2ZD1A 3FCVA 3W2WB 2YPZA 1N5VA 4ZN3A 5HVGA 2E1MC 3V6DA 3OHAA 2VG5B 3L4BC 3FK4A 3PR5B 4NI2A 4QWAA 1RT1B 3SQGA 2VH7A 2ATLA 2BKNA 4O3SA 3K59A 4UY8T 1Q7LB 3OL6A 1WDDA 2GIFA 1YHQS 3K5MA 2LQ8A 1V5VA 5RUBA 1FF2A 3F44A 3RAXA 1ZTWA 1XNQF 3LP2A 4QCLA 2FY8A 3GCWP 3DC2A 3C16A 4B3OA 1CLFA 3KJVB 4B3MF 2QFIA 4F4KA 3N5FA 2RUSA 3I5BA 3AA8A 1TKXB 4KHPF 2BJDA 3UN3A 3ZZ0A 3IRWP 1C0UA 4A4JA 3CCRS 2R7RA 1RJJA 3J7ZT 2XQCA 2DGUA 2HVDA 4DQSA 5C2GA 8AT1B 3K8WA 1TV6B 2KFNA 4ZK7M 4NLYA 4DN9A 3JQKA 4MAKA 2J0QD 3IRXB 3ZZYA 5GMDA 1I51B 3THVA 1ZBTA 1WEYA 2MJUA 4D3GA 3AJ1A 3FZBA 3MM8A 5HMZA 1OYEA 3TX8A 4CIOA 1NK6A 2HVEA 4YR0A 4FF1A 2W9CB 3ZZTA 4CNZA 2QLJB 2VFVA 1KQSR 1ACMB 2PI4A 2LP4A 1C0UB 2EFPA 4ZP8A 1YJUA 3HMJG 5KT3A 3MR6A 3NY0A 5HATA 2BQRA 2MKSA 4DR3F 2UUAJ 9RUBA 2B9EA 1GNKA 2AJ2A 3LP0B 1SCJB 4OMFG 2UUCJ 4NLPA 4LF8F 4Q0BB 3CJKA 4S0MA 5A8WB 2HPUA 2QN6B 1X4BA 4PWDB 1NCLA 3MEDB 4RX6A 1FKAF 4IRKA 1EB0A 3CCTA 1DTTA 2KB2A 3MM9A 3MUMP 3CCVS 5I42A 2YNHA 4HH1A 2QLXA 3D1HA 3H40A 4GKKF 3D4JA 5DM6Q 2V6AA 2MEWA 5D77A 4OI6A 1DURA 4USWA 1HBOA 3KJFB 2EFVA 2I6WA 2VB6A 5KG7A 4L72B 1BHNA 3FRYA 5AJ3J 3FEXB 2ZITA 1VQPS 1TL7A 2H4WB 2ZVIA 1VBYA 4R8UB 4MT1A 4DBQA 3CCLS 3SI8A 4F2RA 2YNGA 2GVZA 5IT9Y 2Y8YA 3ILIA 3TVYA 3FFIA 3CMAS 4QR1A 1H72C 1KVKA 1LK7A 3DXBA 4OFZA 1VQ5S 3R1HA 3NGKA 1ZM2A 4C3LA 2CADA 4ECQA 4F04B 3RRGA 3QYYA 3HD2A 4NCGB 4YQWA 3BQ2A 3HZEA 3Q8UA 3BJYA 2DNKA 1WC1A 3CVKA 4CO1A 4HL9A 5HP1B 2GFFA 1B0TA 4DUZF 1GTEA 5HLFB 3PNIA 2VKZG 3CMQA 1Y11A 3OW2R 1X5TA 3CDUA 1QUVA 1IVZA 1N4LA 4OYIA 1V5IB 5D6GA 4M94A 3PKYA 4AYBD 1XNRF 3TZWA 3P5BP 1U0HB 1WORA 2VL1A 3DLGA 4I6YA 1KTVA 4TY9A 3IBFB 5HAOA 3VTIA 7FDRA 2VQFJ 3TAQA 3JSYA 3CCUS 5KOWA 3TUZC 3G4SS 4UZBA 4YOEA 3B8HA 4PABA 4DN0A 3JAMU 2WTFA 3DRSA 2XLKA 3D1QA 2RS8A 3CC4S 1WC5A 3T3FA 2VC1A 1QTNB 4X4SA 5LXRA 1RT4A 1XWLA 3BEGB 2AX0A 1WHYA 4MK7A 5C42B 4LF7F 1EHWA 1VIOA 3CULA 2YVSA 2HVZA 3PDNA 4ANCA 2W8LA 2YX1A 3ELHA 5EWGA 2G0JA 5E7OB 2MQOA 3DLGB 2NREA 1J27A 4DV1F 2AD9A 2AGQA 2EWHA 3KFWX 2BJ8A 1N0VC 2BACA 3DGPB 3AODA 3CCMS 4H4MA 2JEGA 1UVJA 3MOJB 4URQU 1R3NA 1R0AB 4DV6F 4GKKJ 5KFPA 4F25A 1EKRA 3H2LA 3IG1A 4LSLA 2A2CA 2EFNA 1RWOB 1SKSA 3UNGC 4QR0A 3LTOA 1SJFA 2XEXA 1RTDB 1WNEA 1UVMA 2V5HG 1RAHB 4CLKA 2QRRA 4LBHA 2CVIA 3W2VB 4B17A 2B5JB 1DJ0A 2PE8A 3DOKA 3GFZA 2I38A 2MKHA 3NWRA 4YB1P 1QTMA 4LF8J 4ELUA 3FKBA 1S4EA 1V3RA 4ERDA 1HQEA 4N7TA 5KFVA 3T5HA 2ILZA 3ZXWA 3A8KA 3VZHA 3H2VE 4U7UK 3SYZA 5L39A 1LQ9A 1YIJS 1K44A 4PXBA 1IKYB 3K5NA 4LSLB 4DR6J 2M52A 1WG5A 2ZDPA 4CTAA 3IBCB 4AXIA 2VASA 5KFZA 3W2VA 2W2MP 1LW0A 1MMNA 5LT5A 2HQ3A 2ZC4A 4GVBA 1Q8LA 4ES3A 1Y7PA 3TYTA 4A8WA 2IM2A 2XYHB 1H7WA 4CH7A 2R8GA 3HHKA 2F5GA 3ONQA 4ZVEA 3UCUP 3DGVA 4F3MA 2LQ9A 1T03A 1PBUA 4DS4A 2OD4A 4ED8A 2V8DA 3KTQA 4DPWA 3VAMA 3NGTA 2VD3A 3LO3A 4LF1A 1VQLS 2XSJA 5KFCA 3LWLA 2WRMA 4FYXB 2DRDA 3LAMA 2DBBA 5DDOC 4LF9F 2FGCA 1WUUA 2W7AA 3OTBA 1DQAA 3O1LA 5B0DA 1U7LA 2O1PA 3T9NA 1FJCA 2R2RA 1JJHA 1B70B 1LFPA 4E98A 5B0FA 1R27B 1RWUA 4I2QA 4WFBQ 2LU1A 1W2IA 1CJVB 3I0RB 3CIMA 4RW4B 5ETRA 3NP5A 2IVFB 1H7XA 1T03B 3CO9A 5LXYA 4OX8A 1W7WA 1UWBB 2P9EA 2OSQA 2L9WA 5CZXA 2BRLA 5JVHQ 1RT5A 1B64A 5E33A 4U8VA 4RW8B 4WXWA 1PBAA 3OL7A 2J8SA 3BREA 4NMLA 4X4OA 3GE9A 1X5SA 2A18A 1CS4B 4FKYA 4G1IA 5FLXU 4U9RA 2ZJQQ 2V0NA 5E3PA 3G86A 4NLRA 2R4FA 4PEOA 1MG7A 4E8UA 5F3ZA 4B3TF 1S6PA 4GO7X 2CJQA 2V9WA 1CVJA 4J9KA 2XC9A 2V8GA 3GPAA 2JDJA 3QT6A 3TW0A 3W2WA 5IXUA 3TA2A 3JTOA 1HARA 3HHDA 4MYTA 4NI2B 4JI4F 1RB0A 1P1TA 3PW0A 2OTLS 4GMKA 1K8AT 3DRRA 1CS4A 3HULA 4E0DA 2YWWA 4WP9A 2N7CA 2LVWA 3M6VA 4DR2J 2MZQA 4QPTA 3LALA 1CC7A 5KFSA 2MKKA 2CQCA 2W7OA 5LMUJ 2CQPA 1VK3A 4ZVHA 2ASLA 1RKJA 2HNYA 4CO5A 3JYTB 3LA0A 1KR4A 4UF4A 4JI0F 3KLIB 4ZN1A 3W3SA 1VYAA 1DLOB 2HBZB 4LIRA 3H42A 5H9FK 1FE4A 1MLAA 2LXFA 2HLUA 2YNFA 4RKUC 1TV6A 1C2PA 2YWKA 4DX6A 4JBCA 2BE9B 1JLBA 4A47A 2VQEJ 4K4TA 3RRHA 4QU7A 2Y1RI 3W5YA 1VI7A 1SIWB 1FKOB 2EG1A 3BGRB 3CCZA 1E6VB 2BABA 4CCHA 1I6JA 1WHWA 5GMEA 1JKHA 4J5OA 2FLLA 4DPOA 3TEGA 2POKA 4NLWA 2CPFA 3TA1A 5C2CA 2HZVA 1SUQB 2AEJA 2EFOA 4ICLA 2CKWA 2JC0A 3G6YA 1FRHA 1MROB 3KYLA 3W9HA 1DLOA 1Y5IB 2BDPA 2DD8S 1FK9B 2NYHA 5KG0A 5GAEI 1FJGJ 1TVRB 8RUCA 1C1CB 4DV6J 1S77D 3EXYA 3MAHA 1NEEA 4KGMA 5BYQA 1AZSB 1HNVB 1NO8A 5KT4A 2F3JA 2BX6A 2EFGA 1FKOA 2W4DA 2UUBF 1K1SA 2YX7A 2YNIA 3R7BB 1UVNA 3AB2B 2Z2LA 5D78A 2BM0A 1XMBA 3FDSA 3WX4A 5LMNF 3TARA 3SCJE 1A9NB 4OLOA 5KTQA 1XTZA 3FBFA 5KFDA 3MUVP 3SIPB 4NASA 3GYNA 3O5TB 1WC6A 4CWBA 2E66A 4BC9A 3B4MA 3J80U 4LSNB 3T1YJ 2B4OA 3HVTB 1IWAA 2CJKA 3VHQA 3DDKA 3KDNA 1X0FA 4GKJF 3P8BB 4K4ZA 1U09A 3MR3A 2UVRA 2R8JA 2N3OA 1F3FA 2ZFHA 3GIKA 4DV7J 4FBTA 2X1FA 1NRKA 2W2NP 2V8HA 5D4LA 5J2NA 2VA3A 3V6DB 3K89A 1F0XA 1I5OB 4HVZA 3PRDA 4W90B 1D9FA 1TKTA 2LQJA 1RLDA 4DR4J 3Q89A 2VJUA 1PIEA 3RBXA 3RB4A 5J2PA 5ETQA 3EICA 3HI9A 4HACB 4MK8A 5KG6A 3SSRA 2DITA 3NNHA 2BYCA 4MKAA 4UY85 5K14A 2DHXA 2BV3A 2VU5A 2W2QP 1T9WA 1L3UA 1QAYA 2CQBA 1IJFB 3DMJA 2FQQB 2BJ1A 2C28A 3O44A 4OLPA 4C97A 3R5BA 2WSEC 1Q81T 1D8ZA 4JYAF 2Z2MA 7FD1A 2J76E 4X4RA 4CLSA 2DNHA 2HS0A 4B3RF 2IDLA 3HJFA 2HZAA 2NZ4A 2DH9A 2HK2A 1VC0A 1GMUA 1RTHA 3RBDA 3OLBA 4OHYA 5J2QA 4USIA 4YUDA 5I3PA 4NLQA 1AFJA 4L73A 1AT1B 3CJ5A 3KK1B 1XC9A 4CLFA 4NXNJ 3HLUA 5EX0A 3IBWA 2ZZNA 4NLVA 5L1KA 3W63A 3MEEB 2ZH9A 1U1MA 2FJBB 2CDQA 1J5EF 3K58A 1HR0J 2ACYA 3IGVA 3ZC4A 4LQ3A 1RT3A 3K8VA 4P71A 4EK2A 1NJWA 3NRBA 1XR5A 1SV5A 2IRXA 3W60A 4URGA 3DLJA 1I1GA 3KLGA 3LP2B 4HHUA 5B0GA 3WBZA 1UW4A 3IWXA 1WACA 4WK3A 2IAJA 3AOBA 1IJEB 4LIWA 4AT1B 1MWYA 2HLTA 3KLFB 4ETXA 2BW2A 3GV7B 1KN6A 2DNRA 3DRYA 2Q79A 3M2RA 3PRBA 1FDNA 3AXKA 2RKIB 3DDNA 3P45B 4RW6A 3G8SA 1HBOB 1TK0A 4TKTA 2JVOA 1VFJA 2M9KA 1O5JA 1WI8A 1YITS 1N56A 4AL6A 4IH5A 3OVSA 2ZH8A 2AJQA 4KH1B 4F0MA 5F8LA 2FJAB 1IKXB 2GGPA 5HQMA 5F8MA 2MKIA 3Q23A 3CJ8A 4FVCA 4C8OA 3H5YA 2G0IA 2R2TA 1HQ2A 1Q53A 1Y00A 2HBRB 4FYVB 4CT8A 5HN0A 1IBMF 1PCAA 3HHNB 4K50A 2EG2A 4PG8A 4ZKAA 3SCKE 2HHUA 4CM0A 2RT3A 4CRJA 4ECWA 3DRPB 1FCAA 2CVEA 1MU2A 3V4IA 3D5MA 4ZLNA 2GJIA 1SB6A 4KGXB 4YDXA 4NCGA 5KFQA 5GAGU 1N5QA 5GAHI 1P27B 2HFUA 2QV6A 5C7PA 2UVVA 3UDVA 3PO4A 1GQEA 4I68A 1HNWJ 2AJ0A 1MSWD 1FD8A 2VFSA 1YZ6A 3KNAA 1IN0A 3AXMA 2IVYA 3TUIC 4OX9J 3NCRA 3D68A 1HBMA 2AP6A 5CXTA 1REGX 1S1XB 1WC4A 2CPIA 1LNQA 1U0HA 2QC3A 1TUVA 3P49B 5L9NA 3JSBA 3LWMA 4BBYA 2WB4A 3EJMA 4DQIA 2MDAA 2AKWB 3ENAA 3QIPA 4ZCLA 1AROP 3ET6A 2HIQA 4ZITA 2ZJRQ 4A8KA 4B9UA 2XMTA 4G3IA 1GXLA 2I0XA 3R2CJ 2LDIA 5JVGQ 3QGIA 2IHR1 2H3EB 2HSEB 3BBBA 2NPFA 1HWJA 1DZ5A 3TJ9A 1YJTA 1IBCB 2FC8A 4X4VA 4QU6A 1EETB 5HROB 2MKCA 3NOCA 4ZDNA 3W7BA 3CSKA 3QGPA 2OPQB 2HQIA 5FDLA 3FNNA 5D0GA 3ZFVA 4H4MB 4ID8A 1ZZNA 5F9NA 4EBEA 4LFAF 3KMQA 2BRKA 2V2VA 3V4MA 1OMSA 2L3MA 2RNEA 4Y2MA 2OPRA 3JAMY 3IS9B 3HT3A 4ED1A 3CCQS 3T5JA 1IR1A 5L8RC 3O8WA 1UL3A 4NYOA 3M4XA 5IS2A 2O3DA 4RNNA 2ZH5A 4NMXA 2R7WA 1A0OB 4ZCIA 4ZVGA 5KFGA 1QSLA 3GJRB 1FTCA 2NUUG 3BDEA 2H65B 1Q7YT 3R97A 1I94F 1WF1A 1U1LA 3RAMA 2E5LJ 3AD9C 3GR1A 3EX7B 1VR6A 2DR8A 2U1AA 2JC1A 3HJVA 1NJXA 1UW9A 4EZ6A 5EWEA 3L3CA 3MM7B 4I0WA 3W8PA 1IKWA 4K4WA 2WONA 2R7VA 4PYAA 4RR5A 3R2DJ 2DHHA 4GVBB 4Y6IA 4LVOP 3HSZA 3C6UB 2L9NA 3TANA 3HHLC 1QAXA 2PDAA 2FC9A 4YN3B 3OL8A 4M5HA 2ROPA 3PJXA 1WJ9A 1JJ4A 2C3OA 1Q8BA 3CTRA 4PCQA 2DRAA 2GA7A 4YY3F 2BMBA 2FVCA 2M3DA 2CZVC 2YKOA 3IG1B 5T14A 2BEFA 2VUGA 1NK7A 3SDEB 5AXLA 4FVMA 5IV3A 3IGNA 1S12A 4ICLB 4DOZA 2GIQA 3ISZA 2V4JB 1YZ7A 2M5YA 1PSDA 3IR5B 4M8LA 4EGLA 4O4GA 3RB6A 1AB8A 1D8YA 2M8DB 3I0SB 3NS6A 2HURA 3LF0A 4JI0J 1WOPA 2O67A 3J81j 3UE2A 1S0OA 2CJAA 3DOLA 4CO4A 4NZ6A 2YNIB 4IOBA 3K5LA 3CD7A 4ZPTR 3R5JB 3VGTA 4ZPAA 2XY7A 1M90T 4P75A 5ETSA 2CPZA 3MUTP 5E3CA 2QLBB 1LW0B 4ECVA 4NCAA 1JLAA 1FESA 1RAJA 2CQ1A 2FLNA 1G7CB 2LQ5A 1NDPA 5KT2A 3QSIA 4LBIA 3MM6B 3FQLA 1Y9OA 4DL4A 4DR7J 3RRKA 3MMCA 2E1PA 4Y2IA 2MZJA 2YQ0A 2UXDJ 3QZ8A 2CPXA 5DQGA 4EU0A 1IM4A 1RHJB 2BM1A 5JMNA 2HBQB 1N36F 4WU2A 3ITHA 3CT9A 1VQ9S 4DV4J 1TL3A 3CDAA 3TR5A 4ETZA 4YY3J 3DLKB 3ZO7A 2ZH7A 2I5JA 3A4TA 2HS3A 1IBKF 4JV2A 5F8HA 1T05A 1OO0B 1HPZB 2FHOB 3N0VA 1SJQA 4MFBB 4Y3CA 4O0IA 3Q24A 2ZH4A 3G6VA 4JV5J 2UXBJ 3K2YA 3M6XA 4Y28C 5DQIA 1U2FA 3GIJA 2DGTA 4JI3J 1T02A 1MMLA 5KOXA 2A10A 3MCSA 4FKXA 1O51A 4OV6A 5A8KB 3FGVA 2JJ4D 3MHYA 4ZA1A 4LVNP 4C8NA 3UO0A 1K47A 4IDKB 1HWIA 2VC0A 4LRCA 3NWGA 5B0EA 1VK8A 3TA0A 2FD2A 4EEYA 1UA0A 2YKMA 2HHSA 1OPZA 3JSRA 1KTQA 3RUBL 5KFFA 3CEDA 3X1LB 4DCPB 4C3MA 3BGRA 3S7RA 1S6QB 5F0UA 4ED6A 2JZ5A 1VLOA 3H2UB 5F0WA 3CE8A 1JKHB 4J9LA 1SBRA 1RWKB 1FRIA 4O23A 5ETOA 3VALA 3KK1A 3OFGA 3H25A 4QJVA 3CCSS 3J7AN 1UVLA 3OXLA 3RG6A 1HYSB 2RB7A 1VC6A 2CQ4A 4ZP6A 3J80Y 2H5JB 1UTAA 3IMQJ 4DV0J 4DSFA 2AMCB 2AX1A 4K7QA 2OMOA 1KLNA 4BS2A 1TMMA 2EKNA 5A6PA 2VIHA 2XNRA 3HHLB 4G1QB 3NKYA 4NLOA 4NYPA 4PG6A 4QIFA 2GAGC 4OX9F 4TVAB 3M32A 3EPGA 1RYSA 3HPOA 4ZVRB 1IQZA 1R0CB 2W9CA 1URNA 5DLGA 2BBEA 1H74A 3OR1B 4USHA 5CCMA 3VAGA 2R7XA 1HYSA 1HNIA 3D3CJ 3IO1A 2LKZA 1U0SA 3I9V9 4DHVA 4EYHB 2MTLA 1S99A 1EARA 1JJCB 1UPMB 2RRBA 3PW2A 3PW4A 2V50A 1U6FA 1EP4A 2OJ3A 1JX4A 4PUOA 2HHQA 4WYWA 4EMDA 2CZ4A 1VRTA 2EBEA 3EVMA 5AJ3F 2VOOA 1F2HA 4EFAC 5CD4H 2PN6A 1OJ4A 1IBMJ 2ZBIA 4XPCA 3OJSA 1NKBA 3U7JA 2GHWA 4WTOB 1FT8A 4N41A 2B0GA 3SMZA 1TP7A 3HKWA 1V3ZA 2V2KA 4CLZA 4DEZA 4X62J 1PAEX 1T11A 1TAQA 2EPIA 3OD2A 2EC0A 2HAIA 4DR5F 2ZNYA 2BANA 2PMZD 2ERRA 2KJWA 3C19A 1EP4B 1HNVA 2Q1LA 1FRLA 3HHLD 4DL5A 4KPYA 3HD1A 4ILLA 3SBMA 5E41A 4Y0FA 2DCLA 2IA0A 2B7BB 2UUCF 2MZ1A 1GMWD 2GVZB 1CPZA 3U27A 1WI6A 4KO0A 2MXYA 4DI6A 4AXJA 4O4RA 5J1NA 4ATNA 4ECTA 2KYXA 2DNOA 3JTPA 2BQUA 2XMVA 2AU0A 2B43A 4Z7YA 4C7QA 2GO8A 1S72S 1NHKL 2J8AA 3OFHA 3GLJA 4XDDA 4CQ1A 1ROFA 4ZVFA 5J2QB 1H3DA 4P52A 1T9UA 1E6YB 2CPYA 1XERA 3NBPB 3T5LA 1GMWA 2LMIA 2JLEA 5HP1A 2VA2A 4RUAA 3CO0P 5J1PA 3KLHA 2I2YA 2YXLA 1AA1B 3Q8QB 1JNZB 2PIIA 1QE1A 2VG6B 4P2SA 4CLLA 4ECUA 4B9VA 2KHCA 3R27A 4F2SA 1N5SA 2YKQA 4B3MJ 1L3KA 4U7CA 3C6TB 1M5HA 2GNKA 4KRWA 4ELVA 3FMWA 2Z8QA 3NL0A 5KFXA 2GJ2A 3QATA 4LRBA 5BYRA 2RU3A 1RHUB 2B6AA 3E01B 1YVFA 1W26A 4YDDB 2R2UA 3QT5A 3NS5A 4BDPA 4NXMJ 1GXTA 2W9BB 4TXSA 4UZCA 1NK8A 1FJ7A 4TN2A 5KFUA 3K57A 2FVQA 2ZEJA 2VDHA 3D28A 4UOHA 2N4DA 4EI2A 4GC7A 3RTVA 3ZZUA 2LECA 1L3SA 2DNPA 2ZH2A 4DR1J 2FHJA 2UZAA 2HGMA 3C6TA 3DCAA 3MD1A 4RNHA 1MNEA 2B51A 4KBIA 1Q1KA 2FJVA 1KHWA 2RAQA 2YX4A 4QOTA 4TQSA 4HR2A 1GXUA 1GX6A 2MLYA 3RYLA 5D0HA 2PFDA 3T19A 1K73T 3H90A 1T94A 1TR0A 5B7WA 1HI1A 4AFFA 3A3OB 2KU7A 2JEIA 2ASYA 3PRVA 4MKVA 3D6FB 3RGIA 3U1LA 4C9DA 2H1YA 3MM7A 1YBAA 4FN5A 4P9SA 4EZ9A 1FVQA 1UEVA 2FYXA 4YB7A 5F9LA 3MR5A 3TZXA 3BV8A 4I67A 4RW7B 3LGMA 3MMCB 5HJYA 1LV5A 1S1WA 2XHWA 1VQ6S 3K0JA 2DH8A 1Q4RA 2CWXA 2DXFA 1B0VA 2K3IA 3W5ZA 3GV8B 2UXDF 1PAUB 2WVFA 1S9GA 3E3XA 1ZPVA 2VPXB 1VIXA 3F41A 3KLVA 4USTA 4U67Q 4ER8A 5K8NA 3FBBA 3HSJA 1KRPA 1MWZA 1UPPA 4XAKA 3VR1A 1JLEB 4ED5A 1VLYA 4CT9A 3T41A 4NA1A 3KK2B 3PV8A 4JV5F 1S4FA 1H2VZ 5IC4B 4JV0A 4CDIA 4M5JA 4DV7F 1JLCB 4USJC 1M5SA 2Y0BB 3SCIE 5M2UA 4QW9A 5A8WA 2Y0SD 4X65F 1UWAA 1N5TA 3D6TB 1UVIA 5I42B 4HDHA 1ZETA 2E5HA 1APSA 2B7CB 1VQOS 2AW0A 4R0EA 1VRQC 2RQMA 1IWGA 3TAMB 3TX0A 1FD2A 1WD6A 2IMOA 1JIHA 1FKPA 2LLZA 3DRPA 1FRKA 3CJTA 4LRAA 1PYTA 2WK4A 3M8PB 3FQKA 1JLQB 1KS2A 4JP8A 1O6XA 4I69A 4WFZA 3GILA 2DNNA 2R42A 2OPQA 1HW8A 2HQCA 2E9RX 3L7OA 1C1BA 2H9ZA 2NUHA 1UVKA 2I8EA 3HX9A 4Z2XA 5F8IA 1DTQA 4I2PA 4OI4A 3MURP 4P2MA 3POTB 5FLXY 3MFHA 3PX6A 2C2OB 1SQFA 3N01A 3VVTA 6FDRA 2H54B 2YQ3A 2ZBRA 3FCWA 5IV4A 5HQ8A 1FFSB 2RE1A 5KT6A 1Y0HA 1QDUB 1JNRB 3N28A 1F9FA 4DJBA 3US5A 3ILOA 3MMAA 2H5IB 2OI2A 3AB4B 2HS4A 1FWKA 3H7HB 2CUYA 2J9EA 3MPWA 1S1VB 1X9WA 1N33F 3QIDA 3HKZD 1LWFA 4UW2A 4KJIA 3EMTA 5IQQA 5HLFA 2F40A 1RT2B 4B9NA 2EEYA 2KVQE 1ELOA 3FMBA 4QPXA 1S10A 4QYZK 4P10A 2JLGA 4YR2A 2KFYA 3M6WA 5F41A 2ZH3A 4DUYJ 1PYSB 1R8PA 4OZ0A 3GFXA 1X31C 1HI8A 1KLMA 3MMAB 4BHQA 1VCTA 1OWXA 3C15A 4DR2F 3DRRB 3GV5B 1XIQA 5FDLB 4QIEA 2HHPA 2X7IA 3RB0A 2BJ9A 6AT1B 1MW7A 2KHDA 1JMTA 1YJVA 1NSKL 2XTJP 1Q5YA 2WOMA 4HI1A 3SSQA 3W65A 4JI1F 1SJ4P 4J37A 1UP1A 3PKMA 1RT4B 2F8MA 5IOLA 1RBAA 1I94J 2DNLA 3JTNA 1CJUA 2W9AA 3KWMA 4PPZA 3AJDA 4DLEA 1H98A 2CRLA 1UFKA 1ZM4A 1LOUA 1VQ8S 2YQ1A 1BMQB 4HH0A 2ZOGA 4BWJA 1NUEA 5CYJA 1B99A 3CMES 5MLCV 5IC6B 3MXHP 1IKVA 1R8BA 3MGJA 5IQ6A 5DRKA 4M5MA 4IO1A 2U2FA 2E5JA 1RTDA 3KJQB 1NZ8A 3N4WA 2R8IA 2LEBA 4JI8J 1SC4B 2C42A 2J9CA 2N7YA 3DRXA 2B9YA 3D6HB 2XB2D 2MJNA 4A8FA 4KFBB 3RR7A 1C1CA 1FXDA 3WC0A 2LXUA 1TFWA 3T6JA 4DSLA 3ILLA 4NLUA 4DR6F 4OI2A 1Z1ZA 3QGGA 5DQHA 1S1UB 5DM7Q 3ITHB 4K4SA 5FD1A 4DV3F 1VQMS 1M0SA 2K8GA 3PJWA 3CDWA 3EWGA 2BOAA 5IWAF 4PYDA 3GR0A 3Q8SB 3C3LA 3QT7A 1S0NA 2Y9HA 5CYQA 2IY5B 2XGQA 2FZGB 4ZVQB 3VGUA 4DV5J 4N76A 2K06A 2FGOA 2JNJA 2BJ3A 1RP5A 3UDEA 2KL8A 2AIRB 3LGHA 3DU6A 1NHVA 4KHRA 2BJEA 1F5AA 2WW4A 3VVUA 4ILMA 4DR5J 4ZIVA 5GAGI 1OQ6A 1S0VA 3R6GB 3HO1A 1TTHB 3NNCA 2JWNA 1OSCA 5B0AA 1SL2A 2LA6A 2HWIA 1T9VA 1SJRA 2W7PA 3MPYA 2CNLB 1PJ7A 1RLCL 4R0JA 1NPRA 4HACA 3M30A 2IMWP 1RSCA 3BBFA 3MM6A 2IPOB 2Y1IA 1UA1A 1CJVA 2VFRA 4HT5A 1FX2A 5H9FJ 1X9MA 2HHWA 5K14B 1ZS6A 3W1YC 2QX0A 3QZ7A 1SC6A 3PW7A 1R8CA 3M8WA 3BGOP 2LXIA 5CYMA 1SH0A 1XMOF 1QE1B 1HIYA 3MTKA 5A76A 3PIOQ 4Q2MA 4B9TA 3MECB 3OSNA 3EZ5A 1S9FA 5ETNA 2LEAA 2O5DA 3EGNA 2C2MB 4DX7A 3CJ2A 1UEKA 3DLHA 3UN2A 4KSEB 4DV1J 2APOA 2GVDB 3T9ZA 3HFVA 5A0YB 4JYAJ 3QAUA 4R5PB 3CJRA 2QTWA 3KG4A 3QT8A 1TK8A 2HNZA 1ZH5A 2FPHX 2Y1JA 3ZNJ1 4WZMA 1TL1A 2PD1A 3BYPA 1D9AA 1U2CA 2ATCB 4HHJA 2W9BA 4MIWA 5D0RA 4TYAA 4PUOB 1HD1A 2UVUA 2OEMA 3G6XA 4TU7A 3M8QA 3R5DA 2EVZA 4DUZJ 1U1KA 4CM2A 5I4MA 4Z7CA 3BM7A 1H38A 2CAJA 3TUPA 3X3UA 4CZCA 1WTFA 4ZJQA 1RKIA 3D0GE 4UT4A 3SCLE 3W9JA 1X9SA 1IR0A 2LU2A 2UV8A 2ZVSA 3OTOJ 4RWWA 2HWHA 4JI8F 4L6V3 4F0KA 1WSRA 3EGWB 2RDJA 4PG4A 4DF8A 3EE3A 1FHTA 2XWXA 1JB0C 4OYBA 5HK4A 1EZZB 2HG4A 5B09A 2HNDA 3GIRA 2VG7A 3JQMA 1S1WB 1YRUA 3F73A 2KZMA 4LFBJ 3MR7A 1YBUA 1WHVA 1S48A 4LF6J 5F3TA 2XY5A 1ULRA 2AZ1A 3M32B 2LEPA 3HXMA 3PJ9A 1M5PC 3KJVA 2E7VA 2G1HA 4FXWA 4ZLJA 5HVHA 1FNXH 1AUSL 4NLGA 2NLWA 1RWWB 2JLFA 1YKWA 2PC6A 2G2YA 5I3UB 4GKJJ 5L1JA 2HRUA 1MU2B 3M6UA 2HKEA 2A1BA 2D7SA 3QSYB 4FF2A 3NNAA 3E8OA 1S7IA 3MEGB 2XZWA 2OPPA 3KUEA 4AD6A 3E2EA 1QLNA 2DK2A 5J2MA 1QUPA 2KXNB 1RT7B 2DXEA 2UUBJ 4C0BA 3LQVA 4C8KA 1HBMB 2NXJA 3AD7C 1YRTA 2Z57B 4KY3A 4DUYF 3O2IA 1IBKJ 1UETA 2CA9A 5ADZA 2MQNA 2EW9A 5HSPA 4XO0A 3ENVA 3MEGA 3BB5A 1ZM3A 3R5AA 2A3JA 4EWTA 4FBUA 1S0MA 4DV5F 3OUYA 1VQNS 1U6ZA 3DU5A 2DT9A 3EZUA 4PWDA 2CNKB 5LMNJ 1NDKA 1X4EA 1WKKA 1X4HA 2HGLA 2RHSB 2ZHOA 2E7XA 2J5AA 1CC8A 1HWLA 1SPBP 2D9OA 1Q8KA 3GSDA 1KVIA 4IG3A 2YWGA 4MK9A 3CJSA 4Q7AA 5B08A 4WP8A 3I56S 3FSIA 2ALYB 3I87A 2XS7A 2R8KA 1FJGF 3L7UA 3J7YI 1FJEB 2KXHA 4A8QA 2XS2A 1C4AA 3EVOA 3OJUA 1Y5NB 1HBNA 3OUYB 1E6YA 1SC1B 2C1EB 2XI2A 5LMUF 4KHMA 4ED7A 2OEJA 1LWFB 1V6HA 4ANEA 5IZHA 2CG8A 4PAAA 1RTZA 3OHBA 1NKCA 2IFXA 1CSJA 4C3KA 1NDLA 1RT2A 2OAUA 5CZVA 1NSPA 2V8VA 4B3SF 1JLFB 4OJGA 4C8LA 1RWNB 4RW7A 4P6QA 2QL9B 5C5JA 5KT5A 3HZGA 5F8JA 2FZKB 1D3WA 3BGUA 1RBOB 5LJ3Y 1T95A 1TELA 3BN4A 5GVQA 2LA4A 2ZWPA 3ZZRA 1PG5B 1OY6A 3MAAB 8ATCB 4USVA 1S9GB 2LFVA 2ZKTA 3DLBA 2BVZA 3T1AA 5ITHA 2B4UA 1EX8A 2NCKL 1PYOB 2V9KA 2ZC3A 3IA0A 3MEEA 3Q86A 2ZJPQ 3V6JA 4JI6F 3KDOA 4DX8H 1SC3B 1X4FA 3O3LA 3VZIA 2RDDA 4WIIA 2MY8A 4C8MA 2YWEA 3G2XA 1C0TA 3RB3A 2GQ2A 1JLCA 4IRDA 1DQ8A 3PVXA 1VC5A 1UKUA 2AZ3A 3CJ0A 3QQCD 3BZQA 2CJBA 2ABYA 5DG7A 1Q86T 1P9YA 2IAJB 4U6PA 1FWPA 5CHCB 1IKVB 4JOUA 1R8AA 3W64A 1IKYA 3TAMA 4CI0B 2OPSB 2W4PA 4UUXA 1SKWA 3TP2A 1ZAVA 3AFGA 4ILRA 3SDEA 2BKPA 1SQGA 1XR7A 4N8OA 1NSQA 5C42A 3Q8RB 1RE1B 3JXOA 1KQKA 1C0TB 4KTQA 3FBCA 1KHVA 2ZE2A 1BQNA 3FZ2A 4MH8A 1B7FA 4URSA 3D0HE 5A2QY 4ECYA 4QQBA 1T9YA 4USMA 2D3UA 2DIUA 1NJZA 2N4CA 3MM5A 1T9XA 5KFTA 2D9PA 4OYAA 1SL0A 5KFEA 1WHXA 4N8NA 3IP0A 5GADI 2H51B 4QIVA 4TLQA 3TO8A 1U1PA 4RBVA 2DH7A 1LWCA 2YH1A 2CPJA 1HHSA 2P6SA 4BCAA 4OZ5A 2BR0A 3KG0A 1XMQJ 4NE9C 2MY7A 5D0EA 2AYBA 1F2GA 3ENWA 3OV7A 1H6KX 3GQCA 1VISA 4ZVTB 2GW8A 3PHEA 2ZHAA 4DL7A 1NPPA 4O3QA 4HLBA 5BR8F 4O3OA 2VBYA 2VFTA 2PA8D 1FTRA 1MN9A 4HTIA 2QYGA 2WBRA 2GIRA 4I56A 1U4BA 4ECRA 5EUHA 1NK0A 1F3VA 1X8DA 4PPDA 1JWWA 2NXNA 3UD3P 4RNOA 1BD6A 2L48A 1HWKA 2E1AA 4C4WA 1QY7A 4J9SA 3GJQB 4F02A 3RW7A 3M30B 4H4OA 1FNMA 2B56A 3FBEA 1WEXA 4RW6B 2IRYA 3GP9A 1NK4A 5A8RB 1RQ0A 2OEKA 2K7JA 1ICEB 5J1EB 4RUBA 4ZPWR 4DFJA 1CJKB 4ZJOA 2FHJD 1KEKA 4X4NA 1DHMA 3ETOA 2Z2YB 1IUJA 5HBMA 5E3QA 4WKYA 3DHWC 4KT0C 2QYCA 4O0NA 3PYEA 1Y5LB 4KGVB 4LR8A 1NK5A 4GO5X 4CLWA 5JXSA 4RPFA 4LF6F 1UWBA 2PO4A 2VONA 2F8EX 4ECSA 4CO3A 5J1EA 3VQTA 5CD4A 3ICLA 3OLAA 4OX7A 2AJ4A 4ZPDA 4Y2KA 1VBXA 4DL2A 1O0PA 3DI6B 1URRA 3PR4A 4IOCQ 5IFMA 3OTOF 2P9GA 4NZ0A 1FA0A 3GG1A 1FI4A 3OR2B 3RAQA 4WBFA 2WOMB 3P4UB 4M5KA 4J9UE 4DPYA 3BH7B 2V2ZA 4K2JA 4HI2A 2F9JA 2KZZA 2DVIA 4J7CA 3K17A 3L7PA 3OR1A 3D6MB 5CYQB 3D67A 1R7IA 2AYEA 3M1VB 3J81U 1HR0F 3HT0A 3M8ZA 4AQYJ 1UFLA 2XULA 1HD0A 1J5EJ 2VQFF 4K0KF 1TVRA 3WC2A 1HKAA 1VQYA 1HQUA 1VJWA 2V94A 2F4VF 4WFYA 1HNZF 3KLEB 2FZCB 4QW8A 1Y3KA 1VDHA 2ZZMA 4PR6A 3CC7S 1VQSA 3OXGA 2MSTA 5KFKA 3QAEA 4DV0F 3PEJA 3R5CA 4ZLPA 1N88A 2DY9A 3VAIA 1HNZJ 2G2ZA 2VZ9A 4XDCA 3VAFA 1JLGA 2KYZA 3QO9A 1NMEB 2V4JA 4A48A 3MWBA 5D3GB 3KHRA 2IYIA 1U25A 2EKYA 3I0SA 3TQEA 4CH0S 5IT4A 2UXCF 3GZ7A 4NWBA 3L09A 1XMOJ 3KK3A 4WKRA 4QBUA 1S76D 1X4CA 5J2MB 2HIYA 1EQMA 5DZ6A 5KG3A 1FDDA 2DGVA 2NXEA 3DHXA 2ZBCA 2DB1A 3NMAA 4M5LA 1UMJA 3T1YF 4FS1A 1RA7A 3PYDA 4WFAQ 1JXLA 3C14B 3JS9A 1J2VA 5K8OA 4TY8A 4A46A 1PKUA 2IJFA 2YPYA 3NCQA 3R3TA 5K8MA 4KE5A 3PHTA 1DBDA 4A8YA 2QLWA 4PXDA 3SEOA 4DF4A 1VRUB 4OL8A 3BKFA 3WZ0A 4R5PA 2DKOB 1IR2A 3NS7B 3TUJC 5EGYA 4X62F 1HBUA 2H4YB 3D66A 2D3OR 2R7SA 2CJXB 4A8MP 3UR0A 2XLIA 5ETVA 3VF0B 3UDCA 3SQGB 4IG3B 3UVJB 1RABB 5KFMA 1P6TA 1RACB 1RHRB 3HDSA 3QFHA 1HPZA 1T05B 4FF3A 1D1UA 2LYVA 3OT9A 3M8QB 1U1OA 1RA6A 3HFKA 2AQ4A 3SFGA 1HHQA 1FX4A 4IO9Q 2J7WA 2DHAA 4DR7F 1HL6A 1PILA 2OO4A 1TZ0A 2C3PA 2HQFA 3D1OA 4DX5A 4YHHF 2XMMA 2PEBA 1YBTA 2IBKA 3KOAA 4DMZA 4OHZA 5AXMA 2B9XA 1HBUB 4IH6A 1RBLA 5SZTA 2VICA 4DFMA 1U49A 2B4PA 1TKXA 3MR2A 1KFSA 4IDKA 2GV1A 5L46A 3EGVA 2FJXA 2MQMA 3OFEA 1DRZA 4ZOSA 2KT2A 2YH0A 3S6EA 3ISND 1DARA 2V4RA 5F8GA 1HI0P 1RAFB 1Q78A 3GFHA 4HEA9 5H9EK 1Q0NA 1U24A 2XI3A 4W92B 1HFEL 2MZSA 1Q82T 1VQ4S 2CPHA 4UUWA 4O44B 4ECXA 1X4DA 2MMYA 1TU0B 1JK9B 2G1DA 2WB1D 2KXFA 1OY8A 2ZD1B 3ZTRA 4TLRA 3J7YU 1UJ6A 4J9PA 1H2UX 5I3UA 2MB0B 1YX2A 1RT1A 3UWTA 1RUSA 1IBLF 4LMZA 1KDNA 1YJ9S 3KHLA 1SI9A 4XK8C 1N34F 1TKZA 2V34A 2KH9A 3FJ2A 2X1AA 2KJVA 4K5RA 2VODA 1UAWA 4UQGA 1ZOTA 3MPDA 3EDQB 3CJ4A 4I7FB 2H5EA 1UFWA 4B02A 3TZZA 3FRZA 5CABA 3GCXP 2XO7A 4GVLA 4PQAA 3H4BA 4WTYA 5JJBA 1QSYA 4I6WA 1BGXT 3GB0A 3KK2A 4K4YA 3A8JA 2DPIA 1U8SA 4DPUA 1LFWA 1KONA 3A8EA 1GH8A 5HANA 4CLUA 3KHGA 1YRXA 1TKZB 1A6LA 2GMLA 2X51A 4OYXA 3CD5A 4QIWD 4DFKA 3ZZOA 5AXKA 2MHNA 2AYMA 3PFOA 5DJBA 1JQGA 2J7UA 4ED4A 4B3TJ 2IJRA 3BQ0A 1N34J 2RJZA 3V6KA 3H0PA 3NOGA 4EO6A 1N32F 3MTJA 4FZVA 4TNOA 3SQOP 1XEZA 2FHKA 1DY3A 4C98A 2IBOA 3H98A 4C8YA 1U47A 3IN5A 3DKDA 4P7VA 5K9FA 3IAS9 1HBNB 2AT1B 2BZ2A 3NGSA 5IM0A 2L41A 1ZA2B 1U1QA 2GAHC 4P72A 3PG9A 1DTQB 4I2PB 3CDBA 4LUBA 4F4AA 3DXSX 1DTTB 1YLXA 4OZLA 3TOQA 5FJ4A 3I82A 2GMJA 2ZKUA 1YJRA 5ETPA 5D4NA 1X0PA 1FERA 2DGQA 5ETMA 5AXNA 2XGPA 2KRBA 3IFEA 4KAIA 4LF9J 1YJNS 1EETA 3A3NB 4L3NA 5HROA 2HYIB 3I5AA 1ZA1B 3UD4P 4KB7A 2E1CA 4B3SJ 1T3OA 2PFFB 4A8SA 3ZNUA 3EYZA 4B9LA 2HRTA 5GADU 1RU1A 2GX8A 3GU0A 4R8UA 4RZRA 4LBPA 4NEZA 3KLHB 1KKHA 1RWXB 1ZZFA 1WF0A 2OH2A 1K9MT 1B3TA 2UU9F 3AT1B 3G87A 3IS9A 2W24A 3BGFA 5D4PA 4WXOA 3M2VB 1SJ3P 3W5XA 1G4CA 4EO8A 1KSPA 1KLMB 3QJPA 4BLGA 4ZVOB 1T7PA 1F5BA 5KG1A 4FPIA 2AGOA 4K4XA 4FXDA 2QMXA 4X66J 3LW5C 2G9OA 1CQMA 4N77A 2V8PA 3DGPA 4HDGA 4HTJA 3QRQA 2DEJA 3GJSB 3K7RA 4M95A 2KTQA 2HFVA 1DFDA 1EJ7L 1LW2A 2N3LA 2I9SA 1WC3A 2J9DE 2F8HA 3MZIA 4IKAA 3HF5A 3UCGA 2J9DA 2CWKA 3VQSA 2ZHBA 1NHUA 5H9EJ 2YKPA 2DIVA 2KM8C 2FIUA 2WONB 2KG0A 2HVHA 1JLFA 2B5JA 4IFYA 4MMOA 5KG4A 3FVYA 3U1MA 2MQQA 4DV2F 2JOQA 1S57A 2ZE2B 4IR9A 1DQ9A 1HA1A 3C6UA 1PJ5A 1AUDA 4DSEA 5D4OA 3OPKA 4P2FA 2WVCA 1WG4A 3BBCA 4WYLA 3MAAA 2MQPA 2LCWA 4WCEQ 4IRCA 2F4VJ 2R7UA 1RTIA 2OHDA 3R7NB 4GRSA 3I96A 3MM5B 2JVRA 4E2FB 4FPRA 4C2MA 2C2EA 3OR2A 4NRUA 2M2BA 2YKAA 2ZH1A 1M1GA 4OJ3A 2IM3A 2M0GB 4OYZA 4AE5A 2JEJA 4ES2A 2HMIB 1XNRJ 1SKUB 4DR1F 3U1NA 1LWCB 1TL4A 2OPRB 4L3KA 5C24A 5GAHU 4QWBA 3CNQP 1VHFA 1B0PA 4X84A 3GYGA 2OTJS 1VOMA 1RTIB 1YJ7A 5G0RB 5L1LA 4Q45A 3HSDA 2ROGA 3IAM9 4YB5A 3CWJA 5KFHA 2VJVA 3BO2A 2QIFA 2CXEA 4NRTA 1M1HA 2XCPA 2XSJB 4P74A 4DPTA 2V4QA 1HNXF 2Q6BA 3LUYA 1CQNA 1GK8A 1IKWB 2CNOB 5HO4A 3HK2A 4EBCA 3QO9B 1KFDA 2M4MA 5C24B 2R3VA 4U95A 3PX0A 3A1YG 1LWXA 2B4VA 5HI7A 2GJFA 4C0HA 1Z2ZA 2JEFA 4JI5J 3N9UC 1TUWA 4L74A 2K3KA 4HHHA 4IQMA 4NLTA 3MEKA 1ZYQA 4DCOB 1R8HA 2F4FA 3CCJS 4RBTA 4C11A 4DSIA 4OYWA 1WG1A 1FKPB 5E0OA 3AHPA 3EUNA 3NLCA 3WIVA 1G3OA 2CJYB 4CTAB 4K0KJ 1NM2A 2M8HA 3TJAA 2I5JB 2J7KA 4Q5VA 3TI0A 4Y65A 1KC8T 2D41A 4MFBA 4V19X 5HMYA 1NPKA 2ADBA 4WE1B 2M88A 2KFZA 2V69A 2DNQA 4ZCKA 5E3RA 3V81A 4X2BA 3QWPA 3V6HA 1KNZA 2GS8A 2G4BA 4LSZB 4HKQA 5KAKA 1BE4A 1U45A 5MAOA 2DR7A 1RHKB 4I64A 1P1LA 2BE7D 4NLSA 2HFOA 4OJHA 4RLEA 2YKMB 3TJ8A 5M2PA 1BXNA 3UVJA 3GONA 4LF2A 2Q6CA 1Y4ZB 5A2QU 3ZTPA 1SQEA 4IG0B 1OSDA 4OZ3A 5HL7Q 1EIYB 2GCFA 2GVDA 1S6QA 4Y34A 5A0YA 4YS2A 1K0VA 1WDTA 4I2QB 3AD8C 3GJTB 3L9ZA 3UI3A 3B4DA 2G2OA 4OI0A 2FVRA 5SUHA 2JHEA 3THTA 2XG8A 2OD6A 3HCXA 1KWMA 4P73A 1S1TB 3CGIA 1YK9A 4ZMMA 3CJQA 5GMKa 2D74B 2ALZA 1T3NA 3R7SB 2VPYB 3DLKA 2YNFB 4XIUA 5EHHA 1KOHA 1N5YB 1RAGB 4F36A 1N6QA 4M63A 3SFUA 1R6YA 3RW6A 3LH2S 4LT6A 1OS5A 3S1TA 2F7VA 2AJ1A 2BW7A 3AQPA 4I6AA 4X66F 3EM1A 3LPYA 4IR1A 4B3OB 5L1IA 3CF5Q 4K4VA 1SH3A 2YWHA 4CYUB 4M5DB 1JLGB 4MTPA 4J9RA 3FEZA 3V2UC 4KIAA 3M9OB 2PGCA 2E5GA 2LDYA 3IR6B 2JSXA 4K8RA 1N6QB 4ZVPB 1O8BA 3FSYA 4DFPA 1TKDA 3G8TA 4KQZA 1M5KC 4UOCA 2MQ8A 5L38A 1RHQB 2P9CA 1HNXJ 3A3PB 4O3PA 1WKJA 5DDQC 3BSCA 1GEHA 1G6BA 5DETA 3MMBA 2XM3A 4FS2A 2DTJA 1Z2LA 3FC9A 2QL5B 1PC5A 4HT7A 1NJYA 4FYYB 2FB0A 1WSVA 2MHEA 2VPZB 1BQMB 2XMKA 3H59A 3LAKA 2VKRA 3Q83A 1R0BG 3M8SA 2R7QA 4RO0A 4ZHRA 3C8YA 5AE1A 2MKYA 3BPSP 4X64J 1VJQA 4NA2A 1R89A 1S5ZA 2Z30B 3GG0A 4ZPBA 1HQUB 3R9LA 1RHMB 3EPIA 3IR7B 2IM0A 3DM2A 5KFYA 4USKA 3KLEA 1CULB 2RILA 1Y10A 3IM9A 5E2QA 3LP1B 2Z56B 4V1Ak 2YNHB 3G8QA 4C48A 5JUMA 5DDPC 4ED3A 3THPA 4LFCF 1BWEA 5KFAA 3ZZZA 2QO3A 3I4PA 5LOQA 5LL6d 4DG1A 3M05A 4PG5A 2QA2A 2AYGA 2J0SD 4TU8A 2XSFA 3AA9A 1D9DA 3H5XA 3M2UB 3HP6A 4DV4F 2M7SA 3NGUA 3MCNA 1VRTB 1N36J 1OIAA 5DO2A 2DCUB 5HJXA 3UW1A 3CD6S 3LP1A 5CCLA 1C4CA 4C6AA 4WK1A 3I4HX 4Y2CA 5KFOA 1BLUA 2J6TA 1B7YB 3C46A 4Y00A 2W2PP 3V5RA 2PMWA 2COLA 3OVAA 3FUYA 2K7KA 2J0WA 2JH3A 4DG1B 1X4AA 4I1TA 1X5OA 3TZYA 3HVTA 4FP9A 2DNGA 5B0CA 4DS5A 1RK8A 1X5PA 2QSFA 2MPUA 1WELA 1VRUA 4OI3A 1FXRA 4QWDA 4YMEA 4LF4F 1YSJA 4O44A 3NXZA 3BSNA 2QFJA 3IM8A 4K2XA 5CYMB 2CYYA 5ETTA 1IBLJ 1LEOA 2RHQB 4KO0B 4DZDA 4N5SA 1TKTB 1S7HA 3DN9A 4OV1A 2MGZB 3OVBA 4RUCA 3LANA 4LRFA 5AE3A 3SV3A 1RT3B 2IC3A 1Q16B 1Q8IA 3P5TL 5J2PB 2EK6A 1YTYA 4K59A 1NK9A 3NG8A 3M8RA 1WWHA 1RTJB 4ZVSB 5M2RA 4I7FA 4AL7A 2EFQA 1S97A 3NBPA 2XBPA 4ZP7A 3W61A 1R43A 1S6OA 2PEHA 2WZ1A 3IC1A 3M2RB 3UFCX 2DISA 4ENOA 1TMJA 3VAKA 2KRRA 2VG6A 2WSFC 2BA9A 2VBZA 1Y3JA 2YTCA 1RCOB 2C3YA 5IT9U 3G6ES 4RU2A 2JFDA 2VDIA 4JI2F 1F60B 3VCDA 3RR8A 1XN9A 2AWZA 1RTHB 4P7TA 4JV1A 2RRAA 2DXDA 3N6LA 3TVZA 2DGXA 3HSGA 4RL1A 5I3QA 3KHHA 2E9ZA 3RBEA 3T6BA 2DEIA 3E01A 3U02A 5B0BA 3UPFA 2VPWB 2UVWA 2HQGA 2OIHA 4ZCMA 3MFIA 3KUHA 4LF4J 2C2NA 5DG8A 4AL5A 1SVDA 3OXFA 1EKSA 4OQJA 1U1NA 2W25A 1P9QC 2V63A 4DSJA 5HQLA 2QSWA 2ZNZA 3BF4A 3I5CA 3VGVA 2RF2A 4LR7A 1NH7A 2PA3A 3RZAA 2VOPA 2BXJA 4KV8B 3UQSA 1S1XA 1OPIA 4RW9B 5CQGA 3DYAB 1CEZA 2HFNA 4YR3A 2VBXA 3D54A 2Q43A 4KHPJ 2W2OP 3MI7X 2P2CB 3IWLA 3QGHA 2OPPB 1H73A 1X4GA 1X7VA 2XZDB 2EK1A 2GQQA 4QYRA 1IKXA 2GGPB 2HZCA 3ET6B 3EXCX 5KFJA 4TQRA 2ASDA 2MSSA 4Q8EA 3BO4A 3T5KA 4MKYA 1AXQA 3DDIA 3Q8YA 4U96A 2ZZTA 4KPCA 4N56A 4LFBF 5HMWA 2OELA 2XS5A 4ZVUB 4C11B 3CW2C 1JXEA 4Q43A 3ISNC 2J6UA 1JLEA 2CJ9A 4I4BA 4QWEA 5DZ7A 1WKLA 3H4DA 3GFYA 2OFGX 4ITSA 1AFIA 2RMLA 2HGNA 2XY6A 1XNQJ 3D7SB 2X3GA 2OLWA 1U6BA 4NXMF 1FWLA 2DGWA 4WE1A 4U8YA 5KT7A 4H4OB 3KMSA 3KKFA 1CG2A 5KFRA 1ITPA 2CDRB 1FNOA 4RW4A 4TU9A 2K1RA 4RUHA 4EYIB 2NYIA 1NXIA 4WPAA 1FDAA 4F3QA 4F7VA 3D2WA 4B08A 4YB6A 4QYZJ 1YG0A 1FRXA 1XR6A 3F0NA 1D0EA 2BE2B 3OL9A 2DGSA 3C15B 1JLQA 3BN7A 3QLHB 2PI5A 1RADB 5HBMB 4FYDA 3PZPA 3QIPB 2ZDOA 3L95X 2HHHJ 1OQ3A 4UTGA 3CD0A 2HHXA 2QJ3A 2X3DA 4G6VB 3JSMA 2BKOA 2K1RB 3PYFA 1RYRA 5IT0A 2F9DA 3R5GA 1LKZA 4OYPA 1JJ2R 5C25A 1JXVA 3M2VA 1UJ5A 3QBCA 2KG1A 2DR9A 1HNWF 1HWUA 4DPXA 4DLGA 4DL6A 4TYBA 1IQTA 2Z4PA 4Q8FA 1SJ1A 4DQQA 2C2ZB 2EC2A 3W62A 1QAJA 4L76A 1MWQA 1NBEB 1S1VA 2ZBPA 5K5MA 5DLFA 1PJ6A 1OYDA 3PO5A 2XNQA 1LW2B 4F26A 4KGKA 2RU9A 1ZAWA 4K4UA 3TNVA 1LWEB 3DLEB 2HFZA 1FXLA 2WAQD 4PXEA 2DHGA 4M5DA 3G71S 4F8RA 4OZNA 4MYUA 5EDWA 3I31A 1F9EB 1FDBA 3MPVA 4YEAA 1M1KT 4F50A 3ZZPA 4ED2A 1NJIT 4KFBA 4M5IA 1U48A 2AEMA 3A13A 4PQUA 3I9ZA 2DJWA 2P8IA 4NX9A 2XHCA 3BPDA 4G1PA 3PXGa 4C0OC 1R0AA 1KVJA 4PKDB 3AY0A 3QFWA 1DAXA 5EX3A 4ZPCA 4NXNF 2DPJA 4USUA 1RWPB 1U2RA 3LPEA 4RU9A 3PFEA 4H4KA 3O6QA 5KG2A 3HM9A 2RIJA 5BJRA 3Q2SC 2UUWA 1SH2A 2X1BA 4IFVB 4MKBA 2DNZA 4ZHRB 5CAAA 5IWAJ 4B3RJ 2AJFE 3QJLA 4DV3J 1QVFR 3Q8PB 4IOAQ 4V19J 1AZSA 1V3SA 3B54A 1ZPWX 2CQHA 3SV4A 1CULA 2FY1A 4FXVA 5D15A 1WC0A 4WP3A 4CO2A 2FLPA 2GC8A 1U02A 1XMQF 1X60A 2AEFA 2WVEA 3BKUA 1YI2S 1FE0A 2RVJA 2OP5A 5T7LB 4WWSA 3WQPA 3D3BJ 1Q79A 2XMAA 1F1BB 3K5PA 3Q0AA 3BO3A 1BWVA 2UUTA 1HW9A 3NEKA 2FVPA 4O4GB 1HMVA 1NSAA 1KQFB 4A8OA 5A8KA 3DOLB 2YWFA 3BSAA 3WDOA 1XBWA 1NB7A 3MAQA 4JI3F 2L08A 3NAIA 1N52B 1L3VA 2V68A 2V2QA 2C3UA 2UXBF 1R31A 5DDRC 4KH0B 3CB4A 2IYGA 2QT7A 4NPOA 4C8ZA 2O66A 4QZVB 5T7LA 1YQHA 3MECA 3TEHB 2N82B 2R2SA 3HVRA 3EDRB 3QJJA 1VQKS 3DOMA 1IM6A 3QMQA 4JB8B 3M7VA 4ED0A 1GT8A 2Q66A 2BUNA 2CZ9A 2DYAA 5K20B 4DV2J 2ZUAA 2KDOA 2XMJA 3TVKA 4FYWB 4DR4F 4DU8A 3V81B 3H5UA 2NSBA 3H20A 3CXCR 4QWCA
chains in the Genus database with same CATH topology
2QC3A 3R8YA 3CJ8A 4QBUA 5DZ6A 1NM2A 2G2OA 1MLAA 2JFDA 3IM8A 3EZOA 3H0PA 3PTWA 4RL1A 3HHDA 2JFKA 3R97A 3SBMA 3RGIA 2H1YA 3G87A 2CUYA 3TZZA 2G2ZA 3HJVA 3BV8A 3TZXA 3QATA 3K89A 2C2NA 3TZWA 2G1HA 4RR5A 3TZYA 2QJ3A 2G2YA 3TQEA 5DZ7A 3IM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QC3 A;  3R8Y A;  3CJ8 A;  4QBU A;  5DZ6 A;  1NM2 A;  2G2O A;  1MLA A;  2JFD A;  3IM8 A;  3EZO A;  3H0P A;  3PTW A;  4RL1 A;  3HHD A;  2JFK A;  3R97 A;  3SBM A;  3RGI A;  2H1Y A;  3G87 A;  2CUY A;  3TZZ A;  2G2Z A;  3HJV A;  3BV8 A;  3TZX A;  3QAT A;  3K89 A;  2C2N A;  3TZW A;  2G1H A;  4RR5 A;  3TZY A;  2QJ3 A;  2G2Y A;  3TQE A;  5DZ7 A;  3IM9 A; 
#chains in the Genus database with same CATH topology
 2XZT B;  5HVF A;  3IXQ A;  3SXL A;  2E9T A;  4IQX A;  3M9M B;  5HMX A;  1CJK A;  2QZ8 A;  3N5B A;  2FHM A;  4FNH A;  4F4Y A;  4BC7 A;  2HVI A;  1SXL A;  1LK5 A;  4ZPV R;  2HHV A;  3BR8 A;  4OHV A;  3ILJ A;  4ALZ A;  1FFW B;  2GMH A;  3H8Y A;  2XO6 A;  3I32 A;  4DL0 C;  3CC2 S;  2NXC A;  3DOM B;  4F0H A;  4IG0 A;  3FSX A;  3AOA A;  3HHL A;  4G1Q A;  4AUK A;  1RCX B;  3BS9 A;  3TQ1 A;  3C16 B;  3UD5 A;  4DWI A;  2IM1 A;  3MMB B;  5EWF A;  1WOS A;  2UP1 A;  1N33 J;  4WF9 Q;  4NYZ A;  4F4X A;  5BR8 J;  1ZTT A;  2ZM6 J;  5CA5 A;  4JI7 F;  2EI5 A;  1S1T A;  5LJ5 Y;  3K5O A;  4PWU A;  1F9H A;  3OSP A;  1U1R A;  2OSR A;  1N5Y A;  1EAY C;  2VV5 A;  3DI6 A;  3R1L A;  1QAI A;  2VG7 B;  4FNI A;  2C2D A;  2MQL A;  1VBK A;  2XYG B;  4ZLL A;  1QM9 A;  4WJB A;  1MN7 A;  1MMD A;  3PAC A;  2G13 A;  1VS3 A;  3MM8 B;  1RI7 A;  3QWU A;  3W66 A;  5DG9 A;  2HK3 A;  2XYP B;  4J9V A;  2UU9 J;  4WZQ A;  3KLF A;  3V4I B;  1UZD A;  3BR9 A;  4NLD A;  4CLP A;  3D9B A;  1XQI A;  4OHW A;  3M1V A;  2RKI A;  1AYE A;  2KI2 A;  2MKJ A;  2OGU A;  4W98 A;  2ACM A;  2JFK A;  5KFB A;  4KKO B;  1NKE A;  3MDF A;  4DDF A;  2IVM A;  2NXU A;  1GMV A;  1RAA B;  4OYM A;  3A8I A;  2ASJ A;  3C2P A;  4Q0B A;  3M2U A;  2ZM6 F;  1H2T Z;  4JI7 J;  2VQE F;  3CJK B;  1BY9 A;  1E6V A;  1RT7 A;  4PG7 A;  3PW5 A;  4A8X A;  3MCO A;  2RD5 C;  3OTC A;  4ZP9 A;  2ADC A;  2KM8 B;  3A12 A;  3MPU B;  1RDR A;  1SUQ A;  4KV8 A;  1REV A;  3AJ2 A;  2R7T A;  1BQM A;  1L3T A;  1TQL A;  1RAI B;  3HFZ B;  1HNI B;  3J81 Y;  3BSO A;  1RXO B;  3HHE A;  1PC4 A;  2OML A;  3PYG A;  1QD1 A;  4LFC J;  3E51 A;  2KN4 A;  2DGO A;  1UJ4 A;  2KT3 A;  2RQ4 A;  3DM2 B;  1A7G E;  2HND B;  2B3T B;  1B4S A;  2A2D A;  3IRX A;  3QNW B;  3KK3 B;  2ZOF A;  4OI1 A;  3Q22 A;  1J5O A;  1R6V A;  1XJW B;  4JI4 J;  4FF4 A;  1G1X A;  2IDE A;  4LR9 A;  5DGB A;  4ELT A;  5BXI A;  2CQI A;  4JI6 J;  3OFF A;  5CH7 B;  4LF5 F;  2FJD B;  4YFU A;  1REV B;  3KNG A;  4OX6 A;  3OQ2 A;  5AE2 A;  4TY8 B;  2XCA A;  2BOP A;  4J90 A;  2DHS A;  2B8Q A;  2CQD A;  2IC3 B;  4F67 A;  1FRM A;  2KKH A;  2J6S A;  2QGF B;  2A6M A;  1NB2 A;  2Y3Y A;  3B6B A;  3LP0 A;  1RAO A;  4AND A;  1UEU A;  3F56 A;  2A6O A;  4Z37 A;  5D8H B;  4XTT A;  4XPE A;  2E5I A;  2B6A B;  2PT0 A;  3AQO A;  3PCO B;  3ULH A;  3J7A 1;  5J2N B;  1F6T A;  1IXK A;  3MM9 B;  4OIX A;  4DQR A;  2X1G A;  4LFA J;  2RH3 A;  1AW0 A;  3WIU A;  4DUT A;  2IRU A;  1RAE B;  4J9O A;  4P2X A;  3NMR A;  3HVA A;  2PMH A;  1S79 A;  1N8R T;  2WHO A;  2YKN B;  3EVW A;  1CBK A;  1TFY A;  4DCJ B;  2XMW A;  2BQ3 A;  3GMG A;  2MLX A;  4X64 F;  4KYZ A;  2BE2 A;  5E5N A;  4CLT A;  1P8G A;  3AAW B;  4EBD A;  4OZJ A;  3DNC A;  4DXL A;  1T9T A;  2R7O A;  1ZM9 A;  4NEY A;  2VFU A;  1WF2 A;  2CIM A;  2W1B A;  3NGR A;  1KOO A;  2R8H A;  3PEH A;  2KT5 A;  1EQ0 A;  2ZUG A;  4H54 A;  3CDE A;  2C2K B;  5KFI A;  4YHH J;  2NSC A;  4CH1 A;  3TWZ A;  9ATC B;  2MGZ A;  1KD1 T;  2VBW A;  1L5U A;  2YKN A;  4RWX A;  3ZTQ A;  3CPW R;  2LQB A;  3M8Y A;  2ROE A;  3KUG A;  4WIQ A;  2MZT A;  3GIM A;  2MZR A;  3G82 B;  3T1H F;  5AT1 B;  1RTJ A;  4UOF A;  4X4P A;  2QL7 B;  2FDN A;  1TAU A;  5FII A;  2KO1 A;  3W8G A;  3EZO A;  4LRD A;  2YBV A;  3BQ1 A;  4F4Z A;  4J91 A;  4FDF A;  4NLX A;  3DYA A;  3GSI A;  5U47 A;  5BYS A;  1Z4U A;  1UZH A;  4B9S A;  5KFN A;  4X4T A;  2QA4 G;  2DRB A;  2HMI A;  3GWC A;  2CFX A;  4PRF A;  1SIZ A;  3DOK B;  1CJT A;  3VAH A;  2C3M A;  1BQN B;  2DR6 A;  4LQ9 A;  4RJV A;  5THW A;  4CP5 A;  2HFS A;  1SV5 B;  5K8P A;  1SL1 A;  2QG9 B;  4NOH A;  3G82 A;  3KLG B;  1QVG R;  4MIB A;  2HHH F;  4WU3 A;  4LF7 J;  5T41 A;  4IYQ A;  3KG1 A;  1LXJ A;  5G0R A;  1U8W A;  1VHI A;  2Q3P A;  4ES1 A;  1NZA A;  2XWY A;  2HHT A;  3RU0 A;  4RNM A;  3RBZ A;  2E44 A;  1NH8 A;  4CLY A;  5LSR A;  2B8P A;  1OY9 A;  3M8P A;  4NZ7 A;  3QRP A;  4DZ6 A;  2EBG A;  4CO0 A;  1S9E A;  1CJT B;  2HBY B;  3CJ3 A;  3MCM A;  4PXC A;  4ZIW A;  5LSL A;  1FFG B;  1C1B B;  2EXU A;  3PTW A;  4O3N A;  3UR3 C;  3ETM A;  4UOG A;  3B82 A;  3MED A;  4MJK A;  3DLL Q;  2HAF A;  2D1C A;  3POT A;  2DNM A;  1RZM A;  2ZH6 A;  2A0F B;  2FTR A;  3EGZ A;  2RF2 B;  3T1H J;  4J9M A;  3R6L B;  2DO4 A;  3UNY A;  2QMU B;  3VGS A;  4JI5 F;  3HVW A;  1WOO A;  2OPS A;  4RW9 A;  1G2E A;  1NLK L;  2QMW A;  2NR0 A;  2RDI A;  4F4W A;  2W01 A;  1S6U A;  3BGL A;  2L9D A;  3QLH A;  1S9E B;  2OUG A;  2DNY A;  1JLA B;  2Z0G A;  3C66 A;  4MIA A;  2P6T A;  4WFX A;  1XK8 A;  2IIH A;  5IM0 B;  4HYK A;  2UXC J;  1TL5 A;  2D69 A;  1TL7 B;  4K5S A;  2FJW A;  3ZTO A;  3I0R A;  1KP6 A;  2QA1 A;  3JSM B;  2ZWO A;  2YNG B;  4BWM A;  2D3O 1;  2AHO B;  2WBM A;  2C22 A;  3OTD A;  3JB9 k;  2GQC A;  3WHI A;  1FRJ A;  1FEE A;  2PSZ A;  3FFI B;  4W4M A;  5A8R A;  5C25 B;  2FVS A;  2Y8W A;  3NCP A;  1S59 A;  4M5N A;  4RW8 A;  4RNF A;  2UV8 G;  2VF3 A;  2YY3 A;  2E29 A;  3UN5 A;  3CCW A;  2P5V A;  2QA4 S;  4GC6 A;  5L9X A;  4J9N A;  3CUN A;  1V9O A;  6FD1 A;  3MF5 A;  4OYO A;  3BYR A;  4AQY F;  3QRR A;  2OKQ A;  3FCH A;  1S6P B;  4Y2A A;  4EUV A;  3G96 A;  1RT6 B;  4DL3 A;  1LWE A;  3DLE A;  3N79 A;  2XMU A;  4L75 A;  1RIS A;  2CQ2 A;  2ZOM A;  3OBI A;  1ZAX A;  4NA3 A;  1VQ7 S;  2RQC A;  2GHP A;  2OFH X;  1N54 B;  3KJN B;  1BQX A;  1NDC A;  1SKR A;  2CQ0 A;  4F3O A;  4PZV A;  1D09 B;  1GX5 A;  3D0I E;  4NL5 A;  4J9Q A;  4ZS6 A;  1RWM B;  4Q44 A;  3NAH A;  1TK5 A;  1PGZ A;  4JI1 J;  4DR3 J;  5DGA A;  4DQP A;  4PQU B;  2JX2 A;  1RWV B;  2F1F A;  2WCX A;  1TUG B;  2RRN A;  1K1Q A;  2JRS A;  1YWX A;  2CNN B;  4OZ2 A;  3DRS B;  2DO0 A;  5LSO A;  1NU4 A;  2J0X A;  1GAO A;  1RT6 A;  4KR0 B;  4LRE A;  3P6Y C;  3IWN C;  4ZJL A;  3JYT A;  1T0T V;  3ADA C;  4JUZ A;  4H4K C;  4CYU A;  4X4Q A;  3VAJ A;  5LM7 E;  4IFY B;  1RT5 B;  4N47 A;  4LJM A;  2HEK A;  2DR5 A;  2MYF A;  1S49 A;  4QIG A;  2QEX S;  2H48 B;  3MD3 A;  2BJ7 A;  4Q2L A;  5DS7 A;  4IUF A;  3B78 A;  2FJE B;  2GZO A;  2KVI A;  2W4C A;  2NS1 B;  2I1R A;  1VGY A;  4YP3 A;  4M5G A;  1U26 A;  1YDL A;  1NND A;  5G4D A;  1Q5V A;  2UUA F;  2M70 A;  1M5O C;  5ETK A;  2IA6 A;  3Q2T C;  1UCN A;  2F63 A;  1BC6 A;  3I6P A;  1QSS A;  2Z2Z A;  2CPE A;  4B9M A;  1NAQ A;  1W25 A;  4JI2 J;  3ENQ A;  3SZ2 A;  4KC5 A;  3ZTS A;  3M9N B;  1KQG B;  1CJU B;  1MRO A;  4M1K A;  3NGD A;  3RJM B;  3KXD A;  1T8E A;  4O3R A;  3CIZ A;  3PIP Q;  5D3G A;  1K0T A;  1FK9 A;  2CQ3 A;  3N6N A;  4KKO A;  1Q95 G;  3UCZ P;  4NCB A;  1HQE B;  5ETL A;  2WVB A;  2G0C A;  4DU7 A;  3BH6 B;  3WX8 A;  2MLZ A;  2AV5 A;  4KGZ B;  1QJH A;  1YGY A;  2O01 C;  3PY8 A;  1I3O B;  3SSS A;  2HNY B;  4U7U D;  2GO9 A;  5KFW A;  3BKT A;  2FUG 9;  3C14 A;  2NZC A;  2E7W A;  2RSQ A;  2SXL A;  2R9L A;  2AGP A;  1VBZ A;  3Q8V A;  2JL9 A;  3KLI A;  4ECZ A;  1PO6 A;  2V67 A;  4IFV A;  3S01 A;  3TAP A;  3UDL A;  2GHV C;  4LSN A;  5A6W A;  5EN1 A;  1N48 A;  2HW3 A;  1RGV A;  2E5L F;  2AF6 A;  4CNY A;  2BAN B;  1M5V C;  2F65 A;  1RU2 A;  1JLB B;  1KBR A;  2E1R A;  4G65 A;  2XLJ A;  2Y1L B;  3GII A;  3MOZ A;  3S8S A;  4OJ1 A;  4X65 J;  2IJN A;  1J5O B;  1S1U A;  1FVS A;  1FEH A;  2WSC C;  5GAE U;  4LF5 J;  3VWS A;  4WFN Q;  3AH6 A;  4ID5 B;  3I55 S;  2NPI A;  2RS2 A;  2D3Z A;  3GYX B;  2NQP A;  3JQJ A;  5KG5 A;  4OZ1 A;  2CPD A;  3P3D A;  1FO1 A;  4PWW A;  4UQT A;  5E3A A;  2VHG A;  2HWT A;  2WW8 A;  1GFW B;  4RBU A;  2ZBQ A;  1HMV B;  2QE5 A;  1H0H B;  3MMJ A;  2CG4 A;  2Z58 B;  4D3H A;  4R25 A;  1N32 J;  4X4U A;  2DY1 A;  1GTH A;  2FLO A;  2HNZ B;  3FEY B;  3J7Z 5;  2HQD A;  3CCE S;  5H1S V;  1WEZ A;  2RQK A;  1F5C A;  1TL1 B;  2HRY A;  3DMJ B;  2VG5 A;  3PX4 A;  4ID5 A;  1TL3 B;  4IH7 A;  3W9I A;  3G9C A;  3AOC A;  3R8Y A;  1N0U A;  3PM9 A;  1W2B R;  4QR2 A;  2B9W A;  2ILY A;  4OHX A;  3GTY X;  2C2R A;  1WTB A;  5F8N A;  2CQG A;  3DFE A;  1VMB A;  5KFL A;  3TRG A;  3LOU A;  7AT1 B;  2W8K A;  3BDP A;  4DSK A;  1HLW A;  2WVD A;  3LGN A;  2QLF B;  1LXN A;  2RUG A;  1BUX A;  1YJW S;  3VV2 B;  1HHT P;  3QPI A;  3N6M A;  3H5S A;  3OTE A;  2K2P A;  3P96 A;  2ZD1 A;  3FCV A;  3W2W B;  2YPZ A;  1N5V A;  4ZN3 A;  5HVG A;  2E1M C;  3V6D A;  3OHA A;  2VG5 B;  3L4B C;  3FK4 A;  3PR5 B;  4NI2 A;  4QWA A;  1RT1 B;  3SQG A;  2VH7 A;  2ATL A;  2BKN A;  4O3S A;  3K59 A;  4UY8 T;  1Q7L B;  3OL6 A;  1WDD A;  2GIF A;  1YHQ S;  3K5M A;  2LQ8 A;  1V5V A;  5RUB A;  1FF2 A;  3F44 A;  3RAX A;  1ZTW A;  1XNQ F;  3LP2 A;  4QCL A;  2FY8 A;  3GCW P;  3DC2 A;  3C16 A;  4B3O A;  1CLF A;  3KJV B;  4B3M F;  2QFI A;  4F4K A;  3N5F A;  2RUS A;  3I5B A;  3AA8 A;  1TKX B;  4KHP F;  2BJD A;  3UN3 A;  3ZZ0 A;  3IRW P;  1C0U A;  4A4J A;  3CCR S;  2R7R A;  1RJJ A;  3J7Z T;  2XQC A;  2DGU A;  2HVD A;  4DQS A;  5C2G A;  8AT1 B;  3K8W A;  1TV6 B;  2KFN A;  4ZK7 M;  4NLY A;  4DN9 A;  3JQK A;  4MAK A;  2J0Q D;  3IRX B;  3ZZY A;  5GMD A;  1I51 B;  3THV A;  1ZBT A;  1WEY A;  2MJU A;  4D3G A;  3AJ1 A;  3FZB A;  3MM8 A;  5HMZ A;  1OYE A;  3TX8 A;  4CIO A;  1NK6 A;  2HVE A;  4YR0 A;  4FF1 A;  2W9C B;  3ZZT A;  4CNZ A;  2QLJ B;  2VFV A;  1KQS R;  1ACM B;  2PI4 A;  2LP4 A;  1C0U B;  2EFP A;  4ZP8 A;  1YJU A;  3HMJ G;  5KT3 A;  3MR6 A;  3NY0 A;  5HAT A;  2BQR A;  2MKS A;  4DR3 F;  2UUA J;  9RUB A;  2B9E A;  1GNK A;  2AJ2 A;  3LP0 B;  1SCJ B;  4OMF G;  2UUC J;  4NLP A;  4LF8 F;  4Q0B B;  3CJK A;  4S0M A;  5A8W B;  2HPU A;  2QN6 B;  1X4B A;  4PWD B;  1NCL A;  3MED B;  4RX6 A;  1FKA F;  4IRK A;  1EB0 A;  3CCT A;  1DTT A;  2KB2 A;  3MM9 A;  3MUM P;  3CCV S;  5I42 A;  2YNH A;  4HH1 A;  2QLX A;  3D1H A;  3H40 A;  4GKK F;  3D4J A;  5DM6 Q;  2V6A A;  2MEW A;  5D77 A;  4OI6 A;  1DUR A;  4USW A;  1HBO A;  3KJF B;  2EFV A;  2I6W A;  2VB6 A;  5KG7 A;  4L72 B;  1BHN A;  3FRY A;  5AJ3 J;  3FEX B;  2ZIT A;  1VQP S;  1TL7 A;  2H4W B;  2ZVI A;  1VBY A;  4R8U B;  4MT1 A;  4DBQ A;  3CCL S;  3SI8 A;  4F2R A;  2YNG A;  2GVZ A;  5IT9 Y;  2Y8Y A;  3ILI A;  3TVY A;  3FFI A;  3CMA S;  4QR1 A;  1H72 C;  1KVK A;  1LK7 A;  3DXB A;  4OFZ A;  1VQ5 S;  3R1H A;  3NGK A;  1ZM2 A;  4C3L A;  2CAD A;  4ECQ A;  4F04 B;  3RRG A;  3QYY A;  3HD2 A;  4NCG B;  4YQW A;  3BQ2 A;  3HZE A;  3Q8U A;  3BJY A;  2DNK A;  1WC1 A;  3CVK A;  4CO1 A;  4HL9 A;  5HP1 B;  2GFF A;  1B0T A;  4DUZ F;  1GTE A;  5HLF B;  3PNI A;  2VKZ G;  3CMQ A;  1Y11 A;  3OW2 R;  1X5T A;  3CDU A;  1QUV A;  1IVZ A;  1N4L A;  4OYI A;  1V5I B;  5D6G A;  4M94 A;  3PKY A;  4AYB D;  1XNR F;  3TZW A;  3P5B P;  1U0H B;  1WOR A;  2VL1 A;  3DLG A;  4I6Y A;  1KTV A;  4TY9 A;  3IBF B;  5HAO A;  3VTI A;  7FDR A;  2VQF J;  3TAQ A;  3JSY A;  3CCU S;  5KOW A;  3TUZ C;  3G4S S;  4UZB A;  4YOE A;  3B8H A;  4PAB A;  4DN0 A;  3JAM U;  2WTF A;  3DRS A;  2XLK A;  3D1Q A;  2RS8 A;  3CC4 S;  1WC5 A;  3T3F A;  2VC1 A;  1QTN B;  4X4S A;  5LXR A;  1RT4 A;  1XWL A;  3BEG B;  2AX0 A;  1WHY A;  4MK7 A;  5C42 B;  4LF7 F;  1EHW A;  1VIO A;  3CUL A;  2YVS A;  2HVZ A;  3PDN A;  4ANC A;  2W8L A;  2YX1 A;  3ELH A;  5EWG A;  2G0J A;  5E7O B;  2MQO A;  3DLG B;  2NRE A;  1J27 A;  4DV1 F;  2AD9 A;  2AGQ A;  2EWH A;  3KFW X;  2BJ8 A;  1N0V C;  2BAC A;  3DGP B;  3AOD A;  3CCM S;  4H4M A;  2JEG A;  1UVJ A;  3MOJ B;  4URQ U;  1R3N A;  1R0A B;  4DV6 F;  4GKK J;  5KFP A;  4F25 A;  1EKR A;  3H2L A;  3IG1 A;  4LSL A;  2A2C A;  2EFN A;  1RWO B;  1SKS A;  3UNG C;  4QR0 A;  3LTO A;  1SJF A;  2XEX A;  1RTD B;  1WNE A;  1UVM A;  2V5H G;  1RAH B;  4CLK A;  2QRR A;  4LBH A;  2CVI A;  3W2V B;  4B17 A;  2B5J B;  1DJ0 A;  2PE8 A;  3DOK A;  3GFZ A;  2I38 A;  2MKH A;  3NWR A;  4YB1 P;  1QTM A;  4LF8 J;  4ELU A;  3FKB A;  1S4E A;  1V3R A;  4ERD A;  1HQE A;  4N7T A;  5KFV A;  3T5H A;  2ILZ A;  3ZXW A;  3A8K A;  3VZH A;  3H2V E;  4U7U K;  3SYZ A;  5L39 A;  1LQ9 A;  1YIJ S;  1K44 A;  4PXB A;  1IKY B;  3K5N A;  4LSL B;  4DR6 J;  2M52 A;  1WG5 A;  2ZDP A;  4CTA A;  3IBC B;  4AXI A;  2VAS A;  5KFZ A;  3W2V A;  2W2M P;  1LW0 A;  1MMN A;  5LT5 A;  2HQ3 A;  2ZC4 A;  4GVB A;  1Q8L A;  4ES3 A;  1Y7P A;  3TYT A;  4A8W A;  2IM2 A;  2XYH B;  1H7W A;  4CH7 A;  2R8G A;  3HHK A;  2F5G A;  3ONQ A;  4ZVE A;  3UCU P;  3DGV A;  4F3M A;  2LQ9 A;  1T03 A;  1PBU A;  4DS4 A;  2OD4 A;  4ED8 A;  2V8D A;  3KTQ A;  4DPW A;  3VAM A;  3NGT A;  2VD3 A;  3LO3 A;  4LF1 A;  1VQL S;  2XSJ A;  5KFC A;  3LWL A;  2WRM A;  4FYX B;  2DRD A;  3LAM A;  2DBB A;  5DDO C;  4LF9 F;  2FGC A;  1WUU A;  2W7A A;  3OTB A;  1DQA A;  3O1L A;  5B0D A;  1U7L A;  2O1P A;  3T9N A;  1FJC A;  2R2R A;  1JJH A;  1B70 B;  1LFP A;  4E98 A;  5B0F A;  1R27 B;  1RWU A;  4I2Q A;  4WFB Q;  2LU1 A;  1W2I A;  1CJV B;  3I0R B;  3CIM A;  4RW4 B;  5ETR A;  3NP5 A;  2IVF B;  1H7X A;  1T03 B;  3CO9 A;  5LXY A;  4OX8 A;  1W7W A;  1UWB B;  2P9E A;  2OSQ A;  2L9W A;  5CZX A;  2BRL A;  5JVH Q;  1RT5 A;  1B64 A;  5E33 A;  4U8V A;  4RW8 B;  4WXW A;  1PBA A;  3OL7 A;  2J8S A;  3BRE A;  4NML A;  4X4O A;  3GE9 A;  1X5S A;  2A18 A;  1CS4 B;  4FKY A;  4G1I A;  5FLX U;  4U9R A;  2ZJQ Q;  2V0N A;  5E3P A;  3G86 A;  4NLR A;  2R4F A;  4PEO A;  1MG7 A;  4E8U A;  5F3Z A;  4B3T F;  1S6P A;  4GO7 X;  2CJQ A;  2V9W A;  1CVJ A;  4J9K A;  2XC9 A;  2V8G A;  3GPA A;  2JDJ A;  3QT6 A;  3TW0 A;  3W2W A;  5IXU A;  3TA2 A;  3JTO A;  1HAR A;  3HHD A;  4MYT A;  4NI2 B;  4JI4 F;  1RB0 A;  1P1T A;  3PW0 A;  2OTL S;  4GMK A;  1K8A T;  3DRR A;  1CS4 A;  3HUL A;  4E0D A;  2YWW A;  4WP9 A;  2N7C A;  2LVW A;  3M6V A;  4DR2 J;  2MZQ A;  4QPT A;  3LAL A;  1CC7 A;  5KFS A;  2MKK A;  2CQC A;  2W7O A;  5LMU J;  2CQP A;  1VK3 A;  4ZVH A;  2ASL A;  1RKJ A;  2HNY A;  4CO5 A;  3JYT B;  3LA0 A;  1KR4 A;  4UF4 A;  4JI0 F;  3KLI B;  4ZN1 A;  3W3S A;  1VYA A;  1DLO B;  2HBZ B;  4LIR A;  3H42 A;  5H9F K;  1FE4 A;  1MLA A;  2LXF A;  2HLU A;  2YNF A;  4RKU C;  1TV6 A;  1C2P A;  2YWK A;  4DX6 A;  4JBC A;  2BE9 B;  1JLB A;  4A47 A;  2VQE J;  4K4T A;  3RRH A;  4QU7 A;  2Y1R I;  3W5Y A;  1VI7 A;  1SIW B;  1FKO B;  2EG1 A;  3BGR B;  3CCZ A;  1E6V B;  2BAB A;  4CCH A;  1I6J A;  1WHW A;  5GME A;  1JKH A;  4J5O A;  2FLL A;  4DPO A;  3TEG A;  2POK A;  4NLW A;  2CPF A;  3TA1 A;  5C2C A;  2HZV A;  1SUQ B;  2AEJ A;  2EFO A;  4ICL A;  2CKW A;  2JC0 A;  3G6Y A;  1FRH A;  1MRO B;  3KYL A;  3W9H A;  1DLO A;  1Y5I B;  2BDP A;  2DD8 S;  1FK9 B;  2NYH A;  5KG0 A;  5GAE I;  1FJG J;  1TVR B;  8RUC A;  1C1C B;  4DV6 J;  1S77 D;  3EXY A;  3MAH A;  1NEE A;  4KGM A;  5BYQ A;  1AZS B;  1HNV B;  1NO8 A;  5KT4 A;  2F3J A;  2BX6 A;  2EFG A;  1FKO A;  2W4D A;  2UUB F;  1K1S A;  2YX7 A;  2YNI A;  3R7B B;  1UVN A;  3AB2 B;  2Z2L A;  5D78 A;  2BM0 A;  1XMB A;  3FDS A;  3WX4 A;  5LMN F;  3TAR A;  3SCJ E;  1A9N B;  4OLO A;  5KTQ A;  1XTZ A;  3FBF A;  5KFD A;  3MUV P;  3SIP B;  4NAS A;  3GYN A;  3O5T B;  1WC6 A;  4CWB A;  2E66 A;  4BC9 A;  3B4M A;  3J80 U;  4LSN B;  3T1Y J;  2B4O A;  3HVT B;  1IWA A;  2CJK A;  3VHQ A;  3DDK A;  3KDN A;  1X0F A;  4GKJ F;  3P8B B;  4K4Z A;  1U09 A;  3MR3 A;  2UVR A;  2R8J A;  2N3O A;  1F3F A;  2ZFH A;  3GIK A;  4DV7 J;  4FBT A;  2X1F A;  1NRK A;  2W2N P;  2V8H A;  5D4L A;  5J2N A;  2VA3 A;  3V6D B;  3K89 A;  1F0X A;  1I5O B;  4HVZ A;  3PRD A;  4W90 B;  1D9F A;  1TKT A;  2LQJ A;  1RLD A;  4DR4 J;  3Q89 A;  2VJU A;  1PIE A;  3RBX A;  3RB4 A;  5J2P A;  5ETQ A;  3EIC A;  3HI9 A;  4HAC B;  4MK8 A;  5KG6 A;  3SSR A;  2DIT A;  3NNH A;  2BYC A;  4MKA A;  4UY8 5;  5K14 A;  2DHX A;  2BV3 A;  2VU5 A;  2W2Q P;  1T9W A;  1L3U A;  1QAY A;  2CQB A;  1IJF B;  3DMJ A;  2FQQ B;  2BJ1 A;  2C28 A;  3O44 A;  4OLP A;  4C97 A;  3R5B A;  2WSE C;  1Q81 T;  1D8Z A;  4JYA F;  2Z2M A;  7FD1 A;  2J76 E;  4X4R A;  4CLS A;  2DNH A;  2HS0 A;  4B3R F;  2IDL A;  3HJF A;  2HZA A;  2NZ4 A;  2DH9 A;  2HK2 A;  1VC0 A;  1GMU A;  1RTH A;  3RBD A;  3OLB A;  4OHY A;  5J2Q A;  4USI A;  4YUD A;  5I3P A;  4NLQ A;  1AFJ A;  4L73 A;  1AT1 B;  3CJ5 A;  3KK1 B;  1XC9 A;  4CLF A;  4NXN J;  3HLU A;  5EX0 A;  3IBW A;  2ZZN A;  4NLV A;  5L1K A;  3W63 A;  3MEE B;  2ZH9 A;  1U1M A;  2FJB B;  2CDQ A;  1J5E F;  3K58 A;  1HR0 J;  2ACY A;  3IGV A;  3ZC4 A;  4LQ3 A;  1RT3 A;  3K8V A;  4P71 A;  4EK2 A;  1NJW A;  3NRB A;  1XR5 A;  1SV5 A;  2IRX A;  3W60 A;  4URG A;  3DLJ A;  1I1G A;  3KLG A;  3LP2 B;  4HHU A;  5B0G A;  3WBZ A;  1UW4 A;  3IWX A;  1WAC A;  4WK3 A;  2IAJ A;  3AOB A;  1IJE B;  4LIW A;  4AT1 B;  1MWY A;  2HLT A;  3KLF B;  4ETX A;  2BW2 A;  3GV7 B;  1KN6 A;  2DNR A;  3DRY A;  2Q79 A;  3M2R A;  3PRB A;  1FDN A;  3AXK A;  2RKI B;  3DDN A;  3P45 B;  4RW6 A;  3G8S A;  1HBO B;  1TK0 A;  4TKT A;  2JVO A;  1VFJ A;  2M9K A;  1O5J A;  1WI8 A;  1YIT S;  1N56 A;  4AL6 A;  4IH5 A;  3OVS A;  2ZH8 A;  2AJQ A;  4KH1 B;  4F0M A;  5F8L A;  2FJA B;  1IKX B;  2GGP A;  5HQM A;  5F8M A;  2MKI A;  3Q23 A;  3CJ8 A;  4FVC A;  4C8O A;  3H5Y A;  2G0I A;  2R2T A;  1HQ2 A;  1Q53 A;  1Y00 A;  2HBR B;  4FYV B;  4CT8 A;  5HN0 A;  1IBM F;  1PCA A;  3HHN B;  4K50 A;  2EG2 A;  4PG8 A;  4ZKA A;  3SCK E;  2HHU A;  4CM0 A;  2RT3 A;  4CRJ A;  4ECW A;  3DRP B;  1FCA A;  2CVE A;  1MU2 A;  3V4I A;  3D5M A;  4ZLN A;  2GJI A;  1SB6 A;  4KGX B;  4YDX A;  4NCG A;  5KFQ A;  5GAG U;  1N5Q A;  5GAH I;  1P27 B;  2HFU A;  2QV6 A;  5C7P A;  2UVV A;  3UDV A;  3PO4 A;  1GQE A;  4I68 A;  1HNW J;  2AJ0 A;  1MSW D;  1FD8 A;  2VFS A;  1YZ6 A;  3KNA A;  1IN0 A;  3AXM A;  2IVY A;  3TUI C;  4OX9 J;  3NCR A;  3D68 A;  1HBM A;  2AP6 A;  5CXT A;  1REG X;  1S1X B;  1WC4 A;  2CPI A;  1LNQ A;  1U0H A;  2QC3 A;  1TUV A;  3P49 B;  5L9N A;  3JSB A;  3LWM A;  4BBY A;  2WB4 A;  3EJM A;  4DQI A;  2MDA A;  2AKW B;  3ENA A;  3QIP A;  4ZCL A;  1ARO P;  3ET6 A;  2HIQ A;  4ZIT A;  2ZJR Q;  4A8K A;  4B9U A;  2XMT A;  4G3I A;  1GXL A;  2I0X A;  3R2C J;  2LDI A;  5JVG Q;  3QGI A;  2IHR 1;  2H3E B;  2HSE B;  3BBB A;  2NPF A;  1HWJ A;  1DZ5 A;  3TJ9 A;  1YJT A;  1IBC B;  2FC8 A;  4X4V A;  4QU6 A;  1EET B;  5HRO B;  2MKC A;  3NOC A;  4ZDN A;  3W7B A;  3CSK A;  3QGP A;  2OPQ B;  2HQI A;  5FDL A;  3FNN A;  5D0G A;  3ZFV A;  4H4M B;  4ID8 A;  1ZZN A;  5F9N A;  4EBE A;  4LFA F;  3KMQ A;  2BRK A;  2V2V A;  3V4M A;  1OMS A;  2L3M A;  2RNE A;  4Y2M A;  2OPR A;  3JAM Y;  3IS9 B;  3HT3 A;  4ED1 A;  3CCQ S;  3T5J A;  1IR1 A;  5L8R C;  3O8W A;  1UL3 A;  4NYO A;  3M4X A;  5IS2 A;  2O3D A;  4RNN A;  2ZH5 A;  4NMX A;  2R7W A;  1A0O B;  4ZCI A;  4ZVG A;  5KFG A;  1QSL A;  3GJR B;  1FTC A;  2NUU G;  3BDE A;  2H65 B;  1Q7Y T;  3R97 A;  1I94 F;  1WF1 A;  1U1L A;  3RAM A;  2E5L J;  3AD9 C;  3GR1 A;  3EX7 B;  1VR6 A;  2DR8 A;  2U1A A;  2JC1 A;  3HJV A;  1NJX A;  1UW9 A;  4EZ6 A;  5EWE A;  3L3C A;  3MM7 B;  4I0W A;  3W8P A;  1IKW A;  4K4W A;  2WON A;  2R7V A;  4PYA A;  4RR5 A;  3R2D J;  2DHH A;  4GVB B;  4Y6I A;  4LVO P;  3HSZ A;  3C6U B;  2L9N A;  3TAN A;  3HHL C;  1QAX A;  2PDA A;  2FC9 A;  4YN3 B;  3OL8 A;  4M5H A;  2ROP A;  3PJX A;  1WJ9 A;  1JJ4 A;  2C3O A;  1Q8B A;  3CTR A;  4PCQ A;  2DRA A;  2GA7 A;  4YY3 F;  2BMB A;  2FVC A;  2M3D A;  2CZV C;  2YKO A;  3IG1 B;  5T14 A;  2BEF A;  2VUG A;  1NK7 A;  3SDE B;  5AXL A;  4FVM A;  5IV3 A;  3IGN A;  1S12 A;  4ICL B;  4DOZ A;  2GIQ A;  3ISZ A;  2V4J B;  1YZ7 A;  2M5Y A;  1PSD A;  3IR5 B;  4M8L A;  4EGL A;  4O4G A;  3RB6 A;  1AB8 A;  1D8Y A;  2M8D B;  3I0S B;  3NS6 A;  2HUR A;  3LF0 A;  4JI0 J;  1WOP A;  2O67 A;  3J81 j;  3UE2 A;  1S0O A;  2CJA A;  3DOL A;  4CO4 A;  4NZ6 A;  2YNI B;  4IOB A;  3K5L A;  3CD7 A;  4ZPT R;  3R5J B;  3VGT A;  4ZPA A;  2XY7 A;  1M90 T;  4P75 A;  5ETS A;  2CPZ A;  3MUT P;  5E3C A;  2QLB B;  1LW0 B;  4ECV A;  4NCA A;  1JLA A;  1FES A;  1RAJ A;  2CQ1 A;  2FLN A;  1G7C B;  2LQ5 A;  1NDP A;  5KT2 A;  3QSI A;  4LBI A;  3MM6 B;  3FQL A;  1Y9O A;  4DL4 A;  4DR7 J;  3RRK A;  3MMC A;  2E1P A;  4Y2I A;  2MZJ A;  2YQ0 A;  2UXD J;  3QZ8 A;  2CPX A;  5DQG A;  4EU0 A;  1IM4 A;  1RHJ B;  2BM1 A;  5JMN A;  2HBQ B;  1N36 F;  4WU2 A;  3ITH A;  3CT9 A;  1VQ9 S;  4DV4 J;  1TL3 A;  3CDA A;  3TR5 A;  4ETZ A;  4YY3 J;  3DLK B;  3ZO7 A;  2ZH7 A;  2I5J A;  3A4T A;  2HS3 A;  1IBK F;  4JV2 A;  5F8H A;  1T05 A;  1OO0 B;  1HPZ B;  2FHO B;  3N0V A;  1SJQ A;  4MFB B;  4Y3C A;  4O0I A;  3Q24 A;  2ZH4 A;  3G6V A;  4JV5 J;  2UXB J;  3K2Y A;  3M6X A;  4Y28 C;  5DQI A;  1U2F A;  3GIJ A;  2DGT A;  4JI3 J;  1T02 A;  1MML A;  5KOX A;  2A10 A;  3MCS A;  4FKX A;  1O51 A;  4OV6 A;  5A8K B;  3FGV A;  2JJ4 D;  3MHY A;  4ZA1 A;  4LVN P;  4C8N A;  3UO0 A;  1K47 A;  4IDK B;  1HWI A;  2VC0 A;  4LRC A;  3NWG A;  5B0E A;  1VK8 A;  3TA0 A;  2FD2 A;  4EEY A;  1UA0 A;  2YKM A;  2HHS A;  1OPZ A;  3JSR A;  1KTQ A;  3RUB L;  5KFF A;  3CED A;  3X1L B;  4DCP B;  4C3M A;  3BGR A;  3S7R A;  1S6Q B;  5F0U A;  4ED6 A;  2JZ5 A;  1VLO A;  3H2U B;  5F0W A;  3CE8 A;  1JKH B;  4J9L A;  1SBR A;  1RWK B;  1FRI A;  4O23 A;  5ETO A;  3VAL A;  3KK1 A;  3OFG A;  3H25 A;  4QJV A;  3CCS S;  3J7A N;  1UVL A;  3OXL A;  3RG6 A;  1HYS B;  2RB7 A;  1VC6 A;  2CQ4 A;  4ZP6 A;  3J80 Y;  2H5J B;  1UTA A;  3IMQ J;  4DV0 J;  4DSF A;  2AMC B;  2AX1 A;  4K7Q A;  2OMO A;  1KLN A;  4BS2 A;  1TMM A;  2EKN A;  5A6P A;  2VIH A;  2XNR A;  3HHL B;  4G1Q B;  3NKY A;  4NLO A;  4NYP A;  4PG6 A;  4QIF A;  2GAG C;  4OX9 F;  4TVA B;  3M32 A;  3EPG A;  1RYS A;  3HPO A;  4ZVR B;  1IQZ A;  1R0C B;  2W9C A;  1URN A;  5DLG A;  2BBE A;  1H74 A;  3OR1 B;  4USH A;  5CCM A;  3VAG A;  2R7X A;  1HYS A;  1HNI A;  3D3C J;  3IO1 A;  2LKZ A;  1U0S A;  3I9V 9;  4DHV A;  4EYH B;  2MTL A;  1S99 A;  1EAR A;  1JJC B;  1UPM B;  2RRB A;  3PW2 A;  3PW4 A;  2V50 A;  1U6F A;  1EP4 A;  2OJ3 A;  1JX4 A;  4PUO A;  2HHQ A;  4WYW A;  4EMD A;  2CZ4 A;  1VRT A;  2EBE A;  3EVM A;  5AJ3 F;  2VOO A;  1F2H A;  4EFA C;  5CD4 H;  2PN6 A;  1OJ4 A;  1IBM J;  2ZBI A;  4XPC A;  3OJS A;  1NKB A;  3U7J A;  2GHW A;  4WTO B;  1FT8 A;  4N41 A;  2B0G A;  3SMZ A;  1TP7 A;  3HKW A;  1V3Z A;  2V2K A;  4CLZ A;  4DEZ A;  4X62 J;  1PAE X;  1T11 A;  1TAQ A;  2EPI A;  3OD2 A;  2EC0 A;  2HAI A;  4DR5 F;  2ZNY A;  2BAN A;  2PMZ D;  2ERR A;  2KJW A;  3C19 A;  1EP4 B;  1HNV A;  2Q1L A;  1FRL A;  3HHL D;  4DL5 A;  4KPY A;  3HD1 A;  4ILL A;  3SBM A;  5E41 A;  4Y0F A;  2DCL A;  2IA0 A;  2B7B B;  2UUC F;  2MZ1 A;  1GMW D;  2GVZ B;  1CPZ A;  3U27 A;  1WI6 A;  4KO0 A;  2MXY A;  4DI6 A;  4AXJ A;  4O4R A;  5J1N A;  4ATN A;  4ECT A;  2KYX A;  2DNO A;  3JTP A;  2BQU A;  2XMV A;  2AU0 A;  2B43 A;  4Z7Y A;  4C7Q A;  2GO8 A;  1S72 S;  1NHK L;  2J8A A;  3OFH A;  3GLJ A;  4XDD A;  4CQ1 A;  1ROF A;  4ZVF A;  5J2Q B;  1H3D A;  4P52 A;  1T9U A;  1E6Y B;  2CPY A;  1XER A;  3NBP B;  3T5L A;  1GMW A;  2LMI A;  2JLE A;  5HP1 A;  2VA2 A;  4RUA A;  3CO0 P;  5J1P A;  3KLH A;  2I2Y A;  2YXL A;  1AA1 B;  3Q8Q B;  1JNZ B;  2PII A;  1QE1 A;  2VG6 B;  4P2S A;  4CLL A;  4ECU A;  4B9V A;  2KHC A;  3R27 A;  4F2S A;  1N5S A;  2YKQ A;  4B3M J;  1L3K A;  4U7C A;  3C6T B;  1M5H A;  2GNK A;  4KRW A;  4ELV A;  3FMW A;  2Z8Q A;  3NL0 A;  5KFX A;  2GJ2 A;  3QAT A;  4LRB A;  5BYR A;  2RU3 A;  1RHU B;  2B6A A;  3E01 B;  1YVF A;  1W26 A;  4YDD B;  2R2U A;  3QT5 A;  3NS5 A;  4BDP A;  4NXM J;  1GXT A;  2W9B B;  4TXS A;  4UZC A;  1NK8 A;  1FJ7 A;  4TN2 A;  5KFU A;  3K57 A;  2FVQ A;  2ZEJ A;  2VDH A;  3D28 A;  4UOH A;  2N4D A;  4EI2 A;  4GC7 A;  3RTV A;  3ZZU A;  2LEC A;  1L3S A;  2DNP A;  2ZH2 A;  4DR1 J;  2FHJ A;  2UZA A;  2HGM A;  3C6T A;  3DCA A;  3MD1 A;  4RNH A;  1MNE A;  2B51 A;  4KBI A;  1Q1K A;  2FJV A;  1KHW A;  2RAQ A;  2YX4 A;  4QOT A;  4TQS A;  4HR2 A;  1GXU A;  1GX6 A;  2MLY A;  3RYL A;  5D0H A;  2PFD A;  3T19 A;  1K73 T;  3H90 A;  1T94 A;  1TR0 A;  5B7W A;  1HI1 A;  4AFF A;  3A3O B;  2KU7 A;  2JEI A;  2ASY A;  3PRV A;  4MKV A;  3D6F B;  3RGI A;  3U1L A;  4C9D A;  2H1Y A;  3MM7 A;  1YBA A;  4FN5 A;  4P9S A;  4EZ9 A;  1FVQ A;  1UEV A;  2FYX A;  4YB7 A;  5F9L A;  3MR5 A;  3TZX A;  3BV8 A;  4I67 A;  4RW7 B;  3LGM A;  3MMC B;  5HJY A;  1LV5 A;  1S1W A;  2XHW A;  1VQ6 S;  3K0J A;  2DH8 A;  1Q4R A;  2CWX A;  2DXF A;  1B0V A;  2K3I A;  3W5Z A;  3GV8 B;  2UXD F;  1PAU B;  2WVF A;  1S9G A;  3E3X A;  1ZPV A;  2VPX B;  1VIX A;  3F41 A;  3KLV A;  4UST A;  4U67 Q;  4ER8 A;  5K8N A;  3FBB A;  3HSJ A;  1KRP A;  1MWZ A;  1UPP A;  4XAK A;  3VR1 A;  1JLE B;  4ED5 A;  1VLY A;  4CT9 A;  3T41 A;  4NA1 A;  3KK2 B;  3PV8 A;  4JV5 F;  1S4F A;  1H2V Z;  5IC4 B;  4JV0 A;  4CDI A;  4M5J A;  4DV7 F;  1JLC B;  4USJ C;  1M5S A;  2Y0B B;  3SCI E;  5M2U A;  4QW9 A;  5A8W A;  2Y0S D;  4X65 F;  1UWA A;  1N5T A;  3D6T B;  1UVI A;  5I42 B;  4HDH A;  1ZET A;  2E5H A;  1APS A;  2B7C B;  1VQO S;  2AW0 A;  4R0E A;  1VRQ C;  2RQM A;  1IWG A;  3TAM B;  3TX0 A;  1FD2 A;  1WD6 A;  2IMO A;  1JIH A;  1FKP A;  2LLZ A;  3DRP A;  1FRK A;  3CJT A;  4LRA A;  1PYT A;  2WK4 A;  3M8P B;  3FQK A;  1JLQ B;  1KS2 A;  4JP8 A;  1O6X A;  4I69 A;  4WFZ A;  3GIL A;  2DNN A;  2R42 A;  2OPQ A;  1HW8 A;  2HQC A;  2E9R X;  3L7O A;  1C1B A;  2H9Z A;  2NUH A;  1UVK A;  2I8E A;  3HX9 A;  4Z2X A;  5F8I A;  1DTQ A;  4I2P A;  4OI4 A;  3MUR P;  4P2M A;  3POT B;  5FLX Y;  3MFH A;  3PX6 A;  2C2O B;  1SQF A;  3N01 A;  3VVT A;  6FDR A;  2H54 B;  2YQ3 A;  2ZBR A;  3FCW A;  5IV4 A;  5HQ8 A;  1FFS B;  2RE1 A;  5KT6 A;  1Y0H A;  1QDU B;  1JNR B;  3N28 A;  1F9F A;  4DJB A;  3US5 A;  3ILO A;  3MMA A;  2H5I B;  2OI2 A;  3AB4 B;  2HS4 A;  1FWK A;  3H7H B;  2CUY A;  2J9E A;  3MPW A;  1S1V B;  1X9W A;  1N33 F;  3QID A;  3HKZ D;  1LWF A;  4UW2 A;  4KJI A;  3EMT A;  5IQQ A;  5HLF A;  2F40 A;  1RT2 B;  4B9N A;  2EEY A;  2KVQ E;  1ELO A;  3FMB A;  4QPX A;  1S10 A;  4QYZ K;  4P10 A;  2JLG A;  4YR2 A;  2KFY A;  3M6W A;  5F41 A;  2ZH3 A;  4DUY J;  1PYS B;  1R8P A;  4OZ0 A;  3GFX A;  1X31 C;  1HI8 A;  1KLM A;  3MMA B;  4BHQ A;  1VCT A;  1OWX A;  3C15 A;  4DR2 F;  3DRR B;  3GV5 B;  1XIQ A;  5FDL B;  4QIE A;  2HHP A;  2X7I A;  3RB0 A;  2BJ9 A;  6AT1 B;  1MW7 A;  2KHD A;  1JMT A;  1YJV A;  1NSK L;  2XTJ P;  1Q5Y A;  2WOM A;  4HI1 A;  3SSQ A;  3W65 A;  4JI1 F;  1SJ4 P;  4J37 A;  1UP1 A;  3PKM A;  1RT4 B;  2F8M A;  5IOL A;  1RBA A;  1I94 J;  2DNL A;  3JTN A;  1CJU A;  2W9A A;  3KWM A;  4PPZ A;  3AJD A;  4DLE A;  1H98 A;  2CRL A;  1UFK A;  1ZM4 A;  1LOU A;  1VQ8 S;  2YQ1 A;  1BMQ B;  4HH0 A;  2ZOG A;  4BWJ A;  1NUE A;  5CYJ A;  1B99 A;  3CME S;  5MLC V;  5IC6 B;  3MXH P;  1IKV A;  1R8B A;  3MGJ A;  5IQ6 A;  5DRK A;  4M5M A;  4IO1 A;  2U2F A;  2E5J A;  1RTD A;  3KJQ B;  1NZ8 A;  3N4W A;  2R8I A;  2LEB A;  4JI8 J;  1SC4 B;  2C42 A;  2J9C A;  2N7Y A;  3DRX A;  2B9Y A;  3D6H B;  2XB2 D;  2MJN A;  4A8F A;  4KFB B;  3RR7 A;  1C1C A;  1FXD A;  3WC0 A;  2LXU A;  1TFW A;  3T6J A;  4DSL A;  3ILL A;  4NLU A;  4DR6 F;  4OI2 A;  1Z1Z A;  3QGG A;  5DQH A;  1S1U B;  5DM7 Q;  3ITH B;  4K4S A;  5FD1 A;  4DV3 F;  1VQM S;  1M0S A;  2K8G A;  3PJW A;  3CDW A;  3EWG A;  2BOA A;  5IWA F;  4PYD A;  3GR0 A;  3Q8S B;  3C3L A;  3QT7 A;  1S0N A;  2Y9H A;  5CYQ A;  2IY5 B;  2XGQ A;  2FZG B;  4ZVQ B;  3VGU A;  4DV5 J;  4N76 A;  2K06 A;  2FGO A;  2JNJ A;  2BJ3 A;  1RP5 A;  3UDE A;  2KL8 A;  2AIR B;  3LGH A;  3DU6 A;  1NHV A;  4KHR A;  2BJE A;  1F5A A;  2WW4 A;  3VVU A;  4ILM A;  4DR5 J;  4ZIV A;  5GAG I;  1OQ6 A;  1S0V A;  3R6G B;  3HO1 A;  1TTH B;  3NNC A;  2JWN A;  1OSC A;  5B0A A;  1SL2 A;  2LA6 A;  2HWI A;  1T9V A;  1SJR A;  2W7P A;  3MPY A;  2CNL B;  1PJ7 A;  1RLC L;  4R0J A;  1NPR A;  4HAC A;  3M30 A;  2IMW P;  1RSC A;  3BBF A;  3MM6 A;  2IPO B;  2Y1I A;  1UA1 A;  1CJV A;  2VFR A;  4HT5 A;  1FX2 A;  5H9F J;  1X9M A;  2HHW A;  5K14 B;  1ZS6 A;  3W1Y C;  2QX0 A;  3QZ7 A;  1SC6 A;  3PW7 A;  1R8C A;  3M8W A;  3BGO P;  2LXI A;  5CYM A;  1SH0 A;  1XMO F;  1QE1 B;  1HIY A;  3MTK A;  5A76 A;  3PIO Q;  4Q2M A;  4B9T A;  3MEC B;  3OSN A;  3EZ5 A;  1S9F A;  5ETN A;  2LEA A;  2O5D A;  3EGN A;  2C2M B;  4DX7 A;  3CJ2 A;  1UEK A;  3DLH A;  3UN2 A;  4KSE B;  4DV1 J;  2APO A;  2GVD B;  3T9Z A;  3HFV A;  5A0Y B;  4JYA J;  3QAU A;  4R5P B;  3CJR A;  2QTW A;  3KG4 A;  3QT8 A;  1TK8 A;  2HNZ A;  1ZH5 A;  2FPH X;  2Y1J A;  3ZNJ 1;  4WZM A;  1TL1 A;  2PD1 A;  3BYP A;  1D9A A;  1U2C A;  2ATC B;  4HHJ A;  2W9B A;  4MIW A;  5D0R A;  4TYA A;  4PUO B;  1HD1 A;  2UVU A;  2OEM A;  3G6X A;  4TU7 A;  3M8Q A;  3R5D A;  2EVZ A;  4DUZ J;  1U1K A;  4CM2 A;  5I4M A;  4Z7C A;  3BM7 A;  1H38 A;  2CAJ A;  3TUP A;  3X3U A;  4CZC A;  1WTF A;  4ZJQ A;  1RKI A;  3D0G E;  4UT4 A;  3SCL E;  3W9J A;  1X9S A;  1IR0 A;  2LU2 A;  2UV8 A;  2ZVS A;  3OTO J;  4RWW A;  2HWH A;  4JI8 F;  4L6V 3;  4F0K A;  1WSR A;  3EGW B;  2RDJ A;  4PG4 A;  4DF8 A;  3EE3 A;  1FHT A;  2XWX A;  1JB0 C;  4OYB A;  5HK4 A;  1EZZ B;  2HG4 A;  5B09 A;  2HND A;  3GIR A;  2VG7 A;  3JQM A;  1S1W B;  1YRU A;  3F73 A;  2KZM A;  4LFB J;  3MR7 A;  1YBU A;  1WHV A;  1S48 A;  4LF6 J;  5F3T A;  2XY5 A;  1ULR A;  2AZ1 A;  3M32 B;  2LEP A;  3HXM A;  3PJ9 A;  1M5P C;  3KJV A;  2E7V A;  2G1H A;  4FXW A;  4ZLJ A;  5HVH A;  1FNX H;  1AUS L;  4NLG A;  2NLW A;  1RWW B;  2JLF A;  1YKW A;  2PC6 A;  2G2Y A;  5I3U B;  4GKJ J;  5L1J A;  2HRU A;  1MU2 B;  3M6U A;  2HKE A;  2A1B A;  2D7S A;  3QSY B;  4FF2 A;  3NNA A;  3E8O A;  1S7I A;  3MEG B;  2XZW A;  2OPP A;  3KUE A;  4AD6 A;  3E2E A;  1QLN A;  2DK2 A;  5J2M A;  1QUP A;  2KXN B;  1RT7 B;  2DXE A;  2UUB J;  4C0B A;  3LQV A;  4C8K A;  1HBM B;  2NXJ A;  3AD7 C;  1YRT A;  2Z57 B;  4KY3 A;  4DUY F;  3O2I A;  1IBK J;  1UET A;  2CA9 A;  5ADZ A;  2MQN A;  2EW9 A;  5HSP A;  4XO0 A;  3ENV A;  3MEG A;  3BB5 A;  1ZM3 A;  3R5A A;  2A3J A;  4EWT A;  4FBU A;  1S0M A;  4DV5 F;  3OUY A;  1VQN S;  1U6Z A;  3DU5 A;  2DT9 A;  3EZU A;  4PWD A;  2CNK B;  5LMN J;  1NDK A;  1X4E A;  1WKK A;  1X4H A;  2HGL A;  2RHS B;  2ZHO A;  2E7X A;  2J5A A;  1CC8 A;  1HWL A;  1SPB P;  2D9O A;  1Q8K A;  3GSD A;  1KVI A;  4IG3 A;  2YWG A;  4MK9 A;  3CJS A;  4Q7A A;  5B08 A;  4WP8 A;  3I56 S;  3FSI A;  2ALY B;  3I87 A;  2XS7 A;  2R8K A;  1FJG F;  3L7U A;  3J7Y I;  1FJE B;  2KXH A;  4A8Q A;  2XS2 A;  1C4A A;  3EVO A;  3OJU A;  1Y5N B;  1HBN A;  3OUY B;  1E6Y A;  1SC1 B;  2C1E B;  2XI2 A;  5LMU F;  4KHM A;  4ED7 A;  2OEJ A;  1LWF B;  1V6H A;  4ANE A;  5IZH A;  2CG8 A;  4PAA A;  1RTZ A;  3OHB A;  1NKC A;  2IFX A;  1CSJ A;  4C3K A;  1NDL A;  1RT2 A;  2OAU A;  5CZV A;  1NSP A;  2V8V A;  4B3S F;  1JLF B;  4OJG A;  4C8L A;  1RWN B;  4RW7 A;  4P6Q A;  2QL9 B;  5C5J A;  5KT5 A;  3HZG A;  5F8J A;  2FZK B;  1D3W A;  3BGU A;  1RBO B;  5LJ3 Y;  1T95 A;  1TEL A;  3BN4 A;  5GVQ A;  2LA4 A;  2ZWP A;  3ZZR A;  1PG5 B;  1OY6 A;  3MAA B;  8ATC B;  4USV A;  1S9G B;  2LFV A;  2ZKT A;  3DLB A;  2BVZ A;  3T1A A;  5ITH A;  2B4U A;  1EX8 A;  2NCK L;  1PYO B;  2V9K A;  2ZC3 A;  3IA0 A;  3MEE A;  3Q86 A;  2ZJP Q;  3V6J A;  4JI6 F;  3KDO A;  4DX8 H;  1SC3 B;  1X4F A;  3O3L A;  3VZI A;  2RDD A;  4WII A;  2MY8 A;  4C8M A;  2YWE A;  3G2X A;  1C0T A;  3RB3 A;  2GQ2 A;  1JLC A;  4IRD A;  1DQ8 A;  3PVX A;  1VC5 A;  1UKU A;  2AZ3 A;  3CJ0 A;  3QQC D;  3BZQ A;  2CJB A;  2ABY A;  5DG7 A;  1Q86 T;  1P9Y A;  2IAJ B;  4U6P A;  1FWP A;  5CHC B;  1IKV B;  4JOU A;  1R8A A;  3W64 A;  1IKY A;  3TAM A;  4CI0 B;  2OPS B;  2W4P A;  4UUX A;  1SKW A;  3TP2 A;  1ZAV A;  3AFG A;  4ILR A;  3SDE A;  2BKP A;  1SQG A;  1XR7 A;  4N8O A;  1NSQ A;  5C42 A;  3Q8R B;  1RE1 B;  3JXO A;  1KQK A;  1C0T B;  4KTQ A;  3FBC A;  1KHV A;  2ZE2 A;  1BQN A;  3FZ2 A;  4MH8 A;  1B7F A;  4URS A;  3D0H E;  5A2Q Y;  4ECY A;  4QQB A;  1T9Y A;  4USM A;  2D3U A;  2DIU A;  1NJZ A;  2N4C A;  3MM5 A;  1T9X A;  5KFT A;  2D9P A;  4OYA A;  1SL0 A;  5KFE A;  1WHX A;  4N8N A;  3IP0 A;  5GAD I;  2H51 B;  4QIV A;  4TLQ A;  3TO8 A;  1U1P A;  4RBV A;  2DH7 A;  1LWC A;  2YH1 A;  2CPJ A;  1HHS A;  2P6S A;  4BCA A;  4OZ5 A;  2BR0 A;  3KG0 A;  1XMQ J;  4NE9 C;  2MY7 A;  5D0E A;  2AYB A;  1F2G A;  3ENW A;  3OV7 A;  1H6K X;  3GQC A;  1VIS A;  4ZVT B;  2GW8 A;  3PHE A;  2ZHA A;  4DL7 A;  1NPP A;  4O3Q A;  4HLB A;  5BR8 F;  4O3O A;  2VBY A;  2VFT A;  2PA8 D;  1FTR A;  1MN9 A;  4HTI A;  2QYG A;  2WBR A;  2GIR A;  4I56 A;  1U4B A;  4ECR A;  5EUH A;  1NK0 A;  1F3V A;  1X8D A;  4PPD A;  1JWW A;  2NXN A;  3UD3 P;  4RNO A;  1BD6 A;  2L48 A;  1HWK A;  2E1A A;  4C4W A;  1QY7 A;  4J9S A;  3GJQ B;  4F02 A;  3RW7 A;  3M30 B;  4H4O A;  1FNM A;  2B56 A;  3FBE A;  1WEX A;  4RW6 B;  2IRY A;  3GP9 A;  1NK4 A;  5A8R B;  1RQ0 A;  2OEK A;  2K7J A;  1ICE B;  5J1E B;  4RUB A;  4ZPW R;  4DFJ A;  1CJK B;  4ZJO A;  2FHJ D;  1KEK A;  4X4N A;  1DHM A;  3ETO A;  2Z2Y B;  1IUJ A;  5HBM A;  5E3Q A;  4WKY A;  3DHW C;  4KT0 C;  2QYC A;  4O0N A;  3PYE A;  1Y5L B;  4KGV B;  4LR8 A;  1NK5 A;  4GO5 X;  4CLW A;  5JXS A;  4RPF A;  4LF6 F;  1UWB A;  2PO4 A;  2VON A;  2F8E X;  4ECS A;  4CO3 A;  5J1E A;  3VQT A;  5CD4 A;  3ICL A;  3OLA A;  4OX7 A;  2AJ4 A;  4ZPD A;  4Y2K A;  1VBX A;  4DL2 A;  1O0P A;  3DI6 B;  1URR A;  3PR4 A;  4IOC Q;  5IFM A;  3OTO F;  2P9G A;  4NZ0 A;  1FA0 A;  3GG1 A;  1FI4 A;  3OR2 B;  3RAQ A;  4WBF A;  2WOM B;  3P4U B;  4M5K A;  4J9U E;  4DPY A;  3BH7 B;  2V2Z A;  4K2J A;  4HI2 A;  2F9J A;  2KZZ A;  2DVI A;  4J7C A;  3K17 A;  3L7P A;  3OR1 A;  3D6M B;  5CYQ B;  3D67 A;  1R7I A;  2AYE A;  3M1V B;  3J81 U;  1HR0 F;  3HT0 A;  3M8Z A;  4AQY J;  1UFL A;  2XUL A;  1HD0 A;  1J5E J;  2VQF F;  4K0K F;  1TVR A;  3WC2 A;  1HKA A;  1VQY A;  1HQU A;  1VJW A;  2V94 A;  2F4V F;  4WFY A;  1HNZ F;  3KLE B;  2FZC B;  4QW8 A;  1Y3K A;  1VDH A;  2ZZM A;  4PR6 A;  3CC7 S;  1VQS A;  3OXG A;  2MST A;  5KFK A;  3QAE A;  4DV0 F;  3PEJ A;  3R5C A;  4ZLP A;  1N88 A;  2DY9 A;  3VAI A;  1HNZ J;  2G2Z A;  2VZ9 A;  4XDC A;  3VAF A;  1JLG A;  2KYZ A;  3QO9 A;  1NME B;  2V4J A;  4A48 A;  3MWB A;  5D3G B;  3KHR A;  2IYI A;  1U25 A;  2EKY A;  3I0S A;  3TQE A;  4CH0 S;  5IT4 A;  2UXC F;  3GZ7 A;  4NWB A;  3L09 A;  1XMO J;  3KK3 A;  4WKR A;  4QBU A;  1S76 D;  1X4C A;  5J2M B;  2HIY A;  1EQM A;  5DZ6 A;  5KG3 A;  1FDD A;  2DGV A;  2NXE A;  3DHX A;  2ZBC A;  2DB1 A;  3NMA A;  4M5L A;  1UMJ A;  3T1Y F;  4FS1 A;  1RA7 A;  3PYD A;  4WFA Q;  1JXL A;  3C14 B;  3JS9 A;  1J2V A;  5K8O A;  4TY8 A;  4A46 A;  1PKU A;  2IJF A;  2YPY A;  3NCQ A;  3R3T A;  5K8M A;  4KE5 A;  3PHT A;  1DBD A;  4A8Y A;  2QLW A;  4PXD A;  3SEO A;  4DF4 A;  1VRU B;  4OL8 A;  3BKF A;  3WZ0 A;  4R5P A;  2DKO B;  1IR2 A;  3NS7 B;  3TUJ C;  5EGY A;  4X62 F;  1HBU A;  2H4Y B;  3D66 A;  2D3O R;  2R7S A;  2CJX B;  4A8M P;  3UR0 A;  2XLI A;  5ETV A;  3VF0 B;  3UDC A;  3SQG B;  4IG3 B;  3UVJ B;  1RAB B;  5KFM A;  1P6T A;  1RAC B;  1RHR B;  3HDS A;  3QFH A;  1HPZ A;  1T05 B;  4FF3 A;  1D1U A;  2LYV A;  3OT9 A;  3M8Q B;  1U1O A;  1RA6 A;  3HFK A;  2AQ4 A;  3SFG A;  1HHQ A;  1FX4 A;  4IO9 Q;  2J7W A;  2DHA A;  4DR7 F;  1HL6 A;  1PIL A;  2OO4 A;  1TZ0 A;  2C3P A;  2HQF A;  3D1O A;  4DX5 A;  4YHH F;  2XMM A;  2PEB A;  1YBT A;  2IBK A;  3KOA A;  4DMZ A;  4OHZ A;  5AXM A;  2B9X A;  1HBU B;  4IH6 A;  1RBL A;  5SZT A;  2VIC A;  4DFM A;  1U49 A;  2B4P A;  1TKX A;  3MR2 A;  1KFS A;  4IDK A;  2GV1 A;  5L46 A;  3EGV A;  2FJX A;  2MQM A;  3OFE A;  1DRZ A;  4ZOS A;  2KT2 A;  2YH0 A;  3S6E A;  3ISN D;  1DAR A;  2V4R A;  5F8G A;  1HI0 P;  1RAF B;  1Q78 A;  3GFH A;  4HEA 9;  5H9E K;  1Q0N A;  1U24 A;  2XI3 A;  4W92 B;  1HFE L;  2MZS A;  1Q82 T;  1VQ4 S;  2CPH A;  4UUW A;  4O44 B;  4ECX A;  1X4D A;  2MMY A;  1TU0 B;  1JK9 B;  2G1D A;  2WB1 D;  2KXF A;  1OY8 A;  2ZD1 B;  3ZTR A;  4TLR A;  3J7Y U;  1UJ6 A;  4J9P A;  1H2U X;  5I3U A;  2MB0 B;  1YX2 A;  1RT1 A;  3UWT A;  1RUS A;  1IBL F;  4LMZ A;  1KDN A;  1YJ9 S;  3KHL A;  1SI9 A;  4XK8 C;  1N34 F;  1TKZ A;  2V34 A;  2KH9 A;  3FJ2 A;  2X1A A;  2KJV A;  4K5R A;  2VOD A;  1UAW A;  4UQG A;  1ZOT A;  3MPD A;  3EDQ B;  3CJ4 A;  4I7F B;  2H5E A;  1UFW A;  4B02 A;  3TZZ A;  3FRZ A;  5CAB A;  3GCX P;  2XO7 A;  4GVL A;  4PQA A;  3H4B A;  4WTY A;  5JJB A;  1QSY A;  4I6W A;  1BGX T;  3GB0 A;  3KK2 A;  4K4Y A;  3A8J A;  2DPI A;  1U8S A;  4DPU A;  1LFW A;  1KON A;  3A8E A;  1GH8 A;  5HAN A;  4CLU A;  3KHG A;  1YRX A;  1TKZ B;  1A6L A;  2GML A;  2X51 A;  4OYX A;  3CD5 A;  4QIW D;  4DFK A;  3ZZO A;  5AXK A;  2MHN A;  2AYM A;  3PFO A;  5DJB A;  1JQG A;  2J7U A;  4ED4 A;  4B3T J;  2IJR A;  3BQ0 A;  1N34 J;  2RJZ A;  3V6K A;  3H0P A;  3NOG A;  4EO6 A;  1N32 F;  3MTJ A;  4FZV A;  4TNO A;  3SQO P;  1XEZ A;  2FHK A;  1DY3 A;  4C98 A;  2IBO A;  3H98 A;  4C8Y A;  1U47 A;  3IN5 A;  3DKD A;  4P7V A;  5K9F A;  3IAS 9;  1HBN B;  2AT1 B;  2BZ2 A;  3NGS A;  5IM0 A;  2L41 A;  1ZA2 B;  1U1Q A;  2GAH C;  4P72 A;  3PG9 A;  1DTQ B;  4I2P B;  3CDB A;  4LUB A;  4F4A A;  3DXS X;  1DTT B;  1YLX A;  4OZL A;  3TOQ A;  5FJ4 A;  3I82 A;  2GMJ A;  2ZKU A;  1YJR A;  5ETP A;  5D4N A;  1X0P A;  1FER A;  2DGQ A;  5ETM A;  5AXN A;  2XGP A;  2KRB A;  3IFE A;  4KAI A;  4LF9 J;  1YJN S;  1EET A;  3A3N B;  4L3N A;  5HRO A;  2HYI B;  3I5A A;  1ZA1 B;  3UD4 P;  4KB7 A;  2E1C A;  4B3S J;  1T3O A;  2PFF B;  4A8S A;  3ZNU A;  3EYZ A;  4B9L A;  2HRT A;  5GAD U;  1RU1 A;  2GX8 A;  3GU0 A;  4R8U A;  4RZR A;  4LBP A;  4NEZ A;  3KLH B;  1KKH A;  1RWX B;  1ZZF A;  1WF0 A;  2OH2 A;  1K9M T;  1B3T A;  2UU9 F;  3AT1 B;  3G87 A;  3IS9 A;  2W24 A;  3BGF A;  5D4P A;  4WXO A;  3M2V B;  1SJ3 P;  3W5X A;  1G4C A;  4EO8 A;  1KSP A;  1KLM B;  3QJP A;  4BLG A;  4ZVO B;  1T7P A;  1F5B A;  5KG1 A;  4FPI A;  2AGO A;  4K4X A;  4FXD A;  2QMX A;  4X66 J;  3LW5 C;  2G9O A;  1CQM A;  4N77 A;  2V8P A;  3DGP A;  4HDG A;  4HTJ A;  3QRQ A;  2DEJ A;  3GJS B;  3K7R A;  4M95 A;  2KTQ A;  2HFV A;  1DFD A;  1EJ7 L;  1LW2 A;  2N3L A;  2I9S A;  1WC3 A;  2J9D E;  2F8H A;  3MZI A;  4IKA A;  3HF5 A;  3UCG A;  2J9D A;  2CWK A;  3VQS A;  2ZHB A;  1NHU A;  5H9E J;  2YKP A;  2DIV A;  2KM8 C;  2FIU A;  2WON B;  2KG0 A;  2HVH A;  1JLF A;  2B5J A;  4IFY A;  4MMO A;  5KG4 A;  3FVY A;  3U1M A;  2MQQ A;  4DV2 F;  2JOQ A;  1S57 A;  2ZE2 B;  4IR9 A;  1DQ9 A;  1HA1 A;  3C6U A;  1PJ5 A;  1AUD A;  4DSE A;  5D4O A;  3OPK A;  4P2F A;  2WVC A;  1WG4 A;  3BBC A;  4WYL A;  3MAA A;  2MQP A;  2LCW A;  4WCE Q;  4IRC A;  2F4V J;  2R7U A;  1RTI A;  2OHD A;  3R7N B;  4GRS A;  3I96 A;  3MM5 B;  2JVR A;  4E2F B;  4FPR A;  4C2M A;  2C2E A;  3OR2 A;  4NRU A;  2M2B A;  2YKA A;  2ZH1 A;  1M1G A;  4OJ3 A;  2IM3 A;  2M0G B;  4OYZ A;  4AE5 A;  2JEJ A;  4ES2 A;  2HMI B;  1XNR J;  1SKU B;  4DR1 F;  3U1N A;  1LWC B;  1TL4 A;  2OPR B;  4L3K A;  5C24 A;  5GAH U;  4QWB A;  3CNQ P;  1VHF A;  1B0P A;  4X84 A;  3GYG A;  2OTJ S;  1VOM A;  1RTI B;  1YJ7 A;  5G0R B;  5L1L A;  4Q45 A;  3HSD A;  2ROG A;  3IAM 9;  4YB5 A;  3CWJ A;  5KFH A;  2VJV A;  3BO2 A;  2QIF A;  2CXE A;  4NRT A;  1M1H A;  2XCP A;  2XSJ B;  4P74 A;  4DPT A;  2V4Q A;  1HNX F;  2Q6B A;  3LUY A;  1CQN A;  1GK8 A;  1IKW B;  2CNO B;  5HO4 A;  3HK2 A;  4EBC A;  3QO9 B;  1KFD A;  2M4M A;  5C24 B;  2R3V A;  4U95 A;  3PX0 A;  3A1Y G;  1LWX A;  2B4V A;  5HI7 A;  2GJF A;  4C0H A;  1Z2Z A;  2JEF A;  4JI5 J;  3N9U C;  1TUW A;  4L74 A;  2K3K A;  4HHH A;  4IQM A;  4NLT A;  3MEK A;  1ZYQ A;  4DCO B;  1R8H A;  2F4F A;  3CCJ S;  4RBT A;  4C11 A;  4DSI A;  4OYW A;  1WG1 A;  1FKP B;  5E0O A;  3AHP A;  3EUN A;  3NLC A;  3WIV A;  1G3O A;  2CJY B;  4CTA B;  4K0K J;  1NM2 A;  2M8H A;  3TJA A;  2I5J B;  2J7K A;  4Q5V A;  3TI0 A;  4Y65 A;  1KC8 T;  2D41 A;  4MFB A;  4V19 X;  5HMY A;  1NPK A;  2ADB A;  4WE1 B;  2M88 A;  2KFZ A;  2V69 A;  2DNQ A;  4ZCK A;  5E3R A;  3V81 A;  4X2B A;  3QWP A;  3V6H A;  1KNZ A;  2GS8 A;  2G4B A;  4LSZ B;  4HKQ A;  5KAK A;  1BE4 A;  1U45 A;  5MAO A;  2DR7 A;  1RHK B;  4I64 A;  1P1L A;  2BE7 D;  4NLS A;  2HFO A;  4OJH A;  4RLE A;  2YKM B;  3TJ8 A;  5M2P A;  1BXN A;  3UVJ A;  3GON A;  4LF2 A;  2Q6C A;  1Y4Z B;  5A2Q U;  3ZTP A;  1SQE A;  4IG0 B;  1OSD A;  4OZ3 A;  5HL7 Q;  1EIY B;  2GCF A;  2GVD A;  1S6Q A;  4Y34 A;  5A0Y A;  4YS2 A;  1K0V A;  1WDT A;  4I2Q B;  3AD8 C;  3GJT B;  3L9Z A;  3UI3 A;  3B4D A;  2G2O A;  4OI0 A;  2FVR A;  5SUH A;  2JHE A;  3THT A;  2XG8 A;  2OD6 A;  3HCX A;  1KWM A;  4P73 A;  1S1T B;  3CGI A;  1YK9 A;  4ZMM A;  3CJQ A;  5GMK a;  2D74 B;  2ALZ A;  1T3N A;  3R7S B;  2VPY B;  3DLK A;  2YNF B;  4XIU A;  5EHH A;  1KOH A;  1N5Y B;  1RAG B;  4F36 A;  1N6Q A;  4M63 A;  3SFU A;  1R6Y A;  3RW6 A;  3LH2 S;  4LT6 A;  1OS5 A;  3S1T A;  2F7V A;  2AJ1 A;  2BW7 A;  3AQP A;  4I6A A;  4X66 F;  3EM1 A;  3LPY A;  4IR1 A;  4B3O B;  5L1I A;  3CF5 Q;  4K4V A;  1SH3 A;  2YWH A;  4CYU B;  4M5D B;  1JLG B;  4MTP A;  4J9R A;  3FEZ A;  3V2U C;  4KIA A;  3M9O B;  2PGC A;  2E5G A;  2LDY A;  3IR6 B;  2JSX A;  4K8R A;  1N6Q B;  4ZVP B;  1O8B A;  3FSY A;  4DFP A;  1TKD A;  3G8T A;  4KQZ A;  1M5K C;  4UOC A;  2MQ8 A;  5L38 A;  1RHQ B;  2P9C A;  1HNX J;  3A3P B;  4O3P A;  1WKJ A;  5DDQ C;  3BSC A;  1GEH A;  1G6B A;  5DET A;  3MMB A;  2XM3 A;  4FS2 A;  2DTJ A;  1Z2L A;  3FC9 A;  2QL5 B;  1PC5 A;  4HT7 A;  1NJY A;  4FYY B;  2FB0 A;  1WSV A;  2MHE A;  2VPZ B;  1BQM B;  2XMK A;  3H59 A;  3LAK A;  2VKR A;  3Q83 A;  1R0B G;  3M8S A;  2R7Q A;  4RO0 A;  4ZHR A;  3C8Y A;  5AE1 A;  2MKY A;  3BPS P;  4X64 J;  1VJQ A;  4NA2 A;  1R89 A;  1S5Z A;  2Z30 B;  3GG0 A;  4ZPB A;  1HQU B;  3R9L A;  1RHM B;  3EPI A;  3IR7 B;  2IM0 A;  3DM2 A;  5KFY A;  4USK A;  3KLE A;  1CUL B;  2RIL A;  1Y10 A;  3IM9 A;  5E2Q A;  3LP1 B;  2Z56 B;  4V1A k;  2YNH B;  3G8Q A;  4C48 A;  5JUM A;  5DDP C;  4ED3 A;  3THP A;  4LFC F;  1BWE A;  5KFA A;  3ZZZ A;  2QO3 A;  3I4P A;  5LOQ A;  5LL6 d;  4DG1 A;  3M05 A;  4PG5 A;  2QA2 A;  2AYG A;  2J0S D;  4TU8 A;  2XSF A;  3AA9 A;  1D9D A;  3H5X A;  3M2U B;  3HP6 A;  4DV4 F;  2M7S A;  3NGU A;  3MCN A;  1VRT B;  1N36 J;  1OIA A;  5DO2 A;  2DCU B;  5HJX A;  3UW1 A;  3CD6 S;  3LP1 A;  5CCL A;  1C4C A;  4C6A A;  4WK1 A;  3I4H X;  4Y2C A;  5KFO A;  1BLU A;  2J6T A;  1B7Y B;  3C46 A;  4Y00 A;  2W2P P;  3V5R A;  2PMW A;  2COL A;  3OVA A;  3FUY A;  2K7K A;  2J0W A;  2JH3 A;  4DG1 B;  1X4A A;  4I1T A;  1X5O A;  3TZY A;  3HVT A;  4FP9 A;  2DNG A;  5B0C A;  4DS5 A;  1RK8 A;  1X5P A;  2QSF A;  2MPU A;  1WEL A;  1VRU A;  4OI3 A;  1FXR A;  4QWD A;  4YME A;  4LF4 F;  1YSJ A;  4O44 A;  3NXZ A;  3BSN A;  2QFJ A;  3IM8 A;  4K2X A;  5CYM B;  2CYY A;  5ETT A;  1IBL J;  1LEO A;  2RHQ B;  4KO0 B;  4DZD A;  4N5S A;  1TKT B;  1S7H A;  3DN9 A;  4OV1 A;  2MGZ B;  3OVB A;  4RUC A;  3LAN A;  4LRF A;  5AE3 A;  3SV3 A;  1RT3 B;  2IC3 A;  1Q16 B;  1Q8I A;  3P5T L;  5J2P B;  2EK6 A;  1YTY A;  4K59 A;  1NK9 A;  3NG8 A;  3M8R A;  1WWH A;  1RTJ B;  4ZVS B;  5M2R A;  4I7F A;  4AL7 A;  2EFQ A;  1S97 A;  3NBP A;  2XBP A;  4ZP7 A;  3W61 A;  1R43 A;  1S6O A;  2PEH A;  2WZ1 A;  3IC1 A;  3M2R B;  3UFC X;  2DIS A;  4ENO A;  1TMJ A;  3VAK A;  2KRR A;  2VG6 A;  2WSF C;  2BA9 A;  2VBZ A;  1Y3J A;  2YTC A;  1RCO B;  2C3Y A;  5IT9 U;  3G6E S;  4RU2 A;  2JFD A;  2VDI A;  4JI2 F;  1F60 B;  3VCD A;  3RR8 A;  1XN9 A;  2AWZ A;  1RTH B;  4P7T A;  4JV1 A;  2RRA A;  2DXD A;  3N6L A;  3TVZ A;  2DGX A;  3HSG A;  4RL1 A;  5I3Q A;  3KHH A;  2E9Z A;  3RBE A;  3T6B A;  2DEI A;  3E01 A;  3U02 A;  5B0B A;  3UPF A;  2VPW B;  2UVW A;  2HQG A;  2OIH A;  4ZCM A;  3MFI A;  3KUH A;  4LF4 J;  2C2N A;  5DG8 A;  4AL5 A;  1SVD A;  3OXF A;  1EKS A;  4OQJ A;  1U1N A;  2W25 A;  1P9Q C;  2V63 A;  4DSJ A;  5HQL A;  2QSW A;  2ZNZ A;  3BF4 A;  3I5C A;  3VGV A;  2RF2 A;  4LR7 A;  1NH7 A;  2PA3 A;  3RZA A;  2VOP A;  2BXJ A;  4KV8 B;  3UQS A;  1S1X A;  1OPI A;  4RW9 B;  5CQG A;  3DYA B;  1CEZ A;  2HFN A;  4YR3 A;  2VBX A;  3D54 A;  2Q43 A;  4KHP J;  2W2O P;  3MI7 X;  2P2C B;  3IWL A;  3QGH A;  2OPP B;  1H73 A;  1X4G A;  1X7V A;  2XZD B;  2EK1 A;  2GQQ A;  4QYR A;  1IKX A;  2GGP B;  2HZC A;  3ET6 B;  3EXC X;  5KFJ A;  4TQR A;  2ASD A;  2MSS A;  4Q8E A;  3BO4 A;  3T5K A;  4MKY A;  1AXQ A;  3DDI A;  3Q8Y A;  4U96 A;  2ZZT A;  4KPC A;  4N56 A;  4LFB F;  5HMW A;  2OEL A;  2XS5 A;  4ZVU B;  4C11 B;  3CW2 C;  1JXE A;  4Q43 A;  3ISN C;  2J6U A;  1JLE A;  2CJ9 A;  4I4B A;  4QWE A;  5DZ7 A;  1WKL A;  3H4D A;  3GFY A;  2OFG X;  4ITS A;  1AFI A;  2RML A;  2HGN A;  2XY6 A;  1XNQ J;  3D7S B;  2X3G A;  2OLW A;  1U6B A;  4NXM F;  1FWL A;  2DGW A;  4WE1 A;  4U8Y A;  5KT7 A;  4H4O B;  3KMS A;  3KKF A;  1CG2 A;  5KFR A;  1ITP A;  2CDR B;  1FNO A;  4RW4 A;  4TU9 A;  2K1R A;  4RUH A;  4EYI B;  2NYI A;  1NXI A;  4WPA A;  1FDA A;  4F3Q A;  4F7V A;  3D2W A;  4B08 A;  4YB6 A;  4QYZ J;  1YG0 A;  1FRX A;  1XR6 A;  3F0N A;  1D0E A;  2BE2 B;  3OL9 A;  2DGS A;  3C15 B;  1JLQ A;  3BN7 A;  3QLH B;  2PI5 A;  1RAD B;  5HBM B;  4FYD A;  3PZP A;  3QIP B;  2ZDO A;  3L95 X;  2HHH J;  1OQ3 A;  4UTG A;  3CD0 A;  2HHX A;  2QJ3 A;  2X3D A;  4G6V B;  3JSM A;  2BKO A;  2K1R B;  3PYF A;  1RYR A;  5IT0 A;  2F9D A;  3R5G A;  1LKZ A;  4OYP A;  1JJ2 R;  5C25 A;  1JXV A;  3M2V A;  1UJ5 A;  3QBC A;  2KG1 A;  2DR9 A;  1HNW F;  1HWU A;  4DPX A;  4DLG A;  4DL6 A;  4TYB A;  1IQT A;  2Z4P A;  4Q8F A;  1SJ1 A;  4DQQ A;  2C2Z B;  2EC2 A;  3W62 A;  1QAJ A;  4L76 A;  1MWQ A;  1NBE B;  1S1V A;  2ZBP A;  5K5M A;  5DLF A;  1PJ6 A;  1OYD A;  3PO5 A;  2XNQ A;  1LW2 B;  4F26 A;  4KGK A;  2RU9 A;  1ZAW A;  4K4U A;  3TNV A;  1LWE B;  3DLE B;  2HFZ A;  1FXL A;  2WAQ D;  4PXE A;  2DHG A;  4M5D A;  3G71 S;  4F8R A;  4OZN A;  4MYU A;  5EDW A;  3I31 A;  1F9E B;  1FDB A;  3MPV A;  4YEA A;  1M1K T;  4F50 A;  3ZZP A;  4ED2 A;  1NJI T;  4KFB A;  4M5I A;  1U48 A;  2AEM A;  3A13 A;  4PQU A;  3I9Z A;  2DJW A;  2P8I A;  4NX9 A;  2XHC A;  3BPD A;  4G1P A;  3PXG a;  4C0O C;  1R0A A;  1KVJ A;  4PKD B;  3AY0 A;  3QFW A;  1DAX A;  5EX3 A;  4ZPC A;  4NXN F;  2DPJ A;  4USU A;  1RWP B;  1U2R A;  3LPE A;  4RU9 A;  3PFE A;  4H4K A;  3O6Q A;  5KG2 A;  3HM9 A;  2RIJ A;  5BJR A;  3Q2S C;  2UUW A;  1SH2 A;  2X1B A;  4IFV B;  4MKB A;  2DNZ A;  4ZHR B;  5CAA A;  5IWA J;  4B3R J;  2AJF E;  3QJL A;  4DV3 J;  1QVF R;  3Q8P B;  4IOA Q;  4V19 J;  1AZS A;  1V3S A;  3B54 A;  1ZPW X;  2CQH A;  3SV4 A;  1CUL A;  2FY1 A;  4FXV A;  5D15 A;  1WC0 A;  4WP3 A;  4CO2 A;  2FLP A;  2GC8 A;  1U02 A;  1XMQ F;  1X60 A;  2AEF A;  2WVE A;  3BKU A;  1YI2 S;  1FE0 A;  2RVJ A;  2OP5 A;  5T7L B;  4WWS A;  3WQP A;  3D3B J;  1Q79 A;  2XMA A;  1F1B B;  3K5P A;  3Q0A A;  3BO3 A;  1BWV A;  2UUT A;  1HW9 A;  3NEK A;  2FVP A;  4O4G B;  1HMV A;  1NSA A;  1KQF B;  4A8O A;  5A8K A;  3DOL B;  2YWF A;  3BSA A;  3WDO A;  1XBW A;  1NB7 A;  3MAQ A;  4JI3 F;  2L08 A;  3NAI A;  1N52 B;  1L3V A;  2V68 A;  2V2Q A;  2C3U A;  2UXB F;  1R31 A;  5DDR C;  4KH0 B;  3CB4 A;  2IYG A;  2QT7 A;  4NPO A;  4C8Z A;  2O66 A;  4QZV B;  5T7L A;  1YQH A;  3MEC A;  3TEH B;  2N82 B;  2R2S A;  3HVR A;  3EDR B;  3QJJ A;  1VQK S;  3DOM A;  1IM6 A;  3QMQ A;  4JB8 B;  3M7V A;  4ED0 A;  1GT8 A;  2Q66 A;  2BUN A;  2CZ9 A;  2DYA A;  5K20 B;  4DV2 J;  2ZUA A;  2KDO A;  2XMJ A;  3TVK A;  4FYW B;  4DR4 F;  4DU8 A;  3V81 B;  3H5U A;  2NSB A;  3H20 A;  3CXC R;  4QWC A; 
#chains in the Genus database with same CATH homology
 2QC3 A;  3R8Y A;  3CJ8 A;  4QBU A;  5DZ6 A;  1NM2 A;  2G2O A;  1MLA A;  2JFD A;  3IM8 A;  3EZO A;  3H0P A;  3PTW A;  4RL1 A;  3HHD A;  2JFK A;  3R97 A;  3SBM A;  3RGI A;  2H1Y A;  3G87 A;  2CUY A;  3TZZ A;  2G2Z A;  3HJV A;  3BV8 A;  3TZX A;  3QAT A;  3K89 A;  2C2N A;  3TZW A;  2G1H A;  4RR5 A;  3TZY A;  2QJ3 A;  2G2Y A;  3TQE A;  5DZ7 A;  3IM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...