3BVLA

Structural basis for the iron uptake mechanism of helicobacter pylori ferritin
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
172
structure length
172
Chain Sequence
b'HHSQDPMLSKDIIKLLNEQVNKEMNSSNLYMSMSSWCYTHSLDGAGLFLFDHAAEEYEHAKKLIIFLNENNVPVQLTSISAPEHKFEGLTQIFQKAYEHEQHISESINNIVDHAIKSKDHATFNFLQWYVAEQHEEEVLFKDILDKIELIGNENHGLYLADQYVKGIAKSRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferritin
publication title Structural basis for the iron uptake mechanism of Helicobacter pylori ferritin
rcsb
source organism Helicobacter pylori
molecule tags Oxidoreductase
total genus 79
structure length 172
sequence length 172
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.16.3.2: Bacterial non-heme ferritin.
pdb deposition date 2008-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3bvlA00
4M33A 2FZFA 4PGIA 5J8SA 1Z4AA 4ITTA 3O7SA 3Q4OA 1VEIA 4MUDA 5JACA 2V2RA 1RCCA 4II4B 1O9RA 1NF6A 1N1QA 4LYXA 1FHAA 2WLUA 2XJNA 4Z3BA 4XGSA 1NF4A 3EGMA 5K52A 4TW3A 1IERA 1JGCA 2CN7A 1DPSA 2IU2A 4LYUA 1JTSA 1UMNA 3F32A 3QVDA 5D8PA 3PWQA 1YUZA 3BT5A 3PW8C 4RC6B 3OGHA 2UX1A 3E1QA 2Z5RA 1SQ3A 5D8QA 4M32A 4CVPA 5D8XA 1S3QA 4TOGA 4MN9A 4TOBA 3SHXA 4M35A 3GHQA 4RC8A 2QF9A 4CVRA 2C6RA 1TJOA 4ZLWA 3E6RA 1Z6OA 4REUA 2JD80 4DASA 3ES3A 3RBCA 3SIDA 1BCFA 3WVUA 3F33A 1YV1A 2WLAA 2GS4A 2ZURX 4ZTTA 2IB0A 4IWKA 4CMYA 3F35A 1S2ZA 3R2OA 5CZUA 1TK6A 5JKLG 1BFRA 3UOIA 5GU2X 4DZ0A 4TOFA 4DE6A 4IWJA 4DYXA 5LG2A 2XGWA 3GVYA 3IS7A 3R2SA 5J8WA 1B71A 3H7GA 1RCIA 2FHAA 2YW6A 2YW7A 1RCEA 1DVBA 3AK9A 4DYUA 2W0OA 3UNOA 1VJXA 3RE7A 3RD0A 5IX6A 4ZMCA 3FSEA 1YUXA 4A25A 4YKHA 4ETRA 3IQ1A 2Z5PA 3QD8A 1Z6OM 3QHCA 2V15A 5HQOA 2V2PA 4MJYA 5CMRA 2CHIA 1AEWA 4CVSA 4TODA 3RAVA 4EVEA 4EVBA 1UVHA 3Q4NA 4QUWA 4EVDA 5FFCA 4LQJA 2C2JA 1RCGA 3F36A 2ZG7X 3E6SA 5LBHA 4LPMA 5ERJA 4II4A 4LQNA 2CEIA 5E1UA 5FFEA 1KRQA 1MOJA 3R2MA 2Y3QA 3A9QA 1BG7A 3GE4A 3EZ0A 3KXUA 2FKZA 1NFVA 5LS9A 4KVRA 5I4JA 2GYQA 5C6FA 3AJQA 4P18A 2V2JA 4OYNA 2D5KA 1TKOA 4RC6A 1NNQA 3HIUA 2V2SA 5GN8A 5GN8B 1JI5A 1JKVA 1L8HA 2BKCA 1VEQA 4CY9A 3BKNA 3SE1A 3F38A 3AJPA 1DATA 4XKSA 3AJOA 4CYBA 3PWQC 4ZL5A 3AF9X 3R2LA 3ISEA 2XJMA 3QB9A 4E6KA 5GU3X 1XZ3A 3PVRA 2FL0A 3E1PA 3PVTA 1SOFA 3PVRB 3HL1A 3PVTB 2QQYA 3RGDA 5ERKA 4ML5A 3FI6A 1QGHA 2C2UA 4LPNA 2WTLA 2V2NA 3E2CA 4TO9A 3AF7X 3KWOA 3QZ3A 4LPJA 3WNWA 3AK8A 3QHBA 1S30A 3EZUA 3BVFA 1JREA 5FFAA 3A68A 1L8IA 4Y08A 1OTKA 3IS8A 3BVLA 2CLBA 4TOHA 2RBDA 3KA8A 5FFBA 3Q4QA 2Z5QA 5D8YA 4MKUA 2CHPA 2ZA6A 2GYDA 4RC5A 2XJOA 1JI4A 5E2DA 2CLUA 4RC5B 4ZJKA 2V2MA 5J9VA 1MFRA 3KX9A 2G4HA 1EUMA 1GWGA 5HJFA 3TA8A 5CMQA 3F34A 3PZAA 3NOZX 1O9IA 2JD70 2ZA8A 2VXXA 4DYZA 4PG1A 3AF8X 5JKLA 2CN6A 3E1MA 4KVQA 2OC5A 3E1LA 4Z5SA 2X170 5K53A 3NP2X 2ZA7A 4ZKXA 3R2RA 4ISMA 3KA6A 2FG4A 2ZG9X 5GU0X 2V2LA 5AXSA 2XKQA 3PWFA 4MY7A 3KA3A 4AM5A 5GU1X 4ITWA 2BK6A 1H96A 4RC7A 2BW1A 3NP0X 3MPSA 4XKTA 4RC7B 5FEJA 3PVYA 2Z6MA 3PW1A 4ZL6A 3PVYB 1LKOA 3PW8A 3PW1B 3U90A 3SH6A 4TOAA 4ZKHA 4ISPA 2ITBA 4ERUA 4LQVA 4R42A 4PGKA 3WVVA 2F7NA 4CVTA 1XZ1A 2VXIA 2IY4A 3VNXA 2HR5A 3WVWA 4AM2A 1TKPA 3KA4A 3R2KA 1IESA 5D8OA 5HJHA 1JIGA 4TOEA 2YJKA 5JKMG 3Q4RA 4ZKWA 3F39A 2ZG8X 2BJYA 4KVSA 5D8RA 3BVEA 2Z90A 1QYBA 3BVIA 2CF7A 5GOUA 3E1OA 1RYTA 4DYYA 2C41A 1HRSA 4CYAA 2FG8A 3T9JA 1F33A 2V2OA 4EVCA 3E1JA 2V2IA 1JKUA 2OH3A 4CMYV 3BVKA 3ISFA 3ERZA 1RCDA 1VELA 4PG0A 2VZBA 5FFDA 5J93A 4U3GA 1VLGA 3E1NA 4IXKA 1LB3A 3UOFA 4M34A 2FFXJ 4XKUA 1ZUJA 1F30A 1JYBA 2JD60 2CIHA 4TOCA 3R2HA 3OJ5A 1ZS3A 1LKPA 4DI0A 5JKMA 4AM4A 2C2FA 1J30A 3F37A 4LQHA 2YJJA 3O7RA 2FJCA 2HTNA 1LKMA 2PYBA 3FVBA 5D8SA 3KA9A 5LG8A 1R03A
chains in the Genus database with same CATH superfamily
4M33A 2OKCA 2FZFA 3JZ9A 2CWLA 4PGIA 3GGZA 5J8SA 1Z4AA 4ITTA 3O7SA 3Q4OA 1VEIA 4MUDA 5JACA 2V2RA 1RCCA 4II4B 1O9RA 1NF6A 1N1QA 4LYXA 1FHAA 2WLUA 2XJNA 4Z3BA 4XGSA 1NF4A 3EGMA 5K52A 3JZAB 4TW3A 1IERA 1JGCA 2CN7A 1DPSA 2IU2A 4LYUA 1JTSA 1UMNA 3F32A 3QVDA 5D8PA 3PWQA 1YUZA 3BT5A 3PW8C 4RC6B 3OGHA 2UX1A 3E1QA 2Z5RA 1SQ3A 5D8QA 4M32A 4CVPA 5D8XA 1S3QA 4TOGA 4MN9A 4TOBA 2Y44A 3SHXA 3KHKA 4M35A 3GHQA 4RC8A 2QF9A 4MXPA 4CVRA 2C6RA 1TJOA 4ZLWA 3E6RA 1Z6OA 4REUA 2V8UA 2JD80 4DASA 3ES3A 2N02A 3RBCA 3SIDA 1BCFA 2AR0A 3WVUA 4E40A 3F33A 1YV1A 2WLAA 2GS4A 2ZURX 4ZTTA 2IB0A 4IWKA 4CMYA 3F35A 1S2ZA 3R2OA 5CZUA 1TK6A 5JKLG 1BFRA 3UOIA 5GU2X 4DZ0A 4TOFA 4DE6A 4IWJA 4DYXA 5LG2A 2XGWA 3GVYA 3UFBA 3IS7A 3R2SA 5J8WA 1B71A 3H7GA 1RCIA 2FHAA 2YW6A 2YW7A 1RCEA 1DVBA 3AK9A 4DYUA 2W0OA 3UNOA 1VJXA 3RE7A 3C1YA 3RD0A 5IX6A 4ZMCA 3FSEA 1YUXA 4A25A 4YKHA 4ETRA 3IQ1A 2Z5PA 3QD8A 1Z6OM 3KDQA 2G38B 3QHCA 2V15A 5HQOA 3C23A 2V2PA 4MJYA 5CMRA 2CHIA 1AEWA 4CVSA 4TODA 3RAVA 4EVEA 3LKDA 4EVBA 1UVHA 3Q4NA 2WWXB 4QUWA 4EVDA 5FFCA 4LQJA 2C2JA 3VV9A 5JDOA 1RCGA 3F36A 2ZG7X 3E6SA 5LBHA 4LPMA 5JDOB 5ERJA 3FRRA 4II4A 4WJG4 4LQNA 2CEIA 4YXMA 5E1UA 5FFEA 1KRQA 1MOJA 3R2MA 2Y3QA 3A9QA 1BG7A 3GE4A 3EZ0A 3KXUA 2FKZA 1NFVA 5LS9A 4KVRA 2MGYA 5I4JA 2GYQA 5C6FA 3AJQA 4P18A 2V2JA 4OYNA 4W4LB 2D5KA 1TKOA 4RC6A 1NNQA 3HIUA 2V2SA 3C1ZA 5GN8A 3GGYA 5GN8B 1JI5A 1JKVA 1L8HA 2BKCA 1VEQA 4CY9A 3BKNA 3SE1A 3F38A 3AJPA 1DATA 4XKSA 3AJOA 4CYBA 3PWQC 4ZL5A 4YVZA 3AF9X 3R2LA 3ISEA 2XJMA 3QB9A 4E6KA 5GU3X 4YXJA 1XZ3A 3PVRA 2FL0A 3E1PA 3PVTA 1SOFA 3PVRB 3HL1A 3PVTB 2QQYA 3RGDA 5ERKA 4ML5A 3FI6A 1QGHA 2C2UA 4LPNA 2WTLA 2V2NA 2V8TA 3E2CA 4TO9A 3AF7X 3KWOA 3QZ3A 4LPJA 4KXRB 3WNWA 3AK8A 3QHBA 1S30A 3EZUA 3BVFA 1JREA 5FFAA 3A68A 1L8IA 4Y08A 1OTKA 3IS8A 3FRSA 3BVLA 2CLBA 4TOHA 2RBDA 3KA8A 5FFBA 3Q4QA 2Z5QA 5D8YA 4MKUA 2CHPA 2ZA6A 2GYDA 4RC5A 2XJOA 1JI4A 5E2DA 2CLUA 4RC5B 4ZJKA 2V2MA 5J9VA 1MFRA 3KX9A 2G4HA 1EUMA 1GWGA 5HJFA 3TA8A 5CMQA 3F34A 3PZAA 3NOZX 1O9IA 2JD70 2ZA8A 2VXXA 4DYZA 4PG1A 3AF8X 5JKLA 2CN6A 3E1MA 4KVQA 2OC5A 3E1LA 4Z5SA 2X170 5K53A 3NP2X 2ZA7A 4ZKXA 3R2RA 4ISMA 3KA6A 5HU6D 2FG4A 2ZG9X 5GU0X 2V2LA 5AXSA 2XKQA 3PWFA 3W54A 4MY7A 3KA3A 4AM5A 5GU1X 4ITWA 2BK6A 1H96A 3M6JA 4RC7A 2BW1A 3NP0X 3MPSA 4XKTA 4RC7B 5FEJA 3PVYA 2Z6MA 3PW1A 4ZL6A 3PVYB 1LKOA 3PW8A 3N6OA 3DBYA 3PW1B 3U90A 3SH6A 4TOAA 4ZKHA 4ISPA 2ITBA 4ERUA 4LQVA 4R42A 4PGKA 3WVVA 2F7NA 4CVTA 1XZ1A 2VXIA 2IY4A 3VNXA 4X0JA 2HR5A 3WVWA 4AM2A 1TKPA 3KA4A 3VVAA 3R2KA 1IESA 5D8OA 5HJHA 1JIGA 4TOEA 2YJKA 5JKMG 3Q4RA 3C21A 4ZKWA 3F39A 2ZG8X 2BJYA 4KVSA 5D8RA 3V3KB 3BVEA 2Z90A 1QYBA 3BVIA 2CF7A 5GOUA 3E1OA 1RYTA 4DYYA 2C41A 1HRSA 4CYAA 2FG8A 3T9JA 1F33A 2V2OA 4EVCA 3E1JA 2V2IA 1JKUA 2OH3A 4CMYV 3BVKA 3ISFA 3ERZA 3D19A 1RCDA 1VELA 4PG0A 2VZBA 5FFDA 5J93A 4U3GA 1VLGA 3E1NA 4IXKA 4W4KB 1LB3A 3UOFA 4M34A 2FFXJ 4XKUA 1ZUJA 1F30A 1JYBA 2JD60 2CIHA 4TOCA 3R2HA 3OJ5A 1ZS3A 1LKPA 4DI0A 5JKMA 4AM4A 2C2FA 1J30A 3F37A 2YJJA 4LQHA 3O7RA 2FJCA 2HTNA 1LKMA 2PYBA 3FVBA 5D8SA 3KA9A 5LG8A 1R03A 3L0MA
chains in the Genus database with same CATH topology
4M33A 2OKCA 2FZFA 3JZ9A 2CWLA 4PGIA 3GGZA 5J8SA 1Z4AA 4ITTA 3O7SA 3Q4OA 1VEIA 4MUDA 5JACA 2V2RA 1RCCA 4II4B 1O9RA 1NF6A 1N1QA 4LYXA 1FHAA 2WLUA 2XJNA 4Z3BA 4XGSA 1NF4A 3EGMA 5K52A 3JZAB 4TW3A 1IERA 1JGCA 2CN7A 1DPSA 2IU2A 4LYUA 1JTSA 1UMNA 3F32A 3QVDA 5D8PA 3PWQA 1YUZA 3BT5A 3PW8C 4RC6B 3OGHA 2UX1A 3E1QA 2Z5RA 1SQ3A 5D8QA 4M32A 4CVPA 5D8XA 1S3QA 4TOGA 4MN9A 4TOBA 2Y44A 3SHXA 3KHKA 4M35A 3GHQA 4RC8A 2QF9A 4MXPA 4CVRA 2C6RA 1TJOA 4ZLWA 3E6RA 1Z6OA 4REUA 2V8UA 2JD80 4DASA 3ES3A 2N02A 3RBCA 3SIDA 1BCFA 2AR0A 3WVUA 4E40A 3F33A 1YV1A 2WLAA 2GS4A 2ZURX 4ZTTA 2IB0A 4IWKA 4CMYA 3F35A 1S2ZA 3R2OA 5CZUA 1TK6A 5JKLG 1BFRA 3UOIA 5GU2X 4DZ0A 4TOFA 4DE6A 4IWJA 4DYXA 5LG2A 2XGWA 3GVYA 3UFBA 3IS7A 3R2SA 5J8WA 1B71A 3H7GA 1RCIA 2FHAA 2YW6A 2YW7A 1RCEA 1DVBA 3AK9A 4DYUA 2W0OA 3UNOA 1VJXA 3RE7A 3C1YA 3RD0A 5IX6A 4ZMCA 3FSEA 1YUXA 4A25A 4YKHA 4ETRA 3IQ1A 2Z5PA 3QD8A 1Z6OM 3KDQA 2G38B 3QHCA 2V15A 5HQOA 3C23A 2V2PA 4MJYA 5CMRA 2CHIA 1AEWA 4CVSA 4TODA 3RAVA 4EVEA 3LKDA 4EVBA 1UVHA 3Q4NA 2WWXB 4QUWA 4EVDA 5FFCA 4LQJA 2C2JA 3VV9A 5JDOA 1RCGA 3F36A 2ZG7X 3E6SA 5LBHA 4LPMA 5JDOB 5ERJA 3FRRA 4II4A 4WJG4 4LQNA 2CEIA 4YXMA 5E1UA 5FFEA 1KRQA 1MOJA 3R2MA 2Y3QA 3A9QA 1BG7A 3GE4A 3EZ0A 3KXUA 2FKZA 1NFVA 5LS9A 4KVRA 2MGYA 5I4JA 2GYQA 5C6FA 3AJQA 4P18A 2V2JA 4OYNA 4W4LB 2D5KA 1TKOA 4RC6A 1NNQA 3HIUA 2V2SA 3C1ZA 5GN8A 3GGYA 5GN8B 1JI5A 1JKVA 1L8HA 2BKCA 1VEQA 4CY9A 3BKNA 3SE1A 3F38A 3AJPA 1DATA 4XKSA 3AJOA 4CYBA 3PWQC 4ZL5A 4YVZA 3AF9X 3R2LA 3ISEA 2XJMA 3QB9A 4E6KA 5GU3X 4YXJA 1XZ3A 3PVRA 2FL0A 3E1PA 3PVTA 1SOFA 3PVRB 3HL1A 3PVTB 2QQYA 3RGDA 5ERKA 4ML5A 3FI6A 1QGHA 2C2UA 4LPNA 2WTLA 2V2NA 2V8TA 3E2CA 4TO9A 3AF7X 3KWOA 3QZ3A 4LPJA 4KXRB 3WNWA 3AK8A 3QHBA 1S30A 3EZUA 3BVFA 1JREA 5FFAA 3A68A 1L8IA 4Y08A 1OTKA 3IS8A 3FRSA 3BVLA 2CLBA 4TOHA 2RBDA 3KA8A 5FFBA 3Q4QA 2Z5QA 5D8YA 4MKUA 2CHPA 2ZA6A 2GYDA 4RC5A 2XJOA 1JI4A 5E2DA 2CLUA 4RC5B 4ZJKA 2V2MA 5J9VA 1MFRA 3KX9A 2G4HA 1EUMA 1GWGA 5HJFA 3TA8A 5CMQA 3F34A 3PZAA 3NOZX 1O9IA 2JD70 2ZA8A 2VXXA 4DYZA 4PG1A 3AF8X 5JKLA 2CN6A 3E1MA 4KVQA 2OC5A 3E1LA 4Z5SA 2X170 5K53A 3NP2X 2ZA7A 4ZKXA 3R2RA 4ISMA 3KA6A 5HU6D 2FG4A 2ZG9X 5GU0X 2V2LA 5AXSA 2XKQA 3PWFA 3W54A 4MY7A 3KA3A 4AM5A 5GU1X 4ITWA 2BK6A 1H96A 3M6JA 4RC7A 2BW1A 3NP0X 3MPSA 4XKTA 4RC7B 5FEJA 3PVYA 2Z6MA 3PW1A 4ZL6A 3PVYB 1LKOA 3PW8A 3N6OA 3DBYA 3PW1B 3U90A 3SH6A 4TOAA 4ZKHA 4ISPA 2ITBA 4ERUA 4LQVA 4R42A 4PGKA 3WVVA 2F7NA 4CVTA 1XZ1A 2VXIA 2IY4A 3VNXA 4X0JA 2HR5A 3WVWA 4AM2A 1TKPA 3KA4A 3VVAA 3R2KA 1IESA 5D8OA 5HJHA 1JIGA 4TOEA 2YJKA 5JKMG 3Q4RA 3C21A 4ZKWA 3F39A 2ZG8X 2BJYA 4KVSA 5D8RA 3V3KB 3BVEA 2Z90A 1QYBA 3BVIA 2CF7A 5GOUA 3E1OA 1RYTA 4DYYA 2C41A 1HRSA 4CYAA 2FG8A 3T9JA 1F33A 2V2OA 4EVCA 3E1JA 2V2IA 1JKUA 2OH3A 4CMYV 3BVKA 3ISFA 3ERZA 3D19A 1RCDA 1VELA 4PG0A 2VZBA 5FFDA 5J93A 4U3GA 1VLGA 3E1NA 4IXKA 4W4KB 1LB3A 3UOFA 4M34A 2FFXJ 4XKUA 1ZUJA 1F30A 1JYBA 2JD60 2CIHA 4TOCA 3R2HA 3OJ5A 1ZS3A 1LKPA 4DI0A 5JKMA 4AM4A 2C2FA 1J30A 3F37A 2YJJA 4LQHA 3O7RA 2FJCA 2HTNA 1LKMA 2PYBA 3FVBA 5D8SA 3KA9A 5LG8A 1R03A 3L0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M33 A;  2FZF A;  4PGI A;  5J8S A;  1Z4A A;  4ITT A;  3O7S A;  3Q4O A;  1VEI A;  4MUD A;  5JAC A;  2V2R A;  1RCC A;  4II4 B;  1O9R A;  1NF6 A;  1N1Q A;  4LYX A;  1FHA A;  2WLU A;  2XJN A;  4Z3B A;  4XGS A;  1NF4 A;  3EGM A;  5K52 A;  4TW3 A;  1IER A;  1JGC A;  2CN7 A;  1DPS A;  2IU2 A;  4LYU A;  1JTS A;  1UMN A;  3F32 A;  3QVD A;  5D8P A;  3PWQ A;  1YUZ A;  3BT5 A;  3PW8 C;  4RC6 B;  3OGH A;  2UX1 A;  3E1Q A;  2Z5R A;  1SQ3 A;  5D8Q A;  4M32 A;  4CVP A;  5D8X A;  1S3Q A;  4TOG A;  4MN9 A;  4TOB A;  3SHX A;  4M35 A;  3GHQ A;  4RC8 A;  2QF9 A;  4CVR A;  2C6R A;  1TJO A;  4ZLW A;  3E6R A;  1Z6O A;  4REU A;  2JD8 0;  4DAS A;  3ES3 A;  3RBC A;  3SID A;  1BCF A;  3WVU A;  3F33 A;  1YV1 A;  2WLA A;  2GS4 A;  2ZUR X;  4ZTT A;  2IB0 A;  4IWK A;  4CMY A;  3F35 A;  1S2Z A;  3R2O A;  5CZU A;  1TK6 A;  5JKL G;  1BFR A;  3UOI A;  5GU2 X;  4DZ0 A;  4TOF A;  4DE6 A;  4IWJ A;  4DYX A;  5LG2 A;  2XGW A;  3GVY A;  3IS7 A;  3R2S A;  5J8W A;  1B71 A;  3H7G A;  1RCI A;  2FHA A;  2YW6 A;  2YW7 A;  1RCE A;  1DVB A;  3AK9 A;  4DYU A;  2W0O A;  3UNO A;  1VJX A;  3RE7 A;  3RD0 A;  5IX6 A;  4ZMC A;  3FSE A;  1YUX A;  4A25 A;  4YKH A;  4ETR A;  3IQ1 A;  2Z5P A;  3QD8 A;  1Z6O M;  3QHC A;  2V15 A;  5HQO A;  2V2P A;  4MJY A;  5CMR A;  2CHI A;  1AEW A;  4CVS A;  4TOD A;  3RAV A;  4EVE A;  4EVB A;  1UVH A;  3Q4N A;  4QUW A;  4EVD A;  5FFC A;  4LQJ A;  2C2J A;  1RCG A;  3F36 A;  2ZG7 X;  3E6S A;  5LBH A;  4LPM A;  5ERJ A;  4II4 A;  4LQN A;  2CEI A;  5E1U A;  5FFE A;  1KRQ A;  1MOJ A;  3R2M A;  2Y3Q A;  3A9Q A;  1BG7 A;  3GE4 A;  3EZ0 A;  3KXU A;  2FKZ A;  1NFV A;  5LS9 A;  4KVR A;  5I4J A;  2GYQ A;  5C6F A;  3AJQ A;  4P18 A;  2V2J A;  4OYN A;  2D5K A;  1TKO A;  4RC6 A;  1NNQ A;  3HIU A;  2V2S A;  5GN8 A;  5GN8 B;  1JI5 A;  1JKV A;  1L8H A;  2BKC A;  1VEQ A;  4CY9 A;  3BKN A;  3SE1 A;  3F38 A;  3AJP A;  1DAT A;  4XKS A;  3AJO A;  4CYB A;  3PWQ C;  4ZL5 A;  3AF9 X;  3R2L A;  3ISE A;  2XJM A;  3QB9 A;  4E6K A;  5GU3 X;  1XZ3 A;  3PVR A;  2FL0 A;  3E1P A;  3PVT A;  1SOF A;  3PVR B;  3HL1 A;  3PVT B;  2QQY A;  3RGD A;  5ERK A;  4ML5 A;  3FI6 A;  1QGH A;  2C2U A;  4LPN A;  2WTL A;  2V2N A;  3E2C A;  4TO9 A;  3AF7 X;  3KWO A;  3QZ3 A;  4LPJ A;  3WNW A;  3AK8 A;  3QHB A;  1S30 A;  3EZU A;  3BVF A;  1JRE A;  5FFA A;  3A68 A;  1L8I A;  4Y08 A;  1OTK A;  3IS8 A;  3BVL A;  2CLB A;  4TOH A;  2RBD A;  3KA8 A;  5FFB A;  3Q4Q A;  2Z5Q A;  5D8Y A;  4MKU A;  2CHP A;  2ZA6 A;  2GYD A;  4RC5 A;  2XJO A;  1JI4 A;  5E2D A;  2CLU A;  4RC5 B;  4ZJK A;  2V2M A;  5J9V A;  1MFR A;  3KX9 A;  2G4H A;  1EUM A;  1GWG A;  5HJF A;  3TA8 A;  5CMQ A;  3F34 A;  3PZA A;  3NOZ X;  1O9I A;  2JD7 0;  2ZA8 A;  2VXX A;  4DYZ A;  4PG1 A;  3AF8 X;  5JKL A;  2CN6 A;  3E1M A;  4KVQ A;  2OC5 A;  3E1L A;  4Z5S A;  2X17 0;  5K53 A;  3NP2 X;  2ZA7 A;  4ZKX A;  3R2R A;  4ISM A;  3KA6 A;  2FG4 A;  2ZG9 X;  5GU0 X;  2V2L A;  5AXS A;  2XKQ A;  3PWF A;  4MY7 A;  3KA3 A;  4AM5 A;  5GU1 X;  4ITW A;  2BK6 A;  1H96 A;  4RC7 A;  2BW1 A;  3NP0 X;  3MPS A;  4XKT A;  4RC7 B;  5FEJ A;  3PVY A;  2Z6M A;  3PW1 A;  4ZL6 A;  3PVY B;  1LKO A;  3PW8 A;  3PW1 B;  3U90 A;  3SH6 A;  4TOA A;  4ZKH A;  4ISP A;  2ITB A;  4ERU A;  4LQV A;  4R42 A;  4PGK A;  3WVV A;  2F7N A;  4CVT A;  1XZ1 A;  2VXI A;  2IY4 A;  3VNX A;  2HR5 A;  3WVW A;  4AM2 A;  1TKP A;  3KA4 A;  3R2K A;  1IES A;  5D8O A;  5HJH A;  1JIG A;  4TOE A;  2YJK A;  5JKM G;  3Q4R A;  4ZKW A;  3F39 A;  2ZG8 X;  2BJY A;  4KVS A;  5D8R A;  3BVE A;  2Z90 A;  1QYB A;  3BVI A;  2CF7 A;  5GOU A;  3E1O A;  1RYT A;  4DYY A;  2C41 A;  1HRS A;  4CYA A;  2FG8 A;  3T9J A;  1F33 A;  2V2O A;  4EVC A;  3E1J A;  2V2I A;  1JKU A;  2OH3 A;  4CMY V;  3BVK A;  3ISF A;  3ERZ A;  1RCD A;  1VEL A;  4PG0 A;  2VZB A;  5FFD A;  5J93 A;  4U3G A;  1VLG A;  3E1N A;  4IXK A;  1LB3 A;  3UOF A;  4M34 A;  2FFX J;  4XKU A;  1ZUJ A;  1F30 A;  1JYB A;  2JD6 0;  2CIH A;  4TOC A;  3R2H A;  3OJ5 A;  1ZS3 A;  1LKP A;  4DI0 A;  5JKM A;  4AM4 A;  2C2F A;  1J30 A;  3F37 A;  4LQH A;  2YJJ A;  3O7R A;  2FJC A;  2HTN A;  1LKM A;  2PYB A;  3FVB A;  5D8S A;  3KA9 A;  5LG8 A;  1R03 A; 
#chains in the Genus database with same CATH topology
 4M33 A;  2OKC A;  2FZF A;  3JZ9 A;  2CWL A;  4PGI A;  3GGZ A;  5J8S A;  1Z4A A;  4ITT A;  3O7S A;  3Q4O A;  1VEI A;  4MUD A;  5JAC A;  2V2R A;  1RCC A;  4II4 B;  1O9R A;  1NF6 A;  1N1Q A;  4LYX A;  1FHA A;  2WLU A;  2XJN A;  4Z3B A;  4XGS A;  1NF4 A;  3EGM A;  5K52 A;  3JZA B;  4TW3 A;  1IER A;  1JGC A;  2CN7 A;  1DPS A;  2IU2 A;  4LYU A;  1JTS A;  1UMN A;  3F32 A;  3QVD A;  5D8P A;  3PWQ A;  1YUZ A;  3BT5 A;  3PW8 C;  4RC6 B;  3OGH A;  2UX1 A;  3E1Q A;  2Z5R A;  1SQ3 A;  5D8Q A;  4M32 A;  4CVP A;  5D8X A;  1S3Q A;  4TOG A;  4MN9 A;  4TOB A;  2Y44 A;  3SHX A;  3KHK A;  4M35 A;  3GHQ A;  4RC8 A;  2QF9 A;  4MXP A;  4CVR A;  2C6R A;  1TJO A;  4ZLW A;  3E6R A;  1Z6O A;  4REU A;  2V8U A;  2JD8 0;  4DAS A;  3ES3 A;  2N02 A;  3RBC A;  3SID A;  1BCF A;  2AR0 A;  3WVU A;  4E40 A;  3F33 A;  1YV1 A;  2WLA A;  2GS4 A;  2ZUR X;  4ZTT A;  2IB0 A;  4IWK A;  4CMY A;  3F35 A;  1S2Z A;  3R2O A;  5CZU A;  1TK6 A;  5JKL G;  1BFR A;  3UOI A;  5GU2 X;  4DZ0 A;  4TOF A;  4DE6 A;  4IWJ A;  4DYX A;  5LG2 A;  2XGW A;  3GVY A;  3UFB A;  3IS7 A;  3R2S A;  5J8W A;  1B71 A;  3H7G A;  1RCI A;  2FHA A;  2YW6 A;  2YW7 A;  1RCE A;  1DVB A;  3AK9 A;  4DYU A;  2W0O A;  3UNO A;  1VJX A;  3RE7 A;  3C1Y A;  3RD0 A;  5IX6 A;  4ZMC A;  3FSE A;  1YUX A;  4A25 A;  4YKH A;  4ETR A;  3IQ1 A;  2Z5P A;  3QD8 A;  1Z6O M;  3KDQ A;  2G38 B;  3QHC A;  2V15 A;  5HQO A;  3C23 A;  2V2P A;  4MJY A;  5CMR A;  2CHI A;  1AEW A;  4CVS A;  4TOD A;  3RAV A;  4EVE A;  3LKD A;  4EVB A;  1UVH A;  3Q4N A;  2WWX B;  4QUW A;  4EVD A;  5FFC A;  4LQJ A;  2C2J A;  3VV9 A;  5JDO A;  1RCG A;  3F36 A;  2ZG7 X;  3E6S A;  5LBH A;  4LPM A;  5JDO B;  5ERJ A;  3FRR A;  4II4 A;  4WJG 4;  4LQN A;  2CEI A;  4YXM A;  5E1U A;  5FFE A;  1KRQ A;  1MOJ A;  3R2M A;  2Y3Q A;  3A9Q A;  1BG7 A;  3GE4 A;  3EZ0 A;  3KXU A;  2FKZ A;  1NFV A;  5LS9 A;  4KVR A;  2MGY A;  5I4J A;  2GYQ A;  5C6F A;  3AJQ A;  4P18 A;  2V2J A;  4OYN A;  4W4L B;  2D5K A;  1TKO A;  4RC6 A;  1NNQ A;  3HIU A;  2V2S A;  3C1Z A;  5GN8 A;  3GGY A;  5GN8 B;  1JI5 A;  1JKV A;  1L8H A;  2BKC A;  1VEQ A;  4CY9 A;  3BKN A;  3SE1 A;  3F38 A;  3AJP A;  1DAT A;  4XKS A;  3AJO A;  4CYB A;  3PWQ C;  4ZL5 A;  4YVZ A;  3AF9 X;  3R2L A;  3ISE A;  2XJM A;  3QB9 A;  4E6K A;  5GU3 X;  4YXJ A;  1XZ3 A;  3PVR A;  2FL0 A;  3E1P A;  3PVT A;  1SOF A;  3PVR B;  3HL1 A;  3PVT B;  2QQY A;  3RGD A;  5ERK A;  4ML5 A;  3FI6 A;  1QGH A;  2C2U A;  4LPN A;  2WTL A;  2V2N A;  2V8T A;  3E2C A;  4TO9 A;  3AF7 X;  3KWO A;  3QZ3 A;  4LPJ A;  4KXR B;  3WNW A;  3AK8 A;  3QHB A;  1S30 A;  3EZU A;  3BVF A;  1JRE A;  5FFA A;  3A68 A;  1L8I A;  4Y08 A;  1OTK A;  3IS8 A;  3FRS A;  3BVL A;  2CLB A;  4TOH A;  2RBD A;  3KA8 A;  5FFB A;  3Q4Q A;  2Z5Q A;  5D8Y A;  4MKU A;  2CHP A;  2ZA6 A;  2GYD A;  4RC5 A;  2XJO A;  1JI4 A;  5E2D A;  2CLU A;  4RC5 B;  4ZJK A;  2V2M A;  5J9V A;  1MFR A;  3KX9 A;  2G4H A;  1EUM A;  1GWG A;  5HJF A;  3TA8 A;  5CMQ A;  3F34 A;  3PZA A;  3NOZ X;  1O9I A;  2JD7 0;  2ZA8 A;  2VXX A;  4DYZ A;  4PG1 A;  3AF8 X;  5JKL A;  2CN6 A;  3E1M A;  4KVQ A;  2OC5 A;  3E1L A;  4Z5S A;  2X17 0;  5K53 A;  3NP2 X;  2ZA7 A;  4ZKX A;  3R2R A;  4ISM A;  3KA6 A;  5HU6 D;  2FG4 A;  2ZG9 X;  5GU0 X;  2V2L A;  5AXS A;  2XKQ A;  3PWF A;  3W54 A;  4MY7 A;  3KA3 A;  4AM5 A;  5GU1 X;  4ITW A;  2BK6 A;  1H96 A;  3M6J A;  4RC7 A;  2BW1 A;  3NP0 X;  3MPS A;  4XKT A;  4RC7 B;  5FEJ A;  3PVY A;  2Z6M A;  3PW1 A;  4ZL6 A;  3PVY B;  1LKO A;  3PW8 A;  3N6O A;  3DBY A;  3PW1 B;  3U90 A;  3SH6 A;  4TOA A;  4ZKH A;  4ISP A;  2ITB A;  4ERU A;  4LQV A;  4R42 A;  4PGK A;  3WVV A;  2F7N A;  4CVT A;  1XZ1 A;  2VXI A;  2IY4 A;  3VNX A;  4X0J A;  2HR5 A;  3WVW A;  4AM2 A;  1TKP A;  3KA4 A;  3VVA A;  3R2K A;  1IES A;  5D8O A;  5HJH A;  1JIG A;  4TOE A;  2YJK A;  5JKM G;  3Q4R A;  3C21 A;  4ZKW A;  3F39 A;  2ZG8 X;  2BJY A;  4KVS A;  5D8R A;  3V3K B;  3BVE A;  2Z90 A;  1QYB A;  3BVI A;  2CF7 A;  5GOU A;  3E1O A;  1RYT A;  4DYY A;  2C41 A;  1HRS A;  4CYA A;  2FG8 A;  3T9J A;  1F33 A;  2V2O A;  4EVC A;  3E1J A;  2V2I A;  1JKU A;  2OH3 A;  4CMY V;  3BVK A;  3ISF A;  3ERZ A;  3D19 A;  1RCD A;  1VEL A;  4PG0 A;  2VZB A;  5FFD A;  5J93 A;  4U3G A;  1VLG A;  3E1N A;  4IXK A;  4W4K B;  1LB3 A;  3UOF A;  4M34 A;  2FFX J;  4XKU A;  1ZUJ A;  1F30 A;  1JYB A;  2JD6 0;  2CIH A;  4TOC A;  3R2H A;  3OJ5 A;  1ZS3 A;  1LKP A;  4DI0 A;  5JKM A;  4AM4 A;  2C2F A;  1J30 A;  3F37 A;  2YJJ A;  4LQH A;  3O7R A;  2FJC A;  2HTN A;  1LKM A;  2PYB A;  3FVB A;  5D8S A;  3KA9 A;  5LG8 A;  1R03 A;  3L0M A; 
#chains in the Genus database with same CATH homology
 4M33 A;  2OKC A;  2FZF A;  3JZ9 A;  2CWL A;  4PGI A;  3GGZ A;  5J8S A;  1Z4A A;  4ITT A;  3O7S A;  3Q4O A;  1VEI A;  4MUD A;  5JAC A;  2V2R A;  1RCC A;  4II4 B;  1O9R A;  1NF6 A;  1N1Q A;  4LYX A;  1FHA A;  2WLU A;  2XJN A;  4Z3B A;  4XGS A;  1NF4 A;  3EGM A;  5K52 A;  3JZA B;  4TW3 A;  1IER A;  1JGC A;  2CN7 A;  1DPS A;  2IU2 A;  4LYU A;  1JTS A;  1UMN A;  3F32 A;  3QVD A;  5D8P A;  3PWQ A;  1YUZ A;  3BT5 A;  3PW8 C;  4RC6 B;  3OGH A;  2UX1 A;  3E1Q A;  2Z5R A;  1SQ3 A;  5D8Q A;  4M32 A;  4CVP A;  5D8X A;  1S3Q A;  4TOG A;  4MN9 A;  4TOB A;  2Y44 A;  3SHX A;  3KHK A;  4M35 A;  3GHQ A;  4RC8 A;  2QF9 A;  4MXP A;  4CVR A;  2C6R A;  1TJO A;  4ZLW A;  3E6R A;  1Z6O A;  4REU A;  2V8U A;  2JD8 0;  4DAS A;  3ES3 A;  2N02 A;  3RBC A;  3SID A;  1BCF A;  2AR0 A;  3WVU A;  4E40 A;  3F33 A;  1YV1 A;  2WLA A;  2GS4 A;  2ZUR X;  4ZTT A;  2IB0 A;  4IWK A;  4CMY A;  3F35 A;  1S2Z A;  3R2O A;  5CZU A;  1TK6 A;  5JKL G;  1BFR A;  3UOI A;  5GU2 X;  4DZ0 A;  4TOF A;  4DE6 A;  4IWJ A;  4DYX A;  5LG2 A;  2XGW A;  3GVY A;  3UFB A;  3IS7 A;  3R2S A;  5J8W A;  1B71 A;  3H7G A;  1RCI A;  2FHA A;  2YW6 A;  2YW7 A;  1RCE A;  1DVB A;  3AK9 A;  4DYU A;  2W0O A;  3UNO A;  1VJX A;  3RE7 A;  3C1Y A;  3RD0 A;  5IX6 A;  4ZMC A;  3FSE A;  1YUX A;  4A25 A;  4YKH A;  4ETR A;  3IQ1 A;  2Z5P A;  3QD8 A;  1Z6O M;  3KDQ A;  2G38 B;  3QHC A;  2V15 A;  5HQO A;  3C23 A;  2V2P A;  4MJY A;  5CMR A;  2CHI A;  1AEW A;  4CVS A;  4TOD A;  3RAV A;  4EVE A;  3LKD A;  4EVB A;  1UVH A;  3Q4N A;  2WWX B;  4QUW A;  4EVD A;  5FFC A;  4LQJ A;  2C2J A;  3VV9 A;  5JDO A;  1RCG A;  3F36 A;  2ZG7 X;  3E6S A;  5LBH A;  4LPM A;  5JDO B;  5ERJ A;  3FRR A;  4II4 A;  4WJG 4;  4LQN A;  2CEI A;  4YXM A;  5E1U A;  5FFE A;  1KRQ A;  1MOJ A;  3R2M A;  2Y3Q A;  3A9Q A;  1BG7 A;  3GE4 A;  3EZ0 A;  3KXU A;  2FKZ A;  1NFV A;  5LS9 A;  4KVR A;  2MGY A;  5I4J A;  2GYQ A;  5C6F A;  3AJQ A;  4P18 A;  2V2J A;  4OYN A;  4W4L B;  2D5K A;  1TKO A;  4RC6 A;  1NNQ A;  3HIU A;  2V2S A;  3C1Z A;  5GN8 A;  3GGY A;  5GN8 B;  1JI5 A;  1JKV A;  1L8H A;  2BKC A;  1VEQ A;  4CY9 A;  3BKN A;  3SE1 A;  3F38 A;  3AJP A;  1DAT A;  4XKS A;  3AJO A;  4CYB A;  3PWQ C;  4ZL5 A;  4YVZ A;  3AF9 X;  3R2L A;  3ISE A;  2XJM A;  3QB9 A;  4E6K A;  5GU3 X;  4YXJ A;  1XZ3 A;  3PVR A;  2FL0 A;  3E1P A;  3PVT A;  1SOF A;  3PVR B;  3HL1 A;  3PVT B;  2QQY A;  3RGD A;  5ERK A;  4ML5 A;  3FI6 A;  1QGH A;  2C2U A;  4LPN A;  2WTL A;  2V2N A;  2V8T A;  3E2C A;  4TO9 A;  3AF7 X;  3KWO A;  3QZ3 A;  4LPJ A;  4KXR B;  3WNW A;  3AK8 A;  3QHB A;  1S30 A;  3EZU A;  3BVF A;  1JRE A;  5FFA A;  3A68 A;  1L8I A;  4Y08 A;  1OTK A;  3IS8 A;  3FRS A;  3BVL A;  2CLB A;  4TOH A;  2RBD A;  3KA8 A;  5FFB A;  3Q4Q A;  2Z5Q A;  5D8Y A;  4MKU A;  2CHP A;  2ZA6 A;  2GYD A;  4RC5 A;  2XJO A;  1JI4 A;  5E2D A;  2CLU A;  4RC5 B;  4ZJK A;  2V2M A;  5J9V A;  1MFR A;  3KX9 A;  2G4H A;  1EUM A;  1GWG A;  5HJF A;  3TA8 A;  5CMQ A;  3F34 A;  3PZA A;  3NOZ X;  1O9I A;  2JD7 0;  2ZA8 A;  2VXX A;  4DYZ A;  4PG1 A;  3AF8 X;  5JKL A;  2CN6 A;  3E1M A;  4KVQ A;  2OC5 A;  3E1L A;  4Z5S A;  2X17 0;  5K53 A;  3NP2 X;  2ZA7 A;  4ZKX A;  3R2R A;  4ISM A;  3KA6 A;  5HU6 D;  2FG4 A;  2ZG9 X;  5GU0 X;  2V2L A;  5AXS A;  2XKQ A;  3PWF A;  3W54 A;  4MY7 A;  3KA3 A;  4AM5 A;  5GU1 X;  4ITW A;  2BK6 A;  1H96 A;  3M6J A;  4RC7 A;  2BW1 A;  3NP0 X;  3MPS A;  4XKT A;  4RC7 B;  5FEJ A;  3PVY A;  2Z6M A;  3PW1 A;  4ZL6 A;  3PVY B;  1LKO A;  3PW8 A;  3N6O A;  3DBY A;  3PW1 B;  3U90 A;  3SH6 A;  4TOA A;  4ZKH A;  4ISP A;  2ITB A;  4ERU A;  4LQV A;  4R42 A;  4PGK A;  3WVV A;  2F7N A;  4CVT A;  1XZ1 A;  2VXI A;  2IY4 A;  3VNX A;  4X0J A;  2HR5 A;  3WVW A;  4AM2 A;  1TKP A;  3KA4 A;  3VVA A;  3R2K A;  1IES A;  5D8O A;  5HJH A;  1JIG A;  4TOE A;  2YJK A;  5JKM G;  3Q4R A;  3C21 A;  4ZKW A;  3F39 A;  2ZG8 X;  2BJY A;  4KVS A;  5D8R A;  3V3K B;  3BVE A;  2Z90 A;  1QYB A;  3BVI A;  2CF7 A;  5GOU A;  3E1O A;  1RYT A;  4DYY A;  2C41 A;  1HRS A;  4CYA A;  2FG8 A;  3T9J A;  1F33 A;  2V2O A;  4EVC A;  3E1J A;  2V2I A;  1JKU A;  2OH3 A;  4CMY V;  3BVK A;  3ISF A;  3ERZ A;  3D19 A;  1RCD A;  1VEL A;  4PG0 A;  2VZB A;  5FFD A;  5J93 A;  4U3G A;  1VLG A;  3E1N A;  4IXK A;  4W4K B;  1LB3 A;  3UOF A;  4M34 A;  2FFX J;  4XKU A;  1ZUJ A;  1F30 A;  1JYB A;  2JD6 0;  2CIH A;  4TOC A;  3R2H A;  3OJ5 A;  1ZS3 A;  1LKP A;  4DI0 A;  5JKM A;  4AM4 A;  2C2F A;  1J30 A;  3F37 A;  2YJJ A;  4LQH A;  3O7R A;  2FJC A;  2HTN A;  1LKM A;  2PYB A;  3FVB A;  5D8S A;  3KA9 A;  5LG8 A;  1R03 A;  3L0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...