3BVLA

Structural basis for the iron uptake mechanism of helicobacter pylori ferritin
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
172
structure length
172
Chain Sequence
HHSQDPMLSKDIIKLLNEQVNKEMNSSNLYMSMSSWCYTHSLDGAGLFLFDHAAEEYEHAKKLIIFLNENNVPVQLTSISAPEHKFEGLTQIFQKAYEHEQHISESINNIVDHAIKSKDHATFNFLQWYVAEQHEEEVLFKDILDKIELIGNENHGLYLADQYVKGIAKSRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferritin
publication title Structural basis for the iron uptake mechanism of Helicobacter pylori ferritin
rcsb
source organism Helicobacter pylori
molecule tags Oxidoreductase
total genus 79
structure length 172
sequence length 172
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.16.3.2: Bacterial non-heme ferritin.
pdb deposition date 2008-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3bvlA00
1JREA 1VEQA 5J8SA 2Z90A 4LYUA 3O7SA 1RCCA 4M33A 1RCGA 4LPMA 4ZTTA 4E6KA 5HJHA 3BVEA 2V2OA 1JTSA 1YUXA 2YJKA 4LQNA 3PW8A 3OJ5A 2V2NA 3AJOA 5GU3X 4MJYA 3HIUA 4RC5B 2D5KA 3F39A 2PYBA 3A68A 3SHXA 3NP2X 4Y08A 4DASA 4EVCA 3PW8C 3RBCA 1LKPA 1JGCA 3PVYA 3RE7A 4TOAA 4LYXA 2IY4A 4ETRA 5J93A 4TOFA 1J30A 3VNXA 5C6FA 4AM2A 3Q4QA 4RC6A 1XZ1A 3R2KA 4DYYA 4R42A 3E1NA 4M35A 2X170 3BVKA 4II4A 3R2HA 4DZ0A 1QGHA 5CMQA 3ERZA 4PG0A 1NNQA 1LKOA 3QHBA 3PW1A 4DE6A 2OC5A 5K53A 3F36A 5HQOA 5D8SA 5FFDA 2CHIA 5GN8B 2FL0A 2W0OA 1YV1A 2FG4A 4RC7B 5D8RA 3ISFA 1JI4A 2OH3A 3QVDA 3KA4A 3PWQC 3AJQA 4XKSA 2CEIA 3MPSA 3E1LA 4CVRA 2FG8A 2ZG8X 4Z3BA 4EVDA 2VZBA 5CZUA 1B71A 4ITWA 2Z5RA 4LPJA 4KVQA 3KWOA 4P18A 5GU1X 4TOEA 2WLUA 3R2MA 3UOFA 4TODA 3RAVA 3E1OA 2BJYA 4M32A 1JIGA 4RC8A 2QF9A 5K52A 4ZL6A 4AM4A 1AEWA 4IWJA 2XJNA 4PGKA 3BKNA 2YW6A 1SQ3A 3KA6A 1ZUJA 4LQJA 2Z6MA 2YJJA 3PVRA 5FFEA 3GHQA 1Z6OM 2YW7A 1JKUA 4DYXA 5J8WA 2V2IA 3WVUA 3GE4A 3QHCA 3R2RA 1TJOA 4KVSA 2F7NA 1IESA 1RCIA 2Z5PA 3IQ1A 2G4HA 4CMYV 1UMNA 4LQVA 3SE1A 2XGWA 3O7RA 3PZAA 5D8YA 2V2JA 3KA9A 2CHPA 3SH6A 4ITTA 4II4B 3R2OA 4MN9A 5IX6A 1VLGA 3FVBA 2BKCA 1O9IA 2V15A 1VJXA 5JKLG 2CLUA 2UX1A 3KA8A 4M34A 1NF4A 3FSEA 5I4JA 4XKUA 4AM5A 1FHAA 1DVBA 4EVEA 3RD0A 1RCDA 1ZS3A 3PWFA 5E2DA 4ML5A 4DYZA 3A9QA 3UNOA 5LG8A 2C6RA 3PVTA 2HTNA 1MFRA 4PG1A 5LG2A 1RCEA 4XKTA 5D8QA 2FZFA 3BVFA 2ZG9X 3KX9A 1TK6A 3QD8A 3AK8A 2VXIA 4DYUA 3BT5A 2JD80 4RC5A 4DI0A 3WVVA 2CF7A 2CN6A 3AJPA 4ZKHA 5ERKA 3Q4RA 3ISEA 2V2RA 4ZL5A 1JKVA 1VELA 2ZG7X 3IS7A 1BFRA 2V2LA 1S2ZA 3F37A 3WNWA 4LQHA 2WTLA 4QUWA 2C2JA 2IU2A 4CVTA 3H7GA 2XJMA 4ZJKA 4REUA 1R03A 4U3GA 1TKPA 3PVRB 1BG7A 4MKUA 2FHAA 1L8IA 2GYQA 4RC7A 4TOGA 3NP0X 3Q4OA 3KA3A 1NF6A 4KVRA 5CMRA 2JD60 2GS4A 2GYDA 4ZLWA 5D8XA 1H96A 3E1QA 4IWKA 5FEJA 4CVPA 2RBDA 1SOFA 4YKHA 2ZA7A 1EUMA 1JI5A 2Y3QA 3E1PA 4XGSA 2BW1A 3RGDA 1JYBA 3PVYB 4EVBA 1QYBA 5GU2X 5GU0X 1L8HA 2C41A 3WVWA 4TOBA 1LB3A 5JACA 4MUDA 5E1UA 4RC6B 3QZ3A 3FI6A 1DPSA 3E1JA 3EZ0A 5D8OA 3AK9A 5FFBA 3PVTB 4CYAA 4TO9A 3BVLA 5JKLA 1O9RA 4CMYA 3ES3A 2XKQA 3PW1B 3E1MA 3F38A 4TOHA 5J9VA 3Q4NA 4ZMCA 4ISMA 1VEIA 1BCFA 1GWGA 3QB9A 4TW3A 3EGMA 4LPNA 1XZ3A 4CVSA 3U90A 3KXUA 3E6RA 3NOZX 1F30A 5FFCA 3BVIA 2CN7A 2C2UA 3EZUA 3OGHA 1UVHA 1OTKA 4OYNA 3F34A 2IB0A 2XJOA 2HR5A 5FFAA 2QQYA 2V2MA 1N1QA 2Z5QA 2ZURX 4ERUA 2ITBA 2C2FA 1YUZA 3PWQA 2FKZA 3AF9X 5ERJA 1TKOA 4CY9A 3E6SA 3GVYA 3F32A 4IXKA 1NFVA 2ZA6A 3R2SA 3AF7X 1MOJA 4Z5SA 1Z6OA 4TOCA 3R2LA 3E2CA 5JKMA 1S3QA 5GOUA 5JKMG 3F35A 3AF8X 1LKMA 3TA8A 2V2SA 2CLBA 2WLAA 1S30A 4ZKWA 4MY7A 2FJCA 1DATA 5AXSA 1F33A 4PGIA 4ZKXA 4A25A 3F33A 5GN8A 1HRSA 1Z4AA 3HL1A 3IS8A 1RYTA 2V2PA 4ISPA 2VXXA 2JD70 3UOIA 3T9JA 2BK6A 5D8PA 5HJFA 5LS9A 1IERA 5LBHA 1KRQA 3SIDA 2CIHA 4CYBA 2FFXJ 2ZA8A
chains in the Genus database with same CATH superfamily
1JREA 1VEQA 5J8SA 2Z90A 4LYUA 3O7SA 1RCCA 4M33A 1RCGA 4LPMA 4ZTTA 4E6KA 5HJHA 3BVEA 2V2OA 1JTSA 1YUXA 2YJKA 4LQNA 3PW8A 3OJ5A 2V2NA 3AJOA 5GU3X 4MJYA 3HIUA 4RC5B 2D5KA 3F39A 3KDQA 2PYBA 3A68A 3SHXA 3NP2X 4Y08A 4DASA 4EVCA 3PW8C 4E40A 3RBCA 1LKPA 1JGCA 2V8UA 3PVYA 3RE7A 4TOAA 4LYXA 2IY4A 4ETRA 5J93A 4TOFA 1J30A 3VNXA 5C6FA 4AM2A 2WWXB 3Q4QA 4RC6A 1XZ1A 3R2KA 4DYYA 4R42A 3E1NA 4M35A 2X170 3BVKA 4II4A 3R2HA 4DZ0A 1QGHA 5CMQA 3ERZA 4PG0A 3C1ZA 1NNQA 1LKOA 3QHBA 3PW1A 4DE6A 2OC5A 5K53A 3F36A 5HQOA 5D8SA 5FFDA 2CHIA 5GN8B 2FL0A 2W0OA 1YV1A 2FG4A 4RC7B 5D8RA 3ISFA 1JI4A 5JDOB 2OKCA 2OH3A 3QVDA 3KA4A 3PWQC 3AJQA 4XKSA 2CEIA 3MPSA 3E1LA 4CVRA 2FG8A 2ZG8X 4Z3BA 4EVDA 2VZBA 5CZUA 1B71A 4ITWA 2Z5RA 4LPJA 4KVQA 3KWOA 4P18A 5GU1X 4TOEA 2WLUA 3R2MA 3UOFA 4TODA 3RAVA 3E1OA 2BJYA 4M32A 1JIGA 4RC8A 2QF9A 3C23A 5K52A 4ZL6A 4AM4A 4X0JA 3W54A 1AEWA 4IWJA 3M6JA 2XJNA 4PGKA 3BKNA 2YW6A 1SQ3A 3KA6A 1ZUJA 4LQJA 2Z6MA 2YJJA 3PVRA 5FFEA 3GHQA 1Z6OM 2YW7A 1JKUA 4DYXA 5J8WA 2V2IA 3WVUA 3GE4A 3QHCA 3R2RA 1TJOA 4KVSA 2F7NA 1IESA 1RCIA 2Z5PA 3C1YA 3IQ1A 2G4HA 4CMYV 1UMNA 4LQVA 3SE1A 2XGWA 3O7RA 3PZAA 5D8YA 2V2JA 3KA9A 2CHPA 3SH6A 4ITTA 4II4B 3R2OA 4MN9A 5IX6A 1VLGA 3FVBA 2BKCA 1O9IA 2V15A 1VJXA 5JKLG 2CLUA 2UX1A 3KA8A 4M34A 3C21A 1NF4A 3FSEA 5I4JA 4YVZA 5HU6D 4XKUA 4AM5A 1FHAA 3V3KB 3LKDA 4KXRB 3JZAB 1DVBA 4EVEA 3RD0A 1RCDA 1ZS3A 3PWFA 5E2DA 2G38B 4ML5A 4DYZA 3A9QA 3UNOA 5LG8A 2C6RA 3PVTA 2HTNA 1MFRA 4PG1A 5LG2A 3VV9A 1RCEA 4XKTA 5D8QA 3FRRA 2FZFA 3BVFA 2Y44A 2ZG9X 3KX9A 1TK6A 3JZ9A 3QD8A 3AK8A 2VXIA 4DYUA 3BT5A 2JD80 4RC5A 4DI0A 3WVVA 2CF7A 4W4LB 2CN6A 3AJPA 4ZKHA 5ERKA 4WJG4 3Q4RA 3ISEA 2V2RA 4ZL5A 1JKVA 1VELA 2ZG7X 3IS7A 1BFRA 3L0MA 2V2LA 1S2ZA 3F37A 3WNWA 4LQHA 2WTLA 4QUWA 4YXMA 2C2JA 2IU2A 4CVTA 3H7GA 2XJMA 4ZJKA 4REUA 1R03A 4U3GA 1TKPA 3PVRB 1BG7A 4MKUA 2FHAA 1L8IA 2GYQA 3UFBA 4RC7A 2V8TA 4TOGA 3NP0X 3Q4OA 2MGYA 3KA3A 1NF6A 4KVRA 5CMRA 2JD60 2GS4A 2GYDA 4ZLWA 5D8XA 1H96A 3E1QA 4IWKA 4W4KB 5FEJA 4CVPA 2RBDA 1SOFA 4YKHA 2ZA7A 1EUMA 1JI5A 2Y3QA 3E1PA 4XGSA 2BW1A 4YXJA 3RGDA 1JYBA 3PVYB 4EVBA 1QYBA 5GU2X 5GU0X 1L8HA 2C41A 3WVWA 4TOBA 1LB3A 5JACA 4MUDA 3KHKA 5E1UA 4RC6B 3QZ3A 3FI6A 3D19A 1DPSA 3E1JA 3EZ0A 5D8OA 3AK9A 5FFBA 3GGYA 3PVTB 4CYAA 4TO9A 3BVLA 5JKLA 1O9RA 4CMYA 2AR0A 3ES3A 2XKQA 3PW1B 3E1MA 3F38A 4TOHA 5J9VA 3Q4NA 4ZMCA 4ISMA 1VEIA 1BCFA 1GWGA 3QB9A 4TW3A 3N6OA 3EGMA 4LPNA 1XZ3A 4CVSA 3U90A 3KXUA 3E6RA 3NOZX 1F30A 5FFCA 3BVIA 3VVAA 3GGZA 2CN7A 2C2UA 3EZUA 3OGHA 1UVHA 1OTKA 2N02A 4OYNA 3F34A 2IB0A 2CWLA 2XJOA 2HR5A 5FFAA 2QQYA 2V2MA 1N1QA 2Z5QA 2ZURX 4ERUA 2ITBA 2C2FA 1YUZA 3PWQA 4MXPA 2FKZA 3AF9X 5ERJA 1TKOA 4CY9A 3E6SA 3GVYA 3F32A 4IXKA 1NFVA 2ZA6A 3R2SA 3AF7X 1MOJA 4Z5SA 3DBYA 1Z6OA 4TOCA 3R2LA 3E2CA 5JKMA 1S3QA 5GOUA 5JKMG 3F35A 3AF8X 1LKMA 3TA8A 2V2SA 2CLBA 2WLAA 1S30A 4ZKWA 4MY7A 2FJCA 1DATA 5AXSA 1F33A 4PGIA 4ZKXA 4A25A 3F33A 5GN8A 1HRSA 1Z4AA 3FRSA 3HL1A 3IS8A 1RYTA 2V2PA 4ISPA 2VXXA 2JD70 3UOIA 5JDOA 3T9JA 2BK6A 5D8PA 5HJFA 5LS9A 1IERA 5LBHA 1KRQA 3SIDA 2CIHA 4CYBA 2FFXJ 2ZA8A
chains in the Genus database with same CATH topology
1JREA 1VEQA 5J8SA 2Z90A 4LYUA 3O7SA 1RCCA 4M33A 1RCGA 4LPMA 4ZTTA 4E6KA 5HJHA 3BVEA 2V2OA 1JTSA 1YUXA 2YJKA 4LQNA 3PW8A 3OJ5A 2V2NA 3AJOA 5GU3X 4MJYA 3HIUA 4RC5B 2D5KA 3F39A 3KDQA 2PYBA 3A68A 3SHXA 3NP2X 4Y08A 4DASA 4EVCA 3PW8C 4E40A 3RBCA 1LKPA 1JGCA 2V8UA 3PVYA 3RE7A 4TOAA 4LYXA 2IY4A 4ETRA 5J93A 4TOFA 1J30A 3VNXA 5C6FA 4AM2A 2WWXB 3Q4QA 4RC6A 1XZ1A 3R2KA 4DYYA 4R42A 3E1NA 4M35A 2X170 3BVKA 4II4A 3R2HA 4DZ0A 1QGHA 5CMQA 3ERZA 4PG0A 3C1ZA 1NNQA 1LKOA 3QHBA 3PW1A 4DE6A 2OC5A 5K53A 3F36A 5HQOA 5D8SA 5FFDA 2CHIA 5GN8B 2FL0A 2W0OA 1YV1A 2FG4A 4RC7B 5D8RA 3ISFA 1JI4A 5JDOB 2OKCA 2OH3A 3QVDA 3KA4A 3PWQC 3AJQA 4XKSA 2CEIA 3MPSA 3E1LA 4CVRA 2FG8A 2ZG8X 4Z3BA 4EVDA 2VZBA 5CZUA 1B71A 4ITWA 2Z5RA 4LPJA 4KVQA 3KWOA 4P18A 5GU1X 4TOEA 2WLUA 3R2MA 3UOFA 4TODA 3RAVA 3E1OA 2BJYA 4M32A 1JIGA 4RC8A 2QF9A 3C23A 5K52A 4ZL6A 4AM4A 4X0JA 3W54A 1AEWA 4IWJA 3M6JA 2XJNA 4PGKA 3BKNA 2YW6A 1SQ3A 3KA6A 1ZUJA 4LQJA 2Z6MA 2YJJA 3PVRA 5FFEA 3GHQA 1Z6OM 2YW7A 1JKUA 4DYXA 5J8WA 2V2IA 3WVUA 3GE4A 3QHCA 3R2RA 1TJOA 4KVSA 2F7NA 1IESA 1RCIA 2Z5PA 3C1YA 3IQ1A 2G4HA 4CMYV 1UMNA 4LQVA 3SE1A 2XGWA 3O7RA 3PZAA 5D8YA 2V2JA 3KA9A 2CHPA 3SH6A 4ITTA 4II4B 3R2OA 4MN9A 5IX6A 1VLGA 3FVBA 2BKCA 1O9IA 2V15A 1VJXA 5JKLG 2CLUA 2UX1A 3KA8A 4M34A 3C21A 1NF4A 3FSEA 5I4JA 4YVZA 5HU6D 4XKUA 4AM5A 1FHAA 3V3KB 3LKDA 4KXRB 3JZAB 1DVBA 4EVEA 3RD0A 1RCDA 1ZS3A 3PWFA 5E2DA 2G38B 4ML5A 4DYZA 3A9QA 3UNOA 5LG8A 2C6RA 3PVTA 2HTNA 1MFRA 4PG1A 5LG2A 3VV9A 1RCEA 4XKTA 5D8QA 3FRRA 2FZFA 3BVFA 2Y44A 2ZG9X 3KX9A 1TK6A 3JZ9A 3QD8A 3AK8A 2VXIA 4DYUA 3BT5A 2JD80 4RC5A 4DI0A 3WVVA 2CF7A 4W4LB 2CN6A 3AJPA 4ZKHA 5ERKA 4WJG4 3Q4RA 3ISEA 2V2RA 4ZL5A 1JKVA 1VELA 2ZG7X 3IS7A 1BFRA 3L0MA 2V2LA 1S2ZA 3F37A 3WNWA 4LQHA 2WTLA 4QUWA 4YXMA 2C2JA 2IU2A 4CVTA 3H7GA 2XJMA 4ZJKA 4REUA 1R03A 4U3GA 1TKPA 3PVRB 1BG7A 4MKUA 2FHAA 1L8IA 2GYQA 3UFBA 4RC7A 2V8TA 4TOGA 3NP0X 3Q4OA 2MGYA 3KA3A 1NF6A 4KVRA 5CMRA 2JD60 2GS4A 2GYDA 4ZLWA 5D8XA 1H96A 3E1QA 4IWKA 4W4KB 5FEJA 4CVPA 2RBDA 1SOFA 4YKHA 2ZA7A 1EUMA 1JI5A 2Y3QA 3E1PA 4XGSA 2BW1A 4YXJA 3RGDA 1JYBA 3PVYB 4EVBA 1QYBA 5GU2X 5GU0X 1L8HA 2C41A 3WVWA 4TOBA 1LB3A 5JACA 4MUDA 3KHKA 5E1UA 4RC6B 3QZ3A 3FI6A 3D19A 1DPSA 3E1JA 3EZ0A 5D8OA 3AK9A 5FFBA 3GGYA 3PVTB 4CYAA 4TO9A 3BVLA 5JKLA 1O9RA 4CMYA 2AR0A 3ES3A 2XKQA 3PW1B 3E1MA 3F38A 4TOHA 5J9VA 3Q4NA 4ZMCA 4ISMA 1VEIA 1BCFA 1GWGA 3QB9A 4TW3A 3N6OA 3EGMA 4LPNA 1XZ3A 4CVSA 3U90A 3KXUA 3E6RA 3NOZX 1F30A 5FFCA 3BVIA 3VVAA 3GGZA 2CN7A 2C2UA 3EZUA 3OGHA 1UVHA 1OTKA 2N02A 4OYNA 3F34A 2IB0A 2CWLA 2XJOA 2HR5A 5FFAA 2QQYA 2V2MA 1N1QA 2Z5QA 2ZURX 4ERUA 2ITBA 2C2FA 1YUZA 3PWQA 4MXPA 2FKZA 3AF9X 5ERJA 1TKOA 4CY9A 3E6SA 3GVYA 3F32A 4IXKA 1NFVA 2ZA6A 3R2SA 3AF7X 1MOJA 4Z5SA 3DBYA 1Z6OA 4TOCA 3R2LA 3E2CA 5JKMA 1S3QA 5GOUA 5JKMG 3F35A 3AF8X 1LKMA 3TA8A 2V2SA 2CLBA 2WLAA 1S30A 4ZKWA 4MY7A 2FJCA 1DATA 5AXSA 1F33A 4PGIA 4ZKXA 4A25A 3F33A 5GN8A 1HRSA 1Z4AA 3FRSA 3HL1A 3IS8A 1RYTA 2V2PA 4ISPA 2VXXA 2JD70 3UOIA 5JDOA 3T9JA 2BK6A 5D8PA 5HJFA 5LS9A 1IERA 5LBHA 1KRQA 3SIDA 2CIHA 4CYBA 2FFXJ 2ZA8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JRE A;  1VEQ A;  5J8S A;  2Z90 A;  4LYU A;  3O7S A;  1RCC A;  4M33 A;  1RCG A;  4LPM A;  4ZTT A;  4E6K A;  5HJH A;  3BVE A;  2V2O A;  1JTS A;  1YUX A;  2YJK A;  4LQN A;  3PW8 A;  3OJ5 A;  2V2N A;  3AJO A;  5GU3 X;  4MJY A;  3HIU A;  4RC5 B;  2D5K A;  3F39 A;  2PYB A;  3A68 A;  3SHX A;  3NP2 X;  4Y08 A;  4DAS A;  4EVC A;  3PW8 C;  3RBC A;  1LKP A;  1JGC A;  3PVY A;  3RE7 A;  4TOA A;  4LYX A;  2IY4 A;  4ETR A;  5J93 A;  4TOF A;  1J30 A;  3VNX A;  5C6F A;  4AM2 A;  3Q4Q A;  4RC6 A;  1XZ1 A;  3R2K A;  4DYY A;  4R42 A;  3E1N A;  4M35 A;  2X17 0;  3BVK A;  4II4 A;  3R2H A;  4DZ0 A;  1QGH A;  5CMQ A;  3ERZ A;  4PG0 A;  1NNQ A;  1LKO A;  3QHB A;  3PW1 A;  4DE6 A;  2OC5 A;  5K53 A;  3F36 A;  5HQO A;  5D8S A;  5FFD A;  2CHI A;  5GN8 B;  2FL0 A;  2W0O A;  1YV1 A;  2FG4 A;  4RC7 B;  5D8R A;  3ISF A;  1JI4 A;  2OH3 A;  3QVD A;  3KA4 A;  3PWQ C;  3AJQ A;  4XKS A;  2CEI A;  3MPS A;  3E1L A;  4CVR A;  2FG8 A;  2ZG8 X;  4Z3B A;  4EVD A;  2VZB A;  5CZU A;  1B71 A;  4ITW A;  2Z5R A;  4LPJ A;  4KVQ A;  3KWO A;  4P18 A;  5GU1 X;  4TOE A;  2WLU A;  3R2M A;  3UOF A;  4TOD A;  3RAV A;  3E1O A;  2BJY A;  4M32 A;  1JIG A;  4RC8 A;  2QF9 A;  5K52 A;  4ZL6 A;  4AM4 A;  1AEW A;  4IWJ A;  2XJN A;  4PGK A;  3BKN A;  2YW6 A;  1SQ3 A;  3KA6 A;  1ZUJ A;  4LQJ A;  2Z6M A;  2YJJ A;  3PVR A;  5FFE A;  3GHQ A;  1Z6O M;  2YW7 A;  1JKU A;  4DYX A;  5J8W A;  2V2I A;  3WVU A;  3GE4 A;  3QHC A;  3R2R A;  1TJO A;  4KVS A;  2F7N A;  1IES A;  1RCI A;  2Z5P A;  3IQ1 A;  2G4H A;  4CMY V;  1UMN A;  4LQV A;  3SE1 A;  2XGW A;  3O7R A;  3PZA A;  5D8Y A;  2V2J A;  3KA9 A;  2CHP A;  3SH6 A;  4ITT A;  4II4 B;  3R2O A;  4MN9 A;  5IX6 A;  1VLG A;  3FVB A;  2BKC A;  1O9I A;  2V15 A;  1VJX A;  5JKL G;  2CLU A;  2UX1 A;  3KA8 A;  4M34 A;  1NF4 A;  3FSE A;  5I4J A;  4XKU A;  4AM5 A;  1FHA A;  1DVB A;  4EVE A;  3RD0 A;  1RCD A;  1ZS3 A;  3PWF A;  5E2D A;  4ML5 A;  4DYZ A;  3A9Q A;  3UNO A;  5LG8 A;  2C6R A;  3PVT A;  2HTN A;  1MFR A;  4PG1 A;  5LG2 A;  1RCE A;  4XKT A;  5D8Q A;  2FZF A;  3BVF A;  2ZG9 X;  3KX9 A;  1TK6 A;  3QD8 A;  3AK8 A;  2VXI A;  4DYU A;  3BT5 A;  2JD8 0;  4RC5 A;  4DI0 A;  3WVV A;  2CF7 A;  2CN6 A;  3AJP A;  4ZKH A;  5ERK A;  3Q4R A;  3ISE A;  2V2R A;  4ZL5 A;  1JKV A;  1VEL A;  2ZG7 X;  3IS7 A;  1BFR A;  2V2L A;  1S2Z A;  3F37 A;  3WNW A;  4LQH A;  2WTL A;  4QUW A;  2C2J A;  2IU2 A;  4CVT A;  3H7G A;  2XJM A;  4ZJK A;  4REU A;  1R03 A;  4U3G A;  1TKP A;  3PVR B;  1BG7 A;  4MKU A;  2FHA A;  1L8I A;  2GYQ A;  4RC7 A;  4TOG A;  3NP0 X;  3Q4O A;  3KA3 A;  1NF6 A;  4KVR A;  5CMR A;  2JD6 0;  2GS4 A;  2GYD A;  4ZLW A;  5D8X A;  1H96 A;  3E1Q A;  4IWK A;  5FEJ A;  4CVP A;  2RBD A;  1SOF A;  4YKH A;  2ZA7 A;  1EUM A;  1JI5 A;  2Y3Q A;  3E1P A;  4XGS A;  2BW1 A;  3RGD A;  1JYB A;  3PVY B;  4EVB A;  1QYB A;  5GU2 X;  5GU0 X;  1L8H A;  2C41 A;  3WVW A;  4TOB A;  1LB3 A;  5JAC A;  4MUD A;  5E1U A;  4RC6 B;  3QZ3 A;  3FI6 A;  1DPS A;  3E1J A;  3EZ0 A;  5D8O A;  3AK9 A;  5FFB A;  3PVT B;  4CYA A;  4TO9 A;  3BVL A;  5JKL A;  1O9R A;  4CMY A;  3ES3 A;  2XKQ A;  3PW1 B;  3E1M A;  3F38 A;  4TOH A;  5J9V A;  3Q4N A;  4ZMC A;  4ISM A;  1VEI A;  1BCF A;  1GWG A;  3QB9 A;  4TW3 A;  3EGM A;  4LPN A;  1XZ3 A;  4CVS A;  3U90 A;  3KXU A;  3E6R A;  3NOZ X;  1F30 A;  5FFC A;  3BVI A;  2CN7 A;  2C2U A;  3EZU A;  3OGH A;  1UVH A;  1OTK A;  4OYN A;  3F34 A;  2IB0 A;  2XJO A;  2HR5 A;  5FFA A;  2QQY A;  2V2M A;  1N1Q A;  2Z5Q A;  2ZUR X;  4ERU A;  2ITB A;  2C2F A;  1YUZ A;  3PWQ A;  2FKZ A;  3AF9 X;  5ERJ A;  1TKO A;  4CY9 A;  3E6S A;  3GVY A;  3F32 A;  4IXK A;  1NFV A;  2ZA6 A;  3R2S A;  3AF7 X;  1MOJ A;  4Z5S A;  1Z6O A;  4TOC A;  3R2L A;  3E2C A;  5JKM A;  1S3Q A;  5GOU A;  5JKM G;  3F35 A;  3AF8 X;  1LKM A;  3TA8 A;  2V2S A;  2CLB A;  2WLA A;  1S30 A;  4ZKW A;  4MY7 A;  2FJC A;  1DAT A;  5AXS A;  1F33 A;  4PGI A;  4ZKX A;  4A25 A;  3F33 A;  5GN8 A;  1HRS A;  1Z4A A;  3HL1 A;  3IS8 A;  1RYT A;  2V2P A;  4ISP A;  2VXX A;  2JD7 0;  3UOI A;  3T9J A;  2BK6 A;  5D8P A;  5HJF A;  5LS9 A;  1IER A;  5LBH A;  1KRQ A;  3SID A;  2CIH A;  4CYB A;  2FFX J;  2ZA8 A; 
#chains in the Genus database with same CATH topology
 1JRE A;  1VEQ A;  5J8S A;  2Z90 A;  4LYU A;  3O7S A;  1RCC A;  4M33 A;  1RCG A;  4LPM A;  4ZTT A;  4E6K A;  5HJH A;  3BVE A;  2V2O A;  1JTS A;  1YUX A;  2YJK A;  4LQN A;  3PW8 A;  3OJ5 A;  2V2N A;  3AJO A;  5GU3 X;  4MJY A;  3HIU A;  4RC5 B;  2D5K A;  3F39 A;  3KDQ A;  2PYB A;  3A68 A;  3SHX A;  3NP2 X;  4Y08 A;  4DAS A;  4EVC A;  3PW8 C;  4E40 A;  3RBC A;  1LKP A;  1JGC A;  2V8U A;  3PVY A;  3RE7 A;  4TOA A;  4LYX A;  2IY4 A;  4ETR A;  5J93 A;  4TOF A;  1J30 A;  3VNX A;  5C6F A;  4AM2 A;  2WWX B;  3Q4Q A;  4RC6 A;  1XZ1 A;  3R2K A;  4DYY A;  4R42 A;  3E1N A;  4M35 A;  2X17 0;  3BVK A;  4II4 A;  3R2H A;  4DZ0 A;  1QGH A;  5CMQ A;  3ERZ A;  4PG0 A;  3C1Z A;  1NNQ A;  1LKO A;  3QHB A;  3PW1 A;  4DE6 A;  2OC5 A;  5K53 A;  3F36 A;  5HQO A;  5D8S A;  5FFD A;  2CHI A;  5GN8 B;  2FL0 A;  2W0O A;  1YV1 A;  2FG4 A;  4RC7 B;  5D8R A;  3ISF A;  1JI4 A;  5JDO B;  2OKC A;  2OH3 A;  3QVD A;  3KA4 A;  3PWQ C;  3AJQ A;  4XKS A;  2CEI A;  3MPS A;  3E1L A;  4CVR A;  2FG8 A;  2ZG8 X;  4Z3B A;  4EVD A;  2VZB A;  5CZU A;  1B71 A;  4ITW A;  2Z5R A;  4LPJ A;  4KVQ A;  3KWO A;  4P18 A;  5GU1 X;  4TOE A;  2WLU A;  3R2M A;  3UOF A;  4TOD A;  3RAV A;  3E1O A;  2BJY A;  4M32 A;  1JIG A;  4RC8 A;  2QF9 A;  3C23 A;  5K52 A;  4ZL6 A;  4AM4 A;  4X0J A;  3W54 A;  1AEW A;  4IWJ A;  3M6J A;  2XJN A;  4PGK A;  3BKN A;  2YW6 A;  1SQ3 A;  3KA6 A;  1ZUJ A;  4LQJ A;  2Z6M A;  2YJJ A;  3PVR A;  5FFE A;  3GHQ A;  1Z6O M;  2YW7 A;  1JKU A;  4DYX A;  5J8W A;  2V2I A;  3WVU A;  3GE4 A;  3QHC A;  3R2R A;  1TJO A;  4KVS A;  2F7N A;  1IES A;  1RCI A;  2Z5P A;  3C1Y A;  3IQ1 A;  2G4H A;  4CMY V;  1UMN A;  4LQV A;  3SE1 A;  2XGW A;  3O7R A;  3PZA A;  5D8Y A;  2V2J A;  3KA9 A;  2CHP A;  3SH6 A;  4ITT A;  4II4 B;  3R2O A;  4MN9 A;  5IX6 A;  1VLG A;  3FVB A;  2BKC A;  1O9I A;  2V15 A;  1VJX A;  5JKL G;  2CLU A;  2UX1 A;  3KA8 A;  4M34 A;  3C21 A;  1NF4 A;  3FSE A;  5I4J A;  4YVZ A;  5HU6 D;  4XKU A;  4AM5 A;  1FHA A;  3V3K B;  3LKD A;  4KXR B;  3JZA B;  1DVB A;  4EVE A;  3RD0 A;  1RCD A;  1ZS3 A;  3PWF A;  5E2D A;  2G38 B;  4ML5 A;  4DYZ A;  3A9Q A;  3UNO A;  5LG8 A;  2C6R A;  3PVT A;  2HTN A;  1MFR A;  4PG1 A;  5LG2 A;  3VV9 A;  1RCE A;  4XKT A;  5D8Q A;  3FRR A;  2FZF A;  3BVF A;  2Y44 A;  2ZG9 X;  3KX9 A;  1TK6 A;  3JZ9 A;  3QD8 A;  3AK8 A;  2VXI A;  4DYU A;  3BT5 A;  2JD8 0;  4RC5 A;  4DI0 A;  3WVV A;  2CF7 A;  4W4L B;  2CN6 A;  3AJP A;  4ZKH A;  5ERK A;  4WJG 4;  3Q4R A;  3ISE A;  2V2R A;  4ZL5 A;  1JKV A;  1VEL A;  2ZG7 X;  3IS7 A;  1BFR A;  3L0M A;  2V2L A;  1S2Z A;  3F37 A;  3WNW A;  4LQH A;  2WTL A;  4QUW A;  4YXM A;  2C2J A;  2IU2 A;  4CVT A;  3H7G A;  2XJM A;  4ZJK A;  4REU A;  1R03 A;  4U3G A;  1TKP A;  3PVR B;  1BG7 A;  4MKU A;  2FHA A;  1L8I A;  2GYQ A;  3UFB A;  4RC7 A;  2V8T A;  4TOG A;  3NP0 X;  3Q4O A;  2MGY A;  3KA3 A;  1NF6 A;  4KVR A;  5CMR A;  2JD6 0;  2GS4 A;  2GYD A;  4ZLW A;  5D8X A;  1H96 A;  3E1Q A;  4IWK A;  4W4K B;  5FEJ A;  4CVP A;  2RBD A;  1SOF A;  4YKH A;  2ZA7 A;  1EUM A;  1JI5 A;  2Y3Q A;  3E1P A;  4XGS A;  2BW1 A;  4YXJ A;  3RGD A;  1JYB A;  3PVY B;  4EVB A;  1QYB A;  5GU2 X;  5GU0 X;  1L8H A;  2C41 A;  3WVW A;  4TOB A;  1LB3 A;  5JAC A;  4MUD A;  3KHK A;  5E1U A;  4RC6 B;  3QZ3 A;  3FI6 A;  3D19 A;  1DPS A;  3E1J A;  3EZ0 A;  5D8O A;  3AK9 A;  5FFB A;  3GGY A;  3PVT B;  4CYA A;  4TO9 A;  3BVL A;  5JKL A;  1O9R A;  4CMY A;  2AR0 A;  3ES3 A;  2XKQ A;  3PW1 B;  3E1M A;  3F38 A;  4TOH A;  5J9V A;  3Q4N A;  4ZMC A;  4ISM A;  1VEI A;  1BCF A;  1GWG A;  3QB9 A;  4TW3 A;  3N6O A;  3EGM A;  4LPN A;  1XZ3 A;  4CVS A;  3U90 A;  3KXU A;  3E6R A;  3NOZ X;  1F30 A;  5FFC A;  3BVI A;  3VVA A;  3GGZ A;  2CN7 A;  2C2U A;  3EZU A;  3OGH A;  1UVH A;  1OTK A;  2N02 A;  4OYN A;  3F34 A;  2IB0 A;  2CWL A;  2XJO A;  2HR5 A;  5FFA A;  2QQY A;  2V2M A;  1N1Q A;  2Z5Q A;  2ZUR X;  4ERU A;  2ITB A;  2C2F A;  1YUZ A;  3PWQ A;  4MXP A;  2FKZ A;  3AF9 X;  5ERJ A;  1TKO A;  4CY9 A;  3E6S A;  3GVY A;  3F32 A;  4IXK A;  1NFV A;  2ZA6 A;  3R2S A;  3AF7 X;  1MOJ A;  4Z5S A;  3DBY A;  1Z6O A;  4TOC A;  3R2L A;  3E2C A;  5JKM A;  1S3Q A;  5GOU A;  5JKM G;  3F35 A;  3AF8 X;  1LKM A;  3TA8 A;  2V2S A;  2CLB A;  2WLA A;  1S30 A;  4ZKW A;  4MY7 A;  2FJC A;  1DAT A;  5AXS A;  1F33 A;  4PGI A;  4ZKX A;  4A25 A;  3F33 A;  5GN8 A;  1HRS A;  1Z4A A;  3FRS A;  3HL1 A;  3IS8 A;  1RYT A;  2V2P A;  4ISP A;  2VXX A;  2JD7 0;  3UOI A;  5JDO A;  3T9J A;  2BK6 A;  5D8P A;  5HJF A;  5LS9 A;  1IER A;  5LBH A;  1KRQ A;  3SID A;  2CIH A;  4CYB A;  2FFX J;  2ZA8 A; 
#chains in the Genus database with same CATH homology
 1JRE A;  1VEQ A;  5J8S A;  2Z90 A;  4LYU A;  3O7S A;  1RCC A;  4M33 A;  1RCG A;  4LPM A;  4ZTT A;  4E6K A;  5HJH A;  3BVE A;  2V2O A;  1JTS A;  1YUX A;  2YJK A;  4LQN A;  3PW8 A;  3OJ5 A;  2V2N A;  3AJO A;  5GU3 X;  4MJY A;  3HIU A;  4RC5 B;  2D5K A;  3F39 A;  3KDQ A;  2PYB A;  3A68 A;  3SHX A;  3NP2 X;  4Y08 A;  4DAS A;  4EVC A;  3PW8 C;  4E40 A;  3RBC A;  1LKP A;  1JGC A;  2V8U A;  3PVY A;  3RE7 A;  4TOA A;  4LYX A;  2IY4 A;  4ETR A;  5J93 A;  4TOF A;  1J30 A;  3VNX A;  5C6F A;  4AM2 A;  2WWX B;  3Q4Q A;  4RC6 A;  1XZ1 A;  3R2K A;  4DYY A;  4R42 A;  3E1N A;  4M35 A;  2X17 0;  3BVK A;  4II4 A;  3R2H A;  4DZ0 A;  1QGH A;  5CMQ A;  3ERZ A;  4PG0 A;  3C1Z A;  1NNQ A;  1LKO A;  3QHB A;  3PW1 A;  4DE6 A;  2OC5 A;  5K53 A;  3F36 A;  5HQO A;  5D8S A;  5FFD A;  2CHI A;  5GN8 B;  2FL0 A;  2W0O A;  1YV1 A;  2FG4 A;  4RC7 B;  5D8R A;  3ISF A;  1JI4 A;  5JDO B;  2OKC A;  2OH3 A;  3QVD A;  3KA4 A;  3PWQ C;  3AJQ A;  4XKS A;  2CEI A;  3MPS A;  3E1L A;  4CVR A;  2FG8 A;  2ZG8 X;  4Z3B A;  4EVD A;  2VZB A;  5CZU A;  1B71 A;  4ITW A;  2Z5R A;  4LPJ A;  4KVQ A;  3KWO A;  4P18 A;  5GU1 X;  4TOE A;  2WLU A;  3R2M A;  3UOF A;  4TOD A;  3RAV A;  3E1O A;  2BJY A;  4M32 A;  1JIG A;  4RC8 A;  2QF9 A;  3C23 A;  5K52 A;  4ZL6 A;  4AM4 A;  4X0J A;  3W54 A;  1AEW A;  4IWJ A;  3M6J A;  2XJN A;  4PGK A;  3BKN A;  2YW6 A;  1SQ3 A;  3KA6 A;  1ZUJ A;  4LQJ A;  2Z6M A;  2YJJ A;  3PVR A;  5FFE A;  3GHQ A;  1Z6O M;  2YW7 A;  1JKU A;  4DYX A;  5J8W A;  2V2I A;  3WVU A;  3GE4 A;  3QHC A;  3R2R A;  1TJO A;  4KVS A;  2F7N A;  1IES A;  1RCI A;  2Z5P A;  3C1Y A;  3IQ1 A;  2G4H A;  4CMY V;  1UMN A;  4LQV A;  3SE1 A;  2XGW A;  3O7R A;  3PZA A;  5D8Y A;  2V2J A;  3KA9 A;  2CHP A;  3SH6 A;  4ITT A;  4II4 B;  3R2O A;  4MN9 A;  5IX6 A;  1VLG A;  3FVB A;  2BKC A;  1O9I A;  2V15 A;  1VJX A;  5JKL G;  2CLU A;  2UX1 A;  3KA8 A;  4M34 A;  3C21 A;  1NF4 A;  3FSE A;  5I4J A;  4YVZ A;  5HU6 D;  4XKU A;  4AM5 A;  1FHA A;  3V3K B;  3LKD A;  4KXR B;  3JZA B;  1DVB A;  4EVE A;  3RD0 A;  1RCD A;  1ZS3 A;  3PWF A;  5E2D A;  2G38 B;  4ML5 A;  4DYZ A;  3A9Q A;  3UNO A;  5LG8 A;  2C6R A;  3PVT A;  2HTN A;  1MFR A;  4PG1 A;  5LG2 A;  3VV9 A;  1RCE A;  4XKT A;  5D8Q A;  3FRR A;  2FZF A;  3BVF A;  2Y44 A;  2ZG9 X;  3KX9 A;  1TK6 A;  3JZ9 A;  3QD8 A;  3AK8 A;  2VXI A;  4DYU A;  3BT5 A;  2JD8 0;  4RC5 A;  4DI0 A;  3WVV A;  2CF7 A;  4W4L B;  2CN6 A;  3AJP A;  4ZKH A;  5ERK A;  4WJG 4;  3Q4R A;  3ISE A;  2V2R A;  4ZL5 A;  1JKV A;  1VEL A;  2ZG7 X;  3IS7 A;  1BFR A;  3L0M A;  2V2L A;  1S2Z A;  3F37 A;  3WNW A;  4LQH A;  2WTL A;  4QUW A;  4YXM A;  2C2J A;  2IU2 A;  4CVT A;  3H7G A;  2XJM A;  4ZJK A;  4REU A;  1R03 A;  4U3G A;  1TKP A;  3PVR B;  1BG7 A;  4MKU A;  2FHA A;  1L8I A;  2GYQ A;  3UFB A;  4RC7 A;  2V8T A;  4TOG A;  3NP0 X;  3Q4O A;  2MGY A;  3KA3 A;  1NF6 A;  4KVR A;  5CMR A;  2JD6 0;  2GS4 A;  2GYD A;  4ZLW A;  5D8X A;  1H96 A;  3E1Q A;  4IWK A;  4W4K B;  5FEJ A;  4CVP A;  2RBD A;  1SOF A;  4YKH A;  2ZA7 A;  1EUM A;  1JI5 A;  2Y3Q A;  3E1P A;  4XGS A;  2BW1 A;  4YXJ A;  3RGD A;  1JYB A;  3PVY B;  4EVB A;  1QYB A;  5GU2 X;  5GU0 X;  1L8H A;  2C41 A;  3WVW A;  4TOB A;  1LB3 A;  5JAC A;  4MUD A;  3KHK A;  5E1U A;  4RC6 B;  3QZ3 A;  3FI6 A;  3D19 A;  1DPS A;  3E1J A;  3EZ0 A;  5D8O A;  3AK9 A;  5FFB A;  3GGY A;  3PVT B;  4CYA A;  4TO9 A;  3BVL A;  5JKL A;  1O9R A;  4CMY A;  2AR0 A;  3ES3 A;  2XKQ A;  3PW1 B;  3E1M A;  3F38 A;  4TOH A;  5J9V A;  3Q4N A;  4ZMC A;  4ISM A;  1VEI A;  1BCF A;  1GWG A;  3QB9 A;  4TW3 A;  3N6O A;  3EGM A;  4LPN A;  1XZ3 A;  4CVS A;  3U90 A;  3KXU A;  3E6R A;  3NOZ X;  1F30 A;  5FFC A;  3BVI A;  3VVA A;  3GGZ A;  2CN7 A;  2C2U A;  3EZU A;  3OGH A;  1UVH A;  1OTK A;  2N02 A;  4OYN A;  3F34 A;  2IB0 A;  2CWL A;  2XJO A;  2HR5 A;  5FFA A;  2QQY A;  2V2M A;  1N1Q A;  2Z5Q A;  2ZUR X;  4ERU A;  2ITB A;  2C2F A;  1YUZ A;  3PWQ A;  4MXP A;  2FKZ A;  3AF9 X;  5ERJ A;  1TKO A;  4CY9 A;  3E6S A;  3GVY A;  3F32 A;  4IXK A;  1NFV A;  2ZA6 A;  3R2S A;  3AF7 X;  1MOJ A;  4Z5S A;  3DBY A;  1Z6O A;  4TOC A;  3R2L A;  3E2C A;  5JKM A;  1S3Q A;  5GOU A;  5JKM G;  3F35 A;  3AF8 X;  1LKM A;  3TA8 A;  2V2S A;  2CLB A;  2WLA A;  1S30 A;  4ZKW A;  4MY7 A;  2FJC A;  1DAT A;  5AXS A;  1F33 A;  4PGI A;  4ZKX A;  4A25 A;  3F33 A;  5GN8 A;  1HRS A;  1Z4A A;  3FRS A;  3HL1 A;  3IS8 A;  1RYT A;  2V2P A;  4ISP A;  2VXX A;  2JD7 0;  3UOI A;  5JDO A;  3T9J A;  2BK6 A;  5D8P A;  5HJF A;  5LS9 A;  1IER A;  5LBH A;  1KRQ A;  3SID A;  2CIH A;  4CYB A;  2FFX J;  2ZA8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...