3BW6A

Crystal structure of the longin domain of yeast ykt6
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
137
structure length
137
Chain Sequence
MAMRIYYIGVFRSGGEKALELSEVKDLSQFGFFERSSVGQFMTFFAETVASRTGAGQRQSIEEGNYIGHVYARSEGICGVLITDKEYPVRPAYTLLNKILDEYLVAHPKEEWADVTETNDALKMKQLDTYISKYQDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Synaptobrevin homolog YKT6
publication title Farnesylation of the SNARE protein Ykt6 increases its stability and helical folding.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 43
structure length 137
sequence length 137
ec nomenclature ec 2.3.1.-:
pdb deposition date 2008-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13774 Longin Regulated-SNARE-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.50 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3bw6A00
2NUPC 1IOUA 3BW6A 3EGDC 4B93A 2NUTC 3KYQA 3EGXC 1IFQA 2VX8A 2DMWA 1H8MA 4AFIA
chains in the Genus database with same CATH superfamily
2QJ7A 5A8BA 1K0KA 4WYYA 1YLYA 3BFFA 1OT9A 1RP5A 3DBAA 5I94A 1SDNA 3MXQA 2ACGA 2WADA 1G28A 3M2KA 4MBFA 2JKFA 4QY6A 2P04A 3RJUA 3IH9A 4Y15A 5HL1A 4Q0HA 1S66L 2WK0A 5DF9A 4E3JA 3ZG9B 5M18A 3AGDA 3H7WA 2HGVA 2PAVP 4E3OA 1ERMA 4ZJ2A 5A92A 4JGPA 3T50A 1WE4A 1IELA 2G2UA 2HP5A 5FDHA 1CJFA 5G18A 3W4QA 4RX2A 4AFIA 2ZQ9A 1CEGA 4HQAA 5F1FA 5DJUA 1YLZA 1MXOA 2WAFA 2XSSA 2OLUA 4E6WA 2LB5A 1F9IA 1K54A 3UN7A 1TDGA 4EBLA 4DJ3A 2EXBA 5E2FA 5HZHA 1FR1A 1K55A 4HH3A 3QP8A 4R6LA 3RTYA 3T4SA 2Y79A 3K3CA 1O7EA 3QP5A 4P85A 1LI9A 2Y2LA 3QP1A 3ZYTA 4EEUA 4OLDA 3S7OA 2ZM8A 1AXBA 4M4XA 3IX4A 2RCXA 3E2LA 2EX6A 1XA1A 5E2HA 3A0VA 2P08A 4LV1A 4LCMA 2JKTI 2A49A 1W8YA 3MZFA 4ZBEA 4E3MA 3H7WB 3VOZA 3VE4A 4BENA 4KZ9A 2MJ6A 3LCEA 1MKMA 3IF6A 2XD1A 4GNUA 4DDYA 2XA7S 5CRFA 4JF5A 3W8KA 3I7JA 1Q2QA 4R70A 3KSGA 3ZVWA 3UB6A 2B5RA 3M2JA 4BLMA 1ES2A 3HVFA 4NEED 1K38A 3N4IA 2ZOHA 2NUPC 2H0TA 4K08A 3C30A 5GHXA 2M1CA 5G4ZA 2WYXA 1CI8A 4LENA 5A93A 1SHVA 2ZQDA 1PRQA 3W2ZA 3K2NA 3GRJA 1DRMA 1F5MA 4EQ1A 1J9MA 1WYBA 3C2WA 3IXBA 4JGRA 3PBOA 5GL9A 4PM8A 3VOYA 1OTAA 5HAPA 4GDNA 3UMEA 1YMXA 4WF0A 4UA7A 2PDRA 5KSCA 5C5KA 1XJ6A 4GKUA 3WS1A 3NC8A 3ZG8B 2W3HA 2OAQ1 1SKOA 3IT9A 5K5BA 5IS1A 3AGFA 3O88A 4JXVA 1VM1A 1L0EA 3C7VA 1H8MA 3LIAA 5DTKA 2XGNA 2HV1A 2O9BA 1BLSA 4Y3IA 2H5SA 2ZM2A 5FQQA 5FL3A 4KUKA 4R4RA 4EESA 1CI9A 3IF6B 5EECA 2JKGA 2ZQ8A 4CLCE 3DTMA 4IVIA 3GVBA 4EEPA 3VMAA 4OPRA 1CK3A 2OLVA 4FH4A 1LHYA 1V9YA 2WZXA 4X55A 3EEAA 4LRZE 1L0DA 4X6TA 4I3JA 3G35A 1L2SA 4KZ3A 4QHCA 3HCYA 3UNWA 2H0YA 5DF7A 2QYBA 1YSPA 2BLSA 2PD7A 2V1BA 4CLCD 4C75A 2XRNA 3LEZA 2UWXA 4HJ3A 5F68A 1L3LA 3GTCA 4GN2A 3BM6A 1T1AA 1VETA 5HDSA 3NBLA 4MBHA 3CLOA 2K7SA 1VHMA 3UO9A 4OPZA 3IX8A 5U47A 3V39A 4GHIA 1IKGA 5J8XA 1D1JA 1HD8A 4CLCC 4DE1A 4G3VA 1YMSA 4KZ4A 1SKOB 3FKWA 3ZNTA 1G6AA 3FPVA 3TG9A 5DKKA 2ZBBA 3HUNA 1Y28A 4CLCB 2K2NA 4G3WA 4D2OA 3NHQA 1TDLA 3DWZA 4XT2A 4S2NC 3MFDA 3SS3A 3T1RA 1F2KA 3VSKA 1MWRA 4N92A 1E3UA 3E4QA 4P87A 3V50A 2Y59A 1YPRA 3MR0A 1NLZA 2JCHA 2OV5A 3IWQA 4II7A 4LRYC 3DTIA 4Y0TA 3LUQA 3SS5A 1YLPA 4FH2A 1FCOA 1VETB 3EWKA 4Y0OA 3SW1A 1TEMA 5FQJA 2EX8A 4K0WA 4WM9A 1IYQA 4QPRA 4XXRA 3G4PA 1LSWA 1E3UD 1YM1A 2XA7M 1V9ZA 4GHIB 4X68A 3UDIA 1P97A 3BW6A 2IWDA 3CPTA 4WN5A 3NCKA 5JYPA 1GSVA 1OT6A 5HL6A 2A24B 4QJGA 3WS5A 3CI6A 1DJCA 4OH0A 5E43A 3PHYA 3MQ0A 1IYSA 4IBRA 5GLBA 4DXCA 3D4FA 2WKPA 1BLCA 1PZPA 3SH9A 2Q0OA 3LY4A 1Q2PA 4XT2B 4UEYA 2I72A 4QWOA 4Z9QA 4PAUA 4KZ5A 2LB9A 3JYIA 3E0YA 1W8QA 4EBPA 5L10A 4X56A 1X0OA 5F83A 3BLSA 3TOIA 2ZC7A 3HLBA 3PXPA 4HBUA 4I39A 1ZG4A 3S4XA 1GA0A 3A3DA 1NZOA 4EBNA 4RA7A 4KZ8A 4JPMA 4OOMA 4WEJA 1XA7A 3T4KA 4BD0A 5HWWA 5AQ9A 3E4PA 2V0UA 4IUKA 4HJ4A 4Z1WA 1N4OA 4BL3A 1ZHHB 4OP8A 4MMNA 3B47A 1LL8A 3KSHA 1F98A 5FI2A 3TW8A 3ZG0A 1STZA 4LRXC 5DF8A 2QPNA 5CHMA 1PFLA 5HX9A 3CPTB 4I3AA 2ZC3B 3MJQA 4U0TA 3MXRA 3CG5A 1NWZA 1CQAA 1XJ3A 1XXMA 1LT0A 4LV0A 3GDIA 4FTXA 3PBQA 3C4PA 3NI9A 5MC7A 1DP6A 1VQQA 2XDMA 2WGVA 4E6XA 3JVVA 4OQGA 4IVKA 5FAPA 2OWJA 4JF4A 2ZMVA 1MWSA 5KIZA 4OPQA 3IQAA 4GB7A 1S4SA 4HESA 1IFQA 4PHTA 4R38A 4U0XA 1CF0A 1M6KA 1PWDA 2C5WB 2HJ9C 1WYCA 3OZHA 3E98A 1S4RA 1GSXA 3QHYA 5FEFA 5FSRA 2WAEA 3KSFA 1O07A 3FV7A 2L4RA 2ZMAA 3BFGA 2ZC4B 2EX2A 1W7FA 4F3LA 3MSHA 2EFXA 4R3JA 3IXHA 3KSIA 1ZG6A 3UDXA 3IF5A 2J3TD 1JWVA 4Q8IA 3ZG5A 4R3BA 2KOIA 2P9VB 4BMWA 2P74A 2QZ6A 3CAXA 4XUZA 2Y2HA 3Q82A 4DE2A 2WUQA 3VSLA 2WKRA 4NXBA 5HARA 1FCMA 4NK3A 4B93A 4Y7PA 4O8GA 3WWXA 1AWIA 1E4DA 4BBUA 4MN5A 3OPHA 2HDSA 3LR0A 2PU2A 2PYPA 2DCFA 3A0RA 5AVEA 2Q9NA 4ETZA 4CQHA 5E2EA 5L07A 4EERA 2W27A 3G31A 3FZCA 5FQ9A 3P98A 2VV7A 1SKFA 1ZC2A 3H9WA 2QWSA 1ESIA 1PYYA 4WMCA 1PI5A 3UMDA 3IS2A 3KYEA 4LPZA 3R7WB 4DJ2A 4BBTA 1LL9A 3LIBA 4F3LB 4PMAA 1JTGA 2ZD8A 3GSGA 4ARZA 4X53A 5TFQA 2Y2KA 1OTIA 2HP6A 2VGKA 5EM0A 4HI4A 4H6JA 3BJNA 4DXBA 4ESPA 4F94A 3M6HA 4EU0A 3JPUA 4WMCD 3OPRA 3U4LP 1ZKJA 3O87A 4WZ5C 4O7DA 1MY8A 3PBNA 2Y2NA 5FI6A 4JGOA 1WA9A 4KQOA 2X01A 5FI7A 5FQMA 1BLHA 3V3SA 1SDEA 2PU4A 1NJ4A 3NECA 1K6SA 3Q81A 3IXGA 4CJNA 3L9KA 4Q0JA 2VKSA 4GOGA 1OTEA 3VP1A 5EOEA 5FQIA 1J3WA 3EQUA 3IBJA 3MKEA 5HDDA 1XFQA 1M40A 4DMZA 1T18A 2ZL1A 4EW7A 3EGDC 3QNCA 2VK3A 1YKDA 4S2PA 2VJWA 4OQ0A 4DE0A 1XJ2A 4S2MA 3ZQ5A 1QMFA 4OLGA 2WGWA 4DN0A 2Y4AA 3HJIA 4ARZB 1XGJA 4WZ4A 2KDKA 4OP5A 2V8FA 4ZJ3A 4I5SA 1K54C 3WS2A 3UPPA 2ZMFA 1I2WA 4PM9A 3FKVA 3O3VA 1IEMA 2PD8A 2HP9A 4H6JB 4HP9A 3T1QB 4QB8A 1EI5A 1K55C 2Z6CA 4HIAA 4PPRA 4MDZA 1H8YA 1NYMA 2ZM0A 2J9OA 5HD3A 3GECA 4ZDXA 4FOFA 1NZUA 3CITA 1P0ZA 4Y2FA 4O0PA 3UY6A 1ES4A 3VE3A 5HAIA 1H8ZA 3C5AA 4P6ZS 5F69A 2W0NA 4GW9A 1SCWA 1XX2A 1YLWA 3SH7A 3KX0X 2JBFA 3DW0A 3IHAA 4K0XA 1TS6A 2ZL1B 3IF6C 5IU1A 4QU3A 3A0SA 4OOLA 1HVBA 4E3KA 2WGWB 2GZAA 4O01A 1XKZA 3FWLA 3HJKA 2ZQCA 1DP8A 3LR4A 1VEUA 1BTLA 3LFVA 2BASA 4KZBA 2PBDP 5GLAA 4IEDA 1KGFA 2Y2PA 1PW1A 1K56A 2IA2A 2EFUA 4MN7A 4E3LA 4Y17A 2W1TA 1K57A 3PAGA 1UGUA 3PBTA 3LICA 3UB5P 4KQDA 3T1SA 4NKPA 2WZZA 5DFXA 3OCNA 3N7WA 3DTEA 5IHVA 3LR5A 5BOHA 2JN7A 2V9AA 3C4OA 1H5XA 5KMWA 2ZQ7A 4NXGA 2ZC6B 5GLCA 3OBFA 2Y2MA 2K31A 3SS4A 2L1MA 3Q07A 3D3OA 1K56D 3N8LA 3MKFA 3V3RA 3LGOA 4N1HA 4X69A 1GHMA 3ULFA 4PKYG 4HHDA 3IWOA 3QNBA 1T1BA 2XK1A 2OWHA 3NOTC 1XGIA 1BZAA 4E3IA 4ZRRA 2W3EA 1OTBA 4DKIA 1LLBA 2J80A 3BYDA 1Z09A 3F1NA 4JF6A 4YNRA 3SH8A 4CPKA 4HNBA 3C8CA 4ZTKA 4LV3A 1N9LA 4B9OA 1PNEA 1DY6A 4R1GA 2G7UA 2R9XA 4KUOA 3LY3A 5J4EA 4OVDA 2VLGA 1BYWA 2EA9A 5EVIA 4OQHA 3NOUC 3VP4A 1D06A 4FCFA 1KE4A 2W1TB 3HLFA 2WKHA 1YLJA 4EXOA 3ITAA 4EUVA 2XF3A 3A3EA 4DF6A 3HL9A 3ZVTA 3L7HA 1P9WA 3MQQA 5TBMA 3PR6A 1RGYA 2ZQAA 3UE6A 3UE3A 4L9FA 3T4QA 3T1XA 2HZ5A 2XH9A 3LI8A 1I5QA 1D7EA 3T4TA 1Z6FA 4N1XA 4JGQA 5EVID 4E3NA 1JWPA 3HLCA 5AQ7A 3PBSA 5CERA 2ZOIA 3B42A 5FA7A 2VEAA 4WELA 3UE0A 1ODVA 5FEGA 3F1NB 5EV0A 3LIEA 5AVFA 5HPIA 2EXAA 5EVIC 3ZFZA 2YKFA 1TF1A 3IHBA 5FASA 4ZJ1A 4JKTA 4IHQA 1XJ4A 4P6ZM 1NY0A 3NULA 4XUXA 2XFSA 5EVIB 3HLEA 4X1MA 3N6IA 2JKTM 2ZJ9A 1TS8A 4UAAA 4YOFA 1IOUA 3A3FA 4BWIA 2QJ5A 3G2YA 5L2FA 2WKIA 3A3IA 4GLQA 1FSYA 2DMWA 2Y2JA 4JXSA 5TBMB 1JVJA 2INWA 3IWIA 4ME4A 1BSGA 4ETXA 5GHZA 1MC0A 3H82A 5HAQA 3Q7ZA 3G32A 1IYOA 1JWZA 1K6RA 5EPHA 2KLIA 5I5LA 1ONHA 2XROA 3B33A 4DE3A 2FZ0A 4EQIA 5DFYA 3T12B 3OCLA 1OJGA 1HLUP 2Z2MB 2NUTC 4FUWA 4S2JA 5EUAA 1FSWA 1G6OA 4HP4A 3MBZA 3F1OA 5DVAA 3SZTA 3TE8A 4KZ6A 2PR5A 3LR3A 1N9NA 4UA9A 5F82A 2D02A 2Z2LB 3C7UA 2FH5A 4LCLA 5A91A 3BFEA 2RL3A 1MPLA 2H28A 2V8CA 2UV0E 4P6BA 3P7NA 4RX3A 3G30A 4S2IA 4L0LA 1GSWA 2WKEA 3K3DA 5KZHA 5HD5A 4H8RA 5HDCA 1GHIA 1S67L 2P7JA 4KENB 3H82B 3NDEA 3MXSA 4G3KA 4DDSA 3BLMA 4QD4A 3ICYA 4KZAA 4S2OA 3SOIA 3FG8A 4GZBA 5G4YA 2Q9MA 1FCNA 2A2LA 3IX3A 1LSVA 4E04A 4JXWA 3V67A 4HOIA 2WKQA 1W79A 1OJ5A 3IXDA 3WRZA 1KGEA 4U3TA 1XFNA 3RFBA 2J3TC 1L0GA 3E4OA 1PIOA 4PM7A 1IYPA 4LGWA 3F1OB 3HREA 4GDBA 5TR7A 1PZOA 2OSUA 3G34A 4I38A 5TJJA 3S1YA 5CHUA 1NRFA 1W63M 3LI9A 1XP4A 3LIDA 3D72A 3IH8A 1JTDA 1YLTA 4QY5A 3ITBA 1S1ZA 3VOLA 3T4JA 2O99A 2O0YA 5CX7A 4OPYA 3R4KA 3C38A 2EX9A 1JNUA 2C6WB 3MF0A 2Y2IA 1EWZA 3EOIA 5CXWA 1PWGA 2HDRA 3UPNA 3RXXA 2J7VA 1W63Q 4GJ4A 3G6OA 2Y55A 2XQZA 5M19A 1KDSA 3GV9A 5EE8A 3MQOA 4KG2A 4NXFA 2I9VA 2PR6A 2JKRM 2E8IA 1MKIA 3LYXA 2IWCA 5KSHA 3OPPA 3BRMA 3LEQA 5L8MA 1PI4A 4KQQA 4HEFA 2PT7A 2V1ZA 4OKPA 3TSGA 4YFMA 2Y2OA 1K4EA 2FFYA 4GD6A 3F1PA 1EROA 2Y2QA 1FIKA 3WRTA 4S2KA 1PWCA 2AVXA 1FR6A 4I3IA 2W3GA 3IS2B 2YKHA 1ONGA 2OAP1 1N9OA 3NY4A 1MBLA 3E2KA 5CGWA 5FDSA 5CEBA 3JVUA 1H3QA 1TS7A 5CECA 1BT5A 2VV6A 3HUMA 2VGLS 4N9LA 3A3JA 4GCZA 4UQIS 1KE3A 2O9CA 1P9RA 4X1LA 2O9AA 1LI0A 1C3BA 2JC7A 2QKPA 3KYZA 4WEKA 2OOLA 1H0MA 1N9BA 3IBRA 3BEBA 3MMHA 3HLGA 4BQMA 4K91A 3BY8A 5TGFA 3O86A 3ZNYA 3LO7A 4D60A 2X71A 4Y5FA 1RCJA 4MEZA 3S7PA 2R78A 1ZTUA 3S22A 4WLAA 5DJTA 4KQRA 2XLNA 1ES5A 3UB7A 3B3XA 5A90A 2XEPA 5EM1A 5AQBA 4FD8A 5DTTA 4FSFA 1W5DA 3T4LA 2QHKA 1UWNX 3UB8A 1DJBA 4N9KA 4MBKA 3F1PB 3MFXA 1QMEA 2PYRA 5CEDA 3W4OA 3TRCA 3GR2A 3PBRA 3P01A 1G68A 5GLDA 3G2ZA 3CHWP 3BWLA 5FQKA 2EWVA 4HBTA 2Y8HA 3FPWA 3ZCZA 2DRWA 1T19A 1YT4A 1RGZA 1GHPA 3DAVA 1MWTA 1TS0A 4RVAA 4R0QA 5GHYA 4CLCA 2L0WA 4MN6A 2KX6A 4R23A 1K25A 1KDWA 4UA6A 5FAQA 2M7UA 3CWFA 4Y0UA 3OC2A 3CMZA 5JYOA 1PW8A 3KO6A 3T4OA 3EGXC 1Y54A 3GMWA 4S2NA 2CMNA 4IBXA 4BBVA 3UDFA 4C6YA 2H10A 3CUEA 3RH8B 1ES3A 1ACFA 2JE5A 5HWVA 1BUEA 4RYEA 4R4SA 3MZEA 3Q7VA 3QP2A 3VP0A 1IKIA 1KVMA 4JBFA 4GS9A 1TD5A 4YINA 2X02A 4HJ6A 4L9GA 4PM6A 2J3WA 3MS6A 4GD8A 4R3AA 4Q0IA 3KYQA 4JLFA 2PHYA 3FYZA 3N8RA 3BY9A 3Q1FA 4EUZA 5DTSA 2G2WA 3BECA 2HPBA 3BFDA 4X25A 3UE1A 3ZDJA 4IJGA 2A24A 1DP9A 4MCWA 5FATA 3GQZA 3N8SA 3OOVA 2R9WA 4WUJA 5HPFA 1FQGA 1FOFA 2B18A 3NIAA 1T1CA 5CGXA 1VEUB 5EFWA 4S2LA 4OONA 4HY8A 2V0WA 3HLDA 3CUEC 1K57C 3OLOA 1LL5A 4UHUA 3O5YA 5DKLA 1ERQA 4MLLA 2V20A 2V1AA 2A3UA 2PRFA 1S6RA 4BJPA 2WGIA 3Q7VB 2GNXA 1KOUA 2VGLM 1UWPX 1NLYA 4GS9B 4UQIM 4KG5A 1CEFA 3AGEA 3HLWA 5CGSA 2JHEA 5HSQA 2GX5A 5CHJA 2HDQA 4B88A 2ZC5B 2DNSA 3UPOA 2E8JA 5J7EA 4JXGA 3HBRA 4YWZA 3DTKA 3DWKA 4C3QA 4EWFA 2W3FA 1NXYA 4PKYA 3BQAA 4LV2A 2JKRI 2VX8A 4EV4A 1S0WA 1YQSA 3VFFA 1YAXA 4BL2A 3VV4A 2GJ3A 3PYPA 4NG2A 4OOYA 4HH2A 5FAOA 1L0FA 1OPXA 1KGGA 2GDNA 1Y4OA 3HUOA 4L9EA 5F5YA 2VZWA 1GA9A 3LIFA 3VP3A 2HJEA 3ZG7B 3PTEA 4LFUA 2QMIA 4LLOB 4ID4A 4WL9A 2B95A 3WS4A 4MNRA 1GCEA 2VA0A 2VGJA 5M1AA 4Y13A 2HF6A 5J3WA 1BULA 5F6AA 1HTZA 5E2GA 3D9YA 3VFHA 5CTMA 4M3KA 2M7VA 5D3OA 5AQAA 4KZ7A 1MZUA 5LBRA 5L09A 1KVLA 2CC1A 3W4PA 2B02A 1ALQA 2XD5A 1NYYA 1OMEA 1EW0A 2P9VA 2Y2GA 5EVLA 1NRJA 3OPLA 2PBYA 3FC7A 3M6BA 2V2FF 3BFCA 2W3DA 1DJAA 4BD1A 4B4XA 2J8YA 1ESUA 4KG6A 4NXEA 4B4ZA 4ZAMA 3RXWA 3MZDA 2Y91A 1KE0A 2ZLYA 5IT5A 2J9PA 4P0MA 1MWUA 1K4FA 5HW3A 1YSQA 2BG1A 3WS0A 1I2SA 2W1RA 3CZDA 1XPBA 3ZHHA 1S1YA 1E25A 3NJAA 3PAEA 2FFFB 2IWBA 3CJMA 5HFOA 3R7WA 3NDGA 3TJZC 1SZVA 1U60A 4NETA 3UB9A 4A5RA 2Z6DA 1VB6A 4OQIA 1OTDA 1A0KA 3EEHA 4DRTA 3QP6A 3BQ8A 1FILA 5HWTA 3P09A 3S7NA 3ISGA 5EOOA 2VV8A 2HDUA 5EVEA 4WBGA 5CTNA 3ZGAB 5AJGA 1G5UA 2XR0A 4PM5A 3QP4A 5F1GA 1LSXA 1TVFA 2BTFP 1BLPA 1HZOA 4RQ9A 2XFTA 3EQVA 4EETB 2D01A 3U2AA 3NOPC 3VP2A 4WZ5A 3V5MA 2EWWA 4IUHA 3S7QA
chains in the Genus database with same CATH topology
1OTBA 2QJ7A 1ZTUA 4LRXC 2J80A 5A8BA 3F1NA 4YNRA 4WLAA 5DJTA 4HNBA 3C8CA 1N9LA 4I3AA 3UB7A 3MJQA 4B9OA 1OT9A 3DBAA 2G7UA 3MXQA 4KUOA 1NWZA 1G28A 5J4EA 4FSFA 2P04A 1XJ3A 2VLGA 1BYWA 2EA9A 3T4LA 2QHKA 1LT0A 3GDIA 3NOUC 1UWNX 4Q0HA 1S66L 3UB8A 1D06A 5DF9A 3PBQA 3F1PB 3MFXA 3H7WA 2HGVA 5MC7A 2PYRA 1DP6A 3TRCA 3PBRA 2W1TB 3P01A 3BWLA 4EXOA 2EWVA 3JVVA 2Y8HA 4JGPA 3T50A 2OWJA 4EUVA 2ZMVA 1P9WA 3FPWA 1T19A 3MQQA 5TBMA 3PR6A 5KIZA 4AFIA 3UE6A 3UE3A 4L9FA 3T4QA 4HQAA 1S4SA 1TS0A 1IFQA 4PHTA 4R38A 5DJUA 3LI8A 1D7EA 3T4TA 2XSSA 4CLCA 2L0WA 4MN6A 2LB5A 2KX6A 2HJ9C 4JGQA 1F9IA 3E98A 2M7UA 4DJ3A 3CWFA 3PBSA 2ZOIA 3B42A 5HZHA 3OC2A 1S4RA 1GSXA 3KO6A 4HH3A 4R6LA 3RTYA 3KSFA 2VEAA 2L4RA 3T4SA 3T4OA 2Y79A 3EGXC 3K3CA 4WELA 2CMNA 1ODVA 4BBVA 3CUEA 4F3LA 3RH8B 3F1NB 3ZYTA 4EEUA 3S7OA 3LIEA 5AVFA 5HPIA 5HWVA 3KSIA 2YKFA 1TF1A 2J3TD 4M4XA 2KOIA 4BMWA 4GS9A 4IHQA 1TD5A 1XJ4A 3CAXA 4P6ZM 3A0VA 2P08A 4HJ6A 4L9GA 2JKTI 2J3WA 2WKRA 4R3AA 4Q0IA 4NXBA 2JKTM 1TS8A 3KYQA 3H7WB 3VE4A 2PHYA 4O8GA 4YOFA 4B93A 1IOUA 4BBUA 4BWIA 2MJ6A 4MN5A 2QJ5A 3BY9A 1MKMA 3LR0A 2PYPA 4GLQA 2DMWA 2XA7S 3A0RA 5AVEA 5TBMB 4R70A 4ETZA 2INWA 4CQHA 3KSGA 4IJGA 3UB6A 2A24A 1DP9A 4MCWA 4NEED 4EERA 2W27A 4ME4A 3OOVA 2ZOHA 4WUJA 4ETXA 2NUPC 5HPFA 1MC0A 2VV7A 3H82A 4K08A 3C30A 2M1CA 2B18A 3H9WA 1T1CA 2QWSA 5G4ZA 5EFWA 4HY8A 2V0WA 3W2ZA 2KLIA 3CUEC 1DRMA 1F5MA 3IS2A 3K2NA 3OLOA 5I5LA 3UMDA 2XROA 4EQ1A 4LPZA 3O5YA 5DKLA 4JGRA 3C2WA 3PBOA 3B33A 3R7WB 4DJ2A 2FZ0A 5DFYA 4BBTA 3OCLA 1OJGA 1OTAA 3LIBA 3UMEA 2NUTC 4F3LB 4WF0A 2V1AA 2PDRA 5C5KA 1G6OA 4HP4A 4ARZA 4BJPA 1XJ6A 3F1OA 2GNXA 1KOUA 2VGLM 2W3HA 3TE8A 2OAQ1 1UWPX 5K5BA 5IS1A 2PR5A 1NLYA 3LR3A 4GS9B 1N9NA 4UQIM 2D02A 2JHEA 5HSQA 2FH5A 2GX5A 1OTIA 4HI4A 4H6JA 1H8MA 2H28A 3BJNA 3LIAA 5J7EA 3P7NA 4EU0A 4YWZA 2HV1A 2O9BA 4Y3IA 2W3FA 4PKYA 5FL3A 3BQAA 4KUKA 4EESA 3PBNA 4L0LA 2JKRI 2VX8A 4CLCE 1GSWA 4JGOA 1WA9A 4EEPA 4KQOA 3K3DA 5HD5A 1YAXA 5HDCA 1V9YA 3EEAA 4LRZE 3VV4A 2GJ3A 1S67L 3PYPA 4Q0JA 4I3JA 2P7JA 4HH2A 3H82B 3HCYA 2VKSA 1OPXA 1OTEA 4G3KA 2QYBA 1YSPA 2PD7A 3IBJA 3EQUA 2V1BA 4L9EA 3ICYA 5F5YA 5HDDA 4CLCD 1XFQA 2VZWA 2XRNA 4DMZA 3FG8A 1T18A 4HJ3A 5F68A 5G4YA 2A2LA 1LSVA 4EW7A 4E04A 1T1AA 3EGDC 5HDSA 3V67A 4HOIA 2WKQA 3CLOA 3LIFA 1OJ5A 2HJEA 1YKDA 2K7SA 1VHMA 2VJWA 1XJ2A 1XFNA 3RFBA 3ZQ5A 4LLOB 2J3TC 3E4OA 4GHIA 4DN0A 4WL9A 3HJIA 4ARZB 4IUHA 3F1OB 4CLCC 4G3VA 2KDKA 2VA0A 4I38A 4I5SA 5TJJA 3FPVA 2ZMFA 2HF6A 5DKKA 5J3WA 2ZBBA 1W63M 2PD8A 5F6AA 1Y28A 3LI9A 4CLCB 2K2NA 4H6JB 4HP9A 3LIDA 4G3WA 2M7VA 3D72A 2Z6CA 4HIAA 3NHQA 4MDZA 1MZUA 4XT2A 5LBRA 5HD3A 2B02A 3GECA 1S1ZA 3VOLA 3T4JA 4FOFA 2O99A 3CITA 1P0ZA 1EW0A 2O0YA 3E4QA 5CX7A 4Y2FA 3R4KA 4O0PA 3C38A 3VE3A 1NRJA 1JNUA 3MR0A 3MF0A 4P6ZS 3EOIA 3FC7A 5F69A 1NLZA 2W0NA 4GW9A 2W3DA 3S7QA 3KX0X 4II7A 4LRYC 1TS6A 1W63Q 3LUQA 3EWKA 4GJ4A 4NXEA 5IU1A 3G6OA 3SW1A 3A0SA 4OOLA 4QPRA 3MQOA 4NXFA 1LSWA 2I9VA 2XA7M 1V9ZA 4GHIB 2PR6A 5IT5A 2JKRM 2GZAA 3LYXA 4O01A 1P97A 5KSHA 3BW6A 4WN5A 1YSQA 1GSVA 1OT6A 5HL6A 5L8MA 3HJKA 1DP8A 2PT7A 2A24B 3CI6A 3PHYA 3S7PA 3MQ0A 3LR4A 2W1RA 2BASA 3LFVA 2WKPA 1S1YA 3NJAA 3F1PA 2IA2A 4MN7A 3R7WA 4XT2B 2W1TA 4UEYA 4PAUA 3TJZC 4I3IA 3UB9A 2W3GA 3IS2B 2Z6DA 2LB9A 2YKHA 1VB6A 2OAP1 1N9OA 1UGUA 3E0YA 3PBTA 3LICA 1OTDA 4KQDA 1X0OA 4NKPA 5DFXA 3EEHA 3JVUA 3OCNA 1H3QA 1TS7A 3BQ8A 2VV6A 2VGLS 3PXPA 5HWTA 3S7NA 2VV8A 3LR5A 4I39A 2JN7A 4GCZA 2V9AA 4UQIS 2O9CA 1P9RA 2O9AA 4NXGA 2QKPA 3OBFA 5AJGA 4OOMA 4WEJA 3KYZA 2K31A 4WEKA 2OOLA 2L1MA 3IBRA 3D3OA 3T4KA 3MMHA 5HWWA 1LSXA 3ULFA 4PKYG 3E4PA 2V0UA 3BY8A 4IUKA 4HHDA 4RQ9A 4HJ4A 3EQVA 4EETB 1T1BA 2D01A 4Z1WA 2OWHA 1ZHHB 3U2AA 4MMNA 3NOPC 3NOTC 3B47A 1LL8A 4Y5FA 3KSHA 1F98A 4ZRRA 3TW8A 2EWWA 2W3EA 2R78A 1STZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NUP C;  1IOU A;  3BW6 A;  3EGD C;  4B93 A;  2NUT C;  3KYQ A;  3EGX C;  1IFQ A;  2VX8 A;  2DMW A;  1H8M A;  4AFI A; 
#chains in the Genus database with same CATH topology
 2QJ7 A;  5A8B A;  1K0K A;  4WYY A;  1YLY A;  3BFF A;  1OT9 A;  1RP5 A;  3DBA A;  5I94 A;  1SDN A;  3MXQ A;  2ACG A;  2WAD A;  1G28 A;  3M2K A;  4MBF A;  2JKF A;  4QY6 A;  2P04 A;  3RJU A;  3IH9 A;  4Y15 A;  5HL1 A;  4Q0H A;  1S66 L;  2WK0 A;  5DF9 A;  4E3J A;  3ZG9 B;  5M18 A;  3AGD A;  3H7W A;  2HGV A;  2PAV P;  4E3O A;  1ERM A;  4ZJ2 A;  5A92 A;  4JGP A;  3T50 A;  1WE4 A;  1IEL A;  2G2U A;  2HP5 A;  5FDH A;  1CJF A;  5G18 A;  3W4Q A;  4RX2 A;  4AFI A;  2ZQ9 A;  1CEG A;  4HQA A;  5F1F A;  5DJU A;  1YLZ A;  1MXO A;  2WAF A;  2XSS A;  2OLU A;  4E6W A;  2LB5 A;  1F9I A;  1K54 A;  3UN7 A;  1TDG A;  4EBL A;  4DJ3 A;  2EXB A;  5E2F A;  5HZH A;  1FR1 A;  1K55 A;  4HH3 A;  3QP8 A;  4R6L A;  3RTY A;  3T4S A;  2Y79 A;  3K3C A;  1O7E A;  3QP5 A;  4P85 A;  1LI9 A;  2Y2L A;  3QP1 A;  3ZYT A;  4EEU A;  4OLD A;  3S7O A;  2ZM8 A;  1AXB A;  4M4X A;  3IX4 A;  2RCX A;  3E2L A;  2EX6 A;  1XA1 A;  5E2H A;  3A0V A;  2P08 A;  4LV1 A;  4LCM A;  2JKT I;  2A49 A;  1W8Y A;  3MZF A;  4ZBE A;  4E3M A;  3H7W B;  3VOZ A;  3VE4 A;  4BEN A;  4KZ9 A;  2MJ6 A;  3LCE A;  1MKM A;  3IF6 A;  2XD1 A;  4GNU A;  4DDY A;  2XA7 S;  5CRF A;  4JF5 A;  3W8K A;  3I7J A;  1Q2Q A;  4R70 A;  3KSG A;  3ZVW A;  3UB6 A;  2B5R A;  3M2J A;  4BLM A;  1ES2 A;  3HVF A;  4NEE D;  1K38 A;  3N4I A;  2ZOH A;  2NUP C;  2H0T A;  4K08 A;  3C30 A;  5GHX A;  2M1C A;  5G4Z A;  2WYX A;  1CI8 A;  4LEN A;  5A93 A;  1SHV A;  2ZQD A;  1PRQ A;  3W2Z A;  3K2N A;  3GRJ A;  1DRM A;  1F5M A;  4EQ1 A;  1J9M A;  1WYB A;  3C2W A;  3IXB A;  4JGR A;  3PBO A;  5GL9 A;  4PM8 A;  3VOY A;  1OTA A;  5HAP A;  4GDN A;  3UME A;  1YMX A;  4WF0 A;  4UA7 A;  2PDR A;  5KSC A;  5C5K A;  1XJ6 A;  4GKU A;  3WS1 A;  3NC8 A;  3ZG8 B;  2W3H A;  2OAQ 1;  1SKO A;  3IT9 A;  5K5B A;  5IS1 A;  3AGF A;  3O88 A;  4JXV A;  1VM1 A;  1L0E A;  3C7V A;  1H8M A;  3LIA A;  5DTK A;  2XGN A;  2HV1 A;  2O9B A;  1BLS A;  4Y3I A;  2H5S A;  2ZM2 A;  5FQQ A;  5FL3 A;  4KUK A;  4R4R A;  4EES A;  1CI9 A;  3IF6 B;  5EEC A;  2JKG A;  2ZQ8 A;  4CLC E;  3DTM A;  4IVI A;  3GVB A;  4EEP A;  3VMA A;  4OPR A;  1CK3 A;  2OLV A;  4FH4 A;  1LHY A;  1V9Y A;  2WZX A;  4X55 A;  3EEA A;  4LRZ E;  1L0D A;  4X6T A;  4I3J A;  3G35 A;  1L2S A;  4KZ3 A;  4QHC A;  3HCY A;  3UNW A;  2H0Y A;  5DF7 A;  2QYB A;  1YSP A;  2BLS A;  2PD7 A;  2V1B A;  4CLC D;  4C75 A;  2XRN A;  3LEZ A;  2UWX A;  4HJ3 A;  5F68 A;  1L3L A;  3GTC A;  4GN2 A;  3BM6 A;  1T1A A;  1VET A;  5HDS A;  3NBL A;  4MBH A;  3CLO A;  2K7S A;  1VHM A;  3UO9 A;  4OPZ A;  3IX8 A;  5U47 A;  3V39 A;  4GHI A;  1IKG A;  5J8X A;  1D1J A;  1HD8 A;  4CLC C;  4DE1 A;  4G3V A;  1YMS A;  4KZ4 A;  1SKO B;  3FKW A;  3ZNT A;  1G6A A;  3FPV A;  3TG9 A;  5DKK A;  2ZBB A;  3HUN A;  1Y28 A;  4CLC B;  2K2N A;  4G3W A;  4D2O A;  3NHQ A;  1TDL A;  3DWZ A;  4XT2 A;  4S2N C;  3MFD A;  3SS3 A;  3T1R A;  1F2K A;  3VSK A;  1MWR A;  4N92 A;  1E3U A;  3E4Q A;  4P87 A;  3V50 A;  2Y59 A;  1YPR A;  3MR0 A;  1NLZ A;  2JCH A;  2OV5 A;  3IWQ A;  4II7 A;  4LRY C;  3DTI A;  4Y0T A;  3LUQ A;  3SS5 A;  1YLP A;  4FH2 A;  1FCO A;  1VET B;  3EWK A;  4Y0O A;  3SW1 A;  1TEM A;  5FQJ A;  2EX8 A;  4K0W A;  4WM9 A;  1IYQ A;  4QPR A;  4XXR A;  3G4P A;  1LSW A;  1E3U D;  1YM1 A;  2XA7 M;  1V9Z A;  4GHI B;  4X68 A;  3UDI A;  1P97 A;  3BW6 A;  2IWD A;  3CPT A;  4WN5 A;  3NCK A;  5JYP A;  1GSV A;  1OT6 A;  5HL6 A;  2A24 B;  4QJG A;  3WS5 A;  3CI6 A;  1DJC A;  4OH0 A;  5E43 A;  3PHY A;  3MQ0 A;  1IYS A;  4IBR A;  5GLB A;  4DXC A;  3D4F A;  2WKP A;  1BLC A;  1PZP A;  3SH9 A;  2Q0O A;  3LY4 A;  1Q2P A;  4XT2 B;  4UEY A;  2I72 A;  4QWO A;  4Z9Q A;  4PAU A;  4KZ5 A;  2LB9 A;  3JYI A;  3E0Y A;  1W8Q A;  4EBP A;  5L10 A;  4X56 A;  1X0O A;  5F83 A;  3BLS A;  3TOI A;  2ZC7 A;  3HLB A;  3PXP A;  4HBU A;  4I39 A;  1ZG4 A;  3S4X A;  1GA0 A;  3A3D A;  1NZO A;  4EBN A;  4RA7 A;  4KZ8 A;  4JPM A;  4OOM A;  4WEJ A;  1XA7 A;  3T4K A;  4BD0 A;  5HWW A;  5AQ9 A;  3E4P A;  2V0U A;  4IUK A;  4HJ4 A;  4Z1W A;  1N4O A;  4BL3 A;  1ZHH B;  4OP8 A;  4MMN A;  3B47 A;  1LL8 A;  3KSH A;  1F98 A;  5FI2 A;  3TW8 A;  3ZG0 A;  1STZ A;  4LRX C;  5DF8 A;  2QPN A;  5CHM A;  1PFL A;  5HX9 A;  3CPT B;  4I3A A;  2ZC3 B;  3MJQ A;  4U0T A;  3MXR A;  3CG5 A;  1NWZ A;  1CQA A;  1XJ3 A;  1XXM A;  1LT0 A;  4LV0 A;  3GDI A;  4FTX A;  3PBQ A;  3C4P A;  3NI9 A;  5MC7 A;  1DP6 A;  1VQQ A;  2XDM A;  2WGV A;  4E6X A;  3JVV A;  4OQG A;  4IVK A;  5FAP A;  2OWJ A;  4JF4 A;  2ZMV A;  1MWS A;  5KIZ A;  4OPQ A;  3IQA A;  4GB7 A;  1S4S A;  4HES A;  1IFQ A;  4PHT A;  4R38 A;  4U0X A;  1CF0 A;  1M6K A;  1PWD A;  2C5W B;  2HJ9 C;  1WYC A;  3OZH A;  3E98 A;  1S4R A;  1GSX A;  3QHY A;  5FEF A;  5FSR A;  2WAE A;  3KSF A;  1O07 A;  3FV7 A;  2L4R A;  2ZMA A;  3BFG A;  2ZC4 B;  2EX2 A;  1W7F A;  4F3L A;  3MSH A;  2EFX A;  4R3J A;  3IXH A;  3KSI A;  1ZG6 A;  3UDX A;  3IF5 A;  2J3T D;  1JWV A;  4Q8I A;  3ZG5 A;  4R3B A;  2KOI A;  2P9V B;  4BMW A;  2P74 A;  2QZ6 A;  3CAX A;  4XUZ A;  2Y2H A;  3Q82 A;  4DE2 A;  2WUQ A;  3VSL A;  2WKR A;  4NXB A;  5HAR A;  1FCM A;  4NK3 A;  4B93 A;  4Y7P A;  4O8G A;  3WWX A;  1AWI A;  1E4D A;  4BBU A;  4MN5 A;  3OPH A;  2HDS A;  3LR0 A;  2PU2 A;  2PYP A;  2DCF A;  3A0R A;  5AVE A;  2Q9N A;  4ETZ A;  4CQH A;  5E2E A;  5L07 A;  4EER A;  2W27 A;  3G31 A;  3FZC A;  5FQ9 A;  3P98 A;  2VV7 A;  1SKF A;  1ZC2 A;  3H9W A;  2QWS A;  1ESI A;  1PYY A;  4WMC A;  1PI5 A;  3UMD A;  3IS2 A;  3KYE A;  4LPZ A;  3R7W B;  4DJ2 A;  4BBT A;  1LL9 A;  3LIB A;  4F3L B;  4PMA A;  1JTG A;  2ZD8 A;  3GSG A;  4ARZ A;  4X53 A;  5TFQ A;  2Y2K A;  1OTI A;  2HP6 A;  2VGK A;  5EM0 A;  4HI4 A;  4H6J A;  3BJN A;  4DXB A;  4ESP A;  4F94 A;  3M6H A;  4EU0 A;  3JPU A;  4WMC D;  3OPR A;  3U4L P;  1ZKJ A;  3O87 A;  4WZ5 C;  4O7D A;  1MY8 A;  3PBN A;  2Y2N A;  5FI6 A;  4JGO A;  1WA9 A;  4KQO A;  2X01 A;  5FI7 A;  5FQM A;  1BLH A;  3V3S A;  1SDE A;  2PU4 A;  1NJ4 A;  3NEC A;  1K6S A;  3Q81 A;  3IXG A;  4CJN A;  3L9K A;  4Q0J A;  2VKS A;  4GOG A;  1OTE A;  3VP1 A;  5EOE A;  5FQI A;  1J3W A;  3EQU A;  3IBJ A;  3MKE A;  5HDD A;  1XFQ A;  1M40 A;  4DMZ A;  1T18 A;  2ZL1 A;  4EW7 A;  3EGD C;  3QNC A;  2VK3 A;  1YKD A;  4S2P A;  2VJW A;  4OQ0 A;  4DE0 A;  1XJ2 A;  4S2M A;  3ZQ5 A;  1QMF A;  4OLG A;  2WGW A;  4DN0 A;  2Y4A A;  3HJI A;  4ARZ B;  1XGJ A;  4WZ4 A;  2KDK A;  4OP5 A;  2V8F A;  4ZJ3 A;  4I5S A;  1K54 C;  3WS2 A;  3UPP A;  2ZMF A;  1I2W A;  4PM9 A;  3FKV A;  3O3V A;  1IEM A;  2PD8 A;  2HP9 A;  4H6J B;  4HP9 A;  3T1Q B;  4QB8 A;  1EI5 A;  1K55 C;  2Z6C A;  4HIA A;  4PPR A;  4MDZ A;  1H8Y A;  1NYM A;  2ZM0 A;  2J9O A;  5HD3 A;  3GEC A;  4ZDX A;  4FOF A;  1NZU A;  3CIT A;  1P0Z A;  4Y2F A;  4O0P A;  3UY6 A;  1ES4 A;  3VE3 A;  5HAI A;  1H8Z A;  3C5A A;  4P6Z S;  5F69 A;  2W0N A;  4GW9 A;  1SCW A;  1XX2 A;  1YLW A;  3SH7 A;  3KX0 X;  2JBF A;  3DW0 A;  3IHA A;  4K0X A;  1TS6 A;  2ZL1 B;  3IF6 C;  5IU1 A;  4QU3 A;  3A0S A;  4OOL A;  1HVB A;  4E3K A;  2WGW B;  2GZA A;  4O01 A;  1XKZ A;  3FWL A;  3HJK A;  2ZQC A;  1DP8 A;  3LR4 A;  1VEU A;  1BTL A;  3LFV A;  2BAS A;  4KZB A;  2PBD P;  5GLA A;  4IED A;  1KGF A;  2Y2P A;  1PW1 A;  1K56 A;  2IA2 A;  2EFU A;  4MN7 A;  4E3L A;  4Y17 A;  2W1T A;  1K57 A;  3PAG A;  1UGU A;  3PBT A;  3LIC A;  3UB5 P;  4KQD A;  3T1S A;  4NKP A;  2WZZ A;  5DFX A;  3OCN A;  3N7W A;  3DTE A;  5IHV A;  3LR5 A;  5BOH A;  2JN7 A;  2V9A A;  3C4O A;  1H5X A;  5KMW A;  2ZQ7 A;  4NXG A;  2ZC6 B;  5GLC A;  3OBF A;  2Y2M A;  2K31 A;  3SS4 A;  2L1M A;  3Q07 A;  3D3O A;  1K56 D;  3N8L A;  3MKF A;  3V3R A;  3LGO A;  4N1H A;  4X69 A;  1GHM A;  3ULF A;  4PKY G;  4HHD A;  3IWO A;  3QNB A;  1T1B A;  2XK1 A;  2OWH A;  3NOT C;  1XGI A;  1BZA A;  4E3I A;  4ZRR A;  2W3E A;  1OTB A;  4DKI A;  1LLB A;  2J80 A;  3BYD A;  1Z09 A;  3F1N A;  4JF6 A;  4YNR A;  3SH8 A;  4CPK A;  4HNB A;  3C8C A;  4ZTK A;  4LV3 A;  1N9L A;  4B9O A;  1PNE A;  1DY6 A;  4R1G A;  2G7U A;  2R9X A;  4KUO A;  3LY3 A;  5J4E A;  4OVD A;  2VLG A;  1BYW A;  2EA9 A;  5EVI A;  4OQH A;  3NOU C;  3VP4 A;  1D06 A;  4FCF A;  1KE4 A;  2W1T B;  3HLF A;  2WKH A;  1YLJ A;  4EXO A;  3ITA A;  4EUV A;  2XF3 A;  3A3E A;  4DF6 A;  3HL9 A;  3ZVT A;  3L7H A;  1P9W A;  3MQQ A;  5TBM A;  3PR6 A;  1RGY A;  2ZQA A;  3UE6 A;  3UE3 A;  4L9F A;  3T4Q A;  3T1X A;  2HZ5 A;  2XH9 A;  3LI8 A;  1I5Q A;  1D7E A;  3T4T A;  1Z6F A;  4N1X A;  4JGQ A;  5EVI D;  4E3N A;  1JWP A;  3HLC A;  5AQ7 A;  3PBS A;  5CER A;  2ZOI A;  3B42 A;  5FA7 A;  2VEA A;  4WEL A;  3UE0 A;  1ODV A;  5FEG A;  3F1N B;  5EV0 A;  3LIE A;  5AVF A;  5HPI A;  2EXA A;  5EVI C;  3ZFZ A;  2YKF A;  1TF1 A;  3IHB A;  5FAS A;  4ZJ1 A;  4JKT A;  4IHQ A;  1XJ4 A;  4P6Z M;  1NY0 A;  3NUL A;  4XUX A;  2XFS A;  5EVI B;  3HLE A;  4X1M A;  3N6I A;  2JKT M;  2ZJ9 A;  1TS8 A;  4UAA A;  4YOF A;  1IOU A;  3A3F A;  4BWI A;  2QJ5 A;  3G2Y A;  5L2F A;  2WKI A;  3A3I A;  4GLQ A;  1FSY A;  2DMW A;  2Y2J A;  4JXS A;  5TBM B;  1JVJ A;  2INW A;  3IWI A;  4ME4 A;  1BSG A;  4ETX A;  5GHZ A;  1MC0 A;  3H82 A;  5HAQ A;  3Q7Z A;  3G32 A;  1IYO A;  1JWZ A;  1K6R A;  5EPH A;  2KLI A;  5I5L A;  1ONH A;  2XRO A;  3B33 A;  4DE3 A;  2FZ0 A;  4EQI A;  5DFY A;  3T12 B;  3OCL A;  1OJG A;  1HLU P;  2Z2M B;  2NUT C;  4FUW A;  4S2J A;  5EUA A;  1FSW A;  1G6O A;  4HP4 A;  3MBZ A;  3F1O A;  5DVA A;  3SZT A;  3TE8 A;  4KZ6 A;  2PR5 A;  3LR3 A;  1N9N A;  4UA9 A;  5F82 A;  2D02 A;  2Z2L B;  3C7U A;  2FH5 A;  4LCL A;  5A91 A;  3BFE A;  2RL3 A;  1MPL A;  2H28 A;  2V8C A;  2UV0 E;  4P6B A;  3P7N A;  4RX3 A;  3G30 A;  4S2I A;  4L0L A;  1GSW A;  2WKE A;  3K3D A;  5KZH A;  5HD5 A;  4H8R A;  5HDC A;  1GHI A;  1S67 L;  2P7J A;  4KEN B;  3H82 B;  3NDE A;  3MXS A;  4G3K A;  4DDS A;  3BLM A;  4QD4 A;  3ICY A;  4KZA A;  4S2O A;  3SOI A;  3FG8 A;  4GZB A;  5G4Y A;  2Q9M A;  1FCN A;  2A2L A;  3IX3 A;  1LSV A;  4E04 A;  4JXW A;  3V67 A;  4HOI A;  2WKQ A;  1W79 A;  1OJ5 A;  3IXD A;  3WRZ A;  1KGE A;  4U3T A;  1XFN A;  3RFB A;  2J3T C;  1L0G A;  3E4O A;  1PIO A;  4PM7 A;  1IYP A;  4LGW A;  3F1O B;  3HRE A;  4GDB A;  5TR7 A;  1PZO A;  2OSU A;  3G34 A;  4I38 A;  5TJJ A;  3S1Y A;  5CHU A;  1NRF A;  1W63 M;  3LI9 A;  1XP4 A;  3LID A;  3D72 A;  3IH8 A;  1JTD A;  1YLT A;  4QY5 A;  3ITB A;  1S1Z A;  3VOL A;  3T4J A;  2O99 A;  2O0Y A;  5CX7 A;  4OPY A;  3R4K A;  3C38 A;  2EX9 A;  1JNU A;  2C6W B;  3MF0 A;  2Y2I A;  1EWZ A;  3EOI A;  5CXW A;  1PWG A;  2HDR A;  3UPN A;  3RXX A;  2J7V A;  1W63 Q;  4GJ4 A;  3G6O A;  2Y55 A;  2XQZ A;  5M19 A;  1KDS A;  3GV9 A;  5EE8 A;  3MQO A;  4KG2 A;  4NXF A;  2I9V A;  2PR6 A;  2JKR M;  2E8I A;  1MKI A;  3LYX A;  2IWC A;  5KSH A;  3OPP A;  3BRM A;  3LEQ A;  5L8M A;  1PI4 A;  4KQQ A;  4HEF A;  2PT7 A;  2V1Z A;  4OKP A;  3TSG A;  4YFM A;  2Y2O A;  1K4E A;  2FFY A;  4GD6 A;  3F1P A;  1ERO A;  2Y2Q A;  1FIK A;  3WRT A;  4S2K A;  1PWC A;  2AVX A;  1FR6 A;  4I3I A;  2W3G A;  3IS2 B;  2YKH A;  1ONG A;  2OAP 1;  1N9O A;  3NY4 A;  1MBL A;  3E2K A;  5CGW A;  5FDS A;  5CEB A;  3JVU A;  1H3Q A;  1TS7 A;  5CEC A;  1BT5 A;  2VV6 A;  3HUM A;  2VGL S;  4N9L A;  3A3J A;  4GCZ A;  4UQI S;  1KE3 A;  2O9C A;  1P9R A;  4X1L A;  2O9A A;  1LI0 A;  1C3B A;  2JC7 A;  2QKP A;  3KYZ A;  4WEK A;  2OOL A;  1H0M A;  1N9B A;  3IBR A;  3BEB A;  3MMH A;  3HLG A;  4BQM A;  4K91 A;  3BY8 A;  5TGF A;  3O86 A;  3ZNY A;  3LO7 A;  4D60 A;  2X71 A;  4Y5F A;  1RCJ A;  4MEZ A;  3S7P A;  2R78 A;  1ZTU A;  3S22 A;  4WLA A;  5DJT A;  4KQR A;  2XLN A;  1ES5 A;  3UB7 A;  3B3X A;  5A90 A;  2XEP A;  5EM1 A;  5AQB A;  4FD8 A;  5DTT A;  4FSF A;  1W5D A;  3T4L A;  2QHK A;  1UWN X;  3UB8 A;  1DJB A;  4N9K A;  4MBK A;  3F1P B;  3MFX A;  1QME A;  2PYR A;  5CED A;  3W4O A;  3TRC A;  3GR2 A;  3PBR A;  3P01 A;  1G68 A;  5GLD A;  3G2Z A;  3CHW P;  3BWL A;  5FQK A;  2EWV A;  4HBT A;  2Y8H A;  3FPW A;  3ZCZ A;  2DRW A;  1T19 A;  1YT4 A;  1RGZ A;  1GHP A;  3DAV A;  1MWT A;  1TS0 A;  4RVA A;  4R0Q A;  5GHY A;  4CLC A;  2L0W A;  4MN6 A;  2KX6 A;  4R23 A;  1K25 A;  1KDW A;  4UA6 A;  5FAQ A;  2M7U A;  3CWF A;  4Y0U A;  3OC2 A;  3CMZ A;  5JYO A;  1PW8 A;  3KO6 A;  3T4O A;  3EGX C;  1Y54 A;  3GMW A;  4S2N A;  2CMN A;  4IBX A;  4BBV A;  3UDF A;  4C6Y A;  2H10 A;  3CUE A;  3RH8 B;  1ES3 A;  1ACF A;  2JE5 A;  5HWV A;  1BUE A;  4RYE A;  4R4S A;  3MZE A;  3Q7V A;  3QP2 A;  3VP0 A;  1IKI A;  1KVM A;  4JBF A;  4GS9 A;  1TD5 A;  4YIN A;  2X02 A;  4HJ6 A;  4L9G A;  4PM6 A;  2J3W A;  3MS6 A;  4GD8 A;  4R3A A;  4Q0I A;  3KYQ A;  4JLF A;  2PHY A;  3FYZ A;  3N8R A;  3BY9 A;  3Q1F A;  4EUZ A;  5DTS A;  2G2W A;  3BEC A;  2HPB A;  3BFD A;  4X25 A;  3UE1 A;  3ZDJ A;  4IJG A;  2A24 A;  1DP9 A;  4MCW A;  5FAT A;  3GQZ A;  3N8S A;  3OOV A;  2R9W A;  4WUJ A;  5HPF A;  1FQG A;  1FOF A;  2B18 A;  3NIA A;  1T1C A;  5CGX A;  1VEU B;  5EFW A;  4S2L A;  4OON A;  4HY8 A;  2V0W A;  3HLD A;  3CUE C;  1K57 C;  3OLO A;  1LL5 A;  4UHU A;  3O5Y A;  5DKL A;  1ERQ A;  4MLL A;  2V20 A;  2V1A A;  2A3U A;  2PRF A;  1S6R A;  4BJP A;  2WGI A;  3Q7V B;  2GNX A;  1KOU A;  2VGL M;  1UWP X;  1NLY A;  4GS9 B;  4UQI M;  4KG5 A;  1CEF A;  3AGE A;  3HLW A;  5CGS A;  2JHE A;  5HSQ A;  2GX5 A;  5CHJ A;  2HDQ A;  4B88 A;  2ZC5 B;  2DNS A;  3UPO A;  2E8J A;  5J7E A;  4JXG A;  3HBR A;  4YWZ A;  3DTK A;  3DWK A;  4C3Q A;  4EWF A;  2W3F A;  1NXY A;  4PKY A;  3BQA A;  4LV2 A;  2JKR I;  2VX8 A;  4EV4 A;  1S0W A;  1YQS A;  3VFF A;  1YAX A;  4BL2 A;  3VV4 A;  2GJ3 A;  3PYP A;  4NG2 A;  4OOY A;  4HH2 A;  5FAO A;  1L0F A;  1OPX A;  1KGG A;  2GDN A;  1Y4O A;  3HUO A;  4L9E A;  5F5Y A;  2VZW A;  1GA9 A;  3LIF A;  3VP3 A;  2HJE A;  3ZG7 B;  3PTE A;  4LFU A;  2QMI A;  4LLO B;  4ID4 A;  4WL9 A;  2B95 A;  3WS4 A;  4MNR A;  1GCE A;  2VA0 A;  2VGJ A;  5M1A A;  4Y13 A;  2HF6 A;  5J3W A;  1BUL A;  5F6A A;  1HTZ A;  5E2G A;  3D9Y A;  3VFH A;  5CTM A;  4M3K A;  2M7V A;  5D3O A;  5AQA A;  4KZ7 A;  1MZU A;  5LBR A;  5L09 A;  1KVL A;  2CC1 A;  3W4P A;  2B02 A;  1ALQ A;  2XD5 A;  1NYY A;  1OME A;  1EW0 A;  2P9V A;  2Y2G A;  5EVL A;  1NRJ A;  3OPL A;  2PBY A;  3FC7 A;  3M6B A;  2V2F F;  3BFC A;  2W3D A;  1DJA A;  4BD1 A;  4B4X A;  2J8Y A;  1ESU A;  4KG6 A;  4NXE A;  4B4Z A;  4ZAM A;  3RXW A;  3MZD A;  2Y91 A;  1KE0 A;  2ZLY A;  5IT5 A;  2J9P A;  4P0M A;  1MWU A;  1K4F A;  5HW3 A;  1YSQ A;  2BG1 A;  3WS0 A;  1I2S A;  2W1R A;  3CZD A;  1XPB A;  3ZHH A;  1S1Y A;  1E25 A;  3NJA A;  3PAE A;  2FFF B;  2IWB A;  3CJM A;  5HFO A;  3R7W A;  3NDG A;  3TJZ C;  1SZV A;  1U60 A;  4NET A;  3UB9 A;  4A5R A;  2Z6D A;  1VB6 A;  4OQI A;  1OTD A;  1A0K A;  3EEH A;  4DRT A;  3QP6 A;  3BQ8 A;  1FIL A;  5HWT A;  3P09 A;  3S7N A;  3ISG A;  5EOO A;  2VV8 A;  2HDU A;  5EVE A;  4WBG A;  5CTN A;  3ZGA B;  5AJG A;  1G5U A;  2XR0 A;  4PM5 A;  3QP4 A;  5F1G A;  1LSX A;  1TVF A;  2BTF P;  1BLP A;  1HZO A;  4RQ9 A;  2XFT A;  3EQV A;  4EET B;  2D01 A;  3U2A A;  3NOP C;  3VP2 A;  4WZ5 A;  3V5M A;  2EWW A;  4IUH A;  3S7Q A; 
#chains in the Genus database with same CATH homology
 1OTB A;  2QJ7 A;  1ZTU A;  4LRX C;  2J80 A;  5A8B A;  3F1N A;  4YNR A;  4WLA A;  5DJT A;  4HNB A;  3C8C A;  1N9L A;  4I3A A;  3UB7 A;  3MJQ A;  4B9O A;  1OT9 A;  3DBA A;  2G7U A;  3MXQ A;  4KUO A;  1NWZ A;  1G28 A;  5J4E A;  4FSF A;  2P04 A;  1XJ3 A;  2VLG A;  1BYW A;  2EA9 A;  3T4L A;  2QHK A;  1LT0 A;  3GDI A;  3NOU C;  1UWN X;  4Q0H A;  1S66 L;  3UB8 A;  1D06 A;  5DF9 A;  3PBQ A;  3F1P B;  3MFX A;  3H7W A;  2HGV A;  5MC7 A;  2PYR A;  1DP6 A;  3TRC A;  3PBR A;  2W1T B;  3P01 A;  3BWL A;  4EXO A;  2EWV A;  3JVV A;  2Y8H A;  4JGP A;  3T50 A;  2OWJ A;  4EUV A;  2ZMV A;  1P9W A;  3FPW A;  1T19 A;  3MQQ A;  5TBM A;  3PR6 A;  5KIZ A;  4AFI A;  3UE6 A;  3UE3 A;  4L9F A;  3T4Q A;  4HQA A;  1S4S A;  1TS0 A;  1IFQ A;  4PHT A;  4R38 A;  5DJU A;  3LI8 A;  1D7E A;  3T4T A;  2XSS A;  4CLC A;  2L0W A;  4MN6 A;  2LB5 A;  2KX6 A;  2HJ9 C;  4JGQ A;  1F9I A;  3E98 A;  2M7U A;  4DJ3 A;  3CWF A;  3PBS A;  2ZOI A;  3B42 A;  5HZH A;  3OC2 A;  1S4R A;  1GSX A;  3KO6 A;  4HH3 A;  4R6L A;  3RTY A;  3KSF A;  2VEA A;  2L4R A;  3T4S A;  3T4O A;  2Y79 A;  3EGX C;  3K3C A;  4WEL A;  2CMN A;  1ODV A;  4BBV A;  3CUE A;  4F3L A;  3RH8 B;  3F1N B;  3ZYT A;  4EEU A;  3S7O A;  3LIE A;  5AVF A;  5HPI A;  5HWV A;  3KSI A;  2YKF A;  1TF1 A;  2J3T D;  4M4X A;  2KOI A;  4BMW A;  4GS9 A;  4IHQ A;  1TD5 A;  1XJ4 A;  3CAX A;  4P6Z M;  3A0V A;  2P08 A;  4HJ6 A;  4L9G A;  2JKT I;  2J3W A;  2WKR A;  4R3A A;  4Q0I A;  4NXB A;  2JKT M;  1TS8 A;  3KYQ A;  3H7W B;  3VE4 A;  2PHY A;  4O8G A;  4YOF A;  4B93 A;  1IOU A;  4BBU A;  4BWI A;  2MJ6 A;  4MN5 A;  2QJ5 A;  3BY9 A;  1MKM A;  3LR0 A;  2PYP A;  4GLQ A;  2DMW A;  2XA7 S;  3A0R A;  5AVE A;  5TBM B;  4R70 A;  4ETZ A;  2INW A;  4CQH A;  3KSG A;  4IJG A;  3UB6 A;  2A24 A;  1DP9 A;  4MCW A;  4NEE D;  4EER A;  2W27 A;  4ME4 A;  3OOV A;  2ZOH A;  4WUJ A;  4ETX A;  2NUP C;  5HPF A;  1MC0 A;  2VV7 A;  3H82 A;  4K08 A;  3C30 A;  2M1C A;  2B18 A;  3H9W A;  1T1C A;  2QWS A;  5G4Z A;  5EFW A;  4HY8 A;  2V0W A;  3W2Z A;  2KLI A;  3CUE C;  1DRM A;  1F5M A;  3IS2 A;  3K2N A;  3OLO A;  5I5L A;  3UMD A;  2XRO A;  4EQ1 A;  4LPZ A;  3O5Y A;  5DKL A;  4JGR A;  3C2W A;  3PBO A;  3B33 A;  3R7W B;  4DJ2 A;  2FZ0 A;  5DFY A;  4BBT A;  3OCL A;  1OJG A;  1OTA A;  3LIB A;  3UME A;  2NUT C;  4F3L B;  4WF0 A;  2V1A A;  2PDR A;  5C5K A;  1G6O A;  4HP4 A;  4ARZ A;  4BJP A;  1XJ6 A;  3F1O A;  2GNX A;  1KOU A;  2VGL M;  2W3H A;  3TE8 A;  2OAQ 1;  1UWP X;  5K5B A;  5IS1 A;  2PR5 A;  1NLY A;  3LR3 A;  4GS9 B;  1N9N A;  4UQI M;  2D02 A;  2JHE A;  5HSQ A;  2FH5 A;  2GX5 A;  1OTI A;  4HI4 A;  4H6J A;  1H8M A;  2H28 A;  3BJN A;  3LIA A;  5J7E A;  3P7N A;  4EU0 A;  4YWZ A;  2HV1 A;  2O9B A;  4Y3I A;  2W3F A;  4PKY A;  5FL3 A;  3BQA A;  4KUK A;  4EES A;  3PBN A;  4L0L A;  2JKR I;  2VX8 A;  4CLC E;  1GSW A;  4JGO A;  1WA9 A;  4EEP A;  4KQO A;  3K3D A;  5HD5 A;  1YAX A;  5HDC A;  1V9Y A;  3EEA A;  4LRZ E;  3VV4 A;  2GJ3 A;  1S67 L;  3PYP A;  4Q0J A;  4I3J A;  2P7J A;  4HH2 A;  3H82 B;  3HCY A;  2VKS A;  1OPX A;  1OTE A;  4G3K A;  2QYB A;  1YSP A;  2PD7 A;  3IBJ A;  3EQU A;  2V1B A;  4L9E A;  3ICY A;  5F5Y A;  5HDD A;  4CLC D;  1XFQ A;  2VZW A;  2XRN A;  4DMZ A;  3FG8 A;  1T18 A;  4HJ3 A;  5F68 A;  5G4Y A;  2A2L A;  1LSV A;  4EW7 A;  4E04 A;  1T1A A;  3EGD C;  5HDS A;  3V67 A;  4HOI A;  2WKQ A;  3CLO A;  3LIF A;  1OJ5 A;  2HJE A;  1YKD A;  2K7S A;  1VHM A;  2VJW A;  1XJ2 A;  1XFN A;  3RFB A;  3ZQ5 A;  4LLO B;  2J3T C;  3E4O A;  4GHI A;  4DN0 A;  4WL9 A;  3HJI A;  4ARZ B;  4IUH A;  3F1O B;  4CLC C;  4G3V A;  2KDK A;  2VA0 A;  4I38 A;  4I5S A;  5TJJ A;  3FPV A;  2ZMF A;  2HF6 A;  5DKK A;  5J3W A;  2ZBB A;  1W63 M;  2PD8 A;  5F6A A;  1Y28 A;  3LI9 A;  4CLC B;  2K2N A;  4H6J B;  4HP9 A;  3LID A;  4G3W A;  2M7V A;  3D72 A;  2Z6C A;  4HIA A;  3NHQ A;  4MDZ A;  1MZU A;  4XT2 A;  5LBR A;  5HD3 A;  2B02 A;  3GEC A;  1S1Z A;  3VOL A;  3T4J A;  4FOF A;  2O99 A;  3CIT A;  1P0Z A;  1EW0 A;  2O0Y A;  3E4Q A;  5CX7 A;  4Y2F A;  3R4K A;  4O0P A;  3C38 A;  3VE3 A;  1NRJ A;  1JNU A;  3MR0 A;  3MF0 A;  4P6Z S;  3EOI A;  3FC7 A;  5F69 A;  1NLZ A;  2W0N A;  4GW9 A;  2W3D A;  3S7Q A;  3KX0 X;  4II7 A;  4LRY C;  1TS6 A;  1W63 Q;  3LUQ A;  3EWK A;  4GJ4 A;  4NXE A;  5IU1 A;  3G6O A;  3SW1 A;  3A0S A;  4OOL A;  4QPR A;  3MQO A;  4NXF A;  1LSW A;  2I9V A;  2XA7 M;  1V9Z A;  4GHI B;  2PR6 A;  5IT5 A;  2JKR M;  2GZA A;  3LYX A;  4O01 A;  1P97 A;  5KSH A;  3BW6 A;  4WN5 A;  1YSQ A;  1GSV A;  1OT6 A;  5HL6 A;  5L8M A;  3HJK A;  1DP8 A;  2PT7 A;  2A24 B;  3CI6 A;  3PHY A;  3S7P A;  3MQ0 A;  3LR4 A;  2W1R A;  2BAS A;  3LFV A;  2WKP A;  1S1Y A;  3NJA A;  3F1P A;  2IA2 A;  4MN7 A;  3R7W A;  4XT2 B;  2W1T A;  4UEY A;  4PAU A;  3TJZ C;  4I3I A;  3UB9 A;  2W3G A;  3IS2 B;  2Z6D A;  2LB9 A;  2YKH A;  1VB6 A;  2OAP 1;  1N9O A;  1UGU A;  3E0Y A;  3PBT A;  3LIC A;  1OTD A;  4KQD A;  1X0O A;  4NKP A;  5DFX A;  3EEH A;  3JVU A;  3OCN A;  1H3Q A;  1TS7 A;  3BQ8 A;  2VV6 A;  2VGL S;  3PXP A;  5HWT A;  3S7N A;  2VV8 A;  3LR5 A;  4I39 A;  2JN7 A;  4GCZ A;  2V9A A;  4UQI S;  2O9C A;  1P9R A;  2O9A A;  4NXG A;  2QKP A;  3OBF A;  5AJG A;  4OOM A;  4WEJ A;  3KYZ A;  2K31 A;  4WEK A;  2OOL A;  2L1M A;  3IBR A;  3D3O A;  3T4K A;  3MMH A;  5HWW A;  1LSX A;  3ULF A;  4PKY G;  3E4P A;  2V0U A;  3BY8 A;  4IUK A;  4HHD A;  4RQ9 A;  4HJ4 A;  3EQV A;  4EET B;  1T1B A;  2D01 A;  4Z1W A;  2OWH A;  1ZHH B;  3U2A A;  4MMN A;  3NOP C;  3NOT C;  3B47 A;  1LL8 A;  4Y5F A;  3KSH A;  1F98 A;  4ZRR A;  3TW8 A;  2EWW A;  2W3E A;  2R78 A;  1STZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...