3BWCA

Crystal structure of spermidine synthase from trypanosoma cruzi in complex with sam at 2.3 a resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
291
structure length
282
Chain Sequence
SELISGGWFREENDQWPGQAMSLRVEKVLYDAPTKFQHLTIFESDPKGPWGTVMALDGCIQVTDYDEFVYHEVLGHTSLCSHPKPERVLIIGGGDGGVLREVLRHGTVEHCDLVDIDGEVMEQSKQHFPQISRSLADPRATVRVGDGLAFVRQTPDNTYDVVIIDTTFGEAFYKDVLRILKPDGICCNQGESIWLDLELIEKMSRFIRETGFASVQYALMHVPTYPCGSIGTLVCSKKAGVDVTKPLRPVEDMPFAKDLKYYDSEMHKASFALPRFARHINN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spermidine synthase
publication title Crystal structure of spermidine synthase from Trypanosoma cruzi.
rcsb
source organism Trypanosoma cruzi
molecule tags Transferase
total genus 84
structure length 282
sequence length 291
chains with identical sequence B
ec nomenclature ec 2.5.1.16: Spermidine synthase.
pdb deposition date 2008-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 3bwcA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3bwcA02
5BW5A 3G2MA 1R8YA 3FTDA 3HCAA 3OE5A 4O29A 1G60A 1L1EA 1XJ5A 1D2CA 2BZGA 3MTEA 5DTQA 3NJRA 4RSRA 5HILA 2NP6A 1I9GA 1JSZA 4MIKA 3OU7A 2I6GA 4R8RA 4X63A 3VYWA 1ZHFA 1UIRA 5LR6A 3V97A 2IBSA 5DSXA 5EG5A 2P3LA 4Y30A 1AF7A 5IH3A 2QM3A 5DTMA 5BP7A 4FGZA 4FZVA 3HVKA 3FRHA 1YZHA 2CKDA 4P7KA 5C1IA 3NVMB 2ZIGA 4RTRA 2LD4A 3E05A 2IDJA 3I5UA 4FS8A 2IP2A 4YUWA 3JWJA 3KU1A 3R9XB 3PS9A 3REOA 3HCFA 2UZ4A 3NVKI 4PGHA 5HOQA 4DMGA 2DULA 2QRVA 4DM3A 4YUVA 1KR5A 3M6XA 3M70A 2PX2A 3O31A 4POOA 2NNWB 1WS6A 3GRYA 5DTRA 5HFJA 2Z6UA 4FSDA 5GWXA 2AOUA 3DULA 5JR3A 3EVBA 2H1RA 3I58A 3KR9A 3G88A 7MHTA 3DTNA 3M4XA 2ERCA 3IYLW 2AOUB 1QZZA 1G8SA 2OKCA 2OB1A 2PKWA 1X1DA 2IFTA 3C3YA 4FP9A 1NW8A 3GNLA 5DWQA 5FQOA 3SXJA 3B3JA 1RI2A 1TW2A 1WG8A 2AVDA 1EG2A 2P35A 2ORED 1JG3A 10MHA 2FK7A 3S68A 1L3IA 3OCJA 3X0DA 2OZVA 3EVEA 2EJTA 5FADA 2IPXA 4HGZA 3EGEA 3SSOA 4ER5A 1M6EX 3BWYA 1FP2A 4U7PB 2ZW9A 3HVIA 4P7FA 3SVZA 1D2HA 2AN3A 3G2OA 5CM2Z 1YUBA 8MHTA 2AR0A 5U4XA 4PYJA 3KQPA 2JH8A 2AN5A 3CCFA 1G38A 2OO3A 3KPYA 3O4FA 2QYOA 2OB2A 2ADMA 2B3TA 2ZIFA 2R3SA 3P2KA 2YTZA 1ZG3A 4KRGA 3SX0A 4OX9Y 5GIOE 4EQZA 3TFWA 4YV0A 1JQEA 2NYUA 5CVUA 2GPYA 2ONYA 3GJYA 3HNRA 4CKEA 3GO4A 2AVNA 3LKDA 4QPNA 5FTWA 3HVHA 2E5WA 3MCTA 1KIAA 1QAOA 5HZMA 5LQKA 2C7PA 5K0GA 4WXHA 4OA8A 3FPEA 2HNKA 2PVCA 2YX1A 5M5BA 5JUWA 2YVLA 1ORHA 1RJEA 3E7PA 4PYMA 4E30A 3ERCA 1IM8A 2EJUA 1QANA 3G7UA 3PT9A 3D2LA 1X19A 1R6AA 3OFKA 4IKPA 1P39A 5KVAA 5LQAA 1XTPA 4E2XA 3M6UA 5GOZA 4RTPA 3A26A 3DXYA 3LCVB 3NWEA 1VQ1A 4BLWA 5K0JA 1L3BA 1R74A 3FYDA 3THSA 3WSTA 4PINA 1PJZA 2P7IA 3JWHA 5GIPE 3R24A 4XUCA 2C7OA 2OY0A 3ANXA 4CTKA 3NDJA 4FT2A 3DMFA 3UFBA 1QAQA 2VDWA 3EVZA 3CJTA 5LQUA 1NW5A 2WK1A 4PIPA 3K0BA 4H0NA 3EEOA 5E8JA 5ICEA 5DXJA 1RI3A 1IY9A 5K0CA 3BWCA 3HM2A 2FRXA 4EMSA 2FHPA 1KP9A 4Z2YA 4E2ZA 3ID6C 1Z3CA 4IWNA 3GWZA 3FUUA 1WZNA 4X1OA 1Q0TA 1DL5A 2ZBRA 4GOLD 4KIGA 4KVZA 4M38A 3UWPA 2H00A 1DUSA 2ZTHA 3MCZA 1EJ6A 2JHCA 3UJ9A 4X61A 4F84A 1JR4A 5CUQA 4PYNA 2IGTA 4EVIA 4PCAA 1P1BA 4K6MA 4OQEA 2PV0A 1WXWA 2P1DA 3I53A 4QPPA 3TM4A 4IV8A 2N47A 2Y1XA 3UBTA 3SSNA 1NKVA 3KPUA 3KR1A 5C9ZA 4CXMA 1JQDA 1U2ZA 1XVAA 2XVMA 2P8JA 3HA7A 3KR0A 2UYOA 2O06A 3HCDA 4GC9A 5HIJA 4GEKA 2P3QA 3LBYA 4CKBA 5E2AA 5EZSA 2XBMA 4DZRA 4RTKA 5H02A 3MTIA 1VBFA 3O7WA 3BWBA 3CJQA 5DRYA 5EZQA 4QQKA 5T67A 1NBHA 3L8DA 5CIYA 4PWYA 5K8VA 2AOXA 3UA4A 2ZULA 3C0KA 3I64A 2XYQA 3HVJA 5DM0A 5EOVA 4MQ4A 1FBNA 3A7DA 1R8XA 4M7RA 3BWMA 3DUWA 3LDGA 4HRAA 4NECA 2HR1A 1N2XA 2KW5A 2OPBA 3GGDA 5EVJA 4XUEA 1L3CA 1O9HA 3F4KA 4P7JA 5T64A 2AS0A 2C7QA 3P8ZA 3FYCA 4M37A 5ICCA 3G89A 4GOMD 1FJXA 3FPJA 3LCCA 3GRZA 4V0RA 5CCBA 4GC5A 4PYKA 4AUKA 5E9WA 2H11A 2AZTA 3DMGA 3P2IA 2B9EA 1ZGJA 2NXJA 3EGIA 2AOVA 5D1HA 1QAMA 2PXAA 5IKMA 1AQIA 3UJ7A 2IH4A 5DM2A 4DA4A 3OZRA 1JG1A 3FZGA 3K6RA 2F8LA 3HA3A 2PBFA 5K0LA 5CVDA 2Z6QA 3FUTA 1AQJA 3KPVA 3IEIA 4PYOA 2I9KA 2GAFA 1M0EA 4PCLA 1FPQA 5K0BA 1B42A 3I9FA 3P71T 4LG1A 1KPGA 5DX8A 2G1PA 4LWOA 3T7RA 3ER8A 3M6WA 1G8AA 2XYVA 4YMHA 1WXXA 1JSXA 4LECA 5E2BA 5E8RA 4AZVA 2AN4A 4EKGA 3HA5A 4GF5A 2EFJA 2ZFUA 2IBTA 2PT6A 4RWZA 1NV9A 5LQRA 2GS9A 1P1CA 1Q0SA 1PRYA 3UJCA 4GQBA 4JXJA 1JTFA 2R6ZA 4MHTA 5CCXA 4E2WA 2ONZA 2VDVE 3DLCA 3ME5A 3PFHA 5E1MA 5HEKA 2UYHA 5K05A 2PXCA 3NW9A 3KHKA 2BR4A 4PONA 2IH2A 1UWVA 2JH9A 4DKJA 2B78A 4FT4A 3BUSA 3LL7A 3DXXA 2B25A 1EAMA 4QTTB 4QVGA 2BR5A 5GINE 2O07A 3P2EA 5GP1A 3QV2A 3AY0A 1VE3A 2PWYA 3KQWA 2BR3A 2G8NA 3E8SA 3U81A 5FHQA 4L7VA 3MERA 3SSMA 4CKCA 2FPOA 2I7CA 1TPYA 3EVCA 2Q41A 3SR4A 3DOUA 1EJ0A 3BGVA 3EGVA 3TR6A 4A6EA 4EKIA 5EKUA 1UFKA 5E9QA 4RTJA 4HC4A 4HTFA 4ZTBA 4AX8A 1L9KA 2VDUE 3JWGA 4HTFB 1XDSA 1YB2A 2G70A 3G2QA 3TOSA 3B3FA 2JG3A 1X1AA 3EVDA 3HTXA 1YZ3A 5FA8A 3T0IA 1XXLA 2XVAA 3M6VA 5FCDA 3HEMA 3UJAA 2ZIEA 1H1DA 4RX1A 4F86A 5LQJA 2IDKA 3A7EA 4DCGA 2YXEA 5EMLA 1KHHA 3R3HA 1VPTA 4OBXA 5ERGB 4A6DA 5CVVA 2VZ9A 4M36A 5LSAA 3FTEA 2QY6A 2EG5A 2PY6A 1O54A 2V7EA 4HH4A 5G02A 4YMGA 2JJQA 3DR5A 5BXYA 5LQCA 2CWWA 5EMMA 2O0LA 3KKZA 2YQZA 3SM3A 4QQNA 1R18A 2B2CA 2ZSUA 3VC2A 3Q87B 3P9KA 3B7PA 4R6WA 3UZUA 3G8AA 1O9GA 3GRVA 3GIWA 1OR8A 4OQDA 4GBED 4RVDA 4BY9E 5C0OE 2GA9A 2YXDA 3UA3A 2AOTA 3LHDA 1ZGAA 1VLMA 4HG2A 3OFJA 2PWPA 2AOTB 3LGAA 4R05A 3LDUA 4X41A 2IH5A 2UYQA 4PIMA 3FTCA 2ZBQA 4CTJA 2EX4A 5E9JA 1AV6A 1HNNA 2IIPA 4RTMA 5LQNA 1RI1A 1BC5A 2ZWAA 3BXOA 5K03A 3Q7EA 2G72A 3AXSA 1NE2A 5FWDA 3BKXA 3E23A 3THRA 4ER3A 1ORIA 4QVKA 2Z6AA 4YUZA 2PJDA 5EHGA 2A14A 1JG4A 4HGYA 5DM1A 3V8VA 2PGXA 4GOOD 4V0QA 1ZQ9A 3LSTA 2DPMA 4UOEA 1JTEA 5EGSA 3SMQA 4XUDA 3TLJA 2BH2A 4ER7A 4E32A 2VS1A 3EVAA 5EPEA 5EMJA 5HIIA 3OZSA 1MJFA 4Y2HA 3FTFA 3NTVA 1VL5A 2P3OA 3HCBA 5EKXA 2HTEA 1NW6A 4ER6A 1RJDA 2BM8A 3G5TA 4RTNA 1VP9A 5KQRA 3ELUA 3LBFA 4HSGA 3OZTA 2P41A 3M33A 2CL5A 5EMKA 4X60A 5CD1A 1SUSA 3OPNA 5E1OA 3HCEA 2WA1A 5DT2A 5B1SA 3LECA 2ZLBA 3MGGA 1INLA 4OBWA 3FPGA 2NP7A 4YV2A 2BM9A 4RTOA 1EQAA 3EMBA 5E1DA 2OXTA 1MHTA 3A27A 3CC8A 1F3LA 3DP7A 4PYIA 1NBIA 2O57A 4KWCA 2HV9A 4YUYA 3FUVA 3ELWA 4QDJA 1SQFA 1G6Q1 2VP3A 4E33A 2P40A 1T43A 4RTSA 2QE6A 4B17A 4IV0A 3LX6A 1XDZA 3PB3A 1VP3A 2OBFA 2V74B 1M6YA 3P9NA 4KDRA 4E31A 3FPHA 2ZZKA 5ICGA 4U7TB 1P91A 4BP3A 3JWIA 2HWKA 3B5IA 4ATNA 4F85A 1XCJA 3CBGA 1NW3A 3A4TA 5D1NA 2ZBPA 5DRTA 3CKKA 5GM2A 3C3PA 5T6BA 2I62A 5FHRA 2OYRA 4GUAA 3TPZA 5KQSA 1JQ3A 4RYLA 3BGDA 5CVJA 3KPJA 1RI4A 3PVCA 4PGGA 2ZWVA 4C4AA 5FUBA 2GLUA 4AZSA 5F2OA 3AXTA 3PLAE 2QRVB 1N7JA 3OE4A 1BHJA 3TQSA 2ZZMA 9MHTA 3GXOA 3EMDA 1SVUA 2NXEA 1HMYA 3HP7A 4LWPA 1I1NA 4AZWA 5DM4A 4MWZA 1X1CA 4RVFA 3DXZA 5F2KA 3RODA 3UJBA 5MHTA 3C6MA 3R6TA 2GB4A 3DMHA 3G8BA 3TKYA 5CVEA 3MQ2A 4AZTA 2PXXA 4EK9A 3TMAA 3CVOA 4KIFA 3VC1A 3KQMA 3KQSA 5EIWA 3ELDA 2PLWA 2O05A 5FWAA 2PSSA 5HIMA 1G55A 4QTUB 4MTLA 3NMUF 2FYTA 1SG9A 1X1BA 2XYRA 1YF3A 4XCXA 3RIEA 4CWAA 2CMGA 1IXKA 2PX5A 3PX3A 1I4WA 5DX0A 4RTQA 4E70A 3BZBA 3EPPA 1R00A 4ER0A 2WA2A 4FR0A 3SGLA 3KR2A 2YXLA 3QOXA 4KDCA 3UJDA 1YFLA 4BLVA 2JHPA 3HCCA 3KQYA 3EEYA 5GM1A 3TKAA 4C05A 1RJFA 2Y1WA 2C7RA 2CMHA 3KQQA 3FPFA 3KQVA 3MAGA 1YFJA 4BP1A 3AWIA 3FRIA 5P8WA 4G56A 1KYZA 3C6KA 5EIFA 4RTLA 1NW7A 3UJ8A 4YV1A 3KQOA 4P7GA 1KXZA 4RVGA 3VSEA 3DLIA 3QOWA 3GDHA 3ORHA 4ISCA 3R0QA 1NV8A 2NXNA 1QYRA 2JHAA 4RVHA 5DX1A 4C08A 3KPWA 4PYQA 3TM5A 3IHTA 5FQNA 5K0NA 4KW7A 5KS2A 3ER9A 1XCLA 4DQ0A 3EVGA 1FP1D 4R6XA 4C07A 3BT7A 3CJRA 5DPMA 2FCAA 5ICFA 4C03A 2ZZNA 3LCUA 5EEHA 2HMYB 3OU6A 3AJDA 2P7HA 3NDIA 3FUXA 5DLYA 5K0FA 3P97A 3G2PA 4C04A 1N7IA 4DF3A 3ELYA 5DXAA 3TRKA 4QDKA 1WY7A 3B3GA 4WVLA 4E2YA 3T7SA 3PTAA 3A25A 3B89A 1XDUA 2ZCJA 3GRRA 3PFGA 4FSXA 3P9IA 3LKZA 3OU2A 3KQTA 2PX8A 1JG2A 3T7TA 2G71A 4BLUA 5E1BA 2FK8A 2YUIA 3LDFA 3GRUA 1BOOA 3NWBA 1KPIA 1RJGA 1TW3A 3UJ6A 1EIZA 3RW9A 1NT2A 5EHIA 3GU3A 1KYWA 1D2GA 1Y8CA 5K0EA 2ESRA 2AOWA 5HIKA 1SQGA 5FULA 3IV6A 3G5LA 4R8SA 2PX4A 5K01A 2PT9A 4C06A 1F38A 3EVFA 4OA5A 3GCZA 2GH1A 1BKYA 1KPHA 2NXCA 2ZVJA 4PYLA 3P9CA 3BGIA 1RI5A 5DSTA 3DH0A 3H2BA 3PX2A 1VIDA 5KYGA 2UYCA 4GOND 1ZKDA 5EEGA 5FA5A 1SUIA 5BW4A 3BKWA 2YR0A 3MHTA 1V39A 4YUXA 5EQJB 3CGGA 5K09A 4PNEA 1DCTA 3FUWA 3MB5A 4P58A 2K4MA 4RV9A 5F2NA 5EC8A 1SKMA 4DCMA 3LPMA
chains in the Genus database with same CATH superfamily
3TOZA 3D1LA 1HDRA 1J90A 2TMYA 3BWEA 4QHSA 1Z7YA 2C5HA 2ZIXB 1LC3A 1QZ3A 5TMEA 1DEOA 4O08A 5JJLA 4BNVA 2WSIA 4LF6B 2O8CB 2FG7C 1A4XA 2GLXA 4KFTA 3WKDA 4BKOA 5EJGA 4EI8A 2OCIA 1JDZA 3LE8A 2HK6A 4ME6A 3UOAB 2P0EA 3OP4A 4H6PA 2RHGB 4FGZA 4FZVA 2HA4A 3FRHA 3R7AA 3RSGA 1TD9A 3UHPA 4FR5A 3V34A 3MN1A 1BRMA 2W6NA 2B4TO 3H2JA 1LX7A 3ZDRA 3FCXA 6PFKA 4PFSA 1V26A 2JKZA 1E89A 1Z82A 2XECA 2JASA 3PS9A 4UDXX 3CX7A 3PWKA 1LVUA 4WY8A 4CFYA 5BN3B 3ZTYA 3GDFA 4YXWD 3L8EA 5EFZA 1OLSB 4EHIA 3EWIA 4JASB 3JQ8B 3H1BA 3KD3A 5DTRA 3F49S 1G7CA 2ACKA 2WF5A 2J48A 4ZQBA 4UDNA 4JYZA 3S2IA 1Z5ZA 3D6FA 1FMJA 1WUKS 3LHIA 2QTZA 3QPBA 4TKVB 2Z57A 3VPSA 4BC1A 3H05A 3F2VA 2VDLB 2QQFA 5AHKA 2O2EA 4DCNA 3UG6A 1N2JA 2JHGA 4Z4QA 3QVGA 1UJBA 4YLGA 1Q77A 4KX3A 2XUJA 3K16A 1FDWA 3PXUA 1EG2A 4A3SA 1V2GA 1XDWA 1BDHA 1IWPB 3H8SA 1XNHA 3D0KA 4HGQA 1ZL2A 2HY7A 2A1TS 2QD2A 2IPXA 2WJJA 1XCBA 3EG9A 1JEDA 1J6UA 4GVXA 4FFBB 4R1NA 5CJPA 4ZVOA 3UMRA 4E4RA 1GZ6A 1IE3A 3Q1KA 5D85A 2W93A 3D31A 1EH5A 2AR0A 4M86A 4CM8B 1IB0A 1CRLA 2IY8A 5L4NA 1MEEA 2IYPA 2BGRA 3R8XA 4ZCLA 1TDJA 1T0UA 3K2BA 4RK4A 4COKA 3P2KA 1ECLA 4HRYA 5FL3A 4QTXA 4CL3A 3PENA 4FK8A 4BQFA 3TOXA 1D0VA 1PGNA 2J9YB 1TNDA 2NZVG 2GPYA 2ZTLA 1JAXA 4OVKA 3EX7C 1TCUA 1YBMA 2CEAA 1OMOA 3DOEA 1TO6A 2HA3A 1F4PA 3D6VA 3ONNA 1KI3A 1OLUA 4HWGA 4PHFA 4A10A 5LQKA 5CLIA 3QWBA 1JG6A 3F7MA 3RT9A 1XE3A 5HBGA 3FJOA 2YX1A 4HPXB 3SY8A 1Z22A 1WTAA 5JUWA 4W6ZA 3D7NA 4AS1A 2NZXA 4ZZ3A 4DTCA 5LYJF 4PO3X 3V2UA 1D07A 2O3RA 5CPFA 1KAEA 1X86B 2RBKA 4O25A 4GT1A 4ANFA 1R6AA 2EVWX 1I4LD 2GBPA 2MIIA 4BPRA 4BV9A 1VJ0A 4PS1A 4Q4LA 3GA7A 4F91B 1KBQA 1YQWA 2HW8A 4ZYWA 2O54A 4KQFA 1SXJC 3B2NA 3WMGA 1A0OA 1E18A 2QA5A 3KKNA 1Y3IA 4DYHA 3LIPA 4ZREA 1AUOA 1L8AA 1Y34E 2X7HA 3RUPA 3TECE 1MV8A 4IRMA 3D1JA 1GFZA 3RK4A 2GYYA 2I67A 4QUKA 2OENG 5E6RB 2XITA 2NM0A 4ZZ1A 2O8FA 1UZNA 1IZ0A 4FT2A 5JZBA 4UNNA 1T8UA 4DCPA 4Y9SA 4JYMA 1L5QA 3QE0A 1CRPA 1DRKA 5CB4A 2VDWB 1JYEA 2IBMA 3MWKA 1B3RA 4OL0A 5GAJA 1RXCA 1QVAA 4BCDA 4B3JA 1JB9A 4S1WA 1HH4A 1E1MA 1YQGA 1ZITA 2IUFA 4NS4A 1JMVA 1B6GA 5AP9A 5A4JA 1D6SA 2XWSA 3OEYA 2RFLA 4QNMA 1C4XA 3UWPA 3WO1A 3PX7A 2ZTHA 5FLYA 1W1WA 1GAXA 2HXGA 4GDFA 4OUDA 4TLAA 1ZCAA 1ZJ4A 2BCJQ 2YNMD 1XCPA 3PLNA 5AK3A 3Q4GA 2Y0BA 4N5IX 1FFGA 4QT4A 3COJA 4J7CA 2FMKA 1L5KA 3BIFA 2XVMA 4NNPA 3NTOA 3HB7A 2YN2A 1YVPA 4OMUA 4CCYB 3N2GB 3P0FA 3O9ZA 5HM6A 4M6WB 4UW9A 3U3KA 1WCYA 2WV7A 3LA6A 4ZCQA 3JATB 4PWYA 2L82A 4Q7JB 2DG2A 2JI6A 1QQ6A 3RTEA 5TJHA 3QBJA 4BO3A 4NTZA 3LUBA 3DZCA 4HYEA 1SPBS 1MW9X 1UWLA 4WOJA 3O75A 3LUHA 4A16A 4PZAA 2GERA 2I2BA 3IAS1 3QHQA 3ECSA 4R2XA 4Y0AA 2UUCB 1GFSA 4MHSA 1VCIA 4HZGA 2HO5A 4RZIA 1OBCA 3ZY6A 5KTPA 1VE5A 3C5EA 3C8UA 1MPTA 1U0LA 4B71A 2GUWA 3ORQA 2R7MA 4MGKR 2LRHA 5EJ6A 1HQKA 5KOJA 2CSXA 1Z0UA 2POCA 3QPUA 4PN7A 1H2ZA 2XQJA 1XTRA 1DAIA 1JFFB 1JKMA 1SZCA 1UMDB 1BH2A 3JD0A 3SEQA 2AC4A 4DSAA 5J23A 3V4RA 4IMRA 5T5QA 5CLJA 1NXVA 4JROA 1ULZA 1SR8A 2NXJA 3FN4A 2VHVA 2AZ4A 2GBLC 2VT7A 4H4CA 4AAYA 1T2FA 5KX5A 2IEBA 2H31A 3CZRA 3OZRA 1HR0B 2WIFA 3K6RA 4MVWA 2LXNA 5L6LB 4YAJA 5EZ5A 3DKKA 3OIYA 3ZGXA 2IZ7A 3LG2A 4G9BA 4JYPA 4F1KA 4FFVA 4LCJA 4XM1A 4KSBA 1MN6A 1G5QA 1IJEA 2PPLA 1QVVA 1E64A 2W98A 3GR6A 3IAS6 3VVLA 2DBRA 3KSBC 5EN4A 1A1SA 4Y6LA 3GA5A 3OQIA 4DHEA 2XUQA 3HY3A 1M3SA 1NVAA 1BS1A 1ZY2A 2Q6TA 2W2TA 1E5QA 5A06A 4TSFA 3LKBA 3TF5A 4IL5A 2ZYIA 3BXEA 1JSXA 5D5HA 4ZKDA 4M7PA 2A30A 1GTVA 2WF7A 4J3NA 1FB5A 4OJKA 5BOVA 4HQFA 2V9CA 3HKDB 3ISJA 1OREA 5B3JA 5IHXA 3K5HA 4NBTA 4JQCA 3CLHA 5DK4A 4QGHA 1XCGB 1YA6A 3NW9A 4TMXA 1R66A 3VYUB 1FDIA 4HFMA 4N8EA 3E27A 5C5CA 1W49A 2H65A 2B78A 4WRRA 1HURA 5A4DA 5FL7D 3WGVA 4WW0A 4D92A 2Q0SA 3E9MA 1P4GA 1NHWA 1Z6QA 4ZAFA 5JH7B 5CLLA 4GE0A 2BR5A 3DYIA 1LNQA 3P2EA 1R4NA 4QDZA 1X7YA 4R54A 3QJYA 2X3YA 3N8HA 4N6NA 1BKSB 1XEFA 2C57A 1MABB 1R8QA 4UTNA 4QYMA 3H1TA 2RBEA 2VK2A 1GU0A 2DHQA 4TV9A 3T99A 4MYHA 4E94A 4Y6PA 2Q6KA 1KEPA 2AFRA 4E5NA 1R12A 1ZRSA 4EF6A 3G9XA 4Q24A 2R2AA 1OQAA 2WSBA 3NYWA 2CDAA 4U6QA 3LDAA 3OLZA 1B6RA 3FYHA 3SBEA 5AM3A 2REQB 2BMDA 2IWRA 2J5XA 2O2JA 4EABA 3K9HA 1RWQA 2XVZA 1WCWA 4HB2A 5INTA 3VR4A 4QUAA 3AL3A 3OE1A 4BWFB 4RX1A 3OT1A 1IQRA 1ISHA 2FX5A 1GA4A 2GR9A 1IZZA 2O2IA 4C7OB 5KWJA 5AM0A 2DM6A 3FPSA 2A0YA 2EGUA 2ZSDA 3NHUA 4OBXA 5EVCA 1FDRA 5CVVA 5GJBA 3NWOA 5KDDA 2EG5A 2JIZD 3Q8WA 1QS0B 3A9WA 5KJEA 5BXYA 1EX6A 4GPEA 4PZUA 4URZR 2XUIA 3QFRA 4DIKA 1QHXA 1WDWB 3I01A 3VZRA 3BIOA 3ZWNA 1BTOA 2JZCA 1IJBA 2OC4A 4NYIQ 3B3AA 3F6CA 1TVKB 2VPQA 3K9NA 3T1QA 5ADHA 5LKRA 2HWXA 3MC1A 4Y1RB 4DBVO 3JZMA 2QW1A 3R9WA 1NJGA 1NXPA 1YZNA 1JU3A 3RASA 5E95A 4LY0A 2FLKA 2YXNA 4JHLA 1IK4A 1C3LA 4K2HA 4MQUA 4ENUA 3W5AA 1KFEB 1OXSC 1J8YF 1OFGA 4ZYTA 1KY3A 3WYCA 3ZDCA 1AC5A 2RGNC 2ZBQA 1LDBA 3VJMA 2EWVA 1K6EA 2J3DA 3U49A 2E5FA 4GRAA 3WK8A 5K03A 3Q7EA 2K7ZA 1GZUA 3B9QA 3OPYB 4BZZA 5HR5A 1JAHA 4ER3A 2VQDA 4DA8A 3A05A 4V0NA 1KJ9A 2R6AA 2Q3JA 3U7EB 5EHGA 3AERB 2HF7A 4JBLA 3V8VA 5LFAA 2YMPA 1X7XB 5KJ1A 3V4FA 3L1JA 1Z07A 1PK9A 2HA5A 3VAYA 3V2IA 4DJ5X 2HX1A 4ZGBA 3W6PA 3W3ZB 3CU5A 4ASUD 1WBJB 1YHZA 3SJZA 3UWOA 3MB8A 5G4KB 5JXGA 2HV8A 3I28A 3NHSA 5EIHA 5FYDA 1GKKA 3VPHA 1MW8X 4BUJA 2WHPA 4JXKA 1NX6A 4JN6B 3M7IA 1E94E 1QO0D 1J97A 4MI6A 5B1SA 1QU2A 3Q40A 3U17A 4LBYA 1X70A 1YDMA 2BM9A 2L18A 2J7KA 2J3MA 2WG2A 4R2LA 3ZKWB 4MRSA 4F5DA 1F2UA 2OXTA 2J5KA 1YT5A 2B4AA 4XR4A 5FB3A 1R0XA 4G09A 3S44A 4YUYA 1TKRA 3TNLA 3ELWA 3EIHA 3E5MA 2P40A 4MRRA 1VFPA 1DIHA 4J7UA 3LX6A 1CUGA 3Q11A 4WLOA 4KDRA 2DJ5A 1K89A 3P9NA 3DWEX 3TTTA 4POAA 4LC0A 3OJEA 1E2MA 5C8ZA 4OEHA 4DSOA 2XE8A 4GKVA 2NZYA 1FXUA 2PZGA 4TS4A 3ZI7A 5JJ5A 1T3ZA 1ODIA 3QJGA 1P3DA 3P0RA 4WOPA 1O97C 1E2UA 1ST2A 4A2WA 5A3RA 1DCFA 3IP3A 4OQMA 3THWA 1YCFA 1QF6A 3IILA 2N42A 3TPZA 4ZAVA 4ZICA 4A23A 2WWIA 3RAJA 3O38A 2DRIA 4LMAA 4L75A 2IYUA 3R9IA 3Q6NA 3O3CA 3N70A 3T1HB 2DFNA 4XEUA 5B4UA 1JGTA 1RBZA 1MV5A 3LQFA 1D2MA 1U11A 3HJBA 3O0TA 5L7TA 9MHTA 1SVIA 2Q5IA 3DV2A 3PHJA 4CYMA 1EBBA 4IBOA 4YAKA 3P26A 5JQGF 5IT0A 1N2HA 4BOYA 2WM8A 3FHOA 3M4YA 4L9RA 1VPLA 2ZJ4A 2VHTA 2EGGA 4BIIA 3NX4A 3MQ2A 1ZXXA 2OGZA 2ZSIA 5LM3A 3B13B 3T34A 4PZLA 4ZT6A 3V7NA 2QRJA 4LZPA 4Z49A 1N4AA 4AF8A 3GLTA 3NAMA 3PCXA 1XRLA 1A04A 3RJ9A 4ENRA 1D1TA 2P4SA 3DGEC 4GRIA 1P9LA 3NI2A 4L0CA 4DA6A 2E6KA 4UPDA 1LRKA 2ORIA 5I4IA 1SG9A 2EFDB 4LMPA 4MCAA 4K1XA 2FETA 2WUWE 3PX3A 3ZV7A 1OD6A 1X6VA 4HLCA 3FZEA 3PNOA 1U3CA 5EI5A 4AMUA 4EENA 1ZWKA 1BVYF 1DCKA 1Q2UA 1RIFA 1Y4DE 2FPSA 3UJDA 3ZBQA 1DAGA 2VSXA 4Q3LA 9LDTA 2V7UA 4Q18A 4Y98A 3WGNA 1GEGA 4C05A 1GGJA 1JE1A 4WWHA 1ZRHA 4LHYA 3WA6A 1YB5A 2DH6A 3H0KA 1FFCA 3NB0A 2ZJ8A 2B7CA 2Q21A 4DDVA 3QKSB 4P7GA 1NC1A 3UOGA 4BP9A 1VM6A 4XOUA 2YFQA 4JBXA 4BO5A 1E32A 1TECE 2R85A 3ORHA 2Z30A 4O4JF 3AFIA 1NV8A 4JDUA 3E18A 1CNFA 5F52A 1NKSA 2Q8PA 3ER9A 2C61A 2KM1A 2GEUA 2HU8A 2WUVA 2C07A 2BUAA 3QU7A 1F6BA 1BN7A 2P2YA 2GN8A 3CF0A 3RJTA 1D4AA 1Q0LA 5EEHA 2WIDA 1TAHA 3CUEF 1MDFA 2QRHA 4CR6A 4RCVA 4RE6A 2P2GA 1PWYE 3AF6A 1UMBB 1UPFA 1V16B 1VRVA 3I9JA 5LBUA 3WRVA 4GLFA 5ILQA 3GRRA 2XUFA 4OP3A 1ISIA 1SBTA 2QEQA 4J3JA 2PX8A 2OM2A 3L8CA 3ZD6A 5HUJA 5IFLA 1Z0AA 4NK4A 5IUNC 2YUIA 4I6JA 5EIXA 1JN0A 2RE8A 1NYLA 2XTMA 4H9JA 1CWUA 1V8DA 3LCJA 2JRCA 1GSOA 3KEOA 4OGKA 4P2GA 3UJ6A 3V42A 3SWWA 1V8FA 4TVOA 1KYWA 1D2GA 1USIA 3LPNA 1P2TA 1MAAA 1T5OA 3WGLA 4C7BA 5T6MA 2W58A 3AUTA 3VTZA 3CPJB 3D7LA 5K6TA 3R7FA 4NYMR 2QAJA 4NXNB 3LY8A 4ZMSA 2DX7A 3GCZA 2AZXA 2Y66A 2P1ZA 2CXUA 1LLDA 1HK7A 2A92A 2FPRA 2NXCA 2V0NA 1DKMA 3K09A 3QM1A 1Y7IA 3ASUA 2XH8A 1U4OA 3T5DA 3VMFA 4BNGA 4L6IA 3FTNA 2FPMA 4M0DA 4CM9D 4JJGA 1I7SB 4RO0A 3PFCA 3K30A 2XUZA 3MWYW 4JR0A 5D5QA 4X5OA 3T4UA 4OHPA 1R5JA 1L7PA 2WG1A 2AI1A 1NVVQ 1VSBA 2VAXA 3S28A 5E7MA 3WLNA 2CNWD 3CWQA 4AKTA 3RRJA 4NE7A 2GASA 4HP8A 1KGDA 2HPVA 1YS7A 2PV7A 3IKMB 1GRNA 4IQFA 4BJ6A 3MMPA 3J80A 1ADBA 3L49A 3NORA 4A9AA 1YRYE 2NO0A 4CIWA 3GRPA 3SI7A 4MNTA 4YP5A 1C8BA 3TSYA 4I6GA 2OLKA 1RXWA 1CD5A 1L1EA 2WSMA 2YIJA 2YZMA 4JHXA 5CVTA 1QUEA 2JDIA 2FSVC 2C77A 1NYRA 1S9DA 2ASEA 3MFDA 1NAIA 1U0RA 1IPHA 1XRPA 2ATIA 2H1SA 1XG5A 2WZCA 2XUAA 4JJ8A 3SE0A 1ZLXA 4Y30A 2JL1A 2G09A 3HRIA 1G1MA 4Q9KA 2P30A 2VQ6A 2I3GA 3MMZA 2GKOA 4PSAA 5C1IA 5KDOA 3R74A 2R7AA 3HE3A 3OTWA 1RLUA 2VPTA 7AT1A 5AK6A 1ECBA 1QBGA 1Z8HA 2XHEA 4K6GA 1U1IA 4NONA 4ENTA 4UUMA 4WEOA 4G5FA 1U2DC 3AYZB 1W4ZA 3AV3A 4TZTA 4EGCB 4PLCA 1PX0A 3NJ4A 1DOAA 1O6FA 3JALA 3L0BA 5FD8A 4C4YA 1Y81A 3HUTA 3INRA 4FZ3A 4RDHA 3GLGB 2EOAA 4TRRA 3FETA 3AR9A 4XDGA 1TCAA 4O3MA 3M89A 2R8EA 4JWTA 1C0KA 2RG7A 4DSNA 3IMFA 5HZKA 5JR3A 1EB9A 2NT4A 2VUIB 4UJ3A 4JBHA 3RU2A 3T3DA 3YASA 4EKEA 4JV5B 1NR7A 1G8SA 1QZZA 2FWJA 1M1YB 2E6UX 3E5NA 1YB1A 3KTAB 5FQOA 3OX3A 3AHEA 5LB2A 3ELBA 2CDBA 3H4MA 3O4VA 5IHPA 4DA0A 1VRCA 4GKKB 3P0HA 4IW3B 3HY6A 3K0EA 1ENPA 2QTHA 3DEJA 4FYJA 4GLLA 1J5PA 3TNFA 3ZY5A 1JT2A 3FR8A 1O0BA 3EGDA 3JTEA 3MCAA 3X1YA 1T29A 3ZV4A 3F3KA 3QLTA 4RZSA 3N87A 1EPUA 5DM70 3B1VA 1IXZA 4BMSA 4XVQA 5JC1A 2W2KB 3BL5A 2AN5A 1RYHA 1Q15A 1N4DA 4IDGA 3W2GA 5C80A 1J23A 4F9EA 1NY5A 2I6XA 4G23A 3QFCA 3NIGB 4OB7A 4F45A 4AQ7A 1JZQA 4X3OA 4IFBA 4UUOA 3U0VA 1DU4A 2QTMA 2QLNA 3L18A 4ZCPA 2MSLA 3AI7A 4UBLA 5FYQA 5IZCA 1W581 2H2WA 2JJ2D 5HKKD 3GGCA 4RMGA 4AURA 2JLYA 2ZIZA 2P91A 3AVUA 3EA5A 2ZB2A 4N9WA 1E7YA 3N28A 3IP7A 4BX3A 4JJEA 4ENWA 5JHHB 1WO8A 5LZ9A 1T9GS 3U37A 4E13A 4C7JA 5JXIA 4H18A 3EFOB 4TZKA 2M6SA 4V0SA 3KX2A 4O4HF 3OCZA 1KEUA 3PEEA 5LA6B 2PZMA 1E6LA 2VQ3A 3M1YA 1BSVA 3G2KA 3I9OA 2W90A 4IKPA 3BTUA 4QLAA 5LQAA 2VH2A 4LTDA 4RTPA 5FDFA 2WU0A 4B44A 2HQOA 4C0XA 4RTRA 4KBGA 4KN8A 1EFKA 4MVCA 5DYTA 2JFBA 1RXUA 3QKRB 3B20A 4FQ8A 4Q4CA 3I2HA 4K7JA 4XYEA 5K2OA 5CAEA 1JQJC 2ST1A 3L0CA 4B40A 3S0JA 2PD6A 2VT6A 2VJPA 4HSEA 5EMHA 1KMCA 4OGGA 4E6EA 4DLKA 4HEA1 3LXUX 1F17A 2WJHA 1V7ZA 4DXDA 2D0PB 3LTEA 4PLYA 4UBNA 1SKAA 5ESWA 4H0NA 1ID8A 4KAXA 5J5CA 1NVFA 1VI6A 4IWYA 3I8XA 2WAAA 3EY9A 3E9EA 5DXJA 5K0CA 2O3TA 3RVDA 2QTTA 1FYDA 4QJIA 4PM4A 1GG9A 1BS9A 2B83A 2EP7A 4Z2YA 1DIAA 1E66A 3BXXA 3GJ8A 1NSTA 2ZUDA 4WLFA 4PAGA 3CLUD 3WX0A 3OHSX 4M38A 1LFAA 1U2GC 1WV0A 4HVLA 3JAKB 3SN6A 4L8VA 1W85A 4TSKA 1W5TA 1CJSA 5AJXA 4TVSA 5LXTA 4H7FA 1ACLA 1OI7A 1OWLA 5DNEA 3L6UA 2V96A 5IANA 2OPHA 1TZCA 2PV0A 2WAXA 3T3IA 1Q95A 4A8TA 5EGNA 4CJXA 3UBTA 2YBEA 3FW1A 3Q2KA 2WYHA 1JQDA 1K98A 4KGDA 2PZJA 4LEIA 5JCOC 3HL0A 3K70C 1P72A 2PSJA 5F9HA 3RYIA 4EDFA 3MTIA 2UUOA 4HKTA 5EAIA 5C1OA 4J1SA 5EP3A 4L5YA 1F12A 3L8DA 3H5IA 1SD1A 3JR7A 3KB8A 5K8VA 3GEHA 3P9RA 1HNXB 3UKJA 3R6DA 3PBKA 4U7HA 1JKJA 5GONF 4Z4GA 1ZL0A 1UDAA 4R8KA 1O57A 1YR1A 4J90A 3N7UA 4NE9A 4P36A 5EHZA 1DTWB 3NDBB 5I47A 5DN6D 1YJCA 1WQ1R 1GAQA 1SJ9A 1C1DB 1WB6A 1C9MA 2EQAA 4N5DA 4O0MA 4WV3A 3BC1A 5T64A 1EX1A 4Y18A 2OHIA 1CUWA 2ENWA 4I99A 4KB5A 4BXOA 1PZNA 4IYRA 1S3FA 1GNTA 3ND9A 3H0EA 4V0RA 4GC5A 3G59A 1T9AA 2IYLD 2PSFA 2WKSA 5G3YA 3A1DA 5BWCA 1NG9A 3R9XA 4NX2A 2VHJA 3LRXA 5AMXA 1H5NA 1XQXA 3D8SA 4WIAA 3G0BA 5LMNB 1TGVA 1AQIA 5ALGA 3C6QA 3AESB 4CT0A 1XXHE 1PF7E 3I4LA 3ILVA 1JJ7A 1VBKA 3FZGA 2GDZA 1NPDA 3M1LA 4I9UA 4N01A 4NV1A 3F6RA 3SBXA 3MBIA 1UZMA 1NUHA 4R1TA 4WLUA 3RSCA 3DYBA 5A7FA 3I1JA 1L6RA 3QP9A 3VZSA 4PYOA 2XOKA 3WZ2A 1FE8A 4CMHA 5AM1A 4D57A 2NO9A 1K7XB 3QHAA 4F8YA 1OI2A 1FJGB 3I9FA 1KPGA 2O2HA 3IHKA 1L5ZA 3RVPA 1LPNA 4IDFA 5DM60 1JR3A 3QPVA 5J47A 4ARVA 2PWBA 3LP5A 3K9BA 3L6OO 3PNQA 1WXXA 3AFGA 3I6IA 3LUJA 3JVDA 3T9BA 2XKKA 4RQUA 1P75A 3OOJA 4PO9A 4NBSA 4OUKX 4TS9A 4YJGB 5AKXA 4MVJD 5KQGA 4GI3A 1ZJZA 2ZAIA 4DRYA 4FYPA 5J2UF 4MV7A 4FEEA 4DJTA 2R25B 4EPYA 4H08A 3OCUA 5TGZA 4GQBA 1KR2A 2YY7A 3CUUA 3FCCA 1HLGA 1P5FA 1T6XA 1JTFA 4E2WA 3BHNA 1XEXA 1NM5C 3BULA 1DX4A 2QPAA 3A0RB 1ATIA 2BEJA 3MGBA 4JT8A 4H15A 1A96A 2JPDA 2QPLA 5KOYA 4K8OA 5IAJA 1SVSA 5YASA 4B82A 1DIRA 4M2LA 1KK3A 1VLQA 2VZLA 4X1IA 1MB4A 1RAFA 3Q3CA 1P4SA 1PSWA 3W9UA 4AT1A 1OWNA 3I42A 5T41A 5ECGC 4WDQA 1RAEA 3DTVB 4QYWA 1MO6A 4XYBA 2RK6A 2PH7A 3JZAA 2I7CA 1CUAA 2CVQA 1N5JA 3N8IA 3DOUA 4XB1A 3W5BA 3TR6A 1JJFA 3EOAI 3ANNA 4RSGA 5JDIA 2J59A 4BKQA 1VXOA 4QOJA 4MI9A 2CY0A 2OORA 1II8A 3GP3A 3AF4A 4HTFA 4MWDA 3JZDA 2A9JA 1A5AB 2V6MA 4PZDA 1Z4MA 4UATA 2FI1A 5AJTA 5C4GB 1YB2A 2Z3VA 4I4CA 3G82C 5K9ZA 5HRUA 3Q7IA 2JA1A 1M0WA 3GLIB 3M6VA 1N6IA 3LOPA 5FCDA 2GHQA 3MGKA 4KKVA 5FLKA 1OWPA 5GTDA 5ALEA 3VSDA 4TKMA 4TXLA 2WF8A 4AG6A 5AD1A 1W8DA 4ZIRA 1XV5A 1G8JA 1PG5A 4A6PA 4V38A 4EY6A 2NU7B 1BDIA 4O4LF 1C7RA 1O54A 4Y3UA 1TC1A 3W34A 3M6IA 4EFKA 1S8OA 1UDCA 1P6UA 3L0OA 4EUHA 1BXGA 1ONBA 1NUAA 4GWGA 4QU9A 3SM3A 2W6JA 3NHFA 1HQCA 1JXQA 1V5WA 3VR5H 5E6UB 1JPJA 1QB7A 1EFPB 3Q3GE 4MPJA 5KJCA 3ICEA 2QZSA 3VAAA 1FF9A 1MNAA 4DTIA 1EVZA 1H6AA 1PLKA 1Y6JA 4EZBA 2I6SA 1ZCJA 1GV0A 1ID1A 4MR7A 4NK5A 4ZVVA 5EJ2A 1HSOA 3KCNA 3DLBA 4AJPA 4RD1A 1WZIA 2AOTB 4R4JA 5FFFA 5CK4A 3TSWA 1N1EA 3TMYA 1WM1A 5C3UA 3OE7D 3U31A 3RV3A 2QWXA 3TB6A 4D9FA 2QRQA 2DKFA 5BV2P 5A4IS 4E03A 3NEAA 4B6GA 3QQPA 3IEMA 1LKZA 1Z6XA 4LYDA 4QBGB 4HUTA 5FPPA 1ORIA 3L4EA 3AUXA 2OV2A 4WBXC 1JG4A 4RHEA 1D09A 2ZRQA 4V02A 4S04A 1MRSA 3HJHA 5FRDA 3AP1A 3HV2A 2DECA 4Q7EA 5JCJD 3TLJA 3ZWDA 3PUWA 2VS1A 3IOMA 5BUCA 2FW7A 4EY3A 2JEYA 1X3SA 2NO1A 4BGEA 4QASA 2AE2A 1NN0A 1J20A 5EJFA 1G4HA 2BFCA 3BWVA 1SO8A 3EIOA 5ALTA 4FHCA 3A2MA 2C1XA 2XTJA 1FVFA 1XMIA 3GJ0A 5AO9A 4YRNA 3ROKA 1PT7A 4MKFA 5TS2A 5COAA 3EPLA 1IHYA 4TM7A 4AN0A 2PE5A 4RTOA 4BGIA 3OMXA 1CP3A 3PEWA 3NIDB 4PPFA 1WZUA 3DA8A 3FKSA 4BMXA 2YRWA 2VUHB 1WUHS 1N2CA 4HDSA 4OV6B 1SQFA 3FNRA 1K88A 2X7JA 3B8EA 4IPTA 1CF4A 1NZDA 1Z08A 1KI2A 3BIJA 3SXUB 1L8OA 2J4FA 1XJCA 3GRFA 1C9NA 4PZCA 4EUNA 1G5RA 3U26A 1TM5E 1T6ZA 2D8AA 2A7QA 2WB2A 1C7FA 2Z2ZA 4NCHA 4ND8B 3V4PB 2ZRAA 3IE2A 3VYRB 4X66B 2YZGA 3GFOA 3J7TA 2PMFA 4OOFA 3CKKA 3K96A 4RCZA 4Y9DA 3BDVA 1L4LA 4ZPXA 4YP7A 4A26A 3CPHA 5C18A 4DV4B 1Q20A 3QVLA 4O2BB 2ZJYA 1JQ3A 2PEYA 1UXKA 3F0TA 3OOWA 1DKUA 3O8QB 5F7ZA 3IAEA 3QUQA 1IFXA 1ZZEA 3CZMA 4OHUA 3PLAE 3OPVA 1ZOOA 4S0XA 4FW9A 3U6BA 2VOJA 4KXWA 3T9AA 4D43A 2M6KA 1ESNA 2QN8A 5IWCA 2ZB7A 4GP7A 1EFRD 1N3BA 3D1VA 1Y7HA 3WGZA 1H05A 2RKWA 5BR4A 1FUKA 4JLKA 4KYUA 4US2R 2PXXA 1XZIA 4XM0A 3I92A 2JI8A 2X5XA 3B9RA 3IVGA 4HPWA 3CISA 2ZUCA 5EIWA 1FTYA 4F3RA 1EFCA 4P22A 1I2AA 1JT9A 2FP4B 3ACDA 3DUFA 4MV5A 2MCFA 3EQ9A 2QG6A 3T7AA 4RMIA 4CBVA 1KSFX 2IHYA 3P20A 4RQAA 1FLDA 4NH0A 4IIDA 1YMVA 4I1YA 5ALUA 5B4VA 1PFUA 2XSZA 4JU9A 4TLEA 4XWTA 2E4WA 2VYFA 3T38A 2YXLA 3F3MA 1H22A 1ZK4A 4CV1A 2V4UA 4RJ2A 4Q9AA 4R31A 3SICE 3E7DA 2LUOA 5P8WA 3C6KA 4L57A 4LWZA 4WZAB 1J8MF 1NW7A 2EW2A 2DR2A 5BQXA 2JFUA 4JT9A 1GR1A 2NXNA 2JHAA 1QUFA 2CJWB 1F2TA 4B3RB 2VYVD 3QG5A 3L07A 3RYTC 5K0NA 2YY6A 3BWXA 3ENQA 4PCUA 5A3QA 3BBPA 4B2YA 3TW8A 2YVUA 2FCAA 3E1GA 5DPMA 4A4DA 3DCJA 1FFBA 3GFTA 2CB9A 3JQCA 1SBZA 3BRWD 3ECAA 5A3SA 3RRBA 4B6OA 1VYVA 4H35A 3FUXA 5CR9A 2GO1A 3ILSA 1NJFA 3JS5A 3QBDA 4CKZA 1BCRB 1MRZA 1O94D 1RM3A 4F2HA 5L53A 1E4OA 1U04A 5KTKA 4L73A 2IIVA 1U9JA 3I37X 5B64A 2OUIA 1QZXA 1R3UA 2BCGY 2IJGX 1T1SA 4X1KB 5CLGA 4OHWA 3T7SA 4DBLE 4W5OA 2WLTA 3QLJA 4PXAA 1W4BA 3OU2A 1T3GA 1OXVA 1BQ4A 3CFYA 1C9YA 2A5GA 3Q8KA 1AN9A 4MS1A 3NCHA 2ZQZA 1ZONA 2H4HA 3GJ4A 1FLAA 2YXPX 3NETA 4ALKA 1Z5PA 1EIZA 3RW9A 2D06A 3ZHOA 1GUYA 3GU3A 4QUJA 1Y8QB 1O8BA 1UK8A 4TRMA 1RXVA 1MJHA 1TXGA 1DI0A 2AOWA 1KO7A 1XTQA 4AKGA 3AT1A 4AY3A 1ADJA 2B2NA 4RMHA 1Y80A 4NU6A 4R8SA 4G65A 3A3PA 1EVQA 2D0OB 2NSHA 1JX6A 5CB6A 1EE2A 3E9DA 2Q2QA 2Z8ZA 4F9GA 4HAIA 4WCFA 1PFWA 1Y89A 3CNLA 3DPSA 4FOOA 4GSYA 2ZWIA 1VE7A 3BHMA 1ZKDA 3GGPA 4JNCA 3MRSA 2RSLA 3K1AB 4ZEXA 1GZ5A 1CRQA 4XVUA 4RDXA 3GEBA 4TUYB 3OLQA 4KRXA 3WK7A 4IOMA 1EU1A 3A04A 1FDVA 1Z73A 1PYOA 2E89A 4EJMA 5JV5A 3THXB 3AF5A 4IX1A 4KFCA 1TQ6A 2VA9A 2XMSA 5IBQA 4Q3CA 2Q2OA 4RV9A 5MFPA 2VUUA 3KD2A 2Q49A 1RYDA 1H0HA 4F4FA 2ZIXA 4KQ6A 1U6IA 2CDNA 2WYOA 3HCPA 1VYUA 2ZI6A 5CW2A 3DOOA 1C9JA 2O8CA 3WL4A 4YP0A 1J7JA 3OQ1A 4AS2A 1XX6A 2G9QA 2WT9A 2EJBA 3VR0A 1SZDA 5B3LA 3RB8A 3PPWA 4K9NA 5GGYA 5FTMA 4HVCA 2P3LA 3HM9A 2VT3A 1GPWB 2BIFA 3EEQA 4C6HA 3T7JA 5DHFA 5IUJC 2IL1A 1XEAA 2RJ3A 4DR7B 1P17A 1OGIA 2GM5A 4P54A 5A1JA 3RFTA 5FWXB 4OX9B 4PSKA 4IZOA 2HFKA 2GTIA 3A1WA 1OLSA 1GA1A 4BMNA 4E3WA 5HOQA 1BD4A 3EQZA 3H16A 1KR5A 3VUFA 1P45A 1ZMBA 3P0EA 4R5MA 3QW4B 3TG8A 1P1FA 4KMSA 1VPDA 3PXEA 3TAUA 2CN1A 3HJRA 1TCCA 3EAFA 3A3KA 1WWKA 4BX9A 4TKVA 4YRQA 4FEAA 2RHWA 1V35A 1TFRA 4QXAA 1V47A 2I55A 4JT4A 4CM7A 1Q50A 2J6CA 1CUFA 1DNPA 4ILEA 5TIIA 6ADHA 3IYLW 3L82B 2ZM6B 1BE8A 1D4FA 5L3RA 3HEAA 1Z12A 3W05A 3O8RA 3FVQA 1JEQA 1XDDA 2ZI5A 4D9KA 5HK8A 1T9DA 1M8GA 2I3DA 5CDUA 2C2MA 10MHA 4TTQA 2GFQA 4NCKA 4XOIA 1QYDA 3X0DA 3P9SA 3L0DA 2EJTA 2PAFA 1T2NA 4UUNA 5FADA 1RXYA 1H42A 1SKUA 1W0JD 2OYSA 3BWYA 3D9QX 1FP2A 2BWJA 4XXHA 4B87A 4CM8A 5JPCA 2B99A 5I7FA 1C9EA 1YQ9A 8MHTA 3B36A 3IFSA 3C15C 3O1IC 2QTBA 3HKEB 3LDHA 3KPYA 1E20A 1VJCA 4AG3A 1CR6A 3KRTA 1GUAA 3TGPA 3EIXA 1KNXA 2B3TA 1FNDA 1GQRA 3B38A 3BQ9A 2QD1A 1V3TA 3C2QA 3U4GA 5AVVA 2XDQB 5KTOA 4EG8A 1QQTA 1N92A 2LIPA 3QX8A 2AHRA 2CNLA 4MWGA 4DA9A 5JMOA 4P80A 4D42A 3LQQA 2AVNA 2HBQA 1Z35A 2E5WA 1L9XA 3RHSA 1R6TA 4MB6A 5D86A 4QWWA 1IEQA 2QVZX 2Z8YM 5THQA 2Y1DA 3H17A 4AKSA 1NMSA 5B6IA 3U3ZA 4EGSA 3DE2X 2RH4A 3ERCA 4FDMA 3C16C 3OI7A 4H1VA 2CE7A 1TF2A 3DOCA 4MARA 2I3ZA 3WS7A 4ZN6A 1E2LA 2VTBA 1UUFA 2BE9A 4HBZA 5KC9A 2RK3A 3W78A 3G0HA 2ZT8A 4PLHA 1NR5A 3VPCA 2F1KA 3MWDB 4EX7A 1UJ2A 1KDRA 1NF3A 2HU7A 3BEDA 3EAGA 1PJZA 4D9JA 4NCAA 1FNCA 2PX6A 5E6RA 3U3OA 4GVLA 4ZOQI 5GIPE 3DEZA 4LDAA 4N82A 4ZI7F 3L7JA 2HK7A 5LWHA 2HC9A 4LJLA 1QAQA 2VDWA 5J58A 2PWAA 3K20A 4I7EA 1QK4A 1C30B 1D1QA 1Z4IA 2G80A 3PWZA 3WIVA 4DMCA 2CYCA 1S7GA 4H16A 4LOAA 4L4ZA 1YSCA 2VYCA 3MPOA 3MF4A 3ESQA 3Q1LA 1RRGA 5JYDA 1HOTA 4EMSA 1VMDA 2H1HA 1JRLA 5C8YF 3ZU4A 1DJMA 4JKOA 1ZI8A 1TEHA 3H4TA 2QJRA 4KIGA 1VLJA 1DUSA 2C59A 2IIQA 4TWRA 4X61A 4UBIA 4DCTA 3I1IA 2DF8A 4EHAA 1BFKA 1O95D 3OOHA 4DJDC 1NYTA 5DHSA 3I53A 2HIGA 2RHCA 4IV8A 1HYQA 1KYXA 2PH1A 4XDZA 4CCYA 3N2GA 4DQUA 4OJYA 3O2NA 4DMKA 4P38A 1V9CA 4BB5A 3DL2A 5MN4A 1X39A 3ZX5A 5KEIA 3JATA 3O7WA 3NR2A 4QQKA 2FZ4A 3AC0A 4TLLB 3ZY4A 3KZCA 2PCJA 3B9BA 1Y9AA 3PGJA 4LPSA 2IV7A 5AKJA 5HFNA 1YL7A 3RUEA 4KRYA 2ZBGA 5IJAA 5I6DA 2WT4A 3HR7A 4ND7A 1MFPA 5SZJA 2I1QA 2GARA 2AFHB 3D4NA 2H16A 3GBSA 5E4FA 4C4XA 5C81A 5KTRA 4Z7QB 4EBFA 1COWA 3FYCA 4BZWA 4KQJA 4HX9A 1UMDA 3DHWC 3LGXA 5F5NA 1SELA 4AMVA 5AIAA 3M6LA 2IHZA 3NHJA 4GMXA 4JUAA 2PUEA 3L1HA 1ZUWA 1L1FA 4BMOB 4EIWA 4OAOA 3PUKA 2B5VA 3VU8A 4AJHA 5D1HA 1F0NA 3FMIA 3PC4A 4JU8A 4D8VA 5IKMA 3T9CA 1IZ9A 4HAUA 1KFKB 3RAFC 3KJQA 4QX6A 5K0LA 5LZ7A 3VV3A 3ZGNA 3N2IA 2XMRA 3P19A 1KH2A 4NJEB 2C92A 1GCAA 1OFVA 1TJ4A 1A5TA 2AMFA 3DMNA 4GI7A 4EAAA 2IUYA 1CE8A 3SKXA 3BIWA 1NQTA 3RS7A 3HYSA 5HJ7A 4DLVA 1G59A 4J0JA 2G0TA 4YJHB 4X64B 3P71T 1RAIA 4LG1A 4YALA 1CB7A 3GC6A 4EJ6A 2F3TA 5IS2A 2G1PA 1MJGM 5AVZA 3M6WA 4RL4A 2QDXA 2YVKA 5I4KA 1PJSA 2B1JA 4K9PA 3TTVA 4D9MA 1H5QA 4QO8A 3S8EA 4K05A 5HF9A 2EFJA 3N8DA 4ARIA 3LHSA 4RY8A 1Q91A 4UFOA 3JVUA 1T1GA 4JJIA 5GZ6A 5FX2A 4CW7A 4CTMA 1XHLA 4N7RA 2GS9A 4RFVA 3KKLA 2IA5A 4LQ4A 4PGMA 2GXQA 3OFND 5E7IA 1P2GA 1M73E 1E3WB 2CUKA 3NOQA 3MCUA 4JXJA 2E4VA 3ZHZA 5HEKA 3GLGE 1FA9A 1QO7A 1MX9A 5K05A 4TYPA 1LEHA 2JKVA 5BPFA 1R0KA 5KZMB 1WP4A 2I4RA 3UMFA 4CM5A 3B6MA 3WK4A 1YGYA 4RD6A 1E58A 2GHIA 5JH7A 4N3CA 4GD3Q 1NTRA 2J3JA 3QEKA 3EFHA 5AW6A 5EP2A 4GKJB 1M1YE 5T3YA 3O93A 1J9ZA 3M3DA 5GP1A 4CI9A 4XAQA 1MABA 3PG5A 2YWJA 5J2TF 2A35A 3ZPXA 3EOZA 3HYNA 5COQA 4B3FX 1WCIB 3W04A 4RLSA 1M2VB 3EDQA 1PJ2A 2EEPA 3R6GA 4EKIA 3O2QB 2D7JA 2DWOA 2PL9A 3ZUGA 3G5AA 4TVKA 3JQ7B 4P5EA 2M9MA 2REQA 4ZTBA 2O2DA 1F8UA 1RP7A 2VDUE 1B93A 4KQ9A 3BMNB 1ESCA 4AUEA 1WOYA 3HDYA 3MJEA 3QU4A 1VZ3A 1N9KA 1C0IA 3JYQA 3H5LA 5TPZA 3E1KA 3HUEA 3WAJA 2JG3A 4N7MA 1ORVA 4OLJA 4FDAA 4RHUA 3JRXA 4YYEA 4DRZA 2OHOA 3IB6A 3W2IA 2R6CA 4R9SA 2DY0A 1VPTA 1FIUA 5ERGB 1U94A 3PNYA 2PSHA 2CD9A 3WKEA 4BQRA 3SR0A 4M36A 4ZO7A 4A0GA 5C3MA 1YRLA 2CD7A 4DSTA 4MUJA 1TLFA 4O0LA 3I4FA 3WGGA 2DUNA 5ERYA 4ES6A 1DWQA 2YV1A 1QIJA 3BILA 1UXHA 5F5XA 4MGHA 1W29A 3P9KA 2ZVQX 4FKBA 1GG5A 1TVKA 3GN1A 4IDQA 1LPMA 4Y1RA 4KLRA 1S02A 3GRVA 3EEBA 2QMOA 3Q7QA 3UZUA 3HYRA 1SURA 4NZYA 3HBFA 2QN9A 3K09C 2ZRCA 1ECGA 2Q9BA 1THZA 4WQMA 2AF4C 4IMPA 3FB1A 4DDHA 3OFJA 3KV3O 4W5QA 2Q8QA 4LFBB 2L17A 5I9NA 3AUYA 5FOVA 1GPYA 1BOFA 1KAGA 1R4ZA 4REQB 1IBSA 1CUVA 2OAQ1 1GTMA 1A4UA 1YJ8A 1WMAA 2JGJA 3JPYA 1WMSA 1BKDR 2ZRFA 3QU9A 4CG1A 4CQLB 5LQDA 1PV2A 1Z7BA 1PR9A 1KZ9A 1QMPA 2P69A 1KC1A 3DEIA 1BC5A 3GJTA 3PE4A 3OPYA 3MSCA 2EV9A 2DE0X 1HFWA 2WU8A 3OY7A 3TSAA 3NM6B 2Q27A 3KFVA 1X2BA 3AERA 2IQIA 3LLSA 2JFHA 3OZAA 4UVIA 5EP4A 2OHJA 1A5ZA 1JS1X 2GF0A 4KXLA 4TSRA 1ND6A 4BMDA 4RV4A 2PGXA 4GOOD 2BH9A 1R37A 3DB1A 3CRMA 1XLWA 3LSTA 5TE9A 5JNVA 4MIYA 3VH3A 2V55B 3L02A 2O7SA 2VPPA 1RAGA 4FN4A 4IAOA 4PLPA 4Y2HA 3C6YA 5G4KA 3GVIA 1FZTA 4CEHB 1STOA 3TSCA 2XNDA 2B94A 2FGJA 3NEPX 4IDCA 3U3RA 3DJFA 3IRVA 4OI2A 3E9NA 3VNQA 1HLFA 4HSGA 5IJWA 2B98A 1UEJA 1FSSA 3CM0A 3IQEA 1UMKA 1M8JA 1D6JA 3ED1A 3K15A 4UVGA 1FUEA 4XM2A 5EMKA 5CD1A 4ECEA 1XPOA 2IYYA 3FFXA 2TRSB 1NI4B 4Y2VA 4ZVSA 3CVYA 1M2KA 1Q2XA 2FDRA 5GVSA 2OZPA 3BZUA 3FSGD 4ZK6A 1N75A 4KL8S 2ZDGA 4XSGA 2I7VA 1HUQA 1Q1EA 2V45A 3ZG6A 3FMPB 2HV9A 1NVWQ 1ZOLA 1Q11A 1J49A 2G9ZA 1UIMA 3C3JA 1JE0A 3UKDA 3WHKA 1ZR2A 2A0KA 4DR4B 2XF2A 2WMOB 5KQPA 4P1ZA 1P5ZB 5EIBD 4E4TA 4LQCA 1E4VA 3SAJA 3JWIA 2HMAA 4DE5A 4P98A 3DCIA 2Q7DA 2V97A 2X5KO 3LUPA 2QUZA 4OXRA 5I8PA 2JAHA 3AF0A 3G8CA 4IHKA 4IX9A 3RSQA 2XE4A 4ND2A 3LO8A 2PUBA 3UWSA 4Y6RA 2UXBB 3USZA 4R71A 2R1TB 5HRAA 1GPKA 1OA1A 3GEDA 3ESDA 4ODIA 4PWZA 5JBQA 4D3YA 1LK5A 1NIJA 4ONEA 1ZIDA 2C96A 2QRVB 2WHQA 3A6GA 1U4NA 2VPZA 3KBOA 4LOLA 3QKWA 4K9KA 5C8DA 3OH8A 3N8NA 1XQ6A 2OYCA 1WZCA 3BAZA 3RODA 3IV9A 2H08A 2GBGA 5IZCC 3C6MA 1V6SA 2XNJA 3NT2A 4KK3A 2E3JA 2BI8A 3ZKAA 2O0JA 4C2TA 3UT0A 3GEIA 2NSLA 2F1HA 1RU3A 4B34A 4NOLA 4KE7A 3IDSA 3RU9A 1CX9B 1VDZA 3P2JA 1T15A 2O4CA 2VDKB 4PG5A 4TXJA 3KWFA 3WYNA 2Y1KA 3SVTA 2PSSA 5HIMA 1PNTA 1E63A 2ZYTX 1YRWA 3ZW8A 1Z15A 2Z5LA 4Q00A 4ZCIA 1VB5A 3ESAA 5KTMA 1LY1A 4W9RA 1NSYA 1RSZA 2NU6B 1UC8A 4RVSA 5EQFA 5F23A 1A9OA 1EA5A 2OZEA 1HTBA 1UKZA 3CRNA 1BMTA 4ND6A 5H3HA 3AM5A 1XRNA 3VU3A 1DXOA 4F3CA 3V48A 4QXRA 1CDZA 1QE5A 2D3WA 4BP1A 2R47A 4KVFA 4XQEA 3X2FA 2ZR7A 1NMXA 2JD2A 1SOVA 2PD4A 3VSEA 4OI1A 3TAXA 1EHIA 5TPWB 4JLNA 3DTTA 3AUAA 4X94A 3BGSA 1XTJA 3OTOB 1TQ8A 3FFBA 2OV8A 2X6QA 4HQLA 4RH3A 2XCSB 3AVPA 2MINA 3EXIB 4R6XA 3L7AA 4ADSG 5AFSA 2OQRA 3UJ3X 2B8EA 2R8OA 4KLAA 1QNFA 3V80A 2KI5A 1H66A 3NDPA 4R7ZA 5K0FA 3OF5A 2YJZA 1JQLB 1UMBA 2QRLA 2RHDA 4W4TA 4DEVA 5DYNA 4QSHA 1GDTA 1VMEA 4LXTA 5TDHA 5TLSA 1J2YA 1P1JA 1UQUA 3W7VA 4D4HA 1P4AA 1EM6A 1OZ0A 2I2CA 3LIIA 5CFPA 1NC3A 2NGRA 5B53A 4B84A 3K9CA 4B7UA 3GLIE 3BXZA 3OBIA 2RGGA 1ARZA 1KOFA 4BLUA 1OY1A 1H4TA 1Z5GA 2PANA 4O4LA 1FRZA 3ZIAA 1BMDA 3IAFA 1M2EA 2ZJ5A 3GNTA 4RIEA 5A1TA 3SDBA 1DZIA 3RROA 4N65A 2R7LA 3WZLA 1SQGA 3C48A 3GJ6A 3BE8A 3SQXA 2AFVA 1R3DA 2NAFA 3RIXA 2J07A 1H8ED 1MJ5A 1Y9DA 2XODA 1QKIA 3MNFA 2JZNA 4NPAA 2GH1A 1KPHA 4ROTA 2VQFB 1JHQA 2O8VA 2YQ5A 1KVTA 4YHHB 3VU9B 5E38A 4WNAB 4RHFA 3RM3A 3TDMA 1OH8A 2EBWA 3R8FA 1IN4A 1VKHA 1XNGA 4FWIB 2V0GA 3DOJA 1DG9A 1DO2A 1IEXA 1T3HA 1CIPA 3GUCA 1J4AA 3A6JA 3O3MB 4IXMA 1P3JA 2DLDA 1NP6A 5DLPA 2GCIA 3ZY3A 5HYVA 1N36B 4WECA 2B4QA 1SUWA 5ALPA 1DTSA 2BJWA 3D6MA 3KHTA 4KCGA 3ZZMA 4CE6A 4E4YA 1Q6YA 2HB6A 2WMNB 3QSYA 1N2ZA 1OXTA 1W2WB 1G9SA 5F78A 2QX9A 3B6EA 1DLIA 1DEHA 4RKYA 5KJFA 4CDNA 1KZ1A 4R8RA 4QDUA 4RHTA 4P6VF 4WLVA 1GPNA 5B58T 5B57C 3RC7A 3V8RA 5JYCA 3PR2B 5K45A 4HTAA 2EKDA 3N07A 2FW0A 2FJUA 4E5KA 3ZDEA 3TQTA 4GHWA 4Z1MA 3WLRA 2F9LA 3PDUA 4BLPA 2W22A 3P2MA 4KZKA 4KQKA 721PA 3REGA 2D6FA 1C41A 1KKMA 3N59A 3V8BA 1Z3IX 1SA0A 1J07A 2IP2A 3L8HA 3QW2A 4KO8A 1UC4B 4Q12A 3ZIDA 3Q8LA 1CQZA 1RQRA 5BSMA 3SFTA 3D4IA 5HFAA 3DR3A 3CE9A 3TMKA 1GL7A 4N8SA 3M6XA 3OZGA 4M9CA 2I03A 1D04A 2PRIA 4PIVA 4W1SA 2AJ8A 4BX2A 3B52X 1T3LA 1YO6A 2VAMA 1E2BA 3CIFA 3MYRA 4N0PA 3KWLA 5B1HA 1RPNA 1TAUA 4S0ZA 3I58A 1IBMB 1M1YA 1ORTA 4U7FA 2GBFA 3KTAA 4RIHA 3WBKA 5D3KA 5U4QA 3QKUA 4IV5A 2SCUB 5ALNA 4YQZA 4AI6A 4H7EA 1UDBA 1OZFA 1WG8A 1QORA 1X8XA 4WDRA 3S68A 1ZHOA 3HXOA 3JQFA 4J1NA 1KVRA 4NMHA 2AW3A 3C70A 1FY2A 1ZJWA 2RCNA 4O3FA 2BKXA 3VZDA 2ZW9A 2PZAA 5JDIC 4CUKA 4QREA 1KJJA 7MDHA 2OORC 3BA1A 5H0IA 1GWNA 4MKZA 1FDOA 1G38A 3OCWA 5B1DA 4CQMD 1GADO 2FEWB 3UV3A 1UBEA 3OEHA 3OJFA 3W3AH 5MF6A 2HDOA 4PBSA 4CEJB 4OX9Y 5K3EA 1E1RD 3TFWA 1JQEA 3NBYC 4TTAA 3C8MA 5E4YA 4QM7A 5D01A 3HNPA 4I4NA 4YNBA 3K0FB 2YHUA 4KSYA 4QGGA 3LT5A 2PKCA 5E3IA 3TJZA 4XYLA 2OILA 2Q9AA 3NHLA 3ZQ6A 5K0GA 1D0IA 3EFOA 3IMCA 4MLZA 1PEKE 2JIQA 3ND7A 2W6PA 4PHGA 4CCWA 5JRDS 1CUCA 3VNVA 1RVDA 4O33A 1T5TA 2QRZA 4LRTB 1XTZA 4J9UE 4R9RA 4G1BA 5HKLA 5LA6A 4ACBA 4FGLA 4Z9AA 1IHPA 3GNQA 1CEXA 4XQCA 1Z83A 5EE9A 1PBTA 4PCVA 5JROA 3MS2A 3RRZA 1S2MA 3OAAD 1M75A 4BTEA 1JLKA 2I8LA 3NWEA 2HRBA 4DSZA 3QKRA 2HRCA 3PYXA 3WSTA 4OHFA 1NATA 4BCBA 3R24A 2W2OA 5LMUB 4EHNA 3H6GA 5GV8A 2B20A 4HDMA 2P9QA 4N12A 4OHMA 1YI0A 2F62A 1YS9A 3L7YA 4WZAE 5HKAA 5JCXA 3ZCUA 2HUNA 1B16A 2L19A 5FWYA 3CH4B 2WK1A 3GGGA 3K0BA 1M2HA 4CNQA 3OOSA 1E2NA 1KMHA 4KH0A 5ICEA 2XEXA 3W8EA 2Y0DA 3BWCA 1Z2PX 3GWGA 3CPSA 1R0ZA 1M2FA 2JARA 1OYYA 4FFWA 3UYLA 1M1XB 1WZNA 4F21A 2HN9A 5DTJA 4GOLD 1KWGA 1F9AA 4X7MA 4JLUA 5AW5A 3U4DA 2JHCA 4FUQA 4OQQA 4P5DA 1T91A 5LP6F 3NPAA 4IWXA 1IVYA 1KY5A 3HCWA 1D9XA 1W1IA 4FOTA 1FMLA 1JNYA 1N9GB 4OQEA 4RS3A 4S35A 1VA5A 3LC7O 1RQGA 2JS7A 3AVTA 5L4LA 3KPUA 5C9ZA 4GOJA 2QKYA 3KETA 1T34A 4LVOA 1POWA 1KE2A 1XN4A 2AK2A 2MDTA 1P33A 3AMVA 3I2GA 3K3PA 2CV2A 3OZCA 5TEVA 4JA2A 2RONA 1J22A 4PR3A 4D3SA 3L0ZA 4JI0B 1S1CA 1UEXC 3BWDD 1XQYA 2M2IA 1TK3A 3DPUA 3DKIA 2QNIA 4LMBA 3TK1A 1VRWA 3DFIA 2PN1A 3CKMA 2KSQA 4GNRA 4D4MA 4MRAA 5JY1A 1V3VA 2HSJA 1BS2A 2Z4TA 1Y4UA 4UU0A 3L9XA 2JJ1D 4FKMA 1NMEA 3KOZA 2E4XA 2PUHA 4OAQA 1K08A 2YWDA 2AL7A 1GKYA 3KVVA 3UH1A 1RWKA 4Y2YA 3UOWA 1EHCA 3UAOA 3ZK8A 1YVEI 1ZM9A 4QSMA 1O9HA 3A9RA 3NCTA 4MJ3A 3GRCA 3VNAA 2ZUBA 4UOZA 3IB3A 3RREA 1UBCA 2AMJA 1KKUA 5TY0A 4QTYA 3IE1A 1K68A 4K86A 1L5GB 3H84A 4NBUA 3UAVA 2PJZA 3FOFC 4J8PA 3QE2A 3QFSA 3OZEA 3RIGA 4EPTA 1XMOB 3S2GA 4F06A 3OUTA 2AOVA 3SBOA 4PU0A 5DCUA 4XTRA 1IXRC 2R84A 4PSUA 2Q1UA 4BL5A 2NTEA 2P6NA 2FWAA 1K0FA 2R87A 2WV9A 2PBFA 4R0VA 2QP3A 3SJUA 3RF7A 5FTLA 2NV2B 4KQ2A 2BGLA 2ZKIA 3C6BA 3IQHX 1RKBA 5CG1A 2X1VA 1GCOA 4P4LA 4F5YA 4KXXA 2KLBA 1UKVY 1L2TA 2HYIC 1GDDA 4LGYA 3TLCA 4KV9A 4B35A 5AOCA 5TQ0B 5AUNB 4UEWA 1KK0A 4LWOA 4Y8VA 3T7RA 1SKBA 2IXTA 1DJNA 2QN3A 4LECA 4YJGA 4BBPA 2HF8A 4QU5A 2AKYA 3IP8A 4GP9A 1XZEA 1QIEA 2PT6A 1D6NA 2QLLA 1KETA 3OM1A 3D3EA 3OWOA 4KO4S 3OTGA 4MKHA 1VKNA 2GN2A 1NBME 2BZ0A 2Z8YA 1G41A 2DQYA 3K0CA 4BQPA 4FE7A 2JLBA 1PT5A 3I12A 4EGAA 3PYMA 2R6ZA 4CMEC 3QVSA 1N0WA 2E1RA 3N53A 3DLCA 1L4EA 3S70A 1HT2E 2V7PA 5IN5A 5K3SA 3IKTA 5FAXA 4PZ9A 4DQDA 3W6NA 1DPGA 3GH1A 4GUDA 2CYAA 5ADVA 5L40A 1J56A 3RUAA 1FTNA 1HYGA 2BONA 1AKTA 5K51A 3LMKA 3SXPA 4JCOA 3EHDA 3DTVA 1EP1B 4LGCA 1VE3A 4M98A 1KOGA 1Z29A 1JHUA 2OQIA 3HPRA 4OSEA 5EXXA 5JEDA 5HQTA 3LX8A 2E2WA 4UD2A 1DT3A 1TPYA 2PFKA 3NRJA 1E62A 2VRWA 3BGVA 4MA0A 4BEBA 3OT4A 4DNQA 3OD5A 4WFIA 1JPNA 1UFKA 2WG0A 1PL7A 2JI9A 2VNAA 3TQOA 2WSSA 1GPBA 1UDXA 2V5UA 3DMTC 2IKSA 3HXLA 3OM9A 3AGPA 4JSTA 4OMDA 4EWLA 2BGWA 2XOKD 5TC4A 2CVZA 3TOSA 1TQHA 1WAMA 3F8SA 1AQ6A 3PGMA 3R3XA 4IUYA 4P81A 1N1MA 1Y42X 5CNKA 4WK4B 4XVRA 2J5QA 4YI3A 1SEVA 4OJQA 5TT0A 5BRAA 1HEUA 4R2IA 1PJTA 4DCGA 5C51B 1PR3A 1KI7A 1PG2A 2FWPA 2NU7A 3E7WA 3QXGA 4IOKA 2QY6A 4HFNA 4UBOA 1CQWA 1MT0A 3BEOA 4ZD6A 2JCBA 1WW2A 2P90A 3RS0A 1A95A 2QVGA 4JFRA 5E6UA 4BAUA 4EGQA 1EFPA 3ICCA 3Q87B 2HSGA 1L7MA 2TMGA 2YOHA 3PNVA 3QBEA 4RJKA 2CHQA 2P4UA 5UKDA 3LP8A 4B47A 4O8ZA 3OSZA 4PXSA 3TXXA 3FVTA 4K2AA 3EMVA 4EEZA 3HC7A 3UT5B 1EQ2A 1FZQA 2GA9A 2Q3DA 4WCFC 3UUFA 5AVSA 5FO1A 3RJ5A 2AOTA 4FFOA 2XZDA 4TOIA 1Y1TA 4HG2A 1DXQA 1ZGHA 4ED9A 3JQBA 4UM7A 4R05A 5JNUA 2VTEA 3RRYA 5H9VA 4UOQA 1YK0A 3IS3A 3FYSA 1JDBC 3KZVA 3ZN2A 1AUXA 5C7IO 5JHGB 2YW2A 2V98A 1TRHA 2W7TA 3OQNA 2GXUA 1KH1A 1ZM7A 3SLGA 4AD8A 2LKDA 1NE2A 1WLSA 2DQZA 1PD0A 2XDWA 3V3TA 1RYYA 4WLNA 4GWKA 4XJSA 2FOLA 3KXPA 3NOXA 2DJIA 4JP1A 3RANA 2CC2A 3S81A 1IK6A 5E7QA 2G9UA 3F7TA 3OF2A 1XRQA 4D4JA 2IHUA 2RI6A 1DRWA 1E6KA 3QA3E 1U3UA 2C98A 2OP1A 3GEEA 3O5AA 4XUDA 4E32A 2O5CA 5F9FA 3I76A 2AC7A 2NUBA 1WY5A 3EIFA 4GMDA 5KDLA 4MCIA 1Q44A 4IQ0A 5CT9A 3BF8A 3OMLA 4WFQA 1JHXA 2BN4A 2FWIA 3PNLA 3CVJA 5CDTA 1U31A 2HHHB 1QP0A 3JYOA 1FU4A 3PT5A 5KNDA 3KQLA 3C85A 1SWWA 3KJIA 3RYCB 2ZUEA 4P53A 1MJGA 2GNPA 3GB9A 4AN4A 2XXAB 5A05A 3CW9A 3S6JA 2X2PA 1ZNWA 1WDMA 2X4LA 3HA2A 4O02B 2G88A 2WM2A 3SXUA 2P9CA 1VHTA 2MOKA 4IV0A 2Q3BA 1XDZA 3QEMB 4EFDA 1OBHA 4P8RA 1W30A 3IALA 5CXUA 3A9UA 1RYZA 2AFHE 3NASA 4G07A 5EERA 4ND8A 3VJRA 3WC4A 2JFPA 4A0SA 4AJ2A 2RC6A 2RH5A 3B5IA 2OECA 5AXBA 2YV2A 3A4TA 4K9DA 4OKIA 1MP0A 5AJVB 2JIMA 4WK6A 1N0HA 2X2EA 4CV2A 3H9BA 4O2BA 4RIFA 4H1TA 2OL4A 1CV2A 3O8QA 3QMPA 1M6HA 4BB0A 5JAHA 2CNNA 4DIDA 3TBFA 3KPJA 3I5XA 1T5LA 4JJZA 2VF5X 3MTGA 1CZOA 1N7JA 3NNSA 5JXJA 3TQSA 4B7AA 2C2WA 4TRJA 1IIBA 3UJPA 1N5MA 1GY8A 1XWWA 3EC7A 1BCSA 4QTZA 5DM4A 5CIQA 3C3BA 1DO0A 3H04A 1NLFA 2C29D 2VAWA 3Q98A 1QIMA 4LKOA 4K9RA 4BNZA 3HO8A 2RGRA 1L0BA 1X80A 4ZHQB 5CU7A 2HJGA 4Q02A 5JFOA 2VHYA 4RD3A 2VZ8A 1KAHA 3F73A 2JFFA 3F6EX 1Z4OA 1GM5A 1E2PA 2FP4A 1W2HA 3ZI0A 1WPQA 1W0CA 4NBRA 4G5HA 2EW8A 4YVFA 4RJJA 1ZISA 2C5AA 4DMUB 5AI5A 4RJTA 1E79A 3N0WA 2B92A 5KPJA 1A1VA 2HA0A 1VB3A 3NKFA 2ALJA 5DOZA 3ZYZA 3QBVA 1I4WA 1QHSA 2WJ4A 4PTYA 5DX0A 4QPCA 4FGKA 1FTGA 4M8IA 3WGHA 4LXIA 1C7QA 1P7YA 2SECE 3PDIB 3QOXA 4AICA 4BX0A 3GDGA 5IZ4A 3NHBA 3ZS8A 1V96A 1RJFA 1LV8A 1WABA 3GYBA 1DG1G 1RQXA 3KQVA 3JAWB 4WZAA 3UK1A 4RZUA 1N7GA 1T8PA 3L0YA 4TT3A 4D9CA 1RZUA 2WP8J 4EHHA 3DMRA 2GEDA 3VR6A 3J7AC 3PFWO 2CJWA 3DLIA 3QOWA 3GDHA 4YGYA 4ISCA 1M6VB 1O97D 3OO1A 3DS8A 4X92A 1GUFA 2Y1GA 2EARA 4RVHA 4C08A 4PYQA 5J2TA 4O1MA 1S6YA 4EI9A 4B3SB 2ORVA 3BGOS 1TB4A 3ETJA 5M3BA 2FG6C 1BXZA 3CJRA 1ZVJA 3UQYS 1OSNA 2P0AA 2CZQA 1KIFA 1BCRA 3AJDA 4RGBA 3U7JA 3Q7PA 4BFTA 4BBAA 3P97A 5CITA 5L3QB 1HL3A 1OGJA 1G6HA 1TYCA 4X1KA 4X24A 5FJJA 4OXYA 3MD0A 2ADOA 4Q39A 2O0KA 1BVUA 3PNMA 3PTAA 2BI4A 2F3RA 1DQYA 2GGSA 2V7TA 4C0KA 1V7CA 4PLGA 2BGNA 2JGDB 3ZCVA 3QTLA 3HWRA 4E5PA 3Q5EA 3GRUA 3LP6A 2HWYA 3UUEA 4IO0A 4GWLA 2F6RA 1EFAA 2YHAA 4YBZA 1Y8QA 4F3TA 4ARBA 4KFSA 1AS2A 2ORWA 3BCHA 4ZVQA 5FFNA 3ZHBA 1QCZA 2V6IA 5SY4A 3K9GA 3A28A 4Q47A 3UGJA 4LX0A 3ZVRA 2D1RA 1PEYA 4BRWA 3SZLA 1J0CA 2CWDA 4YRIA 3EF1A 3TQHA 1PJAA 1P0IA 2BELA 3FBTA 2AQIA 3MJDA 1X3LA 4ZQFA 2ID8A 5EJ5A 3T7IA 4ZEVA 3DH0A 1LDGA 1ZP6A 3K1AA 2Z4SA 1XALA 2F43B 2GZAA 3AVWA 1QHFA 4TUYA 3QE4A 3N8GA 1CLUA 1S2IA 3ESCA 3M9LA 2N0SA 1G64A 3M3PA 3CGGA 3URKA 4BFUA 3OC6A 1DFGA 2ETXA 2XB9A 2AEFA 3PP8A 1M2NA 4BUCA 2O5VA 1XR3A 5C37A 2R7NA 3VTFA 5AVTA 4L4XA 3E5HA 4R9UC 4MQEA 4XVCA 1I9GA 1XA0A 3MJ4A 4D80A 2UVQA 5AKHA 5C4IA 2TMKA 1GRVA 1Z16A 4W5NA 3WNBA 3HI4A 1IZ8A 1TK2A 4P7KA 1T3TA 4MHOA 1YZHA 2P9GA 3GEMA 1Q12A 1E9CA 4RA9B 4RL6A 2LD4A 2C2KA 1U1EA 2JVKA 5FWXA 4E08A 1V5EA 3T94A 3UAWA 3ZH9B 2NQTA 5J1TB 3IJ5A 5KYTA 3N6VA 1YULA 1A9TA 1LS1A 3ZFUA 3IXQA 1T2DA 3G8YA 1T6NA 4YCBA 3DBOB 4MQBA 1WZEA 1XI2A 1TZKA 2QT1A 2X2FA 4BLOA 4CLXA 5ALVA 4BO6A 1M0TA 5JSUA 1L1RA 3C1UA 3CEAA 3MS7A 2IS6A 3WO0A 2X9VA 3WIEA 3K6JA 4OQPA 2X7XA 3H8VA 5D51S 2PRJA 1NXSA 1IRIA 3JD1A 5TMDA 4F56A 4B6JA 1QFJA 3ZCQA 3F6BX 1ICIA 3M1AA 3RE1A 2VP4A 7MHTA 1VL8A 5KYXA 4JLOA 4G0MA 2QK4A 2OB1A 3EBOA 4FI3C 2J3EA 2P4HX 4MMXB 4OI4A 1DPFA 2GCNA 2OCAA 3FM9A 5DWQA 3WL8A 1I2ZA 2JEOA 4L7QA 2IDZA 1TW2A 2AJLI 1QYIA 2EIHA 3UVEA 3EIQA 4EMTA 2DU8A 4NOMA 4EYOA 5I4CA 2VQEB 3U39A 3M34A 4NEHB 4QZVA 3C3MA 1IUKA 3C74A 3AHHA 1CB0A 3I5AA 4GXQA 4XA8A 3RR2A 5M29A 1LDYA 3CO0S 2OFOA 4W82A 2CXRA 621PA 1ODFA 3HKEA 4X6LA 3BB3A 1Y6GA 4YT2A 4FBGA 3D8NA 2FPPB 3DBHB 3ZW7A 1FUUA 2HMWA 1OA0A 2OFFA 2B34A 1VL6A 3L0SA 4DBLC 1LI5A 4UFPA 4FHDA 2FEKA 1CZRA 4IM7A 1PJQA 2XW6A 4NIMA 4FS3A 1MO3A 1USKA 2V5AA 3H1PA 1WHSA 2QORA 4RC9A 1D5WA 3RKRA 3SLRA 3H1GA 1XK6A 1ODCA 2HXYA 5TSDA 2ZUUA 2ONYA 3H5NA 3LKDA 8ADHA 4BLRA 1EGHA 4C3UA 1CLEA 1LF5A 4EY8A 4H59A 1RPJA 1UKAA 3O8NA 2P9HA 5HQ3B 1AU9A 3MPUA 1FYXA 1J2TA 2ZI4A 3L1IA 5BUZA 2UU9B 3TLMA 3D2LA 1C3EA 3AUSA 1KJZA 5CFLA 3KDAA 4Q03A 2YFHA 4L3OA 2Z1NA 2PLAA 1E69A 3FYUB 4FMCF 3I45A 1LFDB 1V48A 3BD7A 4IJ6A 2C82A 3D3KA 5GOZA 5LZ8A 5K0JA 3N39C 2EBHX 2CT8A 5BUQA 4O2AB 4C2BA 3BH6A 1SC4A 5BR1A 4HD8A 4E5VA 2ON6A 3DDUA 5AVOA 3ORSA 2EU8A 4WKCA 4Z9XA 3UK7A 1T9HA 1FW6A 1A8SA 1QVZA 2DSNA 2H06A 2WWVD 1W59A 3I9MA 1C30A 1W1UA 2AEEA 4MYRA 4EHBA 5JPDA 4ZOEA 1HKHA 4PIPA 1Y98A 4X62B 1H4QA 1IZ7A 1FQWA 1G3RA 4RESA 2FRXA 2B9VA 2ZUWA 5DGDA 3OQ6A 4Q3DA 3KKOA 5IP5A 3KUDA 2F00A 4V3BA 2ZBRA 1GCIA 1PWXA 4NDZA 4YT4A 3FXAA 4JI6B 1XKLA 4F7DA 2QSJA 1K3TA 5CUQA 2I2XB 4KAJA 3U4QB 1ZGZA 2G5CA 2O1WA 1GILA 3LO5A 2K7FA 1KYTA 2ODPA 3O83A 2XA1A 4F8JA 1RT9A 3MA0A 1NP3A 1B23P 4OY3A 1ETUA 1E1DA 2CK3A 1YJQA 3AQ4A 3BCSA 1WVMA 1U2ZA 3PQ6A 1CDEA 2ONKA 2Q2VA 4NFHA 4X84A 4GEKA 5LYYA 4O59O 2Y67A 4DV5B 2EZTA 1Y1PA 5JS2A 4MW0A 5JSYA 3CSDA 5ECYA 3PJFA 1KJQA 4NRDA 2KS6A 3UA4A 2EL7A 3I64A