3BWDD

Crystal structure of the plant rho protein rop5
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
176
structure length
156
Chain Sequence
RFIKCVTVGDGAVGKTCLLISYTSNTFPFSANVVLGLWDTAGEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKLDLRDDKQFFIDHAVPITTVQGEELKKLIGAPAYIECSSKSQENVKGVFDAAIRVVLQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the plant Rho protein ROP5
rcsb
source organism Arabidopsis thaliana
molecule tags Plant protein
molecule keywords Rac-like GTP-binding protein ARAC6
total genus 58
structure length 156
sequence length 176
ec nomenclature
pdb deposition date 2008-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3bwdD00
3THOA 4AK9A 3QY0A 3I4LA 4Q7LA 3GJ5A 4KV9A 5F3WB 2VP6A 4Q02A 3LX8A 2JATA 1VG9B 1W48A 4KLZA 1W2GA 3RS0A 4AIIA 1PZNA 2QPTA 2O8CA 5HZKA 4BFYA 1II8A 2ZE6A 3N5CA 4Q00A 4Q48A 3K0FA 4A8JC 1OJLA 5CIWA 3KB1A 2YJTD 3T34A 1EXMA 1NVXQ 4BQSA 3CX7A 3K9GA 1Z06A 5EQTA 1XTKA 1KI8A 4Q21A 4LGMA 1JR3A 3KXIA 1E2IA 2VA8A 1S96A 1KOFA 1LF0A 1RRFA 4C9BA 5BN4A 2BMJA 1I2DA 3L8YA 2FPMA 1SVKA 1XU4A 2VLIA 5TMPA 5GADl 5F9FA 3T1TA 1NL3A 2JLSA 3NBZC 4EJSB 2V1UA 1E9AA 2GTPA 621PA 3I73A 1OFIA 2BOVA 2Q9AA 2O8BA 2ZS8A 2OXCA 3WY9A 4D0NA 2AR7A 4AC9A 4YXWD 2GWHA 5GJWC 2MSDB 2Y8EA 3LY5A 4DEYA 4YXWA 3KKNA 2YOGA 3IGFA 4QHTA 1XP8A 1W44A 1NKSA 1JAIA 1US8A 3GPLA 1YE8A 5J47A 1RFLA 4MUBA 2ZROA 5J5CA 1UKEA 2JLUA 1E2HA 1JR6A 4MDFA 5J4YA 1ANKA 2QGZA 1BKDR 3DL0A 1ZNYA 4D2IA 2O5VA 2ZE8A 3MCAA 4B75A 3PIRA 2JASA 4FMBB 1Q1ZA 4W5JA 2F9MA 2ZRLA 3TJZA 2A5FA 2OAQ1 3TE6A 2ZM5A 2ZJYA 4U7DA 3T61A 3MJRA 5GJBA 3RRZA 3OEED 5FOVA 2WBLC 2RGBA 4PC2A 4URUR 2IX3A 3GJ4A 4OJQA 4AKEA 3B9QA 4L8GA 4BGDA 3Q5DA 1IM2A 2ZI5A 3CRQA 2ORWA 2OFXA 4F38A 1DBSA 1UFQA 3QJYA 1OFTA 1G5TA 1DELA 4Q1DA 2A3RA 3QQ5A 4DLRA 4S2EA 1Z6YA 2IYTA 4M1WA 1L4UA 2JLRA 2O8DA 2F1HA 3NXSA 2P2LA 4FINA 4LJ7A 3CWQA 3U61B 4ZI2A 1I2MA 1COWD 5KSOA 1E0JA 1PJRA 2CEAA 2ZYUX 3SYNA 4TN1A 5KUTA 3MWLA 2IS4A 2FH5B 2ZJAA 5G40A 1XX6A 3SC3A 4YQFA 3RS4A 4A36A 4WZ6A 5SZJA 4HUTA 2X77A 3U7GA 3C41J 4M0LA 4BLOA 1FP6A 4UXIA 3SJCA 1W49A 1J8YF 4Q4HB 5DSZA 1CIPA 3NWJA 2YC4C 1YRBA 2RH5A 3RC3A 4G5QA 3I92A 3KKOA 1R0WA 4TT3D 1TEXA 3GJ8A 2P6NA 4ZCMA 4RZXA 4V02A 3BC1A 1D9ZA 3UANA 3WMEA 3C15C 3UATA 3EIEA 2RGDA 4GRAA 521PA 2ZPTX 3FTQA 4DCUA 4I1OA 4Q4LA 2WZQA 1E1RA 2IYQA 4HEJA 2WIBA 3C14C 3U4QA 3OF5A 1IONA 4EQ6A 5JFGA 5FUVA 1NN5A 3JZMA 4PO8A 1BOFA 3ICEA 2GILA 1KO5A 2FWRA 3EASA 4A2QA 1A1VA 3KQNA 2ZU0C 3EZ2A 3HU2A 4ESHA 5FPYA 2MMGA 2WWXA 2EVWX 2XZPA 1AS0A 1OYYA 2D2FA 3PV0A 3QPUA 4Q1AA 1Z6TA 1YR9A 1UF9A 2C8VA 4UNQA 2ATXA 2Z5FA 4OI1A 4ARZA 3EZFA 3AQ4A 4PQRA 3K0EA 2ZETA 2GF9A 1E96A 2QP9X 2ZI6A 2FSGA 3SBDA 4C0QC 4CEHB 1G5PA 5K8UA 2JLYA 3VFDA 2WSMA 1AZSC 5EE9A 1E2NA 2IHYA 4W9MC 3B1XA 4JL6A 4MYUA 4UQOA 4M9QA 2GK6A 2F55A 2XXAB 1FNMA 1KJYA 1WMSA 2JJ1D 5L3RA 1M34E 3MWJA 2GEUA 3GD7A 3SI7A 1JQJC 4L15A 5AJYA 3K53A 4BPBA 3CRRA 5BN3A 2WJJA 4HLUA 3SHFA 3Q8XB 2OAP1 2QA5A 2PZFA 3IBYA 4RSGA 5B2ZA 2EW1A 4QKQA 3AF3A 4C0BA 4QGGA 1Q1QA 1X8JA 2HYIC 4URWR 4PZYA 4V0LA 3L0PA 5CK4A 3VAAA 4TSFD 1Z63A 4D0GA 5CLQA 3KDSE 1AK2A 3PITA 1XD9A 2IYVA 1XEXB 3AKCA 4WZBE 3ZS8A 4HI0E 2GJAA 4TMWA 2GCPA 4R2HA 4ZIRB 2WWYA 1RJ9A 4G01B 4BFSA 1ZD1A 1Y63A 5JEDA 1BIFA 3AVVA 4LJYA 3GJ6A 2G9NA 5D3QA 1US8B 2ZITA 3U5ZB 1GZSA 2HLDA 4GNKA 3V00A 5UKDA 3FWYA 1MO3A 2IEZA 3MWYW 5ELXA 5C4MA 3A1SA 1X8KA 2XAUA 4WXPA 4DDTA 821PA 5KPDA 3NDPA 2V55B 4GP6A 2I3BA 4LC1A 3AP2A 3HYRA 2DBYA 3HP1A 2W6JA 1Y3AA 3B1YA 4URZR 4K46A 4EQ6B 4JLNA 5FBLB 2YWFA 2XJ4A 4LJ4A 1P62B 4A0GA 4MGIR 3UG7A 4EPYA 1P2TA 1RC8A 3HDTA 1X1SA 3OEHA 3QE0A 4JS0A 4IVQA 4PZZA 2ATVA 2DB3A 3P26A 3GLGA 3AP3A 2HF9A 2IUSA 4A9AA 4IXMA 1MT0A 1W46A 2ZS7A 4NL4H 4NCKA 3VU9A 2V7QA 4X8MA 4KFTA 3LAWA 1TPZA 2W2VA 1S3SA 4JJKA 3EPHA 2WWHA 4MH0R 1OE0A 4Q4AB 5EE1A 2WVJA 1NJFA 2D7CA 1NLFA 2ZRCA 1P2UA 2FPLA 1R4AA 2FZLA 1FX0A 1UKVY 1ZM3A 2N46A 2YWGA 3K0CC 1E2EA 2RHMA 5AJVB 4CT5A 3PENA 3TSOA 3VQTA 6Q21A 1G8YA 3X2SA 2ZRBA 1MABA 2GZAA 1HYQA 2CLCX 3GLGE 4URYR 2O8BB 4LBZA 4BASA 3AVWA 2IBMA 2OHFA 1TQDA 4TL7A 3THYA 3BFVA 2Q9CA 2OEPA 1IXRC 3RSOA 1XTJA 3OAAD 1C9KA 2FPKA 1W0JA 3FDIA 4BWYA 5FBRB 2DWOA 2MMCA 1ZM2A 3UMFA 2W6JD 1BS1A 2QU8A 2VHJA 3QPVA 4Z54A 3GJ3A 1N5KA 3EPLA 4NYMQ 4NYMR 4IDNA 3IBGA 5K8LA 3B60A 1XMIA 1WXQA 1YHNA 1XB2A 5J4VA 5C46F 1XEFA 3VKHA 1N5IA 3TW8B 1Z6GA 2A9KA 2JAQA 1W4AA 3QNUA 4A2PA 1P4SA 1OH6A 4KXFB 5L8VA 4MGYR 1VKJA 2GETA 3RVBA 4Z1MD 1O87A 3L0SA 3CBQA 4PQYA 2BEJA 3T15A 2QTVB 2AK2A 3VKWA 1E4VA 4F4IA 4QBGB 3DO6A 2RGEA 2PX0A 2NO6A 2G0TA 4P4TA 2FFHA 3CRMA 3WYFA 4CEIB 4F4JA 3GP8A 2CJWA 1ZM4A 2NPIA 3QKRB 5FTMA 4ZI3A 2JDIA 2OM2A 3RS5A 1SULA 1VIAA 1AKYA 2IC5A 1R5NA 1Z5ZA 1A2BA 2V8OA 4M1SA 5L3SA 1AQUA 5FTJA 4PPFA 2H5EA 3LWNA 3NC1C 1N0WA 3KL4A 1NNEA 1B0UA 2IXGA 3L0OA 1IJFA 1GG2A 3EA0A 4EFNA 3PVSA 3BK7A 1BYUA 3BAFA 1SKYE 2W0MA 3GLHB 3KFXA 1DTSA 3D31A 3K9HA 2NZJA 4U5XA 4DUGD 2RAPA 4DLXA 1QDEA 3QBTA 3QF4A 2ANBA 2BCJQ 1M7HA 4EJSA 1SHKA 5FPSA 2ZJZA 1J7KA 1U0HC 2V54A 3Q85A 3I3SR 4PHTA 1OXXK 1Z0DA 1TQ2A 5KTYA 2W2XA 4ESVA 2OZEA 2N1BA 1E2LA 1MKYA 4IOLA 4KVGA 1OV4A 1H8HD 1QVAA 1OIXA 2RMKA 2J7KA 3L82B 3BIFA 4FMDF 1JAHA 3PEUA 1ZCBA 4OQXA 3ND9A 4NKRA 1HEIA 1RJ9B 4GBMA 3U44A 5EXXA 2GEVA 2NO7A 4LV8B 1NIJA 3GCGA 3LBHA 4L4UA 1Q22A 4GP7A 4TL8A 2QL6A 4B44A 4IOJA 1GNPA 1W4BA 2YVUA 3VR5A 1AM4D 4JVSB 2WHXA 2O8EA 3AEZA 3U3OA 1OIWA 5AUPB 3H2YA 2WOOA 1D2EA 2YV5A 1IN5A 2HLDD 3DHWC 5JWHA 2RHDA 2FEMA 3SOPA 2G3YA 2G83A 2X2EA 5JHGB 4MRSA 1D9XA 3PJRA 4AYXA 4GDFA 4DT1B 2UKDA 1UJ2A 2VP4A 4M9XA 3RS7A 4LJ5A 3SYKA 5EUMA 3LRPA 3GLFE 3AKYA 4I1UA 3SEAA 3W6OA 1QHIA 1KTVA 1Q3HA 4OQNA 5IK2D 1F3OA 1T0HB 4TYPA 1U2RA 2K5UA 1ZC4A 3TAUA 1T0JB 2QPOA 3A1TA 1G16A 2WWFA 4LPKA 2C96A 1DO0A 1QHGA 4CDGA 3L8ZA 5KDDA 1RPZA 2R6CA 5EP3A 4GOXA 2NZ8A 3DMNA 4QXAA 1NVUQ 1Z2AA 4TYQA 2OBLA 4FCWA 1G291 3QEOA 5FOXA 3A37A 2V3CC 4LDJA 4BFZA 4LUCA 3LW8A 2Q0HA 4QGHA 3RRMA 2GHIA 2WJYA 4CW7A 4WBSA 2IWHA 2F3TA 2ZRIA 2IK8A 2DFNA 3EA5A 4DCTA 4PR0A 3HYTA 1R0XA 4GMDA 4XTCS 4Q1CA 3TLXA 4DLZA 3WHLA 3FFBA 4J0QA 2DFLA 2VP2A 3EARA 2J0VA 3EIQA 2QAGC 4JLDA 1AQYA 1QHHB 2OLKA 4G0NA 4KFSA 4B3CA 3T06B 1ZRHA 5KYKA 2ZUBA 1WQ1R 3AF1A 4PAMA 4BLSA 2R65A 3CNLA 4HB3A 3LV8A 3G0HA 2X1VA 2XNSA 1R8QA 4YONB 3BERA 3U7HB 3SFZA 3QXHA 3Q72A 1N25A 1ZINA 2A5JA 3ZVLA 3EX7C 3LNCA 5AK0A 4ABYA 1L8QA 1ZU4A 2IYZA 2VP0A 4RFSB 3U6KA 5FL7D 1TF5A 1FTNA 1GIAA 5E3HA 1Q20A 2CL0X 3QXSA 3RLFA 3ONWA 1E2MA 1F48A 4A6PA 2WPDD 1U81A 1COWA 1E1QD 1TNDA 1QG4A 5CDFA 4DDWA 2QNRA 1A7JA 2C9OA 3SU8A 4MUAA 4OK6A 3LFUA 1ZNXA 4WZAE 5KOYA 1AA9A 2YKGA 4NH0A 3CLVA 3I5XA 2QTHA 4LYFA 4PO1A 5CB8A 3SQWA 2GA8A 2QE7A 1N5LA 2OCBA 3D7MA 4NPHA 3NBFA 5JWRA 3K0AB 3ZIAA 4LWZA 1T4GA 1GRNA 5EXSA 1CR4A 2CXXA 3A1UA 4FI3C 1QHYA 2GCOA 4LBYA 2ONKA 2XSZD 4YMSA 2IYUA 3ECCA 3HPQA 2HUPA 3GLFA 4LHWA 1TF2A 4PSKA 4UNRA 1NF3A 2JJ1A 5FUYA 2GK7A 1YZTA 2HV8A 2OLJA 1UM8A 2ZRPA 1PV4A 1GILA 5JS7A 2ODEA 1ZAKA 2G1KA 4GI7A 2ERXA 4QJ4A 3KUCA 5BWMA 2Q6TA 4DJTA 4G5RA 5AUQA 4TLAA 2CE7A 3GEIA 3AF0A 4FMCF 4N0DA 1EFHA 4NYIQ 4LHYA 3CF2A 5KO2A 2J5XA 2ZJ8A 3AVXA 3FGNA 4D25A 1IXZA 2AFIE 2ECKA 1DEKA 1KI6B 1U99A 2CHVA 1KI9A 4G1UC 1XPUA 2ZE7A 2DCUA 5FL7A 4D6PA 4TZ0A 1TEVA 1MO6A 1U0JA 4PPGA 3B9PA 5AJXA 1U8AA 1T5IA 4LCBA 3KJIA 1M8PA 3FKQA 3G82C 4ZDKA 1KI4A 4IXNA 1CJVC 1DO2A 5E7IA 2VF8A 5DO9A 3DOEA 4EIWA 3AVTA 3QKTA 1P9NA 1XEWY 2O0JA 5EZ5A 2JLXA 2ZJBA 4RD0A 4B71A 3ZD7A 2GNOA 1N6RA 3C7KA 5LD2C 4QG7A 4LC0A 1WBBA 4C2UA 4JL5A 1SXJB 1E94E 2G0NA 4MGKR 3W5IA 4HUQB 3I1FA 1G3QA 2IW3A 4M1KA 1FMJA 4TT3A 1W2HA 3JZAA 4QC2A 3C5HA 2GXSA 1HH4A 1ZCAA 4UJ3A 3ZGXA 4KAXA 3AF2A 4KU4A 2PL3A 1G3UA 4BZPA 2IYLD 1E9CA 4HZUA 3VX3A 3VNUA 3W6PA 4B2IA 2EU8A 1LB1B 1E2GA 2OG2A 4B3FX 1EFTA 5CJ2A 2XITA 4DLYA 4JT4A 3ZD6A 4B73A 1II9A 1LW7A 1Z83A 4B6EA 1PUIA 4CT4B 2PBRA 1W36C 5FOUA 3TSWA 1RE0A 5G3ZA 2FDCA 2IS1A 2DPXA 3H4MA 2FFAA 1CS4C 3ADBA 2QRZA 2WICA 4IJMA 1N6PA 4GFDA 1GITA 1Q44A 2CVHA 2R6AA 1CU1A 1G18A 3X1YA 2VTKA 1NLZA 4I4LA 4OHWA 4DLVA 4ASUA 1JALA 1II0A 3UXMA 1OH8A 4MKFA 1E79D 4L16A 3KJGA 4LJ9A 1Q57A 4YMWA 2R9VA 1V5WA 1G19A 3DEFA 2JJ2A 3LX5A 3U3KA 5DI3B 1L7VC 1KDPA 1UBFA 2GBLC 4LOAA 1R0ZA 2PEZA 4KFRA 3OHMA 5E7JA 3RWMB 4X8OA 4CEIA 3RHFA 1YZGA 1HQYE 5AUNB 2Q9BA 1BO6A 4PPQA 2RGAA 2JLWA 2FSIA 1WE2A 1GKIA 2H8KA 1YZLA 3QSYA 2FZ4A 5KHOC 3ZZUA 4MKGA 5LBIA 4D4KA 1NBMA 4QHYA 4TLDA 2IEYA 2WV9A 3MGCA 2QUZA 2HCJB 3PQCA 3BH0A 4FN5A 2R2AA 1IN4A 3CM0A 5LB2A 2H7VA 1QRAA 1JNYA 2ANCA 2ZI7A 4HAXA 2ZANA 3HU3A 4OI4A 1U8YA 3RWOA 4Z8YA 4PX9A 4Z1MA 3K70C 1K6MA 4PSVA 3B1WA 4RZUA 3HPRA 5IRCD 4TQUS 3EC2A 1NN0A 3IHWA 3KTAA 1ZJ6A 3E1SA 1XJ0A 1HT1E 4CVNA 1L4YA 1P75A 3TR0A 1FFHA 2ZYVX 1NJGA 1LF5A 3EZ9A 3KXLA 1NY6A 1QHXA 4D80A 3P1JA 3KTAB 4UNNA 4RVCA 1DOAA 3IUYA 5KNCA 1EFUA 4OI2A 1GL9B 5G41A 2RGCA 4HDCA 1OFHA 3FMOB 3I32A 3AB3A 3EZ6A 3K9LA 2YINC 2GJSA 2V1XA 2JJ2D 2F1IA 3TUZC 4WXRA 1DAHA 3BD9A 3IILA 1T91A 3BGWA 1GTVA 3EPJA 3M0EA 4D81A 4E5UA 3OEHD 3ZVRA 2IYSA 4AY2A 4BFTA 4OHYA 3BXZA 3DZ8A 5CDFE 4JYCA 4QRHA 3QVVA 3LXRA 4R2IA 3VR6A 3ASYA 3DKVA 3N2IA 2ZQ5A 2ORVA 1T6NA 2A5YB 3B13B 4M21A 4RD2A 2AD5A 1YR8A 1N6LA 4AYWA 1M6NA 4URXR 3QG5A 4DBLC 3EZ7A 2FF7A 1R2QA 4QHSA 1SKQA 2WKRA 3QEJA 1UKYA 3THXB 1HTWA 4II7A 5TV2A 1XPRA 3K0AA 2VHTA 5CM9C 1F60A 2A30A 2HT6A 4IOMA 5IHPA 3ZH9B 1F2TA 2J7PA 2CVFA 4B6FA 2PJZA 3U3JA 4LV6A 3R7WA 3QXJA 5DH9A 1G5RA 5JS8A 3DM5A 1CR2A 2RGXA 3QXXA 1U0LA 4HAZA 4OHZA 5H1YA 2IT1A 1J90A 1S1CA 1N5JA 2GDJA 2GZHA 3KKMA 3FFAA 4LK2A 2F1JA 2VSFA 1T3SA 4H1VA 1OFUX 4F93B 1UKZA 4V0NA 5D3MB 3JVVA 2AN9A 2P0EA 4TYNA 4JJZA 2O52A 1EWRA 4DIDA 2CK3D 2B21A 4NYJQ 4NYJR 4JLOA 3KX2A 4AURA 1U8ZA 2NQ2C 4TLBA 4I99A 5ANRB 3AGPA 5B64A 1Z47A 3DM9B 3I8SA 4HAUA 4L5BA 4US1R 3WMFA 3BB1A 3C16C 4BFVA 1CXZA 3H0KA 1HE1C 1KO4A 4XIGS 1G4AE 4XVRA 1M7GA 3VX4A 5EP2A 4B48A 4NE2A 2BKUA 1VCNA 2OESA 1ZW6A 3P27A 4DSUA 1VYUA 3F0TA 1N3BA 4QFMA 4XVQA 4AI6A 3B85A 2PX3A 4BFWA 2VP9A 4C0JA 3R7WB 1VG1A 3K1JA 1DARA 3BB3A 1U9IC 4M4SA 3C4JA 1K5GA 4O2RA 3M1IA 4Q19A 1P7CA 4GT1A 1EWQA 4JT2A 3SS8A 3BWDD 1QF9A 3ZVMA 1XTSA 2GJ9A 1KSJA 3V9PA 1SVIA 4DHEA 3WMGA 5TB5A 5L3QB 4A8JB 2XXAA 3E70C 4XWOA 4TMKA 2GXQA 3T12A 1PLKA 2R6FA 2CHGA 1O3YA 2VF7A 2YWHA 1S8FA 2W58A 5CLLA 2C03A 2XTZA 1FW6A 3CO5A 1QVRA 4DSTA 1DAMA 2JIZA 4DEXA 4JIMA 4M8NE 4HATA 4TQ9A 2WSSA 4V03A 4DCVA 3NG1A 5BYJA 2QQ0A 2FFBA 4ZKDA 3U7EB 1E98A 2XEXA 2CE2X 3ZJYA 1IY1A 4MYCA 3T1VA 3S1AB 4KCGA 2PLRA 4PXAA 4URVR 3I61A 4JLVA 3THWA 2B7BA 4QBFA 4BZXA 3TR5A 2FFQA 4ZDWA 1CJKC 3TQCA 5FBQB 4TLEA 4M9ZA 3SHWA 1UBCA 2NOAA 1QHSA 1NVVR 4EPWA 1NVVQ 2AKYA 4F92B 3NEJA 1XCMA 3TQFA 5FPKA 1NMZA 1MABB 1P9WA 3R8FA 1XWIA 5D3MA 1P61B 1MO4A 2WWGA 2O8FB 3LA6A 2ZREA 1NRJB 4MRNA 1CEEA 2OFWA 1OLOA 2HEIA 3IHLA 2GJKA 3FKSD 1KI7A 2QG6A 1E2DA 3A1VA 4I1SA 1MV5A 3CPJB 4JYBA 1R7RA 4JVLA 2QT0A 4QOSA 3SN6A 3GEHA 5FPHA 4Q4AA 2QSZA 1BYIA 3MSXA 5LB4A 1R8SA 1VCMA 1P3JA 2WMOB 4N0EA 2ZEJA 2ZR0A 3VTKA 1IY2A 4DCNA 2ZS9A 1FX0B 4HLQB 5TVKA 1IN6A 5JEEA 3LXXA 4A4DA 4MA4A 4O2LA 3BRWD 1UPTA 2EWWA 1WBDA 2D3WA 4DCSA 4HAVA 2Z43A 1X8LA 3TIFA 3UKDA 2ZE5A 1DAIA 3NVAA 4RFSA 4B3XA 4HZIA 3P32A 3SBEA 4D26A 1DAFA 3IO3A 3GFOA 2IYXA 2ZI4A 1ZM7A 4M22A 4M1MA 3VR3A 4D4JA 3U3RA 2O0HA 4X8LA 2QM8A 4HAYA 4HB4A 4OQMA 2CNWD 5EZ6B 1CULC 2H92A 1WF3A 1OT3A 2FX3A 1G21E 2RCNA 2BMFA 3F3YA 1II8B 2OCYC 1OKKD 1JI0A 1F2UB 1LTQA 1DPFA 1N6KA 3R8CA 1XD2B 3W5JA 1P6XA 2HJGA 3CX8A 2W83A 4NMMA 4A2WA 3WYGA 1KZGB 1NG9A 4IW3B 4POAA 3THYB 4DB4A 3K0CA 4WVFA 3IEVA 3IKJA 4A8JA 4AG6A 1KNQA 1D5CA 3AUXA 1H8ED 1XEWX 2BHRA 1KI2A 1E0AA 3KQKA 1ZBDA 3RANA 5KSPA 1T3HA 3T1OA 5KU1A 4B34A 1VYVA 1LS6A 2NO1A 1QHHA 3B1ZA 4O0MA 3O8BA 3LD9A 4RD4A 5H8WA 3KJHA 3R9XA 3BBPA 2H18A 4FCTA 2NMVA 1A2KC 1I4DD 1Z8FA 5J40A 1XBTA 4DWJA 3DOFA 4E09A 4P33A 4GL2A 2E87A 2H16A 3FMPB 1OH5A 1X3SA 2W6IA 3NDBB 5CK5A 4PHGA 3Q5EA 4I1VA 4BLRA 4D4MA 5EE3A 2QGNA 5IDVA 2FSFA 4ZPXA 1CR1A 3WBJA 1IN7A 1D2NA 4IFEA 4R7ZA 1CR0A 3WXMA 3VU9B 2CCGA 2ONJA 1I4TD 2NIPA 1DAKA 4ILEA 2GCOB 5EXPA 3WYAA 4A0FA 3RS3A 4RD3A 1M7BA 2GAOA 4R71A 3MUFA 1CBUA 1KO8A 3QBVA 1SVOA 2AWNA 4KSCA 1S3GA 4B47A 2ZJOA 4GOKA 3F8TA 2GEDA 3TRFA 2FNAA 1M1YE 3A4MA 1DAGA 3T5GA 5H70A 2MSEB 2QBYA 4XH9B 1OXUA 2XGJA 2ZRJA 5L3SB 4UNSA 5HKKA 1J2JA 2QAJA 4P4SA 1E2KA 1E1QA 4PC6A 4EPXA 4AKIA 2EFHB 1FZQA 3DKPA 1KAOA 3O47A 4P0TA 4YDHB 121PA 4NU0A 3ZIAD 1NBME 4ZDJA 1E4YA 3UPUA 4TYYA 4P4UA 2J87A 1DG3A 1XEXA 2NTYC 1E6CA 1S9HA 2ZVPX 3LH5A 1OYWA 1E79A 1KMHA 1W0KD 3N70A 1E3MA 2QP4A 1KSHA 2F6RA 4C0LA 1ZUNB 5GJVC 2REXB 1D8TA 2P6UA 3A4NA 4PC1A 4R98A 1T8TA 2GJ8A 4KODA 4PAQA 1Z0FA 2JLZA 5GJCA 2BV3A 1AN0A 5A0FA 3UMRA 3GFTA 4EJSC 3O8CA 4IFBA 1EX7A 1BH2A 4Q4HA 4O3MA 3QPWA 4A6XA 4LI0A 4Q9IA 4MYHA 2BIFA 4AWXA 3AKEA 2VH5R 1HE8B 2XZOA 1WRBA 2DWQA 3PUXA 2C98A 2FE4A 1DVRA 1E9DA 3CH4B 1Z0JA 2ODBA 3MWKA 1NBMD 4YLGA 2R6DA 3QKUA 1XZQA 4W7SA 5JLJA 3HJNA 3KZ1E 5DLQC 3AGQA 4TSFA 3L2OB 2GZDA 2IA5A 4MQBA 2W0SA 2PLFA 1G6HA 4GMXA 4IDQA 1EFRA 4B76A 1XD8A 1KHTA 1MOZA 3AVOA 2YOHA 4PHFA 4QGFA 5P21A 4OK5A 2OV2A 1RRPA 2WPDA 2UZ3A 5J4LA 5C1BA 4EFLA 1IXSB 2ZRAA 2G1JA 4NZYA 1XXHA 3UK6A 1OXTA 3OZXA 1YZKA 2WWIA 1E69A 3SE0A 5F98A 4U00A 2YNMA 2WJVA 3SFVA 4JLJA 3WNBA 4CZ2A 3RC8A 2LKCA 4IVRA 4B3BA 1E2JA 2OSBA 1F6BA 1KSGA 1YU9A 5L3QA 1HA3A 3FMIA 3WP1B 1ZIPA 4EFMA 5EP1A 1XJCA 3CIOA 4MGZR 1CTQA 4YC7A 2QEQA 4DSOA 3LQQA 1W0KA 1NMXA 4XTRA 1WB9A 3AVPA 4RCYA 4C4PA 1T3LA 3KQHA 2C77A 3OESA 2F43A 2AFHE 1R6BX 4Q47A 4W5HA 1R5OA 2A7QA 4Q01A 1E1RD 3I72A 2FGJA 4XD7D 1W5SA 1Z3IX 4Q4JB 5TDHA 3AVUA 4BEBA 4E07A 1VECA 1FUKA 1YR6A 1OKKA 3NHAA 1UBGA 3GFPA 2EQBA 5FBWB 1AS3A 2VYFA 3QXCA 2HDNB 4QBHA 2KWIA 5JECA 3SZRA 1G8HA 2B92A 3AF4A 2LCFA 4OKSA 3B2EA 3U2QA 3W34A 2PT5A 4YMTA 2IL1A 3FOZA 4Z51A 1Z29A 1ZD8A 2IXEA 4A92A 4OL0A 3BFKA 3ZVNA 2IXFA 1X1RA 1A82A 4JMPA 1OHHD 3L43A 1KI6A 3A36A 2I4IA 5M04A 1OSNA 1XF9A 4ZV4A 4US2R 4QM7A 3TVDA 2VHUA 1AJEA 3A58B 2BBOA 3LVRE 421PA 4BUJA 2HYDA 5DYGA 1YZQA 3SJAA 3ZLJA 2PZEA 2X2FA 1ESMA 3I8XA 5KSZA 5G3YA 2V7QD 2XX3A 3SR0A 4AYTA 2BM0A 1EG7A 2R6GA 4JLPA 3GLHE 3Q7PA 1G6OA 5CJPA 4JZKA 4ACAA 1TUIA 5B30A 2ZU6A 4M1TA 5CB6A 2I1QA 2RGNC 1GAJA 5HE8A 4HUQA 3OE7A 1RYFA 1N6HA 1XFAA 4I81A 1GKYA 3K8YA 3P20A 1GWNA 4KVAA 4HDOB 1CKEA 1GL7A 3U3MA 2BC9A 5FL3A 5DIFA 3X1XA 5BXQC 1KKLA 1LVGA 1P2VA 4NTZA 2J7PD 3CUEF 3H1TA 1ZC3A 1IN8A 5E7MA 3K70B 4DDUA 2CMKA 2C5LA 3VHXA 5J4KA 1QG2A 1GRQA 3R20A 1OW3B 1D6JA 4DVGA 2BKEA 4JKIA 5FTLA 2N42A 1AGRA 2QORA 1GP2A 1G3MA 4PC7A 1C4OA 3SJZA 3ICQB 2FJUA 5IT5A 1N0UA 2BMDA 3F5FA 4MDEA 2B8WA 3N2EA 2FG5A 2QE7D 2FU5C 3W8RA 4KHZA 4DLWA 4LV5B 2QMUA 2R8RA 2DHRA 2D62A 3A1WA 3AUYA 1CRQA 4LYAA 4C30A 3L0IB 1M2OB 1KJWA 1NKTA 3REGA 2ZJ5A 3MG9A 1XXHE 4LJ6A 4TL9A 5HTKA 5FOWA 2XSZA 1A5TA 5EXTA 1ZUIA 1S4QA 5KDLA 3SJBA 3W3ZB 2WWWA 1HQCA 3Q3JB 3VNVA 4FWTA 3WHKA 2ZI9A 4XD7A 1KI1A 4TMXA 2WAYA 1LFDB 1LY1A 2EWVA 1E0SA 4FCVA 3JVUA 2AWOA 5DN6D 2PMDA 1E99A 1P9RA 4HLDA 4EPVA 4HYYA 3PXGA 4XJXA 1VG8A 1R5BA 3CNNA 3AP1A 3NTUA 2X19A 4ZCIA 5BN5A 5JJLA 3QVUA 3EXAA 1XTRA 1TMKA 4JSTA 4CGZA 2ZRMA 2ZIAA 1HY3A 1YVDA 4B43A 4WAUA 4UKDA 3OIVA 2QRNA 1JJVA 2BCGY 1L2TA 2OFOA 1AKEA 1JR3E 1XTQA 1VCOA 2DR3A 4Q1BA 8OHMA 2GKSA 1VMAA 3OIUA 5EUQB 4B2PA 3E2IA 3B8HA 1LV7A 1R0YA 2FOLA 2VQSA 4IRUB 1XZPA 4U02A 1EFCA 4G5SA 4JVNA 5JBQA 4US0R 2KI5A 3BS4A 4V0ME 4C3ZA 5JCPA 4KI0A 3CF6R 2G6BA 2OILA 4ITRC 3PUVA 3HWSA 5JI3E 2OBMA 2DY1A 2A2ZA 2VHCA 4TLCA 1VIYA 1ELOA 1XCPA 3GLIB 3EPKA 1TADA 2O8FA 1HUQA 2QPAA 1VDZA 2BMEA 1E9FA 3EW9A 3GJ7A 4HDQB 2ZXUA 1ZMXA 1PLJA 3GJ0A 2CNWA 2OCAA 2HF8A 3FVQA 2IUTA 1HT2E 2GXUA 3SYLA 3U60B 1G8PA 2XTMA 5HR5A 2C78A 2XZLA 4BLQA 1SVMA 2NGRA 4FXPA 3ZQ6A 3MRSA 5BYKA 3QF4B 3BOSA 1W4RA 2FGKA 2TMKA 1CLUA 2C99A 5JRJA 3PR1A 1JXMA 2ORIA 4FMCB 4G3XA 4PAOA 3W9YA 4F4CA 5DN6A 1G3RA 3PUYA 4Y0VA 5F2EA 4TQAA 3K70D 4HB0A 2H1LA 3AKDA 3FHCB 5FBVB 1JBKA 4RKEA 3B7GA 2VPPA 3KXKA 3AVYA 5DI3A 4WA7A 2WIAA 1IAQA 1SGWA 2AK3A 1ZP6A 2ZSBA 3PUWA 1P73A 3FYHA 221PA 3E5HA 3TBKA 4B2LA 5L3VA 1KK1A 1E9EA 1Q1EA 2P6RA 1SZPA 3I62A 1ZIOA 1CRPA 1W5TA 2D2EA 2EFDB 3MMPA 3QF7A 5J4HA 2EFEB 4LBVA 1G9XA 2FMXA 5SZIA 1H65A 1RW4A 2PEYA 2ZRHA 4TTPA 3WP0A 1KK0A 5TARA 1TQ4A 2P67A 2A5DA 3G5UA 4GOJA 3A8TA 4HSEA 1QHNA 1ZD9A 3B6EA 2GXAA 1G7RA 2RKOA 1OB2A 1FP7A 1ZVQA 5FUXA 2XB4A 2B8TA 2YHSA 1W47A 1XMJA 3BJIC 2VO1A 5AWFC 1JEEA 3IPXA 2QY9A 5FI0B 1H8HA 4D82A 1CJMA 2CK3A 5JI2E 3U44B 1S9DA 1Q1BA 2HXYA 3FMFA 1XDBA 3KKPA 1JQLB 2OUKA 2F7SA 1JJ7A 4KBGA 3PEVA 3I5YA 4ON9A 2VIIA 3GLGB 2JEOA 1J8MF 3IQXA 3VHLB 4O25A 3RRNA 1DAEA 4LRWA 2CBZA 1RYHA 5FTNA 1GNQA 3DVLA 2PCLA 1UBEA 1RRCA 2GVZC 1TU3A 2O8EB 1G8GA 2VRWA 5AJWA 3LVQE 1Z08A 1P5ZB 1VTKA 1KDOA 1ZNZA 2YZ2A 4Q5IA 2QI9C 1E9BA 2VSXA 3NEYA 2JCSA 5IF9A 2QZ4A 3IO5A 1MH1A 4GPTA 5BW8A 3RNLA 5KDOA 4YMUA 3H84A 1WCV1 2L0XA 3A6PC 4LHVA 5DHFA 1TTTA 4KYUA 1D2MA 2J0UB 2JA1A 3LLUA 4A1FA 5JHHB 2DYKA 5DI9A 1TL7C 1SVLA 2C9CA 2HCBA 3EWAA 1DS6A 3X1WA 4TL6A 3MAAC 2WJIA 2DFTA 2PZGA 2UZIR 1R10A 3ZQJA 5IK2A 2LWIA 1P72A 2JIZD 1DADA 3NH6A 4HLUC 1PUJA 5HZHA 2P3SA 3BFXA 3OIWA 3FPAA 2Z4SA 3QI2A 4QBIA 3DDCA 4CEJB 1B23P 4C0KA 5JJKA 2D4HA 3IIMA 4A0HA 1NY5A 2VP5A 1FQKA 3VMFA 2XOKA 5SZKB 2GF0A 3QG1A 2D06A 4AKGA 1UADA 4Y0AA 1N2CE 5A4JA 4RCZA 3M6AA 1G8FA 3SNHA 2WKPA 4G5GA 1FL9A 1Z0KA 4NP6A 4QNRA 4TWZA 4B74A 4DKXA 1GL6A 4QM6A 1ETUA 1GDDA 3GQBA 3BH7A 1VHLA 3W90A 3VR4A 3RYTC 1M74A 2V6IA 3MD0A 5LD2B 5FH9A 4DDVA 2WMNB 4LYJA 1T5LA 1GM5A 3CR7A 2YOFA 4MITA 3KQLA 4E22A 2Q3HA 3W8NA 2UVQA 1UAAA 2PT7A 1Q21A 4CEHA 1VYTA 2BDTA 4Q18A 3ND8A 1PVOA 4WIAA 2YC2C 4EPRA 4EPTA 3BB4A 3CX6A 2J9RA 3AV0B 4Q7KA 4ARZB 4NCJA 2KBFA 2XTNA 3OEEA 3QUSA 4BRUA 1AIPA 5FR2A 2E9SA 5EP4A 4JLMA 2Z6VA 2D7DA 2J0QA 3TK1A 1LNZA 4Q1FA 3TKLA 5AUOB 1YQTA 2AXPA 4FIDA 4C0AC 1XJQA 2ZSFA 1T9HA 4DXAA 1FUUA 2ZSDA 1JEDA 3DZDA 2NO9A 4ACBA 5H68A 2Q3FA 3CH5A 2WJHA 3D3QA 2IF2A 1N6IA 3SDZA 2ZRDA 4HAWA 1YR7A 3HR7A 2QMHA 4FMDB 1W1WA 4Q9HA 2DWPA 3ZDQA 1Q12A 4RKFA 1OF1A 5FOTA 1E2QA 1G64A 4M1OA 4Q9KA 3QKSA 4C7OA 2I1VB 1XCGB 2JLQA 1KDRA 1XNJA 1S1MA 2QROA 1RIFA 2ZYTX 3ADKA 3CB4A 2RGNA 3PG5A 3KB2A 4HB2A 4IEIA 4QNMA 4B3DA 2HJVA 4KYIB 2VSOA 3ETLA 1E32A 4ZKEA 2C95A 4LPSA 4CRWB 4BZQA 1TQ6A 3TW4A 2YWEA 2HXSA 2BEKA 3M4YA 3MJHA 2PCJA 3KKQA 2IUUA 4KFUA 3GLIE 1G7SA 2G88A 4WW0A 1UEJA 3RRYA 5HPYB 4DT1A 2BJVA 1KDTA 3NBYC 1WA5A 1J70A 4P4SB 1G3IA 1G1MA 4IDOA 3KUDA 1KY3A 2BBWA 3ZYCA 4IDPA 5LPNA 1KY2A 3IEUA 4QJ3A 4NDZA 1GVNB 4MYTA 3NHBA 1Z6XA 2GVDC 2R44A 3BE4A 2OXRA 4LSGA 4BE7B 1JECA 2ERYA 1HURA 1KO7A 3GMTA 4B32A 3AVQA 1NSTA 4A82A 3WRXC 4QGAA 2OO7A 3UMSA 2QMOA 2AX4A 4Q7MB 4ERNA 5JWOA 2W6ID 1KSFX 1MR3F 1E2PA 1Z0AA 2CCKA 4ZCLA 3ZZTA 1BMFD 2QAGA 2CHQA 1FMLA 1E2FA 1S0UA 1NVWQ 3EWSA 1BMFA 1WP9A 2QTFA 4RFVA 4OHXA 4LYHA 3K0SA 4Q7JB 4JKYA 2O8CB 2W00A 3VR1A 4B35A 2GESA 5EE0A 3UIEA 2F3RA 1IHUA 1KKMA 4OJKA 4XSHA 1X86B 5CYOA 1E9RA 2ZTSA 4S35A 3IQWA 2Z4RA 1G20E 1GUAA 1ODFA 4WOPA 1EFRD 2J0UA 1H8EA 4UNPA 4Z8XA 3A4LA 3QENA 5FFMA 1IBRA 2V9PA 4DLUA 3CWZA 4W5WA 3CNOA 4GZMA 4BRWA 2WTUA 3NKVA 1W36D 5HKKD 3LDAA 2NPFA 4PANA 2WAXA 2P65A 2NO0A 3D6TB 2CL6X 4DZZA 3LQRA 1OPXA 3NC0C 1YZNA 4M9SA 4B33A 3UWOA 4TZ6A 4Q1EA 4F91B 2A78A 5JRZA 2CCJA 2FV8A 3TSZA 2GCNA 4KO8A 4V0KA 2F1RA 2Z83A 1ONBA 3LO5A 4DLTA 5JSZA 3VKGA 3THXA 1FQJA 1F2UA 2IYWA 3W3AA 1TAGA 1RRGA 2ZR9A 3LBNA 1G4UR 1JXOA 3UWKA 5KNDA 2Q3MA 4M2LA 3QKSB 4LY6A 4CEJA 1Z07A 1RZ3A 3RABA 4C7OB 3CZQA 1Z6AA 5GVRA 3W6NA 1OH7A 4C0SA 4CIDA 5KNBA 4DLSA 3HR8A 5DGXA 1FNNA 3KJEA 1TU4A 2V4ZA 2HT1A 3SQXA 2WOJA 1XPOA 2J45A 2XJ9A 4GSYA 4A15A 1SVSA 4RD6A 1AGPA 2E1RA 4KSBA 4PSAA 1YRAA 4A0RA 3B5JA 4PFSA 1U94A 2F43B 1Z28A 2B6HA 3RS2A 2ODNA 4JBXA 2BJWA 1ZNWA 4LHXA 4MRPA 4PQFA 3GLIA 1Z22A 2REBA 5FPTA 2J1LA 5G53C 4X8HA 2FA9A 2FSHA 3NIBA 2KSQA 2XOKD 2W2TA 4PC3A 4BFUA 3R9WA 4UXJA 3B82A 4BECA 4QJ5A 5F9HA 1KAGA 1I4LD 2OBNA 4JLBA 4JSYA 3ZS9A 4NBSA 3VR2A 2R62A 1SXJC 4CF7A 5B57C 1ZU5A 3J81k 4ASUD 1MO5A 1RVDA 1G41A 1G7TA 2IHBA 3K9NA 4YMVA 1QZXA 2KJQA 1T8UA 4M1YA 1S2MA 2GBLA 2ZRNA 5C18A 4TTRA 3RSLA 1OHHA 1EESA 4TYWA 4FD2A 1OXSC 3CRW1 1NN3A 4NCIA 1YZUA 1EK0A 2BVNA 5JMTA 1JB1A 3WRYC 3TNFA 1XMSA 1W0JD 5FR1A 1IQPA 1GNRA 3P4YA 5LDDC 3U6BA 1GOTA 3ADCA 1KK3A 4D0LB 1Z2CA 1U9IA 1XD2A 4Q9LA 5B58C 2MSCB 4H9GA 4C0HA 4Q9JA 1AS2A 4R9UC 2A5GA 2O8DB 1XTIA 2AL7A 2ZAMA 4NHOA 2P5SA 1CF4A 1CJTC 2ZSEA 4QL3A 1RKBA 3TAHA 4MRRA 1C1YA 3S1AA 4KJZA 1ZYUA 3PEYA 2QT1A 1NP6A 2KBEA 4OQFA 4V0OA 2Z0MA 4EUNA 4N3NA 2OT3B 3D8BA 4OK3A 5DYIA 5JZVA 3TVTA 1ZUHA 3TUJC 1CP2A 3TH5A 1JPJA 4D4LA 1IJEA 3Q9LA 1GFIA 3OAAA 3OIYA 2IYYA 4LHZA 1U98A 4OHVA 1A4RA 3LBIA 1G17A 3GEEA 5HCIA 3ZZ0A 4CYMA 4JL8A 1VCIA 4C2TA 1ZM9A 2GRJA 3DPUA 5JJIA 1XXHB 2H17A 2VL7A 1KGDA 1KI3A 3B1VA 3C5CA 4IOKA 3TGPA 4AD8A 5FTKA 1SQ5A 4AG5A 2X8AA 1F5NA 1LS1A 4DUGA 3MLEA 4XWKA 1TX4B 4L9WA 5JSZB 3FHTA 2FEOA 1GRRA 1VPLA 4DRZA 4E03A 1KMQA 1NSFA 4DB2A 4AKHA 2J46A 2ZRFA 4BFXA 4DSNA 4BLTA 1GSIA 3HU1A 2J0SA 1SVWA 1TUEA 2WJGA 1KZ7B 3GLHA 4OI0A 1KYIA 2J41A 2DFKB 2ASEA 4H1UA 2OCPA 4PO9A 2IS6A 1KNXA 2AXNA 3T5DA 2QSYA 3AH8A 2RGGA 2PH1A 4RZ2A 4FW9A 5EE5B 2RB4A 2OE2A 5CM8B 2C2HA 3V4RA 1FTSA 2CLSA 4JLKA 3PEWA 4PHHA 1N0VC 5GVSA 3CPHA 1F2TB 4BLPA 4P32A 1SXJD 721PA 2ZRKA 4UJ5A 4OYHA 4XOIA 1SXJA 2SHKA 3FE2A 3U7FB 3P4XA 4L9SA 2ZUDA 4NCNA 4OQLA 5DISB 4JVMA 4KITB 3WNDA 1TF7A 3DMDA 4LZZA 1P2SA 4KBFA 2ODWA 3OFNA 1W4CA 2IYRA 2ZJ2A 5DE3A 3NBXX 3OFND 3LW7A 2D74A 5DNYB 3X1ZA 4P3YA 3RDPA 2Q21A 2ZYWX 4MKIA 1VG0B 3KFVA 3QOFA 2XB2A 4ZIRA 2ZVQX 1Q0UA 3K09A 4IKEA 4IHQA 4PTLA 4V0MA 3QKRA 4YDSA 2CL7X 1EGAA 3TMKA 1EX6A 1UEIA 1P60A 2FN4A 2ZAOA 1E9SA 3H86A 2KE5A 2ZRGA 2C9YA 3PUZA 1SXJE 1XRJA 5CYPA 3EIHA 3V4FA 1GKUB 4P31A 3CPEA 3R9IA 1K8RA 4MRVA 4NONA 1MRSA 1WDTA 3NH9A 2BWJA 4PZLA 3B78A 2QAGB 2B7CA 3X1DA 4EDHA 2CLDX 1OIVA 2AD1A 1JPNA 1CJUC 3CRVA 4NCHA 2CJWB 3ADDA 1YJ5A 4KLNA 2G77B 1IY0A 5SZHB 2REOA 3CKLA 2EFCB 5C4GB 3Q7QA 3CZPA 1YKSA 3BH6A 2C04A 2PMKA 3CF0A 1W7AA 1W36B 2BBSA 4JBYA 4TMTA 1AZTA 4XSGA 1KK2A 5AJZA 2CDNA 2VBCA 4LX0A 5E95A 5C2JB 2H57A 1X6VA 3EC1A 2QN6A 1PLLA 4TMVA 5KPJA 1Z0IA 2IS2A 2VHQA 4EAQA 3AM1A 4IDHA 5FOSA 1SKYB 2P5TB 2XNDD 3U4QB 3GLFB 1Q3TA 1NI3A 2XNDA 4M53A 5DHAA 4Q4JA 5K8IA 5TXGA 1IOZA 5EJEA 4FWIB 4B3GA 4JLAA 5HE9A 5FI1B 1U90A 3BORA 2QP3A 1KO1A 1NIPA 2VEDA 2KB0A 2QQEA 3PCRB 4ZO4A 4TMZA 4RY2A 3QIAA 2JJ8A 3IDQA 2GAAA 2JGNA 2YYZA 4TTQA 2J3EA 2ZSAA 4K8OA 4GZLA 4BEJA 5A5GA 1NN1A 3OE7D 3TUIC 2ZR7A 5TY0A 2F9LA 4DC9A 1SHZA 4LBWA 5BQ5A 5K8TA 3FKSA 4G5OA 3EG5A 4Q66C 3EAQA 3O8RA 1ESNA 3KQUA 2ZUCA 2J59A 4NYIR 5AR1A 3T35A 3IIKA 2IWRA 2AKAB 3IIJA 3PFIA 4RD1A 4HLCA 4F7WA 2JLVA 4UXHA 2PJRA 5JCZA 3C8UA 1G7CA 4JBWA 5CIQA 2EYUA 1QBKC 3RAPR 1NLYA 2BM1A 2NG1A 4IEEA 4LJ8A 4RJLA 3WNCA 1JR3D 1UDXA 2QBYB 2LKDA 1OXVA 1HV8A 4ZDIA 2ZI3A 2WSSD 1KMHB 3CR8A 3LLMA 3ASZA 3UG6A 4XVUA 4PPNA 2QMEA 4K81B 1FOEB 3K0FB 4Q03A 5HCNA 4HZUB 4DIEA 2WKQA 2QENA 3MFYA 1K5DA 3CONA 3WBKA 2BBTA 2WM9B 1NG1A 1N6OA 5KSYA 1E0KA 4RZ3A 2O0KA 3O8DA 1UDWA 4MKHA 2EFGA 3T1QA 4EKDA 3IPYA 2V6JA 1DE0A 4OBEA 1FPMA 1J99A 5E4FA 3THWB 3K09C 1XMVA 1NMYA 3REFA 4LJAA 4IVPA 1DG1G 1V43A 2EYQA 3FB4A 4XWAA 5CITA 5FUWA 1MRNA 3CW2A 2QM7A 1KJZA 1KIMA 1N6NA 3FHOA 2JDID 1OB5A 3GJXC 2IF0A 2AHOA 1VHTA 4N1AA
chains in the Genus database with same CATH superfamily
3THOA 3TOVA 3GEPA 3QLUC 2LDBA 3IALA 5F7ZA 3RGGA 5E8JA 1DXYA 4HDKB 3FCXA 3D4OA 1FLAA 4H59A 3K2QA 3MN1A 2ZSKA 5HBGA 3RV4A 4D9JA 5AW5A 2JATA 1FBNA 4ZO9A 1VG9B 2P2GA 3ZC3A 5JOQA 5JPDA 1BROA 1W2GA 3RS0A 4AIIA 3X43A 1OMOA 3L0YA 1BSVA 4BFYA 1II8A 2Y1WA 2ZE6A 5HZKA 4PN3A 3SYRA 2RD2A 3K35A 5C81A 5JCOC 1WDMA 2QUIA 3T34A 2HSWA 2H2WA 4WRRA 4HGOA 2RI6A 4LXXA 4UFNA 1XTKA 1LD3A 4RC9A 4WK0B 4YJDA 1KI8A 5KKAA 4LGMA 3RVDA 4JI3B 1JR3A 1R9NA 4ZAYA 3RKSA 4RPGA 4B46A 2A9QA 5CCXA 3M6LA 3HC7A 2P9JA 1LF0A 1TZCA 1EB8A 4IHJB 1J20A 2FPMA 4WN9A 5JUWA 3STHA 4UW9A 3CF4G 2GTPA 1LDEA 1FDRA 4D56A 4E5MA 2MYTA 2VK2A 5KVVA 1EDOA 4D5EA 2B7LA 5CEEA 13PKA 2H51A 1A69A 1JLHA 3R0JA 1Z4OA 2RGUA 3ZGZA 4Y7CA 3GFBA 3WLFA 5HS6A 1YS2X 3A4VA 3TQIA 3WY9A 4K2HA 3N9IA 1KJ9A 4QDUA 1VBNA 4G4JA 4UBKA 2FEAA 3K94A 1CX9B 2IZZA 3QU4A 5K0EA 1QONA 3A1DA 4EHDA 5G2OA 2YOGA 3UHPA 1QVZA 2YMPA 4QHTA 1MLDA 3ZHUA 4UM9B 3G68A 1NKSA 2JLUA 1RFLA 2ZROA 3I9LA 1UKEA 3G0BA 5CXXA 3AB7A 3E03A 3WSVA 3ZEAA 1EK1A 2JBWA 1UWVA 4HNAB 4UEOA 2QGZA 3MELA 1BKDR 3OECA 3WMXA 1YMVA 2OO5A 4CKYA 2IXBA 2G9RA 4FMBB 1FK8A 3KALA 1Q1ZA 4N48A 2F9MA 1E4EB 2Y0DA 4FHDA 1C30B 1K06A 3AY0A 5BRAA 2ZM5A 1N8KA 1PZFA 5JDCC 3LI2A 3K92A 1FSPA 2IELA 5G1PA 3LCRA 3R9KA 3OEED 1I8TA 3O3MB 2MHCA 5FT9A 2F4VB 2FMIA 1T2UA 1RYNA 2Y77A 3JY6A 3MB5A 1E4EA 1E3LA 4GPZA 4N54A 1FTWA 1ENZA 2QGFA 3GZ4A 4Q24A 4GVPA 1DBSA 1XZ8A 1KEPA 2Q6LA 3NI2A 3PDJA 4RKYA 4LVCA 1V48A 1DELA 3QQ5A 6YASA 5FWYA 3PTLA 5G4KA 3OT1B 1EFAA 2UYHA 4DKJA 3B3FA 5E4TA 2MJLA 2EKZA 2JLRA 3OQIB 1JHYA 1G9SA 1QAOA 1EZZA 2F1HA 2PGDA 3O3CA 4HF7A 4HP8A 5A9TA 4U63A 3VR4D 4WX2B 2ZVDA 4ZAZA 4L78A 4EG5A 3IFSA 3P94A 4I55B 3U61B 4LDZA 1I2MA 3IA2A 2FZKA 1FTGA 3DT8A 4K6MA 5FA6A 3H8WA 4X84A 1TLLA 4TN1A 4DBZA 3CA8A 3QPBA 5LCXA 5HKBA 2VSQA 4Z2YA 4HVTA 2TS1A 4DQUA 4YUXA 1EPUA 4R83A 4KQJA 4H0CA 5TLSA 1M1XB 5SZJA 2X77A 3U7GA 3L77A 3C41J 5F33A 4G1CA 1SHLA 4UXIA 3GUYA 1S4MA 2R4UA 2YC4C 4IQGA 2CVPA 8GPBA 5FNVB 1NUAA 1R0WA 1QZTA 5B1IA 5JAOA 1MNAA 4IHJA 3ERCA 3Q7RA 5FBHA 2AC2A 5LNK6 4PINA 1X7YB 2CFRA 1YFLA 5E7QA 2FPSA 4AZ3A 1WUHS 1YTUA 1SQ6A 4FOSA 1BFDA 1ECJA 3K9QO 2ZPTX 2F3PA 3SP1A 3AM5A 4C3VA 4DCUA 2RHJA 4I1OA 3AEKB 3U4AA 4NNPA 2K2QB 3HRHA 4HEJA 3C14C 4QGBA 2HZBA 3HU5A 3UAOA 3U4QA 3KIPA 1IONA 3W5UA 2PL1A 1FDUA 4MUEA 2NVWA 3KT8A 1I6MA 5I48A 2GILA 1J5PA 2RHHA 2PZLA 3W1VA 3ICEA 5E4JA 1JPUA 4GWLA 2HRZA 5C9ZA 4UULA 4F97A 1PUXA 1Z88A 2WNIA 3I6IA 2SNIE 3P7MA 3OOJA 4U2CA 2Y66A 5T6BA 1ISGA 1YTLA 3BXGA 4ESHA 2EVWX 2XZPA 4V1CI 4JP5A 1IN1A 1OYYA 1GSAA 4CR7A 1KPHA 1IZ0A 1H0RA 2H7XA 2HDHA 1NYTA 3SR3A 4OI1A 2FR8A 3EZFA 1ZUWA 2XHZA 3H1BA 4PX2A 4AZ0A 4IZHA 4EABA 1KEKA 1XTVA 1YFZA 3RC9A 2HWXA 4HX9A 3BN3A 3O6VA 1E5QA 3SBDA 3DDSA 4BO7A 1NAHA 1H05A 3D6NB 3SC4A 3L0BA 2WTUA 3KXPA 4TV8F 1JPVA 1Z8HA 1C9MA 1I01A 2HI0A 5EE9A 1E2NA 1NQ5A 2IHYA 4RZHA 3UK2A 1Q0TA 3EYWA 3GJTA 3SX4A 3ZHXA 1FNMA 1MEJA 4N0MA 1C3XA 4FYVA 2JJ1D 3ROFA 2IZ7A 3HGQA 5GM2A 2GEUA 3GD7A 3PE3A 4MWCA 3ZBPA 4KO1S 4L15A 1TUBA 3NO4A 5CVJA 2EBUA 4LNUA 2ENWA 5FD8A 3K53A 2B3TA 2HMVA 2IU4A 1UPBA 3KV3O 4UHDA 3W3AD 5AK6A 1HXHA 3DR3A 4FE4A 3I2FA 5EFZA 4E5KA 5BMVB 3UB4A 3IL2A 2A33A 3GFRA 4EGFA 3CSSA 3O0TA 4ZVUA 1QR6A 2AF4C 3UAXA 1Z4JA 1C7JA 1XQWA 2XZTA 3DLIA 4HQ6A 8MHTA 1PAUA 3AFGA 3OA0A 5LXTF 1DIGA 3ZCQA 1O95A 1QE5A 4FKBA 4PZYA 3L0PA 4CG0A 3VAAA 1CRZA 1Z63A 1D2RA 1X7WB 5CBKA 4PLVA 1VMDA 4EJMA 3OWOA 3H9QA 4OQPA 2FETA 1OXKB 1PS0A 2G1PA 1XEXB 1JJFA 3AKCA 4WZBE 3ZS8A 3ICPA 3W5VA 4U3JB 4D3YA 4AO7A 4JUAA 2B5VA 5EWMB 3BG5A 4ZIRB 2WWYA 1RJ9A 4BFSA 4HFJA 3K70B 5AI5A 3FOEC 4NFSA 1OWNA 2B1RA 1ONOA 5HSGA 5FKJA 3GJ6A 5K09A 4DMFA 2G9NA 3NHJA 2ZTUA 2HLDA 3CQ9A 1YV9A 3JQPA 1W4LA 4NABA 4G5YA 4WKPA 3OQMA 3AOEC 4CFSA 1UBSB 2YZ7A 4WXPA 1KJIA 3F4BA 1UMBB 5HIKA 5KPDA 1T1IA 1WCWA 2Q1YA 2V55B 1VMKA 1YS9A 4GP6A 1RXWA 2JVIA 1L1RA 3RYCA 3KOWA 3QM1A 1VE6A 1X80A 1Y3AA 3ISTA 2UYGA 4GYYA 4K46A 1C0PA 1I36A 1QRDA 3LRTA 3QUCA 4JLNA 4YACA 4LJ4A 4EGCB 3PPXA 3HK2A 3MINA 4OHMA 5TX7A 3S99A 1RC8A 1Y6GA 1O4VA 1X1SA 4FYYA 2IPAB 1K4MA 5F2KA 4AU1A 4B45A 2FPPA 4C5BA 4GLLA 3BWMA 4A9AA 3ZDEA 3LUKA 3THSA 2WLTA 2JRLA 1BWQA 4OQYA 1DIOB 3GPBA 1W46A 5AJTA 2CYCA 3MUNA 2V7QA 3NYIA 1F7VA 1IJKA 2Q8NA 1YQGA 4CKEA 5FADA 2AN3A 2P40A 3AI3A 1MNQA 3LAWA 1TPZA 4YJHB 1OC2A 1WCXA 3DEAA 4JJKA 3B6MA 4IX1A 4NOLA 3QOYA 4QYWA 2YXLA 1PTJA 4LA4A 4MQUA 2WVJA 1EVJA 5AXCA 4JT8A 2OHJA 4J43A 1UKVY 1Y4ZA 1FX0A 2YWGA 3EW7A 5JE8A 3VU1A 2ADFA 2RHMA 3PGA1 3BMOB 4IIFA 1XDGA 2PS1A 3L5OA 1EUCB 2PLWA 1UQUA 2NYVA 3LNTA 4GQBA 4YS6A 1B8VA 2X4DA 3DHNA 3RUFA 1G8YA 3UJCA 4XYBA 3VQTA 4IBOA 1JDBB 3H9GA 4CLRA 3A9RA 1H4QA 4URYR 4LOKA 2K87A 2FQYA 5HRCA 1NP3A 2P5UA 4WFQA 5AH0A 5D5PA 3S8YA 2G9QA 1A9TA 1TM2A 2W37A 4LZNA 2PMEA 2OHFA 3AVWA 1P6QA 3THYA 2IODA 2Q9CA 4R3UC 5GV7A 4KH1A 3G5MA 3R7FA 1IOWA 2WZDA 4KUHA 2BGRA 2BMAA 4TT8A 3TJMA 1CY2A 3OAAD 5ALXA 1C7EA 4IQ8A 3Q1KA 3VDXA 3O4FA 5DTEA 1DQZA 3PJEA 5EGNA 4KPYA 4NYMQ 4RXMA 5L40A 3AW8A 4KI7A 4UU7A 3IBGA 3DB1A 2PSSA 1CZKA 1P1RA 1QR2A 1YHNA 4BKOA 2VZLA 2ZXFA 2M32A 5CCBA 2A9KA 4P2GA 2JAQA 1YCDA 2Q4EA 3W2FA 2EP7A 3S7ZA 3H04A 3RTAA 5CLHA 3CCFA 3M49A 2FSVC 1YUMA 2DPLA 2ZWPA 4OB8A 1QAMA 2QX7A 3PYXA 1WSWA 3MIZA 4KXFB 4MGYR 4YP0A 3WRWA 2AUNA 2GETA 3U62A 4GKJB 1GEGA 1JA1A 1TVKB 3GRAA 1DIBA 1R12A 3NUQA 4F4IA 4QBGB 1Z4QA 1OWPA 2PH5A 4AS2A 1QRUA 4KR2A 1P9LA 2C94A 4P4TA 3RS8A 3SC2B 1XELA 3FSEA 4XCXA 3VC7A 2FFHA 1FP1D 3OBIA 3TCNA 2AOUB 3ER8A 1JHOA 2P2DA 1T2EA 1G60A 1ZM4A 2VF2A 2CLOB 2VZ9A 1NJ8A 1S8OA 5KYGA 4E2FA 3FPGA 1SULA 5EJGA 3EZLA 3TM5A 1AKYA 2HGSA 1JXAA 1EAYA 2VH2A 4M1SA 2Y1LA 5HILA 1AQUA 4PPFA 2H5EA 3RYFA 4BBJA 3S68A 2JBAB 1B0UA 4QXOA 3L0OA 3W7BA 1GG2A 3K0KA 5FJIA 1U6JA 3EA0A 4XYGA 5AVVA 1EHCA 3BK7A 4MV3A 2P9GA 3KB6A 4PWZA 1RAFA 5JDIC 1OLXB 1PR4A 1DTSA 2ZYAA 3EBLA 3K9HA 4DUGD 5E6RA 1RI4A 3QF4A 1QAQA 4CMCA 5DNCA 1Z0SA 4EJSA 3RYCB 1B3RA 1OWLA 2J8ZA 1EGMB 3LT2A 1PJQA 2VJBA 3H5LA 5E6SA 4LWPA 1OXXK 3IRUA 5IBRA 1KF0A 4BWVA 2ZUTA 4UATA 1ES9A 3FSGA 4A8TA 2ZZMA 4IOLA 4KVGA 1OV4A 1H8HD 2A94A 2M6RA 3MNFA 3MT0A 1OIXA 2FF5A 1NUTA 2V7UA 3BIFA 4ITVA 4Q6BA 4ANFA 1JAHA 3MTQA 3MZ0A 2ZSUA 4HDKA 4NFYA 3P2YA 4WOJA 4XDZA 5U9CA 2O2ZA 1HEIA 1RJ9B 3C8MA 4GBMA 4P1ZA 3S1SA 3OOSA 1TE2A 1XVAA 4FYMA 4ZVOA 5D85A 3W6UA 4QRDA 3UJNA 1WF6A 3HKCB 5DYYA 2FPIB 4E3WA 3GCGA 3WIBA 4L4UA 4QEKA 2CNKA 1PWZA 1DI0A 3C6MA 3JVDA 4RCVA 2H4XA 2JBAA 1DRUA 2E6UX 5JVDB 2B20A 3D8TA 2BSXA 2VDQB 2A9PA 2R6JA 3EUEA 2PUVA 3ADDA 5PGMA 1CS0B 3VR5A 4BQFA 2WHXA 3U3OA 5AUPB 4ZOLB 3CEAA 2QLNA 3O84A 2JFVA 2ZVJA 5JWHA 4F11A 3PDUA 5AKIA 2RHDA 1PDVA 1PGJA 2WM2A 4KB5A 3SOPA 5C51B 3AXTA 2G83A 2F4NA 4QXQA 3OKAA 2X2EA 4IRMA 1Z7BA 1D9XA 2M6SA 4UVEA 4OLAA 1UJ2A 2VP4A 4M9XA 3W05A 3OZIA 3OJCA 1FY2A 4PIVA 2HMUA 4J1TC 1JXQA 3AKYA 4RTNA 4I1UA 3SEAA 1CUIA 5ECYA 1QHIA 4AJOA 3DLHA 4OQNA 1DXQA 2H1HA 1F3OA 4AJ9A 4CL8A 5A4MS 1U2RA 1Y3CE 1ZC4A 4BKQA 3R4CA 1XA0A 3TAUA 2WKSA 3SXJA 3A1TA 2QVZX 2WWFA 2AE1A 2C96A 2EATA 3HYLA 5LA6F 4CDGA 3AFNA 5EP3A 3ZWQA 5KDDA 2Q5EA 2R1TB 3I01A 1X38A 4GOXA 1L3CA 4NU8X 4OUDB 4YECA 3JW8A 2B5OA 1XVVA 4F45A 1FU8A 2YV2A 3CTMA 2C97A 4K03A 3ROMA 1ORRA 1LRKA 3KVYA 4PCVA 3FI0A 1I2BA 4C01A 4JXZA 3PRYA 5DMXA 1TT7A 3JQCA 4MRAA 4NRDA 5FOXA 2QN8A 4ILKA 3A37A 1UZUA 1MJNA 3CZRA 3GWGA 4K86A 4NC9A 4BFZA 3SEFA 2IBSA 1VP3A 3E5MA 4UMDA 2N9UA 2WJYA 4BLWA 2XMDA 2X5XA 3FLBA 2F3TA 1QO0A 3LM8A 3UH0A 5DN9A 5JZOA 1QP8A 2XB8A 3EUFA 4CGYA 2DFNA 4L3OA 1NVFA 2C5EA 3TD9A 2VPTA 2PUJA 4FR2A 5KAPA 4DLZA 3TLXA 2CLEB 3WHLA 3A6EA 3E22B 3KYDB 3NNSA 5GGXA 5LXTB 3TECE 1BX0A 1MV8A 2VP2A 3EARA 2G5GX 3JARB 4KFSA 1AQYA 4KXUA 4G0NA 3RJ5A 1Y3DE 3THRA 2GZ2A 3HJRA 3T06B 4EBBA 1ZRHA 3RTEA 5EJ4A 3PC7A 2VDWB 1C81A 4PAMA 1U3UA 4C7VA 3V7WA 1W52X 1XRRA 3UPDA 1H6BA 2EKBA 1HORA 2R65A 3K15A 1GZ5A 4GM1A 2EJCA 3D3WA 3C2QA 2HCTA 1M3SA 3NX4A 4INAA 5DTRA 1NDQA 2XNSA 3DFIA 3HBFA 3VPGA 1RIIA 3C5VA 1PW7A 2NXNA 1PE0A 2RH9B 1W6RA 2A5JA 2HKIA 3GRRA 3TW8A 2OZLB 1FMTA 2QUBA 3DAFA 3AZPA 4J0CA 3OM8A 4JSRA 1W73A 2MSLA 3MLAA 5AK0A 1MD9A 1GZHB 4ZJUA 2YV4A 2Z04A 3C6KA 2P7IA 3CF4A 2V4UA 5BOSA 3PQFA 1VA5A 1XMPA 4LY3A 1Y1LA 1J23A 2XQKA 2CXNA 4KDCA 6AT1A 1VE1A 4YROA 2CL0X 3RLFA 1KVSA 1JUDA 1Z82A 2BEVA 1O5OA 3GCWA 3NAGA 4IO0A 4XB6B 1U0TA 1Z6QA 2LXNA 2WTNA 1Y8AA 1UDBA 4MUJA 1P4HA 5HUQA 1A7JA 2C9OA 2I4MA 3EIWA 3FRJA 3SU8A 2B5WA 2RJOA 4OX9B 5A9RA 3R6TA 2IVZA 3TRDA 1P5JA 4R84A 1AA9A 2Q6VA 4JNCA 4MUIA 5KNLA 4Q3KA 4IDEA 4N7MA 3TO5A 1IBLB 3HL0A 1EVZA 3SQWA 1WDKA 2GHTA 2OCBA 1YZ3A 1SIBE 3E9DA 1GZ6A 3K0AB 3P9YA 3BGSA 4FXOA 5JYDA 4JC0A 1CR4A 1P1BA 1SOWA 3DBIA 4RZIA 2R25B 2X15A 4D96A 1QHYA 1V5EA 3U26A 2JFQA 4UU1A 2ONKA 2C31A 2IYUA 3ECCA 4HO1X 4QIHA 3FNIA 1XZMA 5CGQB 4LHWA 5DT9A 1TF2A 4OHKA 3ZE1B 1TYDE 1TDJA 2JJ1A 2GK7A 1YZTA 4A0SA 1E7RA 1WZIA 1YL5A 2C2GA 2Q3BA 2I29A 1UM8A 2DTEA 2OHIA 2ZATA 2ZRPA 1W2WB 3DD1A 4FE3A 4RQBA 1NULA 4L75A 3ZHYA 7GPBA 5JS7A 4RDIA 4OHRA 3FUTA 5AHWA 5EZQA 3HWX1 1LBQA 1A7KA 2ERXA 4QJ4A 3WLLA 1ZGAA 5HWSA 4MIYA 3LPCA 2Q6TA 3TLEA 4DJTA 4QYMA 5AW9A 3T41A 4YRGA 1O54A 2W2KB 3AHGA 1KA9H 1SCIA 1J33A 2JI6A 4LHYA 4NULA 5BSGA 2P3QA 5F5XA 2HMWA 2J5XA 3DCJA 4XJSA 1F0PA 3RTDA 2R66A 3QUAA 3CJQA 4X7MA 4D8VA 1EWYA 3CY6A 2AFIE 4V3CA 5HOEA 1HDZA 1M6VA 3ZV6A 1XPUA 1U3GA 2YFHA 4GZ3A 1JFFA 4RHCA 2AA3A 4QVKA 1U6IA 4G67A 1U8AA 3OQBA 4DIUA 2EF0A 3LHIA 1T5IA 2BFAA 4LCBA 1ORTA 4RMJA 4XX1A 3VISA 1FSFA 1M8PA 2HQBA 3QV2A 3LJKA 4QELA 4Y1EA 2XF8A 1KI4A 5HF6A 1C4WA 2SCUA 2H5IA 3GU3A 4R01A 5E7IA 4PW0A 1EBUA 3DTTA 1QGOA 2UVPB 4WY2A 5AI8A 5EZ5A 2X0NA 4E15A 1N5RA 1B74A 1VL0A 1ZI9A 2PSHA 2ZJBA 3KOYA 4HWSA 1TXGA 4TWJA 1J1ZA 3C7KA 3HHEA 4B71A 1IL0A 3NHZA 2AFHB 1NW4A 2QTRA 4WFJA 1Q0ZA 1L5OA 1HDXA 4TUYF 4DBVO 4ZQBA 4JL5A 1J5XA 2G0NA 2VUUA 2YXPX 3H5RA 5JO0A 3D5EA 3CKMA 3V8MA 3WLRA 2HM7A 1ZO8A 3L4BC 1ZK1A 4QODA 5REQB 3UXYA 5DBOA 5IBQA 5CLJA 1NLMA 3TI7A 2WAMA 3T7AA 5IX8A 2VQEB 4KAXA 1IUOA 4PO3X 4CU2A 1VHQA 3GMSA 4PCLA 4OQDA 3VX3A 1AXEA 1Q0RA 2Z95A 5CPBA 2A9OA 1UP7A 3K3PA 1NJ6A 4WECA 1X70A 5HJ7A 1H2WA 2VJMB 4DJDC 1ZH0A 4WY5A 3NYQA 3F6BX 1E2GA 4O08A 1U8FO 3LX6A 1V41E 4HS9A 2PIAA 5CJ2A 1T1SA 4DLYA 1ORVA 2FN3A 4QLBA 1Z83A 3D0RA 3T0GA 4CT4B 1FRNA 1VBKA 1AKUA 2OP1A 4K9SA 3L1KA 3COSA 3NYWA 3TSWA 4PN7A 5JROA 2DPXA 1EVKA 3EYAA 3PL1A 4FHZA 4YK7A 1E4OA 5AO9A 2YICA 4BJ5A 3MWGA 3ADBA 1EM8A 1VSVA 1D6MA 3P9SA 4Z7JA 1N6PA 1EFVB 1OAKA 3ZTYA 1Q44A 1WJGA 1A71A 1GEEA 2R6AA 3X1YA 2WUEA 4OHWA 1AGXA 1T2CA 4DIKA 4MWOA 4RVGA 4IIUA 4Z4GA 1NJ5A 3GGPA 1H1DA 3GZNA 3SLKA 4WBNB 3QOWA 3AB8A 3WL5A 3HXQA 2D5AA 1FB5A 1L7EA 2O2IA 4LJ9A 4RO0A 3RFVA 4PYOA 1JMKC 1G19A 2VFAA 2QTNA 4HV4A 1NR7A 3BMOA 5FOQA 3P2EA 4CE6A 2BF7A 1KDPA 2GBLC 2XWQA 3DEYX 1BKSB 4JP2A 2QYSA 4KFRA 4LOAA 5E7JA 3M4XA 4BJHB 4BVEA 1QS0B 2QDKA 3FSJX 3DA8A 5C35A 3SM9A 2XCOA 4KK4A 4DA4A 1BD3A 3VPDA 5AUNB 5BURA 1RWMA 5BYBA 5BR8B 5CCEA 5FWYB 1HNNA 1Y6QA 4LYGA 2RGAA 3L8HA 5A05A 1V8DA 2ODAA 3O4GA 3ZWAA 3PSAA 1GKIA 4B6OA 4DVJA 1YZLA 4Z9YA 4X0EA 4UVGA 4DRYA 4MKGA 1NBMA 3ABSB 1HOTA 3PFWO 4TLDA 2HA7A 2IEYA 5HRAA 2XVAA 2R7AA 3L46A 1WQ3A 3BL6A 4EHJA 2WIGA 2HL6A 2OGTA 1X1TA 2R2AA 3N74A 4YAJA 1R0LA 2H7VA 1NQWA 3GMDA 4PGFA 5BUSA 4UDOA 3D6FA 2G7MC 2O3RA 4MWEA 1Z18A 3D6AA 2CFTA 2I7DA 3NTVA 3RWOA 4TM8A 1ZRMA 1X0XA 5K51A 1UKAA 3B1WA 1DQPA 2JFOA 5H81A 1V4VA 5TJ9A 2FUNB 1NN0A 3EC2A 3IHWA 3NVKI 4JV5B 3F6RA 2D54A 6REQB 3GPIA 2XH8A 5A71A 3HNPA 3JRXA 5CU7A 2Q5CA 2ZYVX 3TIGA 4DLNA 3LC2O 3EMKA 3OQ6A 3VR2D 3W78A 4F5DA 2FQXA 1Q6YA 1YBHA 3H2ZA 4CMJA 2VAMA 1EUCA 1ZD3A 3KTAB 3IT2A 5KNCA 3L1JA 3UOWA 1GL9B 5G41A 4KJXA 3ORRA 5TF4A 4EVQA 1GL3A 1OFHA 3BE8A 1OR8A 3FMOB 3GBSA 3PUKA 3Q88A 3AB3A 4GSKA 3EZ6A 1N8TA 4EG1A 1YT5A 2GJSA 2J3QA 4FJ1A 3E48A 2J08A 1R4MA 2F1IA 5TJHA 4G5HA 3TUZC 4GO1A 1DAHA 3BD9A 3CS3A 1E5DA 2XMGA 3IILA 2QL9A 4KQ1A 1IFXA 2FW8A 3PU6A 3T3MB 1F4LA 3PYLA 3GFVA 2VT2A 3FCSB 3VH2A 3OEHD 4LXHA 3LLVA 4WWHA 4L9AA 4AY2A 4GG1A 4B7XA 4E1BA 4V2IA 5KYUA 3DZ8A 1A8IA 5G0UA 1B0ZA 1N32B 3QVVA 2HHHB 4PBTA 1DX6A 1W85A 3HUEA 3V1KA 3BTSA 2C92A 1KZ1A 4QULA 5CFMA 2FXIA 1EU1A 2PQ6A 4K9RA 2DH5A 1VL1A 1NXSA 1B8PA 2ZQ5A 4PONA 2DLCX 1ZVJA 2AD5A 4JBGA 1EXDA 2P9QA 3JXEA 3U19A 1U4NA 1E3TA 3HACA 2O3UA 4QHSA 4PLWA 2R6ZA 2PRYA 1GN8A 1SKQA 2OOSA 2EFYA 1Y98A 3CJTA 3DBOB 3DW3X 1C7RA 1T9KA 1U7HA 1W5BA 4II7A 4L9RA 4WCFB 3TTVA 1EVIA 2A30A 1ZR2A 5F3RA 4GSLA 4K9OA 3HCAA 5EVJA 3EUWA 2J7PA 3KVNA 4HEHA 3TB6A 4I1PA 3OJEA 1AQ6A 4LV6A 5A2QA 4PQEA 4DV2B 3QXJA 2W9XA 5GONA 4MHOA 2IUEA 2JRCA 3ZNOA 4CUZA 1F7UA 3DM5A 1CR2A 4B4KA 2X4GA 1G66A 1NYQA 3IKMB 3OQPA 5CAEB 3VBEA 2XVYA 4RH0A 3CLHA 5ULLA 2C4WA 3A0RB 4CIVA 2GDJA 1N5JA 3KQTA 5LDGA 1SXHA 5KYYA 5LUAA 4MZXA 4QSMA 4BLSA 2PRZA 3PCXA 2JS7A 3EH2A 5DBIA 2JFFA 1SD2A 2DVMA 1ENYA 2P0EA 4TYNA 3ILXA 1EWRA 4MIKA 4DIDA 1WXEA 1U7UA 3QU5A 2XD9A 4NYJQ 3EH1A 1BE6A 1U8ZA 3CZ9A 3HEAA 4HLNA 3BSSA 4J03A 1NQAO 1YOBA 4D3XA 1PSDA 5ANRB 3T94A 1E7QA 1RYYA 3LY7A 4RNDB 5B64A 3ND5A 1OLXA 3I8SA 4L5BA 3MT9A 4DA8A 1XQ9A 1CXZA 1HE1C 2O50A 4EY4A 1G4AE 1SUAA 1M7GA 3EQ6A 2GZMA 2WSYB 3EXIA 3FPFA 3IT3A 4NE2A 3VU0A 3MAJA 1B2RA 3DOIA 3ZNQA 2ZKIA 4FGZA 2ZJ0A 1GZUA 4ZK6A 1Y4AE 5EKXA 2WG1A 2JEYA 1YDWA 3GGCA 4HX2A 4ZD6A 3R7WB 3EQZA 2BKVA 1E77A 2FP4A 1U2EA 3HL4A 3ANSA 3ICOA 3C6YA 3NWBA 4M4SA 4RBNA 3S2GA 1C29B 1P7CA 2XDWA 3ZU6A 3DV9A 4I9NA 4JT2A 1BEUB 1JLMA 3F4KA 3SS8A 2JFPA 3EEQA 4JYPA 1CDOA 1MRZA 1QF9A 1FQOA 2JBHA 1ZA2A 2W4QA 1KSJA 1XZFA 3L6RA 3WMGA 2I3DA 4A8JB 2H00A 4POOA 1QNLA 1PP4A 4TMKA 1PLKA 1H4SA 3ZVKA 4IVNA 4W5RA 4UMFA 2VF7A 1DKRA 1S8FA 3ZV3A 1T6YA 1QOPB 1QC5B 2XPCA 4R0MA 4QDKA 4PLZA 1FW6A 4DSTA 3OJ0A 1DAMA 2JIZA 3R23A 4R6XA 4RGVA 4DEXA 4F8YA 4V03A 2WSSA 3ZZ1A 5JAMA 1P8JA 1JEQB 3G5TA 5BYJA 4DCVA 2BGWA 3DDHA 2C3UA 5MN5A 1FFGA 2XEXA 3D2AA 4ZC8A 2H0QA 1B7GO 3I5MA 3BWBA 3NHSA 4KSYA 3L8GA 3V7FA 1PQUA 4PXAA 2BDUA 4GI5A 3I61A 3D8NA 4QBFA 3TR5A 3KXDA 3MPUA 4CLXA 4FB4A 4ZDWA 1CJKC 2HQ1A 5FBQB 4TLEA 5AKLA 4MS4A 4P8RA 1UBCA 5AW8A 4EL0A 1QHSA 4OSEA 1N36B 5CP8A 4F92B 1XCMA 1T25A 5EA2A 4ZVKA 1P9WA 1WXWA 3ZHRA 3R8FA 3QE9Y 4TKVA 1XWIA 4UVDA 4V39A 4ZWNA 2PVSA 1NVAA 4AP5A 3KKZA 1LWNA 2WDZA 3F9IA 4H1HA 4DUPA 1RVV1 1H4TA 3IHLA 4X3PA 5EC8A 1G9TA 2QG6A 2HRCA 3CPJB 1S2GA 4JYBA 5KHAA 4BEWA 2QT0A 3UUFA 5CAEA 2VUTA 1L5HB 4GL4A 4Z4QA 2Y0PA 4Q4AA 1P4GA 1RRMA 4IXWA 5BR1A 1VCMA 2XCIA 4P6VF 1OC4A 4AUNA 1SIUA 1FX0B 4HLQB 3QA3E 1PJCA 5JXJA 1H42A 1EDBA 2B35A 2AW3A 4FSHA 3OQVA 3SFTA 3N7UA 1T35A 2VC2B 5CNIA 4M8KA 4HQNA 2EWWA 3T3PB 2W42A 2D3WA 4KIWA 1OFGA 3FY4A 4FDLA 4MQFA 4WXYB 1N7GA 2Z43A 3TIFA 4LYEA 3I53A 4YASA 5HQ3A 2DECA 4WBNA 1DAIA 3NVAA 4V0RA 4D26A 1E1YA 4M22A 2IYXA 1NNSA 2ZI4A 2E48A 4M1MA 4QYIA 5KOHB 3FNGA 2OXEA 1GVHA 2QM8A 4MTCA 1J2UA 1RHJA 5BWNA 4IJUA 2I8CA 2HWKA 2CJYA 5EZ6B 5TGDA 3OOYA 1N3YA 4CLDA 2FFRA 3IUNA 5B3JC 2RKWA 4I5EA 2E5LB 1KBZA 1G21E 2RCNA 3MM4A 3IEPA 3N8DA 4LFCB 2OCYC 2WHPB 3KPYA 3W5JA 1JFTA 3OZ7A 5IU6A 5JAHA 2QLMA 1Q0LA 1FYDA 3D8RA 3DTYA 4MB0A 1V1RA 3RNOA 3UJPA 4A2WA 4BLUA 1GGKA 4E2WA 3C0KA 2EZTA 3QVSA 4GBGA 1NJ1A 2LCIA 4B0PA 3THYB 2ZIGA 3K20A 4AUEA 1D5CA 2FLVA 4IM7A 4F04A 2WIFA 4G07A 4KMRA 4XGQA 2WWVD 3WVNA 1COZA 4BBPA 1GZVA 4KQEA 1QC5A 3GH3A 3VNSA 4BJ3A 2YJ5A 1QP4A 4KOEC 1SC9A 2NO1A 4O0MA 2ZAIA 2BGJA 4M1ZA 4DEVA 4LFAB 5H8WA 3KJHA 1AK9A 1RHUA 3L8FA 1JG7A 1QIKA 2JC3A 1OLUA 3FCAA 3L7JA 2ZKLA 3GCDA 2VATA 1I4DD 1PGNA 4FYIA 1JIJA 1XBTA 2ZTMA 4LS3A 2ACEA 1RS0A 5BQFA 2E87A 3FMPB 2PLAA 2Q5FA 2QJOA 1W87A 1X3SA 5JD3A 5DULA 2NX2A 3EY9A 5CK5A 2AR0A 2CMFA 2I7TA 1LBSA 4S24A 5EE3A 4W7IA 3S70A 3WAJA 1GQSA 2SCUB 3O8LA 4BMSA 3WBJA 2C7PA 5HUJA 3CRZA 1CR0A 2DR0A 4RADA 2CCGA 4IDAA 1I4TD 3P9KA 4B7CA 3RK1A 4UPDA 4DWOA 1QU3A 3NIDB 4I36A 3UW1A 4C03A 4ILEA 2GCOB 2G70A 1M1YB 3AR9A 3HHPA 4RD3A 4UUBA 3N0RA 3LLCA 4BXOA 1T8YA 1DKLA 1TCBA 2ZYRA 4BN0A 1S3GA 1N7HA 3BBLA 3D3NA 3IVCA 1GHTA 1N3IA 4UTXA 1U8UA 2ZJOA 2C3PA 2P41A 2D5IA 2H2IA 3MJCA 4IEFB 3RYIA 3S2ZA 3TRFA 2HLPA 4INPA 4KWEA 1OXUA 4XH9B 1DGQA 5DNVA 3P96A 1SKMA 3RRXA 5L3SB 5FTWA 3TSCA 4BQOA 4M8LA 4M9CA 2F8TA 2PX5A 3EVTA 5EJAA 2R2GA 1E2KA 1E1QA 3DAHA 1CYEA 2FPUA 4EPXA 4OM7A 4AKIA 2GN4A 2I03A 2EFHB 1WMEA 1E8MA 1N9ZA 5K0BA 3QW2A 1LLCA 3G8DA 3MGBA 4EFKA 1K3UB 2W6MA 5C5IA 1FUYB 4NFLA 2I1LA 1KAOA 2X3FA 4LSMA 3UB2A 1CIVA 1HNWB 4P0TA 4YDHB 4GPIB 4MWGA 1NBME 4NU0A 5EWLB 2E1PA 4S1OA 4DJEC 1VLQA 3ZWNA 1OU4A 4CLOA 1XEXA 5INTA 5LC1A 2ZVPX 3IIEA 4DXHA 1E79A 3NGMA 4R0NA 1W0KD 2ADOA 3N70A 5KYWA 1XCJA 1KSHA 1VI2A 3OE4A 3TDMA 4C0LA 1ZUNB 1RMQA 3VC3A 2REXB 2CNNA 2YW2A 3Q5GA 3R7NA 1QQTA 1T8TA 3MXOA 4ROSA 5IAAA 3K5HA 1ZIYA 3JALA 4G9BA 4PAQA 2AX3A 3E3MA 3L7YA 2JLZA 2BV3A 2IPOA 4ALLA 3IPLA 3O7MA 3CX3A 2DFDA 3AW9A 3E2MA 3HBNA 5AICA 3SZOA 3UMRA 3V2HA 2ZWMA 1YB7A 1MB0A 4C2BA 2WUGA 5IC5A 4N0PA 4LRYA 4MYHA 4B4OA 5LZ2A 3MF4A 3VA7A 1HZZA 2AN1A 3SIRA 3VMFA 4WEOA 5TR9A 1O9GA 3CH4B 1E9DA 4X90A 2HOQA 4J9VA 3H65A 4XVHA 1NBMD 1NSYA 4HVLA 5FWXB 1EUDA 8ADHA 4U7JA 5JLJA 3TINA 1IRIA 4Q3LA 3ESAA 2GZDA 1BNCA 1XQ1A 1WDLA 2W0SA 3ZDZB 1GQYA 1PEYA 1G6HA 4GMXA 3VDMA 5HJ5A 4CFZA 3SWWA 4DR2B 1KHTA 3AVOA 3BUSA 3G8YA 4X92A 1YUNA 4OK5A 4TKZA 3T5TA 1C1DB 3W6ZA 1Q19A 2V65A 5J4LA 2AKEA 1SIWA 5M5BA 5IS2A 3L6DA 3PRKE 3N8NA 2C5SA 4DCCA 2ZTLA 3U56A 3V1YA 2J67A 3AOEA 4NJEB 2IXDA 3FIJA 5C52B 1OI2A 4XX0A 4F6RA 1TTQB 5ELMA 2E82A 2LKCA 4TUYA 4TOIA 1X9HA 3GIDA 1E3WB 4LQ4A 3OVMA 4RABA 3L07A 3DDZX 2GR9A 3CXRA 3Q9UA 3EVAA 1YU9A 1MAHA 3L7KA 1ZIPA 2H8GA 4EFMA 1FTYA 2YJNA 4KO2S 2PJUA 4GP9A 2OCKA 3R3WA 1W0KA 2FMTA 1E3SA 2Q3JA 4C4PA 1UT5A 1T3LA 3PCTA 1KEUA 2HTFA 3FPEA 4I7EA 3IH5A 3IBFA 4NBKA 4BNVA 3OOHA 3OESA 4JP1A 2F48A 3ILVA 3GAFA 3A6DA 1P2FA 4OBWA 2B0JA 5C7LO 4C6TB 2Z8YA 2VP3A 3I72A 4HAIA 4XD7D 4EGSA 1W5SA 2YCLA 3NBUA 3IOCA 4AMUA 4H4EA 1QYCA 5TDHA 1Z26A 3CSUA 4EG7A 3K71B 4BEBA 1UBJS 1BX3A 3Q4GA 2ZAGA 3FNFA 1YR6A 3RS9A 1D6NA 1OKKA 1K68A 1BEEA 3B70A 3NHAA 1DBVO 2PWZA 3JWPA 5IEBA 4DAEA 4RTLA 3FOFC 2EQBA 3D54D 1W94A 3NPMA 3LDUA 4MO2A 1OUMA 5DM4A 4P98A 1GT91 3RYHA 4YT2A 1K66A 4PLHA 3AJDA 4EMTA 1OOEA 1MOPA 2QQ5A 2W98A 1T9GR 2QUKA