3BWDD

Crystal structure of the plant rho protein rop5
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
176
structure length
156
Chain Sequence
RFIKCVTVGDGAVGKTCLLISYTSNTFPFSANVVLGLWDTAGEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKLDLRDDKQFFIDHAVPITTVQGEELKKLIGAPAYIECSSKSQENVKGVFDAAIRVVLQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the plant Rho protein ROP5
rcsb
source organism Arabidopsis thaliana
molecule tags Plant protein
molecule keywords Rac-like GTP-binding protein ARAC6
total genus 58
structure length 156
sequence length 176
ec nomenclature
pdb deposition date 2008-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3bwdD00
2Z4RA 2FDCA 2ZS8A 1GP2A 2RGNA 2QAJA 1DTSA 4EUNA 1ZU5A 1KDOA 1Z29A 4JVNA 4ACAA 1F2UB 4PO1A 3AKEA 1C9KA 1EFHA 5CJPA 4GNKA 4ZI2A 1GSIA 1IY2A 4IVRA 5H68A 2J5XA 4B33A 3D7MA 5E7JA 4CEJB 1XZPA 1NIPA 2J0SA 3IEUA 5AJWA 2PMDA 2YV5A 2C77A 4PQRA 1W0JD 1ZUHA 2FPKA 4K81B 1LB1B 2MMGA 1EFUA 1OB5A 1CJVC 1ZMXA 4S2EA 3A1WA 1WQ1R 1Z2AA 5JI3E 1Z6GA 3REFA 1GILA 4C2UA 1RW4A 2BKUA 3BFVA 2HYDA 3H86A 3PUYA 3ECCA 4BRUA 4FMCF 4B48A 2J9RA 3PUZA 2F55A 4IXNA 2A2ZA 1IXRC 1E2MA 3W3ZB 3LXXA 4EPTA 4JIMA 2ORIA 1XFAA 3A8TA 2H1LA 3OIWA 4QFMA 4BPBA 4MDFA 2YWFA 2ZRDA 5FTKA 3C5HA 3R8FA 3OIVA 1LFDB 3NVAA 3SBEA 1KDPA 2EWVA 5K8IA 3GPLA 5G3ZA 4C7OA 4LHYA 3PUVA 3H0KA 3THWA 1HT1E 2BV3A 1TPZA 1XTIA 2CK3A 4YDHB 5JBQA 2I1VB 3R20A 4EPYA 4LYAA 5DI3A 2O8FB 5DE3A 1JEEA 4LOAA 2XITA 2QRNA 4Z1MA 2ZI5A 2WJYA 4ITRC 2C04A 4K8OA 4RD0A 1PLJA 5G41A 1VYVA 2EVWX 1NRJB 3N5CA 3PEYA 2R6FA 4EFMA 2BJWA 1XU4A 2REBA 4ZCLA 3UIEA 4MH0R 4CEHA 3T1QA 5H8WA 2DFTA 5JHHB 1E0AA 3ETLA 2K5UA 2OV2A 4G3XA 2PBRA 2GDJA 2WIAA 4E03A 3NEJA 2XOKA 1E2DA 2ZITA 3EA0A 1BH2A 1P9RA 1S9DA 2ZJOA 4F91B 2ZI9A 1S1CA 5F98A 4RD1A 3VX3A 1RRCA 2ATVA 4ERNA 1H8EA 3OE7D 2P67A 2C2HA 3TAUA 3TUIC 3AVPA 4C3ZA 4URVR 3KZ1E 4FCTA 2ZETA 2QPTA 4KV9A 1XMVA 5JWHA 2YINC 1PLKA 4GL2A 1SVIA 2NO9A 4PHGA 1ZU4A 3THYA 4LJ9A 3W90A 2FWRA 3CPEA 3CH5A 1OH6A 3EPKA 4G5RA 1N0UA 3DKPA 1WB9A 3ADDA 1VHLA 3AUXA 4KCGA 2QAGA 2FEMA 3LQQA 4EQ6B 4B75A 1II8A 2P0EA 4NYJQ 2QP3A 1Z2CA 1EGAA 4TTQA 1KAOA 1TQ2A 3SFZA 1DOAA 4UJ5A 3B1WA 3HU2A 5TVKA 3RS5A 4WIAA 3K9LA 2CHGA 5IT5A 1KAGA 2I4IA 5K8UA 4B6FA 1UFQA 1W46A 4AYWA 3FPAA 3BB3A 1F48A 1SQ5A 3U3KA 1W0JA 1Q3HA 1G21E 4UQOA 5C1BA 1Z0KA 1E69A 3A1TA 4I81A 1R7RA 1US8B 4YONB 1E9CA 2JGNA 3CO5A 3ZDQA 3DOEA 2Q0HA 4YXWA 4H9GA 3NBFA 3RYTC 1N0VC 1OIXA 1YZLA 3HR8A 5LD2B 3FKSA 1SXJE 721PA 1IXZA 2ZE6A 3FMPB 1TL7C 4OI2A 3JZAA 3MWJA 3A4NA 1E9FA 5KDDA 1QG2A 2WWGA 3TVDA 2VPPA 1IM2A 2W2VA 4BFZA 3VHLB 4P4UA 3U3MA 3LW8A 4KFRA 3A6PC 5FPYA 1E9AA 5JEDA 1RKBA 4RJLA 5FTLA 2O8DB 1KO4A 2JIZD 3SBDA 1FQKA 1G7RA 4C9BA 2C03A 2VLIA 2AD5A 4DSTA 5L8VA 3P26A 4NMMA 2HF8A 2XAUA 2O8BA 4YMVA 1T0HB 4ZO4A 2G1KA 1N6HA 2ZS9A 1GNPA 4MRSA 1DE0A 4Q9KA 3VHXA 2XZLA 4QHYA 2ZYWX 4A0RA 3GLFA 4TTRA 3W5IA 4O25A 4LBVA 3WYGA 2ZSEA 4US0R 1EK0A 2Q21A 4M1YA 3FKQA 4JLOA 2AXNA 1S2MA 1JJ7A 2NPFA 1OXTA 4JSTA 3QPWA 6Q21A 2G3YA 1NNEA 2VHUA 4URYR 1R2QA 2JLRA 4D82A 4JL8A 2GJAA 2CJWA 3A1UA 2D2EA 4LPKA 1VCOA 2WWHA 3B1YA 4BEBA 4ABYA 1HQCA 1G64A 2BMDA 2EW1A 2GXSA 2WM9B 4WBSA 5J4VA 4BLSA 4QBIA 4U02A 2ZRGA 3CWZA 4XD7D 3WXMA 4D0GA 3AF3A 3GLFB 4AKIA 3GEIA 1F60A 4FWIB 2A5YB 2ZR0A 2EQBA 5FUYA 2QMEA 3CZPA 2VP6A 1P3JA 4OHYA 2IT1A 4OJQA 4R7ZA 5KNDA 2ATXA 2IYYA 2OXCA 4NYMQ 5L3QA 1D5CA 1GZSA 1ZNXA 4I4LA 3W9YA 3SR0A 4M0LA 3RAPR 1OB2A 2V8OA 3VU9B 3LH5A 5CDFE 2GZDA 1RE0A 5H70A 4L9WA 3P4XA 1YZUA 2JAQA 1E6CA 1MO5A 2ZR7A 4KVGA 4NYMR 2FEOA 1ZC3A 3ZVMA 1FP7A 4URUR 2D74A 5HCNA 2C9CA 1G17A 3I4LA 1W48A 5DHAA 3RDPA 1AZSC 4UNQA 2WV9A 3FWYA 1RYHA 2L0XA 3N2EA 4ZKDA 1HT2E 5CM9C 2C98A 3GFOA 2YHSA 4X8OA 1ZD1A 2IUTA 3C4JA 3W34A 1TTTA 4FCWA 3FHOA 3PEUA 1E2IA 1I4TD 1OT3A 3CUEF 1M7BA 2HYIC 4XWOA 4OQMA 2FZLA 3WNBA 3ONWA 4JL6A 2W0SA 1IN8A 1XZQA 4C2TA 4KJZA 3KQHA 5D3MB 1HYQA 2QP9X 4MRVA 1KNQA 3A1VA 5BXQC 2WAXA 2IYRA 3PJRA 4CW7A 4EPXA 1EG7A 4PC3A 1F5NA 4A2PA 4BLOA 2VRWA 1G8PA 1X8JA 2WICA 4MYTA 4QXAA 4KODA 4NONA 3X2SA 3Q3JB 1VIAA 1XEXB 5KYKA 2J7KA 4G5SA 2WKPA 1YKSA 5E7IA 4GFDA 2Y8EA 1FMJA 3DO6A 4Q4JA 1N5LA 2JIZA 1SHKA 4HSEA 4XIGS 4L9SA 4MGYR 2I1QA 1COWD 4N0EA 5FI0B 5JCPA 2VH5R 1XD9A 4M2LA 1A7JA 1X8LA 3VTKA 4BFXA 2FMXA 1EWRA 2V3CC 2FE4A 3PIRA 1QDEA 3R9WA 1P2UA 4PTLA 4Q7KA 4QGGA 1G7CA 2Q6TA 1TADA 2UZ3A 4XVRA 1YZKA 4DDTA 3KXLA 5IK2A 4GRAA 1P60A 3B8HA 1ZNZA 1XTSA 3DEFA 4FXPA 1EWQA 3Q9LA 5DIFA 3AVVA 3L43A 4L16A 5C4GB 2GHIA 3KFXA 3U61B 4RZUA 1DADA 5KOYA 1QG4A 2VSFA 5IDVA 4WW0A 1J90A 1ZM2A 4MRPA 4W9MC 1GFIA 2R6GA 2IEZA 1YR6A 2C9OA 1R6BX 1UBFA 4NCHA 2RGDA 1R5BA 5EXPA 3GEEA 3L0OA 3A4MA 4LI0A 2WPDD 3L0IB 2C5LA 4JBWA 4B3FX 4M9ZA 2F1IA 3KTAA 4H1UA 1XCPA 4JLPA 2X2FA 4TL7A 3LBIA 2O5VA 4OHVA 5GVRA 1YRBA 5AR1A 1P2TA 1JR3E 1SGWA 3L8YA 5ELXA 1KK0A 2V54A 1TF5A 2BC9A 2VYFA 2WBLC 1AS2A 2ZU6A 4L15A 2N1BA 3MD0A 4TT3D 3U4QA 3GFPA 5B2ZA 1YVDA 1L2TA 3QF4A 5IRCD 1U8YA 1U99A 5DH9A 4XWKA 5J4LA 3QBTA 3F0TA 1EFCA 2D3WA 2BHRA 3DHWC 1PLLA 4HZIA 4YMWA 1ODFA 5CLQA 1D9XA 1Q1QA 2QGZA 1WBDA 1AIPA 2QRZA 3Q72A 4C0JA 2ZJYA 2G9NA 4BEJA 5KPJA 3HYRA 2H57A 2QENA 4EDHA 2OCYC 4RVCA 5JI2E 1NSTA 4DCNA 1P9NA 1QHGA 3CX7A 4ILEA 1KKMA 2IX3A 1KOFA 4OK3A 4PR0A 1E2KA 3OEHA 1P73A 2WMOB 4GOJA 1JNYA 3CNLA 3DMNA 1HUQA 4Q9HA 4XD7A 1KO1A 4OK6A 3GD7A 5BW8A 1KK1A 2R2AA 5TB5A 2P6UA 1GL7A 3B13B 4LJ6A 4Q1FA 4ASUD 4A8JA 4LPSA 3IPYA 4KVAA 4A8JB 3HYTA 4C0KA 4ZIRB 1KMQA 1Z07A 1XWIA 3DL0A 3VNVA 2BKEA 1P4SA 2BBWA 3AF4A 2CVFA 1KDRA 1NP6A 2CMKA 4M9QA 4Q1CA 5CM8B 3VR5A 1LF0A 4Q4JB 1NN5A 4OQNA 1GG2A 4V0NA 4M1KA 4BLPA 2VHCA 1XTJA 1A5TA 2NO7A 4RKFA 3EWSA 4BFYA 1G8YA 3KX2A 2JLZA 3GLHB 3IQWA 1WRBA 5JRJA 1E9BA 1P6XA 3FFBA 2DB3A 1G6OA 4B3GA 1COWA 3FOZA 5FR1A 2ZUBA 2FV8A 2WJGA 1Z28A 3DDCA 4QC2A 4DSNA 1VDZA 5KU1A 1S0UA 1ZW6A 4ZDKA 2HXYA 2FSFA 3FGNA 3BBPA 2QTFA 4XTCS 3T1TA 1Z3IX 2GZHA 3NG1A 1XXHE 2WKQA 5IK2D 4P31A 3W5JA 2XNDD 3QPVA 5FOSA 3ND8A 1VCNA 5EQTA 2H92A 1QHIA 2YOGA 3BXZA 3DZ8A 4JKIA 4M1TA 2PCLA 3FFAA 3KXKA 4BFUA 3AP1A 1G8HA 2J0QA 4FMDB 3EASA 3NH6A 4PPNA 1NY5A 4MRRA 2IS4A 3B9PA 4AY2A 3G82C 2EWWA 4HLUC 4BZXA 1W36D 1U2RA 2CCGA 4AYXA 2A5FA 4PHTA 1W4RA 4YDSA 2Q9AA 3SJCA 2VF7A 5BQ5A 1ZCBA 4JJKA 2E9SA 3MG9A 2XZPA 4P4SA 4QBFA 2QQ0A 2GF9A 3RRMA 3ZZUA 4O2RA 2CDNA 1FL9A 2J7PA 2DY1A 1N6IA 1IHUA 1MABA 4PPQA 4URZR 3GJ0A 1ELOA 4DCUA 2DWQA 4NU0A 5E95A 1GNRA 4YC7A 2JJ1A 4A2QA 1NVXQ 4PPFA 4Z51A 3O47A 4AG5A 5IHPA 3H2YA 3K70D 2WOOA 4TLAA 1TQ6A 3NHBA 4CGZA 3QPUA 3QXJA 3MGCA 5EXXA 4BFVA 4CEJA 2QUZA 3BC1A 521PA 3UKDA 4JLNA 4IDNA 1VHTA 3BOSA 3AQ4A 3CPHA 1UBGA 5JSZB 3VMFA 4O0MA 3P27A 2ZJZA 2FF7A 1LNZA 3N70A 3LX5A 3VR1A 1G8FA 4TN1A 2OAQ1 3EIHA 1XF9A 1DAEA 2GBLA 5DO9A 4EPRA 1CU1A 1MKYA 3D31A 3IIKA 4QJ4A 1NLZA 2GA8A 2WVJA 4FN5A 4J0QA 2ORVA 3LY5A 2NTYC 3OEHD 3SU8A 4CRWB 1CJTC 1GIAA 1NMXA 1NN1A 1QHSA 2D7CA 2FOLA 2IYSA 2ZREA 2ZSFA 3GQBA 3DPUA 2W83A 1JJVA 3EC2A 2GF0A 1T4GA 1E0KA 1JR3A 4MKHA 1N6RA 1RFLA 4ESHA 4F4IA 3TGPA 2B8WA 2OT3B 3LVRE 3NH9A 1TQDA 3KQKA 2EYQA 4TWZA 1G4UR 3C8UA 3I8SA 4Q1AA 1CIPA 3JZMA 5D3MA 1MR3F 4PZYA 2QA5A 3REGA 4LYJA 1NKTA 3TIFA 3ZD7A 2NO6A 2NO0A 4GI7A 3FVQA 4MGIR 3GLIB 2ZS7A 4A36A 3KL4A 4PAQA 4B43A 4B71A 2DFKB 4BWYA 4FMDF 2DHRA 1XXHA 3WNDA 2O8CA 3Q8XB 4LRWA 3SYLA 4U7DA 1H8HA 1VYTA 4I1OA 2JDIA 2IEYA 2QM8A 2GWHA 2B6HA 5HKKA 1EFRA 1NKSA 2IL1A 1IJEA 2PZEA 3HU3A 1L7VC 4Q1BA 2BWJA 2GKSA 1KZ7B 1XBTA 2QM7A 2RGAA 1FUUA 2NQ2C 4PFSA 2ZUDA 4IOJA 5EZ6B 5HE9A 4DT1A 1YRAA 1Q44A 3SYKA 5CITA 4IHQA 2R8RA 1I2MA 1ZUIA 1T91A 1Z8FA 2ZSDA 4DSUA 2ECKA 2F1RA 2G1JA 1F3OA 4D4LA 4TLDA 1SXJB 1JQJC 1N6LA 3EZ2A 5FTMA 3WRXC 2ERYA 4MYUA 2D7DA 5FL7A 1NY6A 2PJZA 1JPJA 1AA9A 1DPFA 2RGBA 1TUEA 4JLMA 2Z43A 4LYHA 4WXPA 3TJZA 3ZYCA 4TYYA 1LVGA 2XEXA 2H8KA 1YR7A 5P21A 2V7QD 2B8TA 2XB2A 1SVLA 1PV4A 4LV5B 3RRNA 1R0WA 4C0HA 1R8SA 4TSFA 3T35A 1GVNB 4RFVA 2GVZC 3O8BA 4I1SA 4BECA 3AVYA 2YC4C 4XSHA 3AVXA 1M74A 4PQYA 2CHQA 2IS2A 2J0UA 2E1RA 2Z4SA 3B6EA 1UDWA 3MJRA 2ZE5A 3EZFA 1IN5A 2HDNB 4M9XA 2DFLA 1TU4A 2XXAB 3H1TA 5CJ2A 2Z6VA 2NO1A 5CK4A 2BJVA 1Q57A 4LJYA 4UXIA 1U0LA 4PANA 1KMHA 3N2IA 4Q9LA 1XJCA 1PVOA 1CJKC 2O0JA 4PZZA 5C18A 3KJHA 4U00A 1G8GA 1T3SA 4OHWA 1E9EA 1G3IA 1VG0B 1TEVA 3KJIA 1OF1A 2WSSA 3Q5EA 4BFWA 5FOTA 1ZNYA 4QGAA 3GP8A 3RS0A 4AC9A 2XZOA 2WJJA 2IF2A 2FGKA 4LHZA 3K70C 1QHXA 2F9LA 1Q1ZA 4DZZA 3GLGA 1L4UA 4M1MA 1HE1C 4TLCA 4V02A 3TH5A 2FU5C 2VHTA 4GPTA 4LY6A 1AZTA 2PEZA 3HPQA 4BLRA 3MWLA 2G0NA 1G6HA 2R62A 3NBZC 3VFDA 1NI3A 4OI4A 4R9UC 3EXAA 3ZGXA 2VP4A 4JLBA 3ZLJA 4HUTA 3UMFA 3IEVA 3CRW1 5L3SA 4LK2A 1MH1A 1E94E 2JEOA 1QRAA 2GEDA 1F2TB 4EAQA 1CEEA 4V0KA 1II8B 1SKQA 4FMBB 2QAGB 4PHFA 3K09A 4PO8A 4QHTA 4XOIA 3SHFA 4DHEA 3O8CA 3B85A 5LBIA 1NL3A 5BN4A 1NLYA 4O2LA 4US2R 1N6KA 4GZLA 2AFHE 1VTKA 3EC1A 4L8GA 2OBMA 4JVLA 4F92B 3R9IA 5EZ5A 2BMFA 3B78A 1Q20A 1JALA 1CRQA 3A58B 3I32A 1CR1A 2IXGA 2QTVB 2ZM5A 2HT1A 5GVSA 4Z8YA 2V7QA 3RHFA 4IDQA 1XCMA 3K0EA 5J40A 4XWAA 3B1VA 1XEWX 3GEHA 4HAUA 4GZMA 2QT1A 3MWYW 3CF6R 2CBZA 4W5WA 3G5UA 4ZCMA 3BB4A 4RKEA 3CX8A 2FN4A 5AK0A 5G40A 4QRHA 4A92A 3IDQA 3LA6A 3PQCA 4Q48A 2ZYUX 4V03A 3WRYC 5FBWB 4ZIRA 1XCGB 2CEAA 4BASA 5L3SB 2PEYA 4QBHA 2FPMA 3IHWA 4HAYA 1KIMA 2HT6A 4IDOA 4O3MA 2XNSA 1NF3A 3CONA 3PV0A 4OQFA 2P6NA 1RVDA 4V0MA 1E3MA 1W47A 3BFXA 1W36C 4CEHB 4Q7JB 4LJ4A 1BYUA 1M2OB 4DIDA 2ZE7A 3NBXX 1YHNA 2DPXA 4M8NE 1N3BA 1KJWA 4KBGA 4R98A 1G5RA 1ANKA 1I4DD 2P65A 1I4LD 2WJHA 3PXGA 3WBKA 2QPAA 3CR7A 1MRSA 3L8ZA 1W4AA 4TMKA 5AWFC 1NN0A 3QY0A 3BJIC 5A0FA 5JEEA 3W6NA 1P5ZB 2HXSA 2RCNA 4BLTA 1UKYA 5FL7D 4ON9A 3RSOA 1GDDA 2FSGA 1D8TA 3CM0A 1U9IC 5C4MA 2YNMA 3F5FA 4TMVA 3AKDA 1E2NA 4NCIA 2CLDX 1VG9B 1U94A 1FNMA 2B21A 3CX6A 3IIJA 4TLBA 3C16C 3PVSA 4PSAA 4F4CA 1QVAA 4TSFD 1M34E 1OXXK 4OBEA 3C5CA 2Q9CA 3PFIA 4XTRA 3U7HB 3H4MA 2ZRAA 2ZRIA 1RIFA 4LHXA 4B76A 2OHFA 5DN6A 1F6BA 3K09C 3KKPA 2UVQA 3DKVA 2PZFA 2W00A 3QOFA 2V55B 2OUKA 2QL6A 1YR9A 1GL9B 1QBKC 4DIEA 1W4BA 1NVVQ 3W6OA 3U6BA 2XTMA 2XSZD 1Q3TA 1YZTA 3ASZA 4TL9A 2ASEA 1KK3A 3Q5DA 4HLDA 3BH6A 3AM1A 3K0AB 2FFBA 1U81A 3T1VA 2ZRKA 2GXAA 2YOFA 1UPTA 4PZLA 1V43A 2OLKA 1YZQA 3OIUA 4L4UA 3SZRA 1Z0FA 5FUWA 4OK5A 1XPOA 4R2HA 3U2QA 4AIIA 1X1SA 4OJKA 2IUUA 2Z83A 2BBOA 3K9NA 4KYUA 3K0FA 1FZQA 1T5IA 3QQ5A 5SZIA 2P6RA 1CLUA 1DAKA 4KSCA 3H84A 1Y3AA 3LO5A 2GILA 5DGXA 1HURA 4AKGA 1AKYA 3TBKA 2J41A 1S9HA 4FI3C 4DCVA 4DBLC 4QBGB 4IKEA 1L8QA 2JLWA 4CDGA 3C7KA 3QIAA 4V0OA 3WMGA 4BFTA 1R10A 2PX3A 1T6NA 5FTJA 3RC8A 4IVQA 5FOWA 1Q22A 2C99A 5CIQA 1II0A 1XP8A 1BYIA 1VCIA 2ONJA 2W58A 1H65A 3THWB 1HTWA 1IBRA 4RZ3A 1NMZA 1TNDA 4A0HA 2GJ9A 3T34A 3PUWA 4DLXA 2ODWA 4ZPXA 3ADCA 4YMSA 2IK8A 3U4QB 4Q4LA 3CR8A 4KLNA 1DVRA 1SVSA 1J7KA 1S3SA 1XX6A 4HB4A 3BAFA 3CRVA 3W8RA 3M1IA 4IRUB 5KHOC 3NBYC 4JLDA 4HEJA 2JLUA 1VG8A 1UDXA 2F1HA 2VSXA 1JXMA 3SJBA 3C41J 2VQSA 3M4YA 1GL6A 1P2SA 2ZRBA 3KTAB 4KYIB 4GBMA 821PA 1GRRA 2QROA 4TL6A 3MUFA 4P33A 2XXAA 1U90A 3TW8B 1TF7A 1ZD9A 4NCNA 4TMXA 3X1YA 4GP6A 1ZRHA 3NWJA 5J5CA 2WJIA 5J4YA 4KBFA 3JVUA 2ZTSA 2EFHB 3D3QA 4LJ7A 4Q03A 1Z5ZA 1RJ9B 4LBZA 3A37A 4B2PA 4QKQA 2WWYA 3M6AA 4TTPA 2AXPA 3SE0A 1WF3A 1E1QA 2FH5B 4DXAA 1VPLA 3TLXA 4CF7A 2ANBA 2G83A 1RRGA 1MOZA 1KI7A 2I3BA 2QEQA 2HJGA 3LNCA 2ZYTX 2QE7D 4P4TA 4WAUA 4FW9A 4Q4AB 2FX3A 4HZUA 4WZ6A 4CVNA 4M9SA 5ANRB 4GDFA 1D2EA 1ZC4A 4JT2A 2H5EA 2F3RA 2QMOA 4MQBA 3F3YA 3ZS9A 3PENA 3KQNA 1JBKA 4RFSB 2IYWA 3DM5A 4ZDWA 1R0ZA 4AKEA 1G19A 1P62B 3QKRB 1KO8A 3TNFA 2OO7A 3I73A 3EIEA 3ICQB 1QHNA 2TMKA 4MGZR 3GJ4A 4KITB 3GJ6A 5FPSA 1PJRA 1SKYE 2AWOA 2O8CB 2B7CA 4DDUA 1JAIA 2PMKA 3CH4B 4YLGA 1SVWA 2ZRPA 3SOPA 2WIBA 4X8MA 5DYIA 1Z6XA 4TQ9A 2IYQA 3K8YA 3O8DA 4HYYA 3THOA 4D4JA 2QMUA 4F7WA 1DS6A 1L4YA 2AK2A 5EXSA 1E2QA 4EJSB 2HLDD 2A78A 1ZM9A 2YKGA 4LUCA 5EJEA 4D0NA 5KUTA 3IQXA 1OJLA 2BIFA 1UEIA 5EXTA 1NG1A 1E1RA 3B9QA 2GCOA 1OHHD 1D9ZA 4URXR 1FUKA 5TARA 3T06B 2ZSAA 1DAGA 1NLFA 1XRJA 5G3YA 4FIDA 1N6OA 5BYJA 4Q1DA 4A6PA 3GLHA 1U98A 4FINA 5K8LA 1G5PA 2D62A 1P75A 3K9HA 1KI6B 2C78A 3RWOA 3SQWA 4JS0A 5F9FA 1UM8A 4C0BA 1G7TA 1ZIOA 4MRNA 4B3XA 4NPHA 3MLEA 5FUVA 2W6IA 1XD2B 4HLQB 3PITA 3ZZ0A 3UATA 4WOPA 1GUAA 1TU3A 4ACBA 5B58C 1NMYA 1GKUB 3B60A 4LGMA 5AUPB 4I1VA 3WMEA 2REXB 2BEKA 3QVVA 5AJVB 4DJTA 3VKHA 4A82A 2OFOA 4II7A 3LD9A 4BZPA 1A2KC 2IC5A 3CW2A 4B2LA 3VR6A 3FDIA 1KSFX 1UKZA 2NGRA 421PA 5JLJA 3E70C 1W4CA 5AJYA 4IFBA 2VEDA 1G1MA 1AGPA 2OXRA 3WMFA 1MABB 3THYB 2N42A 3QEJA 4DC9A 4HUQA 3QUSA 4DEXA 2A9KA 4K46A 2P2LA 2UZIR 3UPUA 2ZAMA 4QL3A 4WZBE 2JCSA 1AQUA 1Z08A 4TLEA 4URWR 3MFYA 2FA9A 3BERA 1ZCAA 3EA5A 5JS8A 2O0KA 3LV8A 1R4AA 3QG5A 1WXQA 2OCBA 4Z1MD 2QE7A 2BM1A 1T3LA 1WMSA 1GTVA 2CE7A 4CZ2A 8OHMA 4RSGA 3ZIAD 4TMZA 3VKWA 3TRFA 3NKVA 1J8YF 2ZROA 1BIFA 2OESA 1ZJ6A 3AGQA 4TQUS 2GCPA 5JZVA 3GJ8A 3AP2A 3UMRA 2IHBA 5JMTA 2JA1A 3SQXA 1UAAA 4NCJA 3QXXA 5DI9A 4RY2A 621PA 2D2FA 2GTPA 1E9DA 1H8ED 3B5JA 1WDTA 1W1WA 1W0KD 1JQLB 1P9WA 2V6JA 1GWNA 3SHWA 1CKEA 2YWHA 3X1DA 2VP9A 2JLQA 5KDOA 3RS7A 4V0LA 1X6VA 5BN5A 3LVQE 2P5TB 3UMSA 4Z8XA 3U6KA 2OSBA 2JLVA 1W44A 2SHKA 4M21A 5FOXA 4QM7A 2RMKA 1K6MA 4Q5IA 3W3AA 1SZPA 1ZM4A 3B2EA 5FBVB 3R9XA 3AKYA 2VP2A 1JPNA 1E0SA 2W0MA 1E1RD 1GAJA 1OHHA 4JSYA 2GK6A 2ZRCA 5E4FA 3SN6A 4DDWA 3P4YA 4PC7A 2ZAOA 1SVKA 2IXFA 2KBEA 1N25A 2QBYA 4A0GA 2KJQA 3NC0C 4OKSA 5TMPA 4D26A 1MRNA 2JJ8A 1XPUA 1UKVY 3KJGA 3GLGE 2N46A 4G0NA 1G41A 1J2JA 3GJ3A 1YJ5A 2LCFA 3AVQA 3MWKA 4MKIA 2REOA 1T0JB 2Q3FA 3WP0A 4DKXA 4YMUA 1E2JA 1A82A 1HV8A 3MAAC 4Q4HA 3OE7A 1OE0A 2OM2A 3AF2A 1EX6A 1F2TA 3LFUA 2QT0A 1E2FA 2H16A 3LLUA 4NHOA 3ZQ6A 2GK7A 4F4JA 1YU9A 2J0VA 3DMDA 2R9VA 4DLYA 4NYJR 1XMSA 2NOAA 2OG2A 2NPIA 3V9PA 3VR4A 3IUYA 4D81A 5EE0A 2P5SA 2J46A 1Z47A 5FPTA 3U3JA 2MMCA 1EESA 2QSYA 3IHLA 2IYUA 3AH8A 4Q66C 3I62A 3S1AA 1YR8A 3B1ZA 3LW7A 4AG6A 1Z6TA 4U5XA 3THXB 4A1FA 3NC1C 3HU1A 1PZNA 2VP5A 5HR5A 2RKOA 1KSJA 2CL6X 2GCOB 3ZJYA 2XNDA 4NE2A 2O8EB 1TQ4A 2BMEA 4D25A 1SULA 2OILA 2KWIA 3P1JA 4GMXA 5J4KA 4UNPA 2QU8A 3KUDA 4LHVA 4WZAE 4E07A 1AS3A 3FMOB 3L2OB 5TDHA 2PLFA 2W6ID 2AKAB 4PC1A 3OFND 2A5DA 5FI1B 4JKYA 4TL8A 1B0UA 1V5WA 1KMHB 5K8TA 1CXZA 4BE7B 2JJ2A 3I5YA 1D6JA 1N5JA 4KXFB 1J8MF 1YQTA 5EE1A 3VKGA 4D4MA 5KSYA 1G3QA 1A4RA 1WCV1 2WAYA 1Z0JA 1DBSA 1R8QA 3QBVA 3RNLA 3DVLA 1WA5A 1SVMA 5JHGB 2D4HA 3OIYA 5CYPA 2F9MA 2LWIA 2ODNA 2VA8A 1HQYE 121PA 1S1MA 1G3MA 1QVRA 4BLQA 3QSYA 3U44A 2PX0A 2YC2C 4MA4A 4D6PA 3AGPA 4RZXA 3WBJA 4OYHA 2R44A 5JRZA 1FTNA 4IXMA 1AK2A 4TYNA 1E9RA 3TQFA 3RSLA 3CZQA 4GOXA 2XTNA 2WJVA 3IO5A 1BOFA 4HDQB 2AN9A 5JSZA 4RCZA 1LS1A 2ORWA 2Z5FA 2ZJBA 2O8BB 1NG9A 2RGXA 1GKIA 4DLUA 4DUGD 1FPMA 1UBCA 1W36B 3TUZC 1Z83A 5JWOA 3EZ6A 1K8RA 1OV4A 4IDPA 4TZ6A 4Q7MB 1U0JA 3ZIAA 4NDZA 1RJ9A 1GRNA 1I2DA 5JJIA 1EFTA 5LB2A 1FOEB 5EP4A 1ZD8A 1G7SA 3AVUA 4G1UC 2KI5A 1OIVA 2WSMA 2YWEA 2ANCA 4V0ME 4WXRA 1EX7A 4PQFA 1IAQA 2ZJ2A 2ZRNA 4DLRA 3GCGA 4GSYA 3WP1B 2KE5A 2RHMA 1IN7A 3AF0A 4PHHA 1G3RA 2Q3HA 2YWGA 3BWDD 5FPHA 4JJZA 4L5BA 3TMKA 3EWAA 4B3CA 4DT1B 2WWXA 3QG1A 1RRPA 2HEIA 3K9GA 1VG1A 3PR1A 3GLIE 1K5DA 2EFDB 3QJYA 5A4JA 4OHXA 4P3YA 2F7SA 5BN3A 2ZVQX 5DISB 5SZJA 2FG5A 5CIWA 1NJGA 2R6CA 1M6NA 1HH4A 3W6PA 4RD3A 4BUJA 3D6TB 5HKKD 2PJRA 3NHAA 4HATA 5KDLA 4ZI3A 2QQEA 1AQYA 1MO6A 2OBNA 3QKSA 2VL7A 2NG1A 2FSIA 1OH5A 2XJ9A 1SHZA 3OZXA 4KO8A 2F1JA 4ARZB 3GLFE 2XTZA 4N0DA 3V4RA 2BEJA 1OFTA 4B3DA 3I61A 3R8CA 1PUJA 1XNJA 2C96A 4JVSB 3K0FB 1ZIPA 3ICEA 5AJXA 2JJ2D 2PH1A 3QXCA 4WVFA 4PPGA 3X1XA 5C46F 3LQRA 3U3RA 1KI9A 3Q7QA 1ZNWA 2J0UB 3KB1A 4OQXA 3SNHA 2DFNA 1FW6A 4P32A 1VYUA 4PSKA 3QXHA 1RYFA 1AN0A 3A36A 2BCJQ 3Q85A 5EP2A 3QKTA 1Z0AA 4MUAA 4I1UA 2O8DA 2FGJA 2XGJA 3CWQA 2IS1A 4NKRA 1CBUA 3U7FB 2P3SA 2RGNC 3CB4A 1VKJA 5J4HA 3CPJB 2KB0A 5HE8A 1AKEA 4EPVA 5F3WB 2PT5A 1CR0A 3AKCA 4I99A 4B44A 5FFMA 3ADKA 3VQTA 3LAWA 2VHJA 3EZ7A 3BS4A 4OI1A 4GT1A 4YQFA 1E2GA 1E99A 1RZ3A 3W8NA 2ZE8A 1ESMA 2A30A 2FPLA 3WY9A 1D2MA 2YZ2A 5JS7A 3IKJA 3TAHA 2J59A 4JBXA 3TSWA 5G53C 5AJZA 2ZRLA 4UXJA 4Y0VA 3VX4A 5KNBA 4Q47A 1Z63A 2O52A 2X1VA 2QAGC 3L0SA 1XMIA 2AR7A 4RD2A 3OFNA 1S4QA 4H1VA 2X19A 2QP4A 1LTQA 3MMPA 2XOKD 1XPRA 5FOVA 1XTKA 1FX0B 1M8PA 2WPDA 3D8BA 4PAOA 1XXHB 4LWZA 3E5HA 5D3QA 1GRQA 4XVUA 1A2BA 1HEIA 4CEIA 1Q0UA 2OFXA 2PT7A 2DWPA 3AF1A 3GLIA 1P61B 4PC2A 3WYFA 5LDDC 3UG7A 2AK3A 2VTKA 4W7SA 2A3RA 1UKEA 5JWRA 4M1WA 1KO7A 1TUIA 2E87A 3KDSE 3IILA 2IA5A 2RGCA 5GJBA 3SYNA 221PA 2QBYB 2GNOA 4B35A 4NYIQ 2CLSA 1G18A 2IYTA 2UKDA 4HB0A 1Z06A 5KNCA 1M7GA 3QXSA 4EIWA 2CLCX 1AM4D 4EFNA 4Q02A 4Q7LA 1ONBA 3DOFA 3M0EA 4DUGA 3KKQA 3E2IA 4HI0E 1XD8A 1ZM3A 1OW3B 4GMDA 4HB3A 4B73A 4A2WA 4MKFA 4FD2A 1JAHA 1NIJA 3EZ9A 4FWTA 1E2LA 1T8TA 4JLKA 4B74A 1OIWA 4NBSA 4DB4A 1JEDA 3IO3A 4B6EA 4IOKA 4A8JC 3QKSB 1NVWQ 2VSOA 3TSZA 1E2PA 3PG5A 4C0QC 1E2HA 3T12A 2XB4A 3T5DA 4YXWD 2ZJAA 4NTZA 2CL7X 1FNNA 2X2EA 4LBYA 2RGGA 3NIBA 2F6RA 2GVDC 1G4AE 2F43B 2EFEB 1IONA 4Q18A 4EJSA 1N0WA 1X86B 1LV7A 4PO9A 3VNUA 1NVUQ 3QF4B 4DCSA 3RVBA 3KQUA 2ZPTX 1G3UA 5LPNA 1FMLA 2QY9A 2ZUCA 4IDHA 1G291 3HJNA 4MDEA 1RRFA 4HAVA 3B7GA 1R5OA 4UJ3A 3EW9A 1N6NA 3AP3A 4E22A 5DSZA 4B3BA 2DR3A 2YYZA 1II9A 1FP6A 1E79A 3KB2A 4PAMA 3L0PA 5DYGA 4MYCA 4ZDIA 1RPZA 2FFHA 5HZHA 2VP0A 4A4DA 4Z54A 2NMVA 2AHOA 3IIMA 4M1SA 1NN3A 1U8AA 3AEZA 1KGDA 2GETA 1E2EA 1E98A 4PSVA 4TMWA 4CT4B 1OH7A 3QNUA 2IS6A 4CYMA 2FNAA 2B7BA 3LRPA 3SJAA 2OLJA 4KSBA 5GJVC 3RRYA 3EPLA 4C4PA 4P0TA 2QTHA 3VR3A 3MRSA 1U9IA 1JI0A 4NCKA 5LD2C 1OFHA 1TF2A 4Q4AA 2F43A 2W6JA 5B57C 3SC3A 1IOZA 3L82B 3ZQJA 3IBGA 1E4VA 1JR3D 3FYHA 1KO5A 4MYHA 4QGFA 4F38A 1PUIA 2CXXA 1OXVA 4YMTA 4EFLA 2Z0MA 1IY0A 5F9HA 1S8FA 4ZCIA 4E5UA 2OZEA 1LW7A 3BK7A 1DAFA 3BB1A 3NDBB 3R7WB 3RS2A 2JJ1D 3GJ7A 3CNOA 4ARZA 3KKOA 2QZ4A 4KHZA 1ETUA 3SFVA 3V00A 3WHKA 4A9AA 2ZRJA 3CF2A 2EFCB 4POAA 1N5IA 4Q00A 1QHHA 3BIFA 2GXUA 3RS3A 2CL0X 2ZU0C 4LJAA 4W5HA 3QENA 1N5KA 1H8HD 4UNSA 2IYLD 2OE2A 1E0JA 2VBCA 3AVOA 2QI9C 4MKGA 2GJ8A 1FQJA 2ZJ5A 5FOUA 3RLFA 1J70A 4RD4A 3X1ZA 3RANA 2V9PA 2WMNB 1T5LA 5SZKB 3BFKA 1TAGA 2ODEA 4S35A 3OEEA 4NL4H 3MSXA 4A6XA 4KFTA 3ZVLA 3EX7C 5EE5B 1ZINA 1JECA 2FJUA 4ZDJA 4JYBA 2XJ4A 2LKDA 4HAZA 5DNYB 3ND9A 1WBBA 1T8UA 4TYWA 1FX0A 4BRWA 3THXA 1SXJC 2HV8A 2YVUA 2MSEB 3GMTA 4WA7A 5EP1A 5FUXA 3RC3A 4KFUA 3NXSA 2RHDA 2NZ8A 3I3SR 4DVGA 2ONKA 5TV2A 1JR6A 2IUSA 2CCJA 3SJZA 5KSZA 1HY3A 4M1OA 3RRZA 4NYIR 3TR5A 1TEXA 4QJ3A 5EP3A 3EARA 3FMFA 3VU9A 1W7AA 2V4ZA 1FFHA 1KI4A 5FPKA 1QZXA 1HA3A 2IF0A 3I8XA 4X8HA 3HDTA 3ZVRA 2KSQA 5CLLA 3CIOA 2VF8A 1FTSA 2AFIE 2BOVA 3UG6A 3GLGB 1KZGB 5IF9A 3QE0A 3KXIA 3PCRB 3QEOA 5KSPA 4PC6A 2QG6A 4EQ6A 3SEAA 3ZD6A 4DB2A 3CRMA 5M04A 3I5XA 3K0AA 2WWWA 1W5TA 5BYKA 1D2NA 4BQSA 1OXSC 5AUNB 4IFEA 3HWSA 1SKYB 3OHMA 4OQLA 3JVVA 1VCMA 3AVTA 1YE8A 2ZRHA 4NP6A 4Q21A 1X3SA 4D0LB 3TSOA 4NZYA 2OEPA 2ZJ8A 4DLSA 1T3HA 1KI2A 1E32A 3CRRA 2W6JD 4ESVA 1W2GA 2PCJA 3AB3A 1NSFA 1S96A 3CRQA 1BO6A 1XJ0A 1E96A 4AD8A 2PL3A 4DLVA 1JB1A 4OHZA 4ZKEA 5DHFA 4TZ0A 2ZVPX 1P2VA 4JL5A 3K70B 5HPYB 4B2IA 1DEKA 2ZEJA 3LWNA 4TMTA 2WZQA 5FH9A 2DBYA 3KQLA 2HJVA 1XEXA 3BH0A 2H7VA 1BS1A 4TT3A 2IWRA 1KY3A 1DG1G 1JXOA 2GEVA 5CDFA 3IPXA 4KU4A 5KTYA 1R0XA 1KYIA 3BE4A 4FCVA 3CLVA 3K0CC 5FL3A 4TQAA 1KSHA 2F3TA 1E79D 4LJ5A 4XH9B 2FFQA 1N2CE 1A1VA 4B34A 1XEFA 3ASYA 4LJ8A 1MO3A 3LXRA 3EPHA 3S1AB 1XDBA 5FTNA 2HF9A 1DAIA 4NH0A 4Q19A 1GNQA 1GKYA 4XJXA 1US8A 2D06A 1OFIA 4PXAA 3KKNA 3VAAA 5E3HA 4FMCB 1T9HA 3OEED 2O8EA 1DO0A 1KJZA 4DEYA 3GLHE 1ZUNB 4C0AC 5SZHB 3O8RA 1MO4A 1QHYA 4QJ5A 2QPOA 4P4SB 1C4OA 2ZIAA 2R6AA 4DRZA 4D80A 1OLOA 1G5TA 2A5GA 2LKCA 5L3VA 5TY0A 4BGDA 1Y63A 3OAAA 3FMIA 4Q4HB 2YJTD 1TX4B 2GAAA 4ASUA 5AUQA 3KKMA 4B47A 4A0FA 3LLMA 3T15A 5KPDA 1KK2A 2NZJA 4QG7A 2RH5A 1AJEA 2HLDA 3FB4A 2VO1A 4AURA 3G0HA 3LBNA 1ZYUA 1TMKA 2FFAA 3DM9B 2G0TA 4JMPA 4JLJA 2QGNA 3ZH9B 2QSZA 1KY2A 1UBEA 1DO2A 4DCTA 1KI8A 1OXUA 3BRWD 5B30A 1E9SA 1CF4A 4AKHA 2ZSBA 3K53A 2W2XA 4RCYA 1OPXA 1Z6AA 4PX9A 2V1XA 1ESNA 3MCAA 1IQPA 1OSNA 4IEIA 4QOSA 1QHHB 1N6PA 1KHTA 1YZGA 2AL7A 1Q1EA 3EG5A 1OYWA 4IJMA 2AKYA 4BFSA 2J3EA 2W2TA 2CNWD 2XX3A 3EAQA 4Q1EA 1IN4A 3U7GA 3U44B 1XD2A 2YOHA 3U3OA 4G5OA 1R5NA 3R7WA 4KAXA 4DDVA 3TK1A 1P72A 5JCZA 2HUPA 1VIYA 2WWFA 2JLXA 2EFGA 2O0HA 3AVWA 1YZNA 2QNRA 3E1SA 2QN6A 1KSGA 3SI7A 2JASA 4IW3B 4JT4A 4UKDA 1HE8B 1U8ZA 5F2EA 1XMJA 5H1YA 5B64A 2BMJA 1UEJA 2OCAA 2ZYVX 1Q21A 1M7HA 3I1FA 1OKKD 3SS8A 2R65A 2ZANA 2BM0A 3K0CA 5GADl 5EE9A 3Q7PA 1B23P 1NJFA 2WOJA 4KI0A 3AV0B 3T61A 4D2IA 2CHVA 4N1AA 2J7PD 2ZR9A 4DLZA 3GFTA 1Q1BA 3NTUA 2CCKA 4LDJA 3MJHA 3TQCA 1P7CA 1XB2A 3CNNA 3DZDA 1KKLA 2JLYA 4OI0A 3RWMB 1GM5A 1DG3A 4UXHA 4MGKR 5JJKA 3KUCA 5E7MA 4N3NA 3WHLA 2X77A 4KLZA 2A7QA 1O87A 2IYVA 1ZVQA 1R0YA 1OH8A 5LB4A 4OL0A 3SDZA 4US1R 2G77B 2FZ4A 5UKDA 4HDCA 4E09A 2WKRA 2RAPA 4MUBA 3QKUA 4Q9IA 1IJFA 4AK9A 3GJXC 4AWXA 1ZBDA 2CE2X 1AS0A 5JECA 4CT5A 2BVNA 4JZKA 2ZI4A 4TYPA 3UK6A 3OF5A 1LF5A 2VHQA 4HLUA 1J99A 3IGFA 3TE6A 2RGEA 1W0KA 1ZM7A 2IBMA 1XJQA 2OAP1 4LX0A 2Q9BA 3U60B 5FBRB 4QM6A 4IVPA 1BMFD 5GJCA 1XTQA 3BORA 2BDTA 4HUQB 3OAAD 4XVQA 3P32A 2AD1A 1CP2A 3PUXA 1DARA 2R6DA 3UWKA 3K0SA 5AUOB 3CF0A 2OBLA 1NBMA 1O3YA 1KDTA 2C95A 3TVTA 4LCBA 4QGHA 1IXSB 4M4SA 3CBQA 4JYCA 2V1UA 2GZAA 1G20E 2GXQA 1KI6A 1KJYA 2ZI3A 1MV5A 5DN6D 1UJ2A 2GEUA 1OYYA 4C0LA 4W5JA 2DYKA 3VR2A 2HCJB 2IW3A 2WWIA 1SXJA 1GOTA 2GESA 4HDOB 2IWHA 2JDID 4QNMA 4RZ2A 1Z6YA 3OESA 5JFGA 1EFRD 4MITA 1XTRA 2XSZA 5EUQB 2H18A 3HPRA 1KTVA 4UNNA 3TKLA 4LSGA 4ZV4A 1SVOA 2GAOA 2WHXA 2ZRMA 3A1SA 1G9XA 3BGWA 1CJUC 1LS6A 5TXGA 2G88A 2BBTA 1QF9A 3KJEA 4IOLA 4CEIB 5DI3B 3UANA 4LZZA 2O8FA 2B92A 2ERXA 2IYXA 1W49A 3K1JA 3LBHA 4R71A 2AX4A 4DLWA 1DELA 1EXMA 1OKKA 5CB8A 1IN6A 1Q12A 3HP1A 1KI3A 4JVMA 2MSDB 1VMAA 4C7OB 5DLQC 2V6IA 2PZGA 2X8AA 3PEVA 4G5QA 3C14C 3QKRA 3TR0A 1W2HA 2PLRA 2OCPA 1CTQA 4IEEA 1KNXA 2IHYA 3CKLA 4RFSA 1X8KA 2IYZA 3ADBA 3U5ZB 2A5JA 1CRPA 5C2JB 1BKDR 1DAHA 3FTQA 1E1QD 1ZP6A 2HCBA 5EUMA 4X8LA 4LC1A 1IY1A 4HZUB 4G5GA 3F8TA 4QNRA 2ZRFA 2RB4A 3B1XA 1CJMA 3C15C 2J1LA 3P20A 2J87A 1G16A 5KSOA 4BZQA 5JJLA 1K5GA 3B82A 1UF9A 2QORA 1C1YA 4B32A 4HAWA 3U7EB 4DWJA 4EPWA 2GJSA 1DAMA 5CYOA 4Q9JA 1UADA 4AYTA 5FBQB 1RC8A 4QHSA 1Z0IA 2GBLC 4M53A 3T1OA 2CNWA 2IXEA 4KFSA 1M1YE 2OFWA 4JBYA 4D4KA 4LC0A 4DSOA 4TYQA 5J47A 2C9YA 1VECA 2EYUA 4A15A 4RD6A 4G01B 1OFUX 5L3QB 2WSSD 3FHTA 2AWNA 2ZI7A 1W5SA 3WNCA 5HZKA 3RS4A 3BH7A 2JLSA 5HCIA 3NEYA 2ZQ5A 1Z0DA 3T5GA 3NDPA 2MSCB 4JLAA 3UWOA 3FE2A 3X1WA 1Z22A 3ZS8A 5GJWC 1F2UA 2WTUA 4GOKA 2EU8A 1WE2A 4R2IA 1WP9A 1AGRA 1U0HC 1CR2A 1ZAKA 4LYFA 3UXMA 1E4YA 3BD9A 3J81k 1CULC 4IOMA 4LV6A 2CJWB 3PEWA 2ZI6A 3I92A 1NBMD 3GJ5A 4CIDA 5A5GA 4Y0AA 3EPJA 1S3GA 2CK3D 4DLTA 4LBWA 5FBLB 4EJSC 1X1RA 3LDAA 5BWMA 2GJKA 2NIPA 3QI2A 4F93B 1NBME 2CVHA 1KI1A 1CS4C 2G6BA 1XEWY 3WYAA 3A4LA 4EKDA 1SXJD 2JATA 3LX8A 1CR4A 2C8VA 5KO2A 3QF7A 3AUYA 1MT0A 2FSHA 2GCNA 4HAXA 3TUJC 5CB6A 3ZVNA 1GITA 4LHWA 3RABA 1LY1A 2KBFA 3QVUA 4C0SA 2H17A 2BCGY 3IBYA 5FR2A 2J45A 2DWOA 3EIQA 3FHCB 5HTKA 4LV8B 5EE3A 3FKSD 1NVVR 4AI6A 4JLVA 4M22A 2ZXUA 2GRJA 3V4FA 4HB2A 4C30A 3TW4A 1BMFA 2DCUA 5L3RA 2QMHA 4UNRA 2ODBA 4HLCA 4GP7A 3I72A 2VIIA 5CK5A 3KFVA 4XSGA 2BBSA 3ZZTA 2Q3MA 3HR7A 4Q01A
chains in the Genus database with same CATH superfamily
2HF2A 3NEPX 1EX1A 4XB6B 3HSYA 2JH3A 2QAJA 3DBHA 4LRSB 4EW1A 3HXOA 2RHHA 4BCBA 1AMNA 1ZU5A 1NRIA 2G4VA 4FT4A 5BV2P 3UMMA 1EVEA 3H4VA 1F2UB 1JILA 3BWVA 4R31A 2QT9A 4BAZA 3TIVA 4F84A 4OJTA 3E48A 4UU8A 2Z4TA 1NOKA 2D2IA 5AW8A 4FNMA 4KK4A 2NZ2A 1YL5A 4PZ0A 1QKIA 5CJPA 4YRJA 3UFXB 1IY2A 1UBTS 4IVRA 4QVKA 3JQ7A 4RNCA 2J5XA 3V33A 3ZXSA 3OO1A 1HEUA 1ODKA 3IEUA 1N1GA 4BKOA 3BHJA 3IH5A 3RREA 4D3SA 3WV4A 1ZQ9A 1PJLA 4GKVA 4K81B 4M0UA 2MMGA 5NLLA 1G2QA 4JBNA 4YP0A 3ZDAA 1IVSA 3Q2OA 1CJVC 5JI3E 1Z2AA 2RBEA 3REFA 1GILA 3VOSA 2HWUA 4EG5A 3JARA 1EGHA 4CKWB 3BFVA 1R0SA 3GEBA 4OGKA 3RJMA 1JLSA 4BRUA 4D4IA 1RBYA 2PYZA 4Y3UA 3PR3A 2E7ZA 2Q29A 3QEAZ 2PLWA 5K3OA 4HNVA 2ORIA 3ND7A 3A8TA 4DIMA 4G1BA 1OZ0A 1OX4A 1AK1A 4ZAYA 4JI1B 2JJQA 1PCXA 2VDMB 2WIGA 3DZJA 3MRVA 3ZCSA 2YWFA 1NLUA 5FWXA 4UHKA 5DM1A 5G0WA 3OQ1A 1IWBB 3BFPA 3OIVA 3SBEA 2ONCA 5CLHA 1WHSB 1HOXA 3ORHA 3OVMA 2P78A 2FWMX 4QOIA 1UFRA 3KOMA 4OHCA 2JCVA 3FDXA 4O2BB 1U0NA 1AKMA 3JQ6A 5JBQA 3NHKA 3E23A 2A1TR 4PSCA 5DOZA 4LYAA 3RCBA 1P0PA 1OWNA 1RQ7A 4A0QA 5DI3A 3UJBA 4EMSA 5DE3A 1TEHA 5IX8A 2QRNA 5EYPB 4XUGB 3SG0A 5A4DA 1M0SA 3DZBA 4RD0A 1PLJA 4TVBA 2ZG6A 5BO5A 1ESCA 1TM7E 1VYVA 1JMYA 2EVWX 3IE0A 3N5CA 3D1JA 3W5CA 4EFMA 2G76A 1XU4A 4JB8A 4ZCLA 3IVMA 5FA8A 4CEHA 3T1QA 1KH2A 1XTZA 4I6EA 5JHHB 2ZYIA 5H8WA 1DGQA 1E0AA 2K5UA 1YRWA 2ADMA 3RSCA 2OV2A 4FILA 3I2GA 4IQ8A 3TAXA 3WTCA 3UC5A 3NEJA 1IEWA 2R00A 1E2DA 4KQXA 2W98A 4E03A 2XUHA 5ADHA 4ZC1A 4F91B 3STWA 1M34A 2JAPA 3MJEA 3A28A 4WLEA 1X0VA 4DXDA 5AOCA 1AZWA 1C2TA 2WPNA 3GW8A 1QOZA 5JMOA 3GEDA 2IH5A 5F5NA 3OTGA 1IIBA 4DPMA 3H9GA 2GJ4A 1EE2A 2C2HA 2O4CA 1NZDA 2I71A 2ORYA 4C3ZA 3R5XA 1QQAA 3ZGYA 1CS0B 3IAXA 1DWPA 4L8WB 1EH5A 3KSRA 1C2YA 1XMVA 5JWHA 5JJBA 1YNSA 2QRQA 1SVIA 1Z4NA 3HZHA 1VJ0A 1Z9BA 3CLKA 3LO8A 4OLHA 2NU8A 1FJXA 1CUUA 4IYJA 1SK8A 2YDXA 2FWRA 3CPEA 3H97A 4HNQA 1TVCA 3S8YA 1FDWA 2XVZA 4TMYA 2NWQA 4LNUB 2VPQA 1N2BA 4RL4A 1DCMA 3AUXA 1ABFA 2DE0X 2QAGA 4XVHA 1II8A 5CJJA 2V3VA 1ADGA 3MQ2A 3WJ1A 5JDIC 1KAOA 2VPWA 3GO4A 3FPGA 4F60A 2FW7A 2ZB7A 3SFZA 5FPQA 1DOAA 1B8UA 1SUAA 1TMOA 3B1WA 5TVKA 2FK7A 3TXYA 2UZ4A 4WIAA 3I05A 2Q49A 1I8TA 3K9LA 2TS1A 2JAWA 3O9MA 4ZEXA 1VSQA 4KQ1A 5K8UA 1W46A 1LLCA 2H2FA 5TGTA 3FPAA 3PYLA 4D9BA 1SQ5A 2CBGA 5HK8A 3G89A 3U3KA 5BV7A 2BYTA 4AJPA 5C1BA 1GA1A 1RHKA 3A1TA 3IC5A 3X1KA 1GZ5A 2XKAA 4P92A 1SRRA 3QHAA 3IQHX 2XCLA 1ZD4A 3DOEA 4NS4A 2CNOA 4LHEA 4YXWA 2YXDA 2OAEA 4H9GA 5IUJC 3RYTC 1P1BA 1SJ9A 2XNJA 2YFYA 4FFPA 4UUPA 2PYIA 1OIXA 1SIWA 5LD2B 4TTSA 1SXJE 3D6HA 1R12A 1BXRB 4YV2A 1T1JA 3AI1A 1MB0A 1TL7C 3MJCA 1JF8A 4OI2A 1RYMA 3A4NA 2YHIA 4KMOA 5JNLA 3BT7A 1AUXA 1QG2A 2WWGA 3A3KA 3H1GA 4ZC8A 4WD3A 5AM1A 3LUFA 3VHLB 4LVNA 2OYRA 3U3MA 3UOGA 3F74A 4IMJB 2BT4A 3GMIA 4PG5A 1DKOA 4KFRA 2HHHB 4LRTB 5T8KA 3DLBA 3LT4A 4IJVA 5FTLA 3FYTA 1CUZA 1KO4A 3SBDA 2YV2A 5K51A 2N3ZA 2PKCA 4W6ZA 3R9KA 5JBNA 5GOTA 3H1BA 3IALA 3A2KA 4C9BA 1QGYA 3UPTA 4ENRA 3RYCB 2AD5A 4QXMA 1C5KA 1C7FA 3I28A 3OCXA 1UFVA 2HF8A 1L5YA 1INLA 3EPRA 3PGA1 4HX5A 4ZO4A 2I80A 1J2UA 5EGSA 2PUEA 1VHQA 3FNEA 3M34A 4OFZA 2LR0A 3WYGA 1V4NA 4M1YA 3OA2A 5BVHB 2ILVA 4WBNB 2HK8A 3LUKA 5K99A 5I51A 1QFYA 3AG5A 4LGCA 2D7JA 4JSTA 6Q21A 4HH1A 4D9CA 2G3YA 3AR5A 4D9HA 2RD2A 3PQ7A 4KPYA 2R79A 1TQHA 2QTGA 3K35A 4KL8S 2GJAA 1JHOA 5IN5A 3RGWS 2I91A 3LFTA 3L9WA 1VCOA 3B1YA 4BGIA 3R7FA 4DIKA 2BMDA 1CB7A 1EVJA 3AFGA 4KTVE 4XUDA 2ZB2A 6AT1A 4EK9A 4WKPA 1V48A 2CFTA 2XMCA 1Z35A 1QYWA 5JXWA 2FLVA 3A27A 1AY0A 2A5YB 2ZULA 3S2YA 2EQBA 3JQ7B 2V6BA 4FFDA 2D0PB 4RENA 3M4NA 1NI4A 2PZBA 4M76B 4QYIB 4RGYA 3ZK8A 4OHYA 2XB9A 4DB2A 3R3HA 2OXCA 5LJLA 5JD6A 1IMJA 1D5CA 3IAUA 2AFIB 2PKQO 2ZT6A 1Z16A 1X19A 4WN9B 1UUFA 3ANMA 5EEHA 2WU4A 2W2OA 4M0LA 2V8OA 1V16A 3RAPR 4CIWA 4B3RB 2NUAA 4ZVQA 2GZDA 2JH8A 5CDFE 5H70A 4R1LA 4OUDA 2MU1A 5LP1A 3HN6A 3VZBA 2AF4C 5AJUA 4ARIA 2JAQA 3PHBE 1E6CA 3A0RB 7REQA 4LQDA 2C4WA 1NHWA 5A06A 2D74A 3WRYA 3O8QB 4PZCA 4NE9A 4EY7A 2B1IA 4NBLA 4XFKA 4ZWNA 1Y33E 1UCFA 3D6MA 3A1CA 3U4DA 1SCQA 4AXXA 3HFGA 4D8VA 3IAS6 4UNQA 3EGVA 2WA2A 2A9FA 1GPKA 3P9ZA 1V11A 2L0XA 4NICA 3N2EA 5ULLA 1T26A 1U3DA 1HT2E 1HBJA 3PNKA 2C98A 4M8KA 4X8OA 1ZD1A 3U7QA 3W34A 4CLOA 1S2DA 2HA4A 3FHOA 1I4TD 3PEUA 5FWAA 5HGJA 3CUEF 4HG2A 2HYIC 3FAKA 3IODA 3ONWA 4JL6A 1ZRSA 1XZQA 2YUIA 5D3MB 2OBBA 2VAMA 4MS4B 4AJ2A 1PDOA 1E3SA 3GB9A 1M72A 3A1VA 1DQNA 4EGJA 3KZNA 4F1KA 1XLTA 2IYRA 1HFEL 3PJRA 2BEVA 2PSSA 3CC8A 2L42A 4HQRA 4PE5B 4DA0A 3ELWA 1B6GA 1R27A 1LI4A 2VJMB 4XIFA 3NTVA 3WIVA 3CG4A 2H9AA 4GEGA 1WSAA 2JHFA 1X8JA 2ZSJA 4MYTA 1SEVA 3KJQA 1VIAA 2CWDA 3Q3JB 4BE9A 4BCCA 4QXPA 4EF5A 3I9LA 1DIGA 1UC5B 2QR2A 1MAVA 4U9IS 4E3WA 4GFDA 4ZK2A 3WLOA 1FMJA 1X13A 2AN3A 1ZL0A 3KZMA 5HEKA 3DC2A 5KQSA 4Q4JA 1DUSA 5LP6F 1B26A 3I34X 1I13A 4L9SA 4MGYR 3ROKA 5DRYA 4EW2A 1YI8A 1A7JA 1D1TA 2E82A 1JLHA 4BFXA 4DLBA 2V3CC 4Q24A 4BV2A 1X7XA 2ON6A 3AYXB 4KDRA 2PUBA 4QGGA 2BTEA 3DJYA 2UZ3A 3MHPA 1Q11A 3RUHA 2VWQA 1NXQA 4Q4CA 2AZXA 4XVRA 5IUNC 4RKQA 3KXLA 2GN0A 4JHLA 4BNUA 4LI3X 4FFNA 1CDEA 4F96A 4J03A 3A32A 1ZNZA 1IC6A 3PL1A 4JHXA 4Y9UA 2W2LD 1BKSB 3AVVA 3DXZA 2A7XA 5EIFA 2B82A 4Z9BA 2BUAA 2GHIA 5JC8A 3S68A 4RZUA 1DADA 1QG4A 2VSFA 5EHXA 1D2AA 3EUFA 3NU1A 4YO7A 4RTRA 4W9MC 4WX2B 4CFZA 2P4UA 2R6GA 1UBJS 2BKLA 1SMKA 3THRA 3A2MA 4EHFA 2NUTA 4IEFB 5HQTA 1BXGA 4JITA 1QFSA 1ZJWA 2OBFA 3GEEA 4LJSA 3AI3A 4LI0A 3C6QA 3ABRB 3L0IB 4B3FX 4F04A 3P71T 4IGFA 4CU2A 3MGKA 5A71A 4KW7A 3HUDA 1XCPA 4H1UA 3O1JC 3VPHA 8LDHA 2GQ0A 3O2SB 4JOCA 4KIWA 4OHVA 5GVRA 3W8EA 4BP9A 1ZH2A 2F9FA 2YVQA 5CRIA 1O9HA 4KLAA 2QD3A 1S2LA 1Z5OA 4F3TA 1U1CA 3L8YA 3V4SA 4YO8A 4TKVA 4CDRA 2V54A 2VJQA 4J0IA 5AIAA 3TIIA 3QF4A 1O4WA 2P9YA 2QXTA 3I6MA 5CTAA 4M7RA 3KEFA 2AGVA 1U6IA 5LM3A 4YMWA 1KJJA 1B8OA 1ODFA 2J07A 5CLQA 3B5IA 3JPYA 3RFVA 5FJJA 2NU7A 3U61B 2W6QA 3L0YA 2XUQA 1P5FA 4F3YA 5BMOA 4FI3F 1VE9A 5EG5A 5KPJA 2YVLA 4GZ5A 3QLEA 2A0XA 4LXGA 5ED0A 2AQ8A 2E5LB 3NDIA 3OX2A 5K3CA 5B2FA 3PQFA 1Z73A 2O2ZA 3U1BA 4BNIA 3CX7A 1K08A 2H3EA 2IX3A 4HN2A 4GPZA 3VJRA 2W6MA 1E2KA 4LTDA 5GGYA 4KGZA 2R7MA 4X6XA 3JQRA 1VI2A 3K96A 4COOA 4ZV7A 4RPIA 5THQA 4Q3CA 2ZUEA 1MFZA 4XM1A 4Q9HA 1ZSYA 3GNSA 1XVUA 4OK6A 4GXRA 4YRAA 4GKKB 2DUMA 3SZLA 4DQLA 1YRYE 2ETXA 1Q7CA 1KK1A 2R2AA 3G2OA 5TB5A 3VVBA 4KE9A 4B4WA 2ZJFA 3K2IA 1WUIS 4Q1FA 3MERA 1VDMA 3KWJA 4IYRA 3R09A 4ZIRB 1GGKA 1XQWA 3DL0A 4MJLA 3WDSA 3VNVA 1OZFA 5GM1A 1NNLA 2PH5A 4Q3KA 2V03A 4IHKA 4MP8A 2CVFA 1BCSA 3GA7A 1DHTA 1GPBA 1BHSA 3VR5A 1FUYB 2VQDA 2IZ5A 1IZ8A 3ZKWA 5A5FA 2DEUA 3R7BA 2RH9B 4V0NA 1RPNA 3BK1A 3K5PA 4M1KA 3QVSA 4NRDA 5ALIA 3LCRA 5E8RA 4RKFA 4FOTA 1LLUA 3PQ2A 3W5SA 2AC7A 3IQWA 2J3LA 4MMYB 2ZWPA 5H5JA 1P6XA 2J9ZB 4RF4A 2DB3A 1JBQA 2P3QA 3DDCA 2WJGA 4QC2A 5C51B 1DC7A 1ZW6A 4H7HA 2E5WA 4UHCA 1QGAA 3L7OA 1OLSB 4ZDKA 1IZZA 3NAMA 1WUTA 2EFJA 2FZEA 1JDTA 3UYLA 4CQMD 3NG1A 1XXHE 1ZHHA 5IK2D 5CT4A 3VDMA 4UCWA 1YE5A 5FOSA 4R8MA 3UAYA 1T5BA 2H92A 1RT9A 3I45A 2OD7A 1EI9A 3DZ8A 1P39A 4J0JA 4Z7JA 4O08A 1ZWLA 3GD5A 3HO1A 2BFWA 1FFEA 2WTXA 3UOAB 1G8HA 3HM2A 2K4MA 5AKIA 2P4HX 4BX8A 2C94A 5JT1A 3V7UA 4MRRA 5JJ5A 5CFRA 1OLUA 4E2YA 4AY2A 4P7FA 1N2GA 1WY5A 2V0CA 2CCGA 2IPXA 1ADYA 3H18A 4AYXA 3RVRA 2BONA 2A5FA 2Q6IA 2BFFA 3VV2A 1ODLA 1W4RA 3IOCA 3RTEA 3GAFA 4YAOA 2VF7A 3RFXA 5FRDA 1UOOA 2XZPA 1CY7A 5E3IA 4QBFA 1GAEO 2QQ0A 4JNCA 2CV0A 4CBVA 1IHOA 1K98A 5E4YA 2VDJA 3ZZUA 2PSDA 4JI0B 2DY1A 1J20A 3DC7A 1BJTA 1TUBA 3QVKA 2IU0A 2IEGA 4LE1A 4KRXA 4O63O 1RPJA 3HA7A 2YZNA 1ORIA 2JJ1A 1GRVA 3R5KA 3B6KA 4PPFA 4A2QA 4DG5A 5GONB 2YWXA 1JUDA 3ZGVA 4AG5A 1PFWA 3ROXA 3K70D 2WOOA 1PP4A 4EG4A 4M55A 3AV3A 4CGZA 4JYZA 3QXJA 4CEJA 3WB0A 3BICA 4QYIA 3BC1A 3K9FC 1Y81A 1O94C 2X8LA 1ZKMA 1CY2A 1KPGA 4I6JA 4R3UC 3RIEA 5KKCA 1SIUA 5IS2A 3CJQA 3B8EA 4RIEA 2D8AA 3F2VA 4RVFA 4BZWA 3OPNA 3Q2IA 4I5FA 2FF7A 1LNZA 1SUBA 3N2ZB 3N70A 3E18A 4OBWA 3OZCA 1G8FA 1QLWA 4P36A 4TYMA 2FPIA 5AOAA 3VR1A 4AB1A 5KVCA 5KJCA 4OLBA 1LXCA 4KH0A 1JH8A 4KX5A 1ZGJA 3AXTA 4MV8A 3J81A 1CU1A 5BW4A 2WVJA 4FN5A 4X94A 3BMNB 3LY5A 3QFCA 5BP7A 5CFPA 1ZOOA 3C3BA 3X1MA 2WD7B 1NN1A 1N5MA 2R60A 3RRMA 3GQBA 4FHEA 3BDVA 3UUFA 1MTZA 2XHZA 1T9BA 2P2DA 1URPA 1UPAA 1W9MA 1YK0A 1T4GA 2ODQA 2GHQA 4LG1A 4NHEA 1E0KA 5GWXA 3UMBA 4YCNA 2WFMA 4BE4A 4EMBA 4ESHA 4F4IA 4HHEA 3LVRE 1Z0UA 2DQYA 1YTUA 1KPHA 1O96A 4TWZA 4AFNA 4E31A 4IWNA 3I8SA 1G0OA 4R8KA 5AVUA 2FR8A 4G8CA 4XLLA 5A4IS 1WM1A 1R4ZA 2QA5A 2WYWA 3LDHA 3NV7A 4R68A 4B80A 4N5HX 2QB5A 3GWZA 4F5EA 5I5GA 4ZTBA 3TIFA 2VT7A 3ZD7A 3PKZA 2NO6A 4AWAA 2J9XB 4GI7A 4BNTA 1IAVA 1G8AA 1UIMA 1VJCA 3RAGA 3NTQA 3VVLA 5IXYA 2ZS7A 4CKEB 1JIKA 2QJOA 2BRUA 5AJHA 3WKCA 1P91A 3DMPA 3VU8A 4BWYA 4YLYA 4FMDF 1IB0A 2W42A 3K6SA 4I6GA 4UDNA 4NJEB 4LZWA 2W70A 5ETJA 3IMEA 1OBCA 1TPYA 3SYLA 4RETA 2K2QB 3F9IA 3QKIA 2JDIA 3IQDB 1ODCA 4J2HA 2PKXA 1HYBA 5CW2A 3VPXA 1EFRA 3ZDEA 2IL1A 1IJEA 3CZRA 1EYZA 1L7VC 2VR1A 1RJGA 2VSQA 4OXRA 5DW3A 5EL0A 5IARA 1KZ7B 1XBTA 2QM7A 1LRKA 2GD6A 3F2IA 1L7QA 1P1HA 3C6KA 4HS4A 2ZUDA 1BMTA 5LP6B 1ZUD1 5BOSB 4KNWA 3VI3B 2F1KA 3OWOA 4X6LA 2QS9A 2YN4A 4IHQA 5CITA 1ZUIA 5KDDA 4EBFA 4N5IX 3CZ4A 4OFWA 3S6JA 1JIIA 2EQ5A 5IM4A 5FTMA 1X42A 5GPBA 5KYTA 2IEAA 4MYUA 3V6MA 3NHRA 3HGQA 2PJZA 3FCYA 1AA9A 1UJ5A 4GZ6A 3GRZA 4KI7A 4WXPA 2Z43A 3X3HA 3OMWA 2LP4Y 2O3JA 2CUZA 5ALKA 2QDXA 1G8MA 1P2FA 3RK1A 3EQ6A 2BJHA 3FJOA 2XB2A 5JS2A 4BS9A 1XWFA 1GTSA 3GWGA 4LV5B 2AX3A 4GI2A 4L9AA 3BQNB 1EDOA 4C0HA 4ENQA 3BUSA 3T35A 4A27A 4AZTA 1V6CA 1GVNB 1Y6QA 2QYSA 2VF5X 4OB6A 4OFBA 4PZAA 4RFVA 5AHWA 4BECA 4BEWA 1AKWA 2P77A 3L6OO 2FOXA 4U0JA 1U2PA 4PQYA 4ZYVA 3BCHA 4G2TA 5KB3A 8MHTA 2J0UA 4GPAA 3GG9A 5I8WA 4YRFA 3ZGNA 3D0RA 1UDWA 1Z45A 2PWBA 3DOUA 3ED5A 2GB4A 1Q7BA 1A8QA 4FFLA 3L1IA 4UARA 5IEBA 5CCEA 1TU4A 5JAOA 1KL7A 1QGDA 3AL3A 2NO1A 3OJ0A 1O0CA 4LYGA 5KTRA 2BJVA 1G21A 1VLJA 5TMEA 1VI6A 4RF3A 4RGVA 4BYMA 4J4BA 4BUCA 4O4JA 1VHJA 4PGMA 4YPVA 4IKPA 5JH7A 4Q9LA 4CT0A 2BR5A 3JD1A 2GAJA 1Y42X 2NZXA 1CJKC 2P4EA 4F7DA 1J1IA 4PZZA 5AW7A 1JAXA 4U00A 4Y30A 3GLQA 1KR2A 2Q5LA 1LLDA 2BFEB 2YQ4A 4X41A 4QZVA 1XVTA 3WWZA 4JYMA 3A6JA 1EK5A 1GQ2A 1D1SA 1KQPA 1VLQA 3KE8A 4FC6A 4JUDX 2BLNA 3T3OA 1ZI8A 5EZSA 10MHA 1IXKA 2IX9A 2JFWA 2FGKA 3C98A 4BO1A 3M6XA 1J7JA 3K70C 1PT7A 1W29A 4F4UA 1XNGA 1R0BA 4C06A 3GLGA 1HE1C 2D8MA 3E5RA 4C3VA 3OPYI 4UVGA 3ORQA 1W0CA 2PV0A 2J9FA 3D4BA 3EMDA 2GD0A 3IAM6 3NBKA 4LY6A 1AZTA 1DWQA 5ALUA 4CDMA 1I7NA 4RV4A 2R6HA 4MZDA 1HQDA 3MWLA 2G0NA 1G6HA 4P0PB 2I6XA 3TL2A 2R62A 5B3AA 5BSRA 1NDQA 1WKVA 4G89A 2IVZA 4OI4A 7ADHA 1BJRE 5KTMA 4BNKA 3ZGXA 1QIGA 1QC5A 2BN4A 2VP4A 3ZLJA 3UMFA 3PRJA 3ET4A 4I8DA 3TDNA 4C20A 3UFBA 4TKLA 3JAWB 5GIOE 1F2TB 3OHPA 4H4EA 3C48A 2BH9A 3UGJA 1J0DA 5BRNA 4GG1A 1JTFA 4V0KA 3V4OA 4BKQA 1II8B 2JAXA 4HNGA 2YVKA 3K09A 4PHFA 3SHFA 4PG4A 5ABPA 4WH0A 3DL2A 3NHFA 2UDPA 3N7UA 3SKXA 1OREA 3B85A 1GADO 3BG5A 4Y0NA 4B4DA 2E4YA 1N2CB 3F71A 4KV7A 4R51A 2VSNA 2HIAA 4US2R 4PLVA 3F5SA 4URFA 4W9RA 4CM4B 3WLPA 4JVLA 2GWRA 3IVAA 3PYMA 3H9CA 2ZATA 4FJ0A 5D6OA 3BJZA 2CT8A 4LRXA 5C1IA 2UUBB 1DFIA 3HMQA 4PX2A 1JALA 3DDOA 4WJKB 2RONA 4EG3A 4IIUA 3I32A 4Z49A 3RK0A 2QTVB 5KOHB 3QHPA 2Z3WA 4XCQA 1J8DA 4ES6A 3ER8A 3V9AA 5HIIA 3KAPA 4Z8YA 2G08A 3OQIA 2V7QA 1XRSB 2V74B 5H16A 1QK5A 1XCMA 3VOTA 3GYGA 2VBFA 5J40A 1DQYA 1SPBS 3TQTA 2J48A 5F73A 2O59A 4EKEA 1Z7YA 4E88A 1JWBB 1SUWA 4GZMA 9LDTA 2CKMA 3CF6R 1OBVA 2CBZA 3EGXA 3JD0A 4IUCS 1T4CA 1UH5A 2QU7A 4RKEA 1IXYA 2YWJA 2ZZMA 4YVFA 5EIHA 1L7BA 2V58A 5C81A 3VO1A 4A92A 2EP5A 5KTPA 5K8CA 3WK9A 1TO1E 1OI7A 3KZCA 4KXVA 5FBWB 4EQZA 2X42A 1FE8A 3M5PA 4C89A 3OM0A 1R4MA 2IHVA 5MF6A 5ELLA 2XE8A 5EVJA 1H4SA 1NF3A 1JKIA 3RB8A 2AG6A 1T43A 2HWXA 4PYRA 3HEBA 2C92A 3OP4A 4FGWA 1QS0B 2PIAA 4MUGA 1M1YA 1GA4A 5ADUS 2A9PA 1BYUA 4DIDA 1W36C 2UUAB 1D4OA 3CUYA 2X0DA 3NBXX 1YHNA 1T1SA 5EHIA 4YT2A 5L95A 2DPXA 2Q7XA 4YJKA 3T9EA 3K05A 5PGMA 4O4HB 3U0VA 3L7CA 4W82A 1QO0D 2QSUA 1I4DD 3VSAA 3BILA 4ENPA 3AM3A 5A7FA 1Y7IA 4Z7OB 3FRIA 1SQSA 4GI3A 3L8ZA 3LVBA 1STOA 3QTLA 2OC9A 5K09A 1U2ZA 1P5ZB 4YRLA 2HXSA 2RCNA 4ZMRA 1UKYA 2O7NA 4ON9A 3EWIA 1GDDA 5HBGA 2VRCA 3IBCA 2AR9A 2IXDA 1HE5A 1U9IC 2W48A 4OYYA 4MZXA 5C4MA 2J3KA 4M0DA 2YNMA 3F5FA 2AHRA 4BVBA 4IV5A 2QVBA 2VDUE 3E3MA 3ZW8A 3ANSA 1E2NA 4NCIA 1M2NA 4LDRA 1U94A 2GLXA 2FK8A 4Q39A 5IZ4A 3GLVA 5HQJA 3LKDA 3MA0A 1M34E 2HKIA 4JEUA 2JIBA 1EUDA 4Z9AA 5DX0A 4ZFNA 5L4LA 1QP4A 3B48A 1Y48E 3AT1A 3FVVA 3OE1A 3FCOA 2Q9CA 3E7DA 3NV9A 3PFIA 4CPDA 3H4MA 1MRZA 1RIFA 3QNWA 1D7AA 2GZSA 4MO9A 2YYAA 3EY4A 2A92A 4NMLA 2OHFA 5DN6A 1NMQA 2HB6A 3DKVA 2PZFA 2W2QA 2VDLB 3I1YA 2JARA 3V7NA 3LTNC 4CKYA 4O2AA 1GL9B 1QBKC 3T3IA 1CSEE 2ZQYA 1Z2OX 1NVVQ 3OQPA 3OC0A 4LNUA 4ZEVA 1KVUA 3DAGA 2XTMA 1GD1O 1CG6A 2HAEA 4MI1A 4CMGA 3O7WA 1YZTA 2QR3A 2BE7A 4TL9A 1KK3A 4X65B 4NENB 3BH6A 4PGHA 1A7AA 5J5VA 2RI1A 3KZXA 1T5SA 2F1OA 2L18A 3IEPA 1UPTA 4L4XA 1ZOLA 5CLFA 4L4UA 3ST7A 2P2GA 3NB0A 1N4DA 1QQ5A 4KQMA 5C7LO 5CA0B 4IIJB 3N0TA 3RQSA 1FXWF 2HU8A 2NXNA 4J6EA 1KYTA 4WOBA 1V5EA 5A4AA 4KYUA 1ZA1A 1FZQA 2AMVA 3QQ5A 5A4FS 1IPEA 5CX1B 4CCSA 5LUAA 1H2WA 2ZAYA 3H7IA 3HACA 2Z04A 3LO5A 2GILA 5DGXA 2H9YA 1HURA 1C3OA 3D64A 4AKGA 1AKYA 3V2IA 2J41A 1RRKA 1NXTA 1U04A 1HFKA 1L8QA 1T0IA 1T1EA 4BN5A 5HA5A 3FPEA 4FLEA 1E1CB 1Y7TA 2IZ7A 2SECE 4OOFA 3C7KA 5AXCA 3RVOA 4BFTA 3TB6A 2Q3DA 1JG2A 2PX3A 1ZH4A 3OMXA 4M7WA 1YDMA 3HJCA 4ND7A 5EYPA 5FTJA 3WIEA 1U80A 2FE1A 1F8XA 5E2AA 3W05A 2P3LA 4IR7A 2WJPA 3ROEA 2QN1A 1DBQA 2C99A 3TJRA 4C5CA 3EZXA 1XP8A 2JBHA 2ONJA 3WMWA 1QQTA 1E7RA 1OT5A 4IRMA 4ZOAA 4YYZA 4DEVA 1G5FA 5AVJA 4DC0A 5I7WA 1F14A 1M0EA 1EA5A 2Z8ZA 1MX1A 3ILSA 4D45A 3LIPA 3TLGA 4ZPXA 2ZB4A 1J06A 1GPAA 3U4QB 2FQQA 4HB4A 3NFYA 1ULBA 3BAFA 2OQVA 4CUJA 1ZVKA 1J0EA 3KSDO 4JLSA 2P6OA 3MJSA 3VAYA 1W8IA 2C8LA 4JNKA 4LISA 5ILGA 5JYEA 1VG8A 1UDXA 1TW2A 3LP6A 2LUOA 1GL6A 2WUEA 1H85A 1P2SA 3UC9A 5G4KA 4GBMA 1GARA 3K1AA 1GRRA 3RYHA 1XKXA 2QROA 3MUFA 5ER6A 3UJ3X 1BVUA 2ADFA 3TW8B 2XXAA 1ECGA 3GY0A 3EVNA 3U1TA 1OGYA 4P5DA 4OJYA 2QLNA 3USZA 3GRPA 2NU6B 2BGWA 3ZDRA 2OUIA 1EVYA 3PHIA 1VFPA 1C7QA 2B99A 1F5SA 3HA3A 4R1TA 3SCZA 3AR6A 3FBWA 4WBXC 2H0AA 2XD9A 4IDGA 3K2BA 4PM4A 3S2UA 5IT9A 1ID8A 2J08A 4KBFA 3I6QA 2ZTSA 3JVUA 1KOJA 2Z3ZA 2O8VA 4J94A 4JOSA 2QL5A 4O4IF 4Q03A 1NT2A 3RGGA 2HM7A 4AZWA 1A0OA 3HUUA 1YXMA 3CSUA 1PNQA 2Q50A 1S5PA 3DE4X 3GDWA 2EATA 3HC7A 3HKEB 3M6AA 2WWYA 1CNMA 1NW8A 5T3UA 2FH5B 1BFUA 2XYRA 4DXAA 3O6VA 5ITZB 5CT5A 5KYVA 4JGBA 1S3FA 4MV5A 3SSOA 1DU4A 1R8YA 4M49A 2QE7D 4P4TA 4FW9A 4Q4AB 4Y7CA 2OECA 4AQYB 3FOEC 4CVNA 3TLKA 2B35A 5HIAA 4IM7A 2QVXX 2G7MC 4QFDA 2X8WA 2H5EA 3KQOA 4A03A 3LBYA 2B9VA 2F8LA 2Y0BA 3CRZA 1RCTE 2YXEA 3Q1LA 5LYYA 3ZS9A 4RFSB 4ZDWA 2IYWA 3DM5A 3UHAA 4CLHA 3KQNA 4XPZA 2QUKA 1R0ZA 3ENQA 3JVDA 4AKEA 3QKRB 4M88A 4MWDA 3TNFA 4GGPA 4EVIA 2OO7A 3FNBA 3UKOA 3OJWA 1NP3A 4UM9B 1UKAA 3BCRA 2FZWA 3O4IA 5IT0A 4OEHA 2X9GA 5CYGA 4YECA 4R9SA 3UT5B 5FPSA 2QRKA 3L4KA 1SKYE 3D2LA 2O8CB 2B7CA 2KW5A 3H9BA 1RI2A 3ASUA 5HILA 4YLGA 3UXYA 1WO8A 3IVGA 4ML3A 4QXOA 2VJLA 2WIBA 3VYUB 4NY1A 3MWDA 4TQ9A 1YOBA 5DK6A 6NULA 4PONA 3LUPA 1J8VA 5EFZA 1PJCA 4C87A 2WTAA 4K5QA 1DS6A 1L4YA 1EZZA 4GMHA 1W87A 2PGLA 2DTDA 4FYWA 2APJA 1SCAA 2B37A 1OJLA 3GPIA 1NG1A 3VOBA 1E1RA 2EV9A 3AEKA 4OXYA 4URXR 5TARA 2A88A 4PEVA 3QELB 3T06B 1ULUA 1TA9A 1QUEA 3Q3GE 1NLFA 1XRJA 2IHUA 2Y1KA 1V1MB 3DLHA 5KNDH 3FHJA 1LZLA 4A6PA 1NJ8A 3T7DA 4MWOA 1E1CA 4EH1A 4QECA 4HBGA 3SQWA 1KI6B 3E4DA 1UPXA 3O91A 1UM8A 2V6GA 1BX0A 3B70A 1P1FA 3AXSA 3HYNA 1ZIOA 5AP9A 2OHHA 2XMPA 4FOPA 4W1SA 3CGGA 3EQ8A 5C3UA 3ESQA 3UATA 1N75A 2WILA 2C1ZA 2Z2YA 3OIFA 3QLTA 3TEJA 1DV2A 3GDHA 1GUAA 4NQRA 3AR4A 3ZTYA 5B58C 3PP8A 4NE7A 2ZT7A 4BNJA 1N9GB 1W4LA 3WYBA 1U4SA 2QSJA 3WLNA 1TO6A 1DNPA 2WHYA 2UYCA 2REXB 2XRMA 3LGXA 5AJVB 2QTVA 5BSMA 3UTCA 1QAQA 4EARA 2HY7A 1Y8CA 3ZI0A 1BGXT 2IOHA 1E6EA 1O08A 1A2KC 2GPYA 2LRHA 1ZISA 1UMCA 2O3SA 3INGA 3A3YA 1B6TA 3EIOA 4UCFA 1YGYA 4PZEA 3KEOA 3ELUA 5LLTA 1UKZA 4KDCA 4QULA 1IFXA 421PA 5JLJA 1H9BA 4H7JA 4MWCA 3GG2A 2GBFA 3MTQA 3NKFA 3OJFA 1AGPA 2OXRA 3NLLA 1GGNA 3THYB 1M2GA 5CAEB 1WW3A 3OOYA 4DEXA 2A9KA 4UAGA 2NU6A 4N18A 2HDOA 1R9MA 3IAM1 4WNCA 1A5AB 1XRQA 4WZBE 4QFCA 4CTNA 2F90A 1M2EA 1AQUA 1Z08A 3L7JA 4TLEA 4URWR 2JKVA 4LOLA 4O4HF 4LZLA 3RJ9A 3T3MB 2I66A 1N0IA 2Z9CA 1T0BA 2VHXA 3BERA 3H2GA 4Z7NB 5LDHA 1ZCAA 3EA5A 3JWIA 4RWEA 5BWOA 5KYUA 4Q15A 3GJQA 1H1DA 1ODIA 1UOPA 3QG5A 3DDNA 3ZY3A 1QC5B 4B3JA 1LDNA 4M7OA 1RU3A 2CE7A 2IIQA 3HR4A 3ZIAD 4FSXA 3VDQA 1NQUA 3TRFA 1J8YF 2PU5A 4B5LA 4TQUS 1KQ3A 2XMBA 4GDMA 1MDBA 1B8PA 2GCPA 4C78A 3GZNB 1RAIA 2G71A 2C5SA 2IHBA 4EO4A 5CLIA 1M2OA 4QAQA 1VL5A 1G5QA 2PMFA 4UEWA 3BSFA 3JQCA 3L04A 2DC1A 5SY6A 4CM3A 1Q0PA 1BAPA 3QXXA 4P81A 5DI9A 3BGVA 4HH4A 1J5XA 5K3DA 4AO7A 1I2ZA 4RH3A 2NVUB 2CF6A 1XHFA 4L2IB 1A7KA 4ME6A 3EIWA 5FB3A 3K9WA 5LIPA 3IMCA 4CI0B 1P9WA 3OZDA 2NVOA 1GWNA 1YBVA 3SHWA 1E4OA 4OYRA 1J4AA 5LDGA 3HJAA 2LXNA 1ECPA 4YRIA 2VP9A 2JLQA 5KDOA 2C2XA 2VJKA 2I7XA 2P5TB 3QTTA 1N3YA 4W5OA 3KAQA 1W44A 2SHKA 2WAMA 3Q10A 4JFAA 4QT0A 3RUAA 5T5QA 1RTKA 4OGFA 1T8WA 2YV1A 2F3PA 3D8RA 3JZIA 3W3AA 1MB3A 3AKYA 3U39A 1TTHA 3PFFA 4K88A 1JPNA 3C3KA 4EHBA 2V97A 3U31A 5CYFA 3FOCA 4JSYA 1WETA 1RMYA 3R24A 4LWOA 3KE9A 1UBUS 1AOXA 3FPFA 4D4HA 5MGBA 2BFMA 2FQXA 4UUMA 2KBEA 5E38A 2GD2A 1XRRA 1NR1A 4U7JA 2I2WA 2IUEA 2QBYA 1AHHA 1JHRA 3OUUA 2KJQA 3NC0C 4HTAA 1C4KA 3S7ZA 5TMPA 4QLOA 3T9FA 1KGSA 3TW6A 1RWPA 2FLKA 4J7XA 2MSLA 1WXDA 2IU3A 4DGQA 5FNVB 3TXAA 4I14A 2UVPA 3D1LA 4YAJA 4G0XA 2GCIA 3CVWA 4MVWA 3GJ3A 1YJ5A 4MKIA 1YVPA 2ISQA 3WP0A 1T0JB 2QRVA 4DKXA 4YMUA 3QJGA 1A82A 3D81A 3U4MA 5GZ1A 3ZTWA 4FHFA 4BDTA 5JCJA 4X0EA 2OM2A 3DMGA 3G49A 3H5NA 5LZ2A 3COYA 1ECCA 3PIDA 3U09A 1OI2A 3JR7A 2OMEA 3N2KB 1IBSA 3PUHA 2I7CA 4JR0A 4K05A 3UO8B 1KQGA 3COJA 3DLIA 1EWYA 1DKUA 3ZQ6A 1HK7A 1YU9A 3H3JA 1LJ8A 3A1NA 5HJEA 4DLYA 4Q0MA 2AOTB 2R1TB 4MS3A 1REQA 4YFVA 1XIVA 3CMCO 2OG2A 4MWSA 4C3UA 3DOIA 5LNK1 5EE0A 2P5SA 1X7ZA 5KC8A 3ND6A 1TYCA