3BWLA

Crystal structure of pas domain of htr-like protein from haloarcula marismortui
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
125
structure length
125
Chain Sequence
SNAERKRREKRLEETSSRLEALFENSPDMIDVLDADGTICEVNQRFCAELGYDESEVLGRSIWEFDLMFDAEDVQTQLSGFSVDERRKFEGLYERRDGSTMSVEVHLLRFNLEGEDRFLAISRDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sensor protein
publication title X-ray crystal structure of PAS domain of HTR-like protein from Haloarcula marismortui.
rcsb
source organism Haloarcula marismortui atcc 43049
molecule tags Transferase
total genus 42
structure length 125
sequence length 125
chains with identical sequence B, C, D
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3bwlA00
4EEUA 4GHIA 2ZBBA 2PR6A 5DJUA 1LSVA 2A24A 4E04A 2QHKA 3F1PA 3C8CA 4F3LB 4NXEA 2PYPA 1XJ3A 1F98A 4R38A 1D06A 4F3LA 4R3AA 4HH3A 2KDKA 2PDRA 3H82B 3D72A 3A0VA 3LYXA 3E4QA 1N9NA 2VV7A 3MXQA 3H82A 3VE3A 4WLAA 3K3DA 5DJTA 2V0UA 2WKPA 4HH2A 4HP9A 5J7EA 4HOIA 1OT9A 2BASA 1GSVA 4R6LA 1P97A 1S67L 3H7WB 2KX6A 1OTIA 2V1BA 1ODVA 2K7SA 3H7WA 1TS0A 1XJ4A 4XT2B 2PR5A 1N9LA 1Y28A 4I5SA 2WKRA 2W0NA 4XT2A 2PHYA 4L9FA 4L9EA 2QJ5A 1UGUA 5G4YA 4HHDA 4GS9B 4I39A 1D7EA 1OTBA 4GW9A 4EESA 1GSXA 3K3CA 4GS9A 5HWTA 4H6JB 1P0ZA 4HY8A 3LIDA 3A0RA 4B9OA 2I9VA 2CMNA 2P7JA 5HDSA 5F6AA 2VV6A 3GECA 4KUKA 2OWHA 2HV1A 2ZOIA 3F1NB 1S4RA 5A8BA 3G6OA 3NHQA 4MN6A 3CLOA 3H9WA 2PD7A 1MZUA 2QKPA 4WUJA 4YWZA 4PKYG 4MN5A 3BWLA 4NXGA 1XJ2A 3CAXA 4LRXC 2VV8A 1LT0A 4BBUA 1UWPX 2EA9A 4I3AA 1TS7A 1T19A 2JHEA 3B33A 5IU1A 4LLOB 4JGOA 1NWZA 4L9GA 4GCZA 1DRMA 5DKKA 3UMDA 1T18A 4LPZA 2W27A 3LIFA 4PKYA 3UB6A 4LRYC 1T1CA 4I3IA 5AVFA 3OLOA 3UB7A 2L1MA 4EERA 5AVEA 2VEAA 1S66L 1OTEA 3NOTC 3ULFA 2L0WA 1LSWA 3MR0A 3LIAA 5DKLA 2J80A 2PYRA 1G28A 1XJ6A 3GDIA 4HP4A 4NXFA 2ZOHA 2INWA 3NOUC 1TS6A 3E4OA 5KIZA 4H6JA 3HJKA 5J3WA 1S1YA 3FG8A 1XFNA 4KUOA 1S4SA 5TBMB 1T1BA 5TBMA 1DP9A 3F1NA 1OT6A 4HJ3A 5HSQA 1OTDA 2QJ7A 1VB6A 2JN7A 5HDDA 1LSXA 4EXOA 3A0SA 3ICYA 3LIEA 2OOLA 4R70A 1LL8A 3HJIA 4WL9A 4I3JA 3E4PA 3RTYA 1WA9A 4WF0A 2A24B 3CWFA 4EETB 2R78A 3KX0X 2L4RA 3LICA 3LUQA 1T1AA 5I5LA 1BYWA 1EW0A 5HWVA 5F68A 5HD3A 1F9IA 3LI8A 1OJGA 4RQ9A 4BBVA 3BY8A 3IS2B 5HWWA 3LIBA 1V9YA 2GJ3A 5EFWA 1N9OA 5F5YA 3IS2A 4JGRA 4EW7A 3MFXA 2QWSA 3LI9A 4HJ6A 3C2WA 1OJ5A 2D02A 3MQQA 2B02A 2OWJA 1DP6A 2M1CA 4K08A 3IBRA 4WN5A 1UWNX 4HI4A 1JNUA 1KOUA 1X0OA 4HIAA 3UE6A 2V1AA 4NXBA 5F69A 2Z6CA 1XFQA 3MQOA 1V9ZA 3ZQ5A 1DP8A 3VOLA 3F1OB 4HNBA 3MJQA 3T50A 1S1ZA 2PD8A 3P7NA 2H28A 4LRZE 3PHYA 3NOPC 4HJ4A 3F1OA 5G4ZA 3RH8B 4I38A 5HZHA 2V0WA 3FC7A 3PYPA 4JGQA 2WKQA 5HDCA 3BY9A 3UB8A 2VLGA 4EQ1A 1OTAA 1TS8A 2D01A 4DJ2A 5IS1A 2YKFA 3EWKA 2YKHA 4BBTA 5HD5A 4DJ3A 4M4XA 3NJAA 4HQAA 4JGPA 3UB9A 3VE4A 2V9AA 3EEHA 4GHIB 4EEPA 5J4EA 2Z6DA 3SW1A 3UMEA 1GSWA 3F1PB 4KQDA
chains in the Genus database with same CATH superfamily
4EEUA 4WEKA 4NG2A 2JKRM 4GDNA 4E04A 3G2YA 2QHKA 4B4XA 2O99A 1IOUA 1WYCA 1LI0A 2UV0E 2G2UA 4E3KA 1CJFA 4R38A 2C6WB 3QP8A 5FDSA 3H82B 3SH8A 1XGIA 4UA9A 5GHXA 3LYXA 1F5MA 1N9NA 5AQ9A 3H82A 4E3MA 4WLAA 3IXDA 4JF5A 4HP9A 5GLDA 3HLCA 4EUVA 2BG1A 5DTTA 4E3IA 2BASA 2HPBA 1JTDA 5IHVA 3NI9A 1IKGA 5J8XA 4WZ4A 3Q1FA 2V1BA 2K7SA 2EX6A 5L10A 1XJ4A 4XT2B 2VGJA 3ZNYA 1L0FA 2BLSA 4XT2A 1M40A 2PHYA 1K55A 4L9FA 4CLCC 1MY8A 2P9VA 3OPRA 3BFCA 3ZG7B 1GSXA 3GRJA 1RP5A 2V8CA 1MC0A 4EU0A 4LFUA 4B9OA 3IF6B 4E3NA 1KDWA 3T1XA 1XA1A 2CMNA 2P7JA 4CJNA 5TGFA 1LI9A 2VV6A 1Z6FA 2HV1A 3CI6A 3KSFA 4OQHA 5HL1A 1LL9A 3G6OA 5FSRA 1PWGA 4IUHA 4HEFA 4DXCA 1NY0A 3CLOA 3NCKA 2WGIA 1MZUA 3MZDA 4S2PA 4PKYG 4MN5A 1SKOB 3EQUA 2HDSA 3B42A 4OKPA 5CEDA 1SKOA 5FI7A 1SHVA 1G6AA 5FAPA 1NRJA 1LT0A 4BBUA 5L07A 4ZJ3A 4GLQA 2EA9A 3NBLA 1IYSA 2FFFB 3VOZA 2JHEA 3MS6A 3T4SA 4LLOB 2ZJ9A 1KVLA 3C4OA 4L9GA 4UEYA 4JXSA 1NLYA 3UMDA 1VETB 3CPTB 3HUNA 2MJ6A 3BLMA 1SCWA 4LV2A 2PRFA 4LPZA 3IQAA 4PPRA 1K54A 1VETA 3CPTA 1FR6A 3KYZA 4IVKA 2VX8A 4X25A 3UB6A 4K91A 1T1CA 1F2KA 4E3LA 1PZPA 3UB7A 3HVFA 4R23A 4DXBA 3B47A 4BD1A 3ZCZA 3UB5P 4JF4A 1ERMA 3ULFA 4IVIA 3C7UA 3LIAA 5TJJA 5DKLA 3AGFA 3G34A 4EUZA 2ZOHA 4K0XA 2ZC4B 1YLZA 2QPNA 5F1GA 3IH9A 1RGZA 2NUPC 4H6JA 4XUZA 5FQKA 3E0YA 2ZM0A 1XFNA 4Y2FA 2E8JA 4KQRA 4Y5FA 2Y4AA 4KZ7A 3T1SA 1S4SA 4WZ5C 4R4SA 3ZYTA 2O0YA 2CC1A 5TR7A 1T1BA 3C30A 3HREA 5EM0A 4O0PA 1DY6A 3N7WA 3EEAA 4QHCA 1YLPA 4HJ3A 2WADA 1KGGA 1PYYA 5FQJA 3CUEA 1PWCA 4XXRA 3MFDA 3HUMA 3ZG5A 4DE1A 3DTKA 3DWKA 2GNXA 2H5SA 1K0KA 4YNRA 1K56A 5GL9A 2R9XA 3GQZA 3MF0A 2IWBA 3LICA 2DRWA 3R7WB 4GN2A 1T1AA 5HWVA 2LB9A 4FCFA 5F68A 5E43A 1PFLA 3FPWA 3QP6A 1F9IA 1OJGA 4OQ0A 3R7WA 1IEMA 4KZAA 4RQ9A 3EGDC 1K57C 3UE3A 1YM1A 2OLVA 3Q07A 1ESUA 1AWIA 2PAVP 2X71A 3L9KA 3E2KA 1FCNA 2VGLM 3KSGA 3VSKA 1KGFA 5HPFA 3FKVA 3HLDA 3LI9A 1JWVA 4KG5A 1ESIA 2B02A 4BL3A 2O9AA 1SZVA 1ZHHB 3IBRA 2GDNA 4WN5A 2EXAA 3C5AA 4HI4A 4KG6A 1JNUA 2DCFA 5FAOA 5DF8A 2EX8A 5EVID 2EXBA 3MSHA 5I94A 3VOYA 4HIAA 1FCMA 5F69A 2UWXA 2EWWA 3MQOA 1K6SA 3PXPA 2ACGA 5EVEA 4BJPA 3KO6A 1E25A 3MJQA 2XFSA 4O7DA 2B18A 3LR3A 1MWRA 1CI8A 4MBKA 3G2ZA 3GTCA 1ZC2A 2OV5A 1L3LA 1YQSA 2WKQA 3LO7A 4MDZA 1BT5A 5HDCA 3A3IA 3PBNA 4WMCD 3C4PA 4ZJ2A 4RX2A 5IT5A 5EPHA 3DW0A 1PRQA 4DJ2A 3EWKA 2Y2GA 1W8YA 3R4KA 1C3BA 3NJAA 3NECA 1CK3A 4JGPA 2W3HA 2I72A 4WBGA 5DTKA 2ZQCA 3EEHA 3DTIA 1NLZA 1YSPA 3UMEA 4HESA 3C38A 3F1PB 4KQDA 2Y8HA 3MKFA 2ZBBA 2XR0A 1LSVA 2A24A 3JPUA 2ZL1B 5U47A 3SS4A 3F1PA 4F3LB 2PYPA 2ZL1A 1ALQA 2J3TC 4LV3A 5GHYA 1YLTA 1MXOA 4X53A 1D06A 3IH8A 4F3LA 4R3AA 1K55C 2KDKA 2WGWB 3UPPA 3D72A 3A0VA 4KG2A 5CGSA 2VV7A 3MXQA 5FI6A 3VE3A 2W3DA 3K3DA 4N9KA 4M3KA 1W7FA 2Z2LB 1KVMA 1OT9A 1AXBA 4D60A 5EVIB 5FEFA 4R6LA 4CPKA 3H7WB 4ARZB 2XH9A 2EFXA 1ERQA 1PNEA 3S7QA 5EVIA 3MKEA 3H7WA 4ARZA 1TS0A 3WS1A 3VP0A 2ZC5B 4A5RA 4OQGA 2WKRA 5L2FA 3VSLA 3S7PA 2ZQ9A 1K25A 3QP2A 4L9EA 3TSGA 3NIAA 2WYXA 4OPRA 3VP4A 4XUXA 4I39A 1D7EA 2A49A 4EESA 3GSGA 2GX5A 1L0EA 4WMCA 1NJ4A 1NXYA 3P01A 4S2NA 4S2MA 1M6KA 1H3QA 5CECA 3V50A 4N1XA 2XA7S 5FQIA 4CLCE 1Q2PA 3GECA 4KUKA 1HTZA 2OWHA 1XXMA 3F1NB 2Q9NA 1S4RA 2QMIA 1YSQA 2QYBA 4DE2A 1K54C 1CEGA 4ZBEA 3HUOA 4PHTA 3T4OA 2PD7A 3A3FA 5G18A 5CXWA 1BTLA 3Q81A 5AQ7A 4PMAA 4YWZA 4LCMA 3RJUA 4C6YA 2WKEA 3RFBA 3OC2A 3BWLA 1PW1A 4PM5A 3D4FA 4NXGA 4P6BA 2H10A 3GMWA 1XJ2A 3Q82A 4GJ4A 4B93A 4LRXC 1YAXA 2XGNA 2VV8A 3D9YA 3ZG9B 2HJEA 3N8RA 4G3WA 2J7VA 4JF6A 5EE8A 2JBFA 3K2NA 4ME4A 2ZMFA 5M19A 5F83A 3QP1A 1T19A 5FQMA 3WS4A 2ZMAA 1FQGA 3SH9A 3MZFA 4KZ9A 4B88A 2W27A 3LIFA 4OPQA 3W4PA 4OLDA 5FI2A 5FEGA 4LRYC 3IWQA 1IYPA 1CF0A 5AVFA 2JKFA 3OLOA 4Y13A 3N4IA 3FPVA 3MXSA 2L1MA 3ZG8B 5K5BA 4FOFA 4GOGA 5AVEA 1PIOA 2XDMA 2VEAA 5L8MA 2WAEA 1BLCA 4QB8A 1OTEA 3TG9A 2W3EA 4R0QA 1LSWA 3MR0A 2NUTC 3UY6A 4GD8A 3PBTA 3QNBA 1G28A 1XJ6A 2B95A 2JCHA 3BJNA 4S2KA 3N8SA 4OVDA 3I7JA 5J3WA 5HAQA 4KUOA 3IF6A 2DMWA 4DMZA 4S2LA 3T4LA 3P98A 3LEZA 4R4RA 1BSGA 1D1JA 1MWUA 1GHPA 2Y2IA 4S2JA 4X56A 2QJ7A 5FA7A 5GLAA 3RXWA 1VB6A 1H5XA 3D3OA 4EXOA 3ICYA 3HLBA 2OOLA 3HJIA 4I3JA 1E4DA 4WF0A 2ZM8A 4X55A 1PI5A 4KZ6A 1GHMA 1K56D 2R78A 1BUEA 1NZOA 5EV0A 4CLCD 3NDEA 1DJBA 2FFYA 3KSIA 1IELA 1JWPA 2PU2A 3ITBA 3HLFA 4BBVA 4U3TA 3BY8A 1BLSA 5HWWA 3BLSA 5EFWA 1N9OA 5F5YA 2HP6A 1EWZA 4JXWA 3MFXA 3SS3A 2A3UA 3FV7A 3MMHA 1K38A 4HJ6A 5FDHA 5CHJA 3C2WA 3WS5A 1QMEA 3FWLA 4BL2A 3LEQA 3HLWA 4D2OA 2OSUA 3S7NA 4CQHA 3EGXC 3T4QA 3VP1A 3AGDA 1A0KA 3VP3A 3IBJA 1ES5A 4FD8A 1X0OA 3BW6A 1KDSA 3S7OA 3BECA 4X1MA 4E6XA 3VP2A 4NXBA 4FH2A 2ZLYA 1MKIA 5E2EA 1XFQA 2HP5A 4Y15A 4NKPA 4LV1A 4WEJA 3VMAA 1DP8A 4JXGA 3VOLA 1NZUA 3F1OB 3ISGA 2WZXA 3P7NA 2H28A 1BLPA 3PHYA 5FAQA 5GLCA 4FUWA 3W2ZA 3F1OA 2X01A 2V1ZA 1S0WA 2PT7A 5HZHA 4JLFA 2ZQDA 1STZA 2W1RA 4PM9A 3P09A 1OTAA 4PM8A 3TW8A 3PBSA 3GV9A 2H0YA 4AFIA 3PBOA 1XGJA 1XKZA 4OLGA 4P6ZM 4Q8IA 2HF6A 4E3OA 2YKHA 1J9MA 4OPZA 4X6TA 4M4XA 4PM7A 3UB9A 2VA0A 4CLCB 1H0MA 3IX3A 2V9AA 4GHIB 4Y7PA 3SW1A 4GZBA 3RXXA 4CLCA 4EBPA 5CHMA 4GHIA 1L0DA 1U60A 4S2OA 3GVBA 3T1QB 3LGOA 2KLIA 4IHQA 3PBQA 4NXEA 1F98A 4Q0JA 3UN7A 5AQBA 4HH3A 1H8YA 4BQMA 2J9OA 3O5YA 3BEBA 1QMFA 3A3JA 5DTSA 4DE0A 1CQAA 2ZQ8A 3LR0A 1PZOA 4R3JA 4KZBA 3G31A 4HH2A 3NC8A 1W63Q 5FL3A 5J7EA 4HOIA 1G6OA 1ZG6A 2JC7A 5M1AA 3ZVWA 4MNRA 1S67L 4L0LA 4IUKA 2KX6A 1MWSA 4DN0A 1OTIA 4UA7A 2A2LA 1ODVA 4DRTA 1VM1A 2PR5A 1N9LA 1Y28A 4I5SA 1BZAA 5EM1A 5GLBA 2QJ5A 1UGUA 5G4YA 1GA0A 2ZM2A 4HHDA 4GS9B 3PAGA 5KMWA 4IBRA 3W4OA 1Q2QA 1OTBA 4GW9A 5HPIA 3CG5A 3CZDA 3K3CA 4GS9A 4GB7A 5HWTA 2V8FA 1FOFA 1J3WA 4C3QA 4KQOA 3BQAA 2Y2JA 5A90A 4QU3A 2H0TA 1ES3A 3MBZA 4QD4A 4ID4A 3WS0A 3HLGA 1I5QA 3Q7VB 2XA7M 2DNSA 5KSHA 2V2FF 2ZOIA 3IF5A 2XD1A 1G68A 1P9WA 4KZ3A 4MN6A 1FIKA 3LY3A 2P08A 3H9WA 3T4TA 2ZMVA 4RYEA 1CEFA 4IBXA 2ZQAA 2G7UA 3V3RA 4ESPA 3U2AA 2Y2PA 3B3XA 3N6IA 2Y91A 4IEDA 2IWDA 1N9BA 3G30A 2M7UA 2HJ9C 4RA7A 3QNCA 3V5MA 1VHMA 3PR6A 4DKIA 2WKIA 4RX3A 2Y2KA 2FZ0A 2Y2HA 1TS7A 3B33A 2HDRA 5CRFA 4FTXA 2WGWA 4WZ5A 5IU1A 4JGOA 1NWZA 4GCZA 5DKKA 2HDUA 3WWXA 2KOIA 2FH5A 1YPRA 3MZEA 5KZHA 2LB5A 3IF6C 3JVVA 3A3EA 2HZ5A 4I3IA 1ES4A 1LLBA 4GNUA 1FSWA 1XX2A 3WS2A 5JYOA 4EERA 1ONHA 1JVJA 3LCEA 3NY4A 4BMWA 1K4EA 4GDBA 2L0WA 2Y2MA 3Q7ZA 2IWCA 3JYIA 1K57A 2PYRA 3UDIA 3GDIA 4BD0A 4MLLA 1TD5A 1TF1A 1YLYA 4PM6A 5CTNA 3S1YA 1Y4OA 1BULA 2X02A 4P85A 3JVUA 3E98A 3ZG0A 2IA2A 4P0MA 1W63M 3NDGA 3HJKA 4QY6A 3SS5A 1HD8A 3IXBA 4HBTA 4BLMA 1E3UA 3UDFA 3T4KA 2R9WA 3CMZA 4NK3A 3F1NA 2XLNA 4N1HA 2VK3A 4KENB 5HSQA 3OZHA 2JN7A 2M7VA 4ZTKA 1MWTA 5A93A 1Y54A 3M6HA 4R3BA 2B5RA 5LBRA 5CHUA 4OOYA 1YLJA 4WM9A 3CWFA 5DVAA 4EETB 4UHUA 3KX0X 2L4RA 4MEZA 3M2KA 5I5LA 1EW0A 3LI8A 3VFHA 5BOHA 4Y3IA 3IS2B 3VV4A 3OPPA 2Y79A 4U0TA 4K0WA 3KYQA 1RCJA 3UPOA 4UQIS 5L09A 4KQQA 2PBYA 3IS2A 4EW7A 3IX8A 3T1RA 4DDSA 3E2LA 3OBFA 5AQAA 2XF3A 3IHBA 3O87A 4S2IA 4Y17A 1OJ5A 1OMEA 4KZ8A 4YOFA 3IXGA 3BYDA 1XP4A 1DP6A 2M1CA 4K08A 4KZ5A 2WAFA 1S6RA 1UWNX 2ZC6B 4II7A 3TE8A 2ZC3B 2XQZA 2O9BA 1XPBA 3CUEC 3W4QA 1I2SA 2V1AA 2Z6CA 1V9ZA 2P9VB 3WRZA 2K2NA 2PD8A 2V20A 3UDXA 3QHYA 3NOPC 2WGVA 4Z1WA 4I38A 5M18A 3ZHHA 3A3DA 3FC7A 3PYPA 4LCLA 1WYBA 3ITAA 2QZ6A 4ZRRA 3S22A 3BY9A 4KZ4A 3UPNA 2VLGA 3TJZC 5EECA 1TDLA 5E2FA 3UE1A 1ZTUA 2D01A 3HBRA 4Q0IA 4OQIA 5HAPA 4FSFA 1FSYA 3IXHA 1RGYA 4DJ3A 4QJGA 1GA9A 1N4OA 3BM6A 2Y59A 4HQAA 1P9RA 4ZDXA 4LV0A 1IYOA 4EEPA 1VEUB 3HLEA 3PAEA 1GSWA 1G5UA 3LR4A 1K6RA 1JTGA 1DJAA 1ACFA 2Y55A 2PR6A 1VEUA 5DJUA 2Q9MA 1H8MA 3C8CA 2JKGA 3N8LA 2Y2LA 2OAP1 3WRTA 2VZWA 1XJ3A 1BLHA 1LL5A 4X1LA 1VQQA 4O01A 3ZVTA 1YMXA 3UO9A 1FILA 3BRMA 3NULA 4C75A 4Y0TA 3FZCA 2PDRA 3OCNA 1LHYA 5F1FA 1IYQA 3E4QA 2JKTI 5EVLA 1HZOA 4OOLA 3SZTA 4JPMA 4WYYA 2JKTM 5DJTA 2V0UA 2WKPA 3QP5A 5GHZA 1W79A 2ZD8A 3MQ0A 4EBNA 4Z9QA 1TDGA 4GD6A 2OAQ1 1GSVA 2AVXA 5C5KA 3IWIA 1P97A 2J8YA 2W1TB 4UA6A 4WELA 5DF7A 2ZQ7A 1YMSA 2OLUA 1Z09A 4Y0UA 2W1TA 3BFFA 2W0NA 1CI9A 4EV4A 1SDNA 2HGVA 5TFQA 1HLUP 1KE0A 5D3OA 1YKDA 3EOIA 2JE5A 1KGEA 4OH0A 3QP4A 3DAVA 4FH4A 5HL6A 5CERA 5CGXA 3AGEA 3G32A 4H6JB 1P0ZA 2VJWA 4HY8A 3LIDA 3A0RA 4MBHA 1K4FA 2RL3A 3CJMA 1ES2A 4E6WA 1L0GA 1SDEA 3PTEA 5HARA 4BENA 2I9VA 5HDSA 2J9PA 3ZFZA 1JWZA 3SH7A 5F6AA 5CX7A 3ZNTA 1DJCA 4O8GA 5JYPA 4P87A 1NYYA 5A8BA 3NHQA 3BFDA 2Y2OA 4ZAMA 3UE0A 3C7VA 5AJGA 4RVAA 4JKTA 4GKUA 2QKPA 2XFTA 5A92A 2EX9A 4WUJA 5EVIC 2O9CA 4YFMA 4U0XA 4QWOA 2WK0A 4JXVA 4PAUA 5CEBA 2XROA 1W5DA 3CAXA 4OOMA 5HFOA 3BFGA 4EQIA 2J3WA 4IJGA 3UNWA 2XD5A 5MC7A 1FCOA 2BTFP 2RCXA 2K31A 4HBUA 5FASA 1UWPX 4I3AA 2Q0OA 4OP8A 1DRMA 2VKSA 1H8ZA 2ZC7A 1HVBA 3ZDJA 5A91A 1T18A 4NETA 2XK1A 3HL9A 5E2HA 5DF9A 4G3KA 4OPYA 4S2NC 1O7EA 2E8IA 3SOIA 2GZAA 5FQQA 4PKYA 1OPXA 4E3JA 3TOIA 4B4ZA 1KE3A 2WKHA 2XEPA 2W3FA 4EBLA 3IT9A 1EI5A 4ETXA 1ZKJA 4H8RA 1S66L 3NOTC 2P74A 3IX4A 4QPRA 1EROA 5FQ9A 5CTMA 2J80A 4HP4A 2Y2QA 4NXFA 4Q0HA 3VFFA 1XA7A 3L7HA 2INWA 3KYEA 3NOUC 1TS6A 3IHAA 5EUAA 3E4OA 3GR2A 5KIZA 3DTMA 4ZJ1A 1S1YA 3FG8A 4QY5A 3T12B 2WZZA 5TBMB 3CHWP 1SKFA 4MCWA 1PI4A 1O07A 2WUQA 1MBLA 4NEED 4N92A 4MBFA 3Q7VA 1E3UD 1TEMA 3BQ8A 3TRCA 1YLWA 5TBMA 1DP9A 3CITA 3O3VA 5E2GA 1NRFA 1ONGA 3KSHA 1OT6A 3V3SA 1L2SA 4P6ZS 1GCEA 1IKIA 1MKMA 1W8QA 5EOEA 1OTDA 4F94A 5HDDA 1LSXA 3A0SA 1PW8A 3LIEA 4R70A 1WE4A 1LL8A 4WL9A 3RTYA 3E4PA 4OP5A 1WA9A 3V67A 3HCYA 3V39A 4X69A 3OPLA 2A24B 5KSCA 1ZG4A 2EWVA 4Y0OA 3M6BA 3LY4A 3LUQA 1BYWA 5HX9A 3G4PA 5HD3A 1MPLA 4JBFA 1PWDA 3LIBA 5HW3A 1V9YA 2GJ3A 2VGLS 4JGRA 3LR5A 4UQIM 2QWSA 4G3VA 1IFQA 5EOOA 3T4JA 2D02A 3MQQA 3DTEA 1YT4A 5DFXA 2Z2MB 5DFYA 2OWJA 4X68A 2HP9A 4YINA 4MN7A 3G35A 3ZGAB 3O86A 5HAIA 4OONA 3MXRA 1KOUA 5F82A 3M2JA 4DE3A 1TVFA 1KE4A 3LFVA 3EQVA 4LGWA 2VGKA 5CGWA 3OPHA 3UE6A 4DDYA 4DF6A 3ZQ5A 2J3TD 3O88A 1I2WA 2G2WA 4HNBA 3T50A 1S1ZA 4R1GA 2W3GA 2PBDP 2HDQA 4LRZE 2C5WB 5FATA 1NYMA 1FR1A 4HJ4A 5G4ZA 2Y2NA 4BWIA 3RH8B 2V0WA 4JGQA 3DBAA 3OCLA 4UAAA 2EFUA 3BFEA 2XSSA 3UB8A 3U4LP 4EQ1A 3W8KA 1TS8A 3PBRA 3FYZA 2XRNA 4LENA 5IS1A 2YKFA 1GHIA 3DWZA 4BBTA 3OOVA 5HD5A 3S4XA 4ETZA 2P04A 3FKWA 4N9LA 2PU4A 3IWOA 4MMNA 3VE4A 2EX2A 5J4EA 2Z6DA 4EWFA 2JKRI
chains in the Genus database with same CATH topology
2Y8HA 4EEUA 4GHIA 2ZBBA 2PR6A 5DJUA 1LSVA 2A24A 1H8MA 4WEKA 2JKRM 4E04A 2KLIA 2QHKA 4IHQA 2O99A 3F1PA 3C8CA 1IOUA 3PBQA 2OAP1 4F3LB 4NXEA 2PYPA 1XJ3A 2VZWA 1F98A 4Q0JA 2J3TC 4O01A 4R38A 1D06A 4F3LA 4R3AA 4HH3A 2KDKA 2PDRA 3O5YA 3H82B 3D72A 3OCNA 3A0VA 3LYXA 3E4QA 1F5MA 2JKTI 1N9NA 2VV7A 3MXQA 3H82A 3LR0A 4OOLA 3VE3A 2W3DA 4WLAA 3K3DA 2JKTM 5DJTA 2V0UA 2WKPA 4HH2A 1W63Q 4HP9A 5FL3A 5J7EA 4HOIA 3MQ0A 1OT9A 1G6OA 4EUVA 2OAQ1 2BASA 1GSVA 4R6LA 5C5KA 1P97A 1S67L 4L0LA 3H7WB 4ARZB 4IUKA 3S7QA 2KX6A 2W1TB 4DN0A 1OTIA 4WELA 2V1BA 2A2LA 1ODVA 2K7SA 3H7WA 4ARZA 1TS0A 1XJ4A 4XT2B 2PR5A 1N9LA 1Y28A 2W1TA 4I5SA 2WKRA 2W0NA 3S7PA 2HGVA 4XT2A 2PHYA 4L9FA 4L9EA 4CLCC 2QJ5A 1UGUA 5G4YA 1YKDA 4HHDA 3EOIA 4GS9B 4I39A 1D7EA 1OTBA 4GW9A 4EESA 5HL6A 1GSXA 5HPIA 3K3CA 4GS9A 2GX5A 5HWTA 4H6JB 1P0ZA 2VJWA 4HY8A 4KQOA 1MC0A 3BQAA 3LIDA 3A0RA 4EU0A 4B9OA 3P01A 1H3QA 2I9VA 2CMNA 2P7JA 5HDSA 2XA7S 5F6AA 2VV6A 2XA7M 5CX7A 4CLCE 3GECA 4KUKA 2OWHA 5KSHA 2HV1A 3CI6A 3KSFA 4O8GA 2ZOIA 3F1NB 1S4RA 5A8BA 3G6OA 1P9WA 3NHQA 1YSQA 4MN6A 2QYBA 4IUHA 4PHTA 2P08A 3CLOA 5AJGA 3T4OA 3H9WA 2PD7A 1MZUA 3T4TA 2ZMVA 2QKPA 4WUJA 4YWZA 4PKYG 4MN5A 3EQUA 2O9CA 2G7UA 3B42A 3U2AA 3RFBA 3OC2A 3BWLA 4PAUA 4NXGA 1XJ2A 4GJ4A 2XROA 4B93A 3CAXA 4OOMA 4LRXC 1YAXA 2J3WA 4IJGA 5MC7A 2M7UA 2VV8A 2HJ9C 2HJEA 2K31A 4G3WA 1NRJA 1VHMA 1LT0A 3PR6A 3K2NA 4BBUA 4ME4A 1UWPX 2ZMFA 4GLQA 2EA9A 2FZ0A 4I3AA 1TS7A 1T19A 2JHEA 3B33A 5IU1A 3T4SA 4LLOB 4JGOA 1NWZA 4L9GA 4GCZA 1DRMA 2VKSA 4UEYA 5DKKA 1NLYA 3UMDA 1T18A 2MJ6A 2KOIA 4LPZA 2FH5A 5DF9A 4G3KA 2W27A 3LIFA 3KYZA 2GZAA 2LB5A 2VX8A 1OPXA 4PKYA 3UB6A 4LRYC 3JVVA 1T1CA 4I3IA 5AVFA 3OLOA 2W3FA 3FPVA 3UB7A 2L1MA 5K5BA 4EERA 4FOFA 5AVEA 3B47A 2JKRI 2VEAA 5L8MA 4ETXA 1S66L 1OTEA 3NOTC 4BMWA 2W3EA 3ULFA 2L0WA 4QPRA 1LSWA 3MR0A 2NUTC 3LIAA 5TJJA 5DKLA 2J80A 3PBTA 2PYRA 1G28A 1XJ6A 3GDIA 4HP4A 4NXFA 4Q0HA 1TD5A 1TF1A 2ZOHA 3BJNA 2INWA 3NOUC 1TS6A 3JVUA 2NUPC 3E98A 2IA2A 3E4OA 5KIZA 4H6JA 1W63M 3HJKA 5J3WA 1S1YA 3E0YA 3FG8A 1XFNA 4Y2FA 4KUOA 4Y5FA 1S4SA 2DMWA 3ZYTA 5TBMB 4DMZA 3T4LA 4MCWA 2O0YA 4NEED 3T4KA 1T1BA 3BQ8A 3C30A 4O0PA 3TRCA 5TBMA 1DP9A 3CITA 3EEAA 3F1NA 3KSHA 1OT6A 4HJ3A 4P6ZS 1MKMA 5HSQA 1OTDA 2QJ7A 3CUEA 1VB6A 2JN7A 2M7VA 5HDDA 1LSXA 3D3OA 4EXOA 3A0SA 3ICYA 3LIEA 2OOLA 2GNXA 4R70A 3HJIA 1LL8A 4WL9A 4I3JA 3E4PA 5LBRA 1WA9A 3RTYA 3V67A 3HCYA 4WF0A 4YNRA 2A24B 3CWFA 4EETB 2R78A 3KX0X 2EWVA 3MF0A 2L4RA 3LICA 4CLCD 3R7WB 3LUQA 1T1AA 3KSIA 5I5LA 1BYWA 1EW0A 5HWVA 2LB9A 5F68A 3FPWA 5HD3A 1F9IA 3LI8A 1OJGA 3R7WA 4RQ9A 4Y3IA 4BBVA 3EGDC 3UE3A 3BY8A 3IS2B 3VV4A 2Y79A 5HWWA 3LIBA 1V9YA 3KYQA 2GJ3A 5EFWA 1N9OA 2VGLS 5F5YA 2VGLM 3KSGA 4UQIS 3IS2A 4JGRA 4EW7A 3LR5A 4UQIM 3MFXA 2QWSA 5HPFA 4G3VA 1IFQA 3LI9A 3OBFA 3T4JA 3MMHA 4HJ6A 3C2WA 1OJ5A 2D02A 3MQQA 2B02A 4YOFA 5DFXA 2O9AA 5DFYA 2OWJA 3S7NA 1DP6A 2M1CA 1ZHHB 4CQHA 3EGXC 4K08A 4MN7A 3IBRA 3T4QA 4WN5A 1UWNX 4HI4A 1JNUA 3IBJA 1KOUA 4II7A 3TE8A 2O9BA 3CUEC 1X0OA 3BW6A 3LFVA 3EQVA 3S7OA 4HIAA 3UE6A 2V1AA 4NXBA 5F69A 2EWWA 2Z6CA 1XFQA 3MQOA 4NKPA 1V9ZA 3ZQ5A 2J3TD 4WEJA 1DP8A 3PXPA 3VOLA 4BJPA 3F1OB 4HNBA 2K2NA 3KO6A 3MJQA 3T50A 1S1ZA 2PD8A 2W3GA 3P7NA 2H28A 2B18A 4LRZE 3PHYA 3W2ZA 3LR3A 3NOPC 4HJ4A 3F1OA 5G4ZA 4Z1WA 4BWIA 3RH8B 2PT7A 4I38A 5HZHA 2V0WA 3FC7A 3PYPA 4JGQA 3DBAA 2WKQA 3OCLA 4MDZA 1STZA 2W1RA 5HDCA 2XSSA 4ZRRA 3BY9A 3PBNA 3UB8A 2VLGA 3TJZC 4EQ1A 1OTAA 1TS8A 5IT5A 3PBRA 3PBSA 3TW8A 4AFIA 1ZTUA 2XRNA 2D01A 3PBOA 4DJ2A 4Q0IA 2YKFA 3EWKA 5IS1A 4P6ZM 2HF6A 3R4KA 4FSFA 2YKHA 4BBTA 3OOVA 5HD5A 4DJ3A 4M4XA 3NJAA 4ETZA 4HQAA 2P04A 1P9RA 2W3HA 4JGPA 3UB9A 2VA0A 4CLCB 4MMNA 3VE4A 2V9AA 3EEHA 4GHIB 4EEPA 5J4EA 2Z6DA 3SW1A 1NLZA 1YSPA 3UMEA 4CLCA 1GSWA 3C38A 3F1PB 3LR4A 4KQDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EEU A;  4GHI A;  2ZBB A;  2PR6 A;  5DJU A;  1LSV A;  2A24 A;  4E04 A;  2QHK A;  3F1P A;  3C8C A;  4F3L B;  4NXE A;  2PYP A;  1XJ3 A;  1F98 A;  4R38 A;  1D06 A;  4F3L A;  4R3A A;  4HH3 A;  2KDK A;  2PDR A;  3H82 B;  3D72 A;  3A0V A;  3LYX A;  3E4Q A;  1N9N A;  2VV7 A;  3MXQ A;  3H82 A;  3VE3 A;  4WLA A;  3K3D A;  5DJT A;  2V0U A;  2WKP A;  4HH2 A;  4HP9 A;  5J7E A;  4HOI A;  1OT9 A;  2BAS A;  1GSV A;  4R6L A;  1P97 A;  1S67 L;  3H7W B;  2KX6 A;  1OTI A;  2V1B A;  1ODV A;  2K7S A;  3H7W A;  1TS0 A;  1XJ4 A;  4XT2 B;  2PR5 A;  1N9L A;  1Y28 A;  4I5S A;  2WKR A;  2W0N A;  4XT2 A;  2PHY A;  4L9F A;  4L9E A;  2QJ5 A;  1UGU A;  5G4Y A;  4HHD A;  4GS9 B;  4I39 A;  1D7E A;  1OTB A;  4GW9 A;  4EES A;  1GSX A;  3K3C A;  4GS9 A;  5HWT A;  4H6J B;  1P0Z A;  4HY8 A;  3LID A;  3A0R A;  4B9O A;  2I9V A;  2CMN A;  2P7J A;  5HDS A;  5F6A A;  2VV6 A;  3GEC A;  4KUK A;  2OWH A;  2HV1 A;  2ZOI A;  3F1N B;  1S4R A;  5A8B A;  3G6O A;  3NHQ A;  4MN6 A;  3CLO A;  3H9W A;  2PD7 A;  1MZU A;  2QKP A;  4WUJ A;  4YWZ A;  4PKY G;  4MN5 A;  3BWL A;  4NXG A;  1XJ2 A;  3CAX A;  4LRX C;  2VV8 A;  1LT0 A;  4BBU A;  1UWP X;  2EA9 A;  4I3A A;  1TS7 A;  1T19 A;  2JHE A;  3B33 A;  5IU1 A;  4LLO B;  4JGO A;  1NWZ A;  4L9G A;  4GCZ A;  1DRM A;  5DKK A;  3UMD A;  1T18 A;  4LPZ A;  2W27 A;  3LIF A;  4PKY A;  3UB6 A;  4LRY C;  1T1C A;  4I3I A;  5AVF A;  3OLO A;  3UB7 A;  2L1M A;  4EER A;  5AVE A;  2VEA A;  1S66 L;  1OTE A;  3NOT C;  3ULF A;  2L0W A;  1LSW A;  3MR0 A;  3LIA A;  5DKL A;  2J80 A;  2PYR A;  1G28 A;  1XJ6 A;  3GDI A;  4HP4 A;  4NXF A;  2ZOH A;  2INW A;  3NOU C;  1TS6 A;  3E4O A;  5KIZ A;  4H6J A;  3HJK A;  5J3W A;  1S1Y A;  3FG8 A;  1XFN A;  4KUO A;  1S4S A;  5TBM B;  1T1B A;  5TBM A;  1DP9 A;  3F1N A;  1OT6 A;  4HJ3 A;  5HSQ A;  1OTD A;  2QJ7 A;  1VB6 A;  2JN7 A;  5HDD A;  1LSX A;  4EXO A;  3A0S A;  3ICY A;  3LIE A;  2OOL A;  4R70 A;  1LL8 A;  3HJI A;  4WL9 A;  4I3J A;  3E4P A;  3RTY A;  1WA9 A;  4WF0 A;  2A24 B;  3CWF A;  4EET B;  2R78 A;  3KX0 X;  2L4R A;  3LIC A;  3LUQ A;  1T1A A;  5I5L A;  1BYW A;  1EW0 A;  5HWV A;  5F68 A;  5HD3 A;  1F9I A;  3LI8 A;  1OJG A;  4RQ9 A;  4BBV A;  3BY8 A;  3IS2 B;  5HWW A;  3LIB A;  1V9Y A;  2GJ3 A;  5EFW A;  1N9O A;  5F5Y A;  3IS2 A;  4JGR A;  4EW7 A;  3MFX A;  2QWS A;  3LI9 A;  4HJ6 A;  3C2W A;  1OJ5 A;  2D02 A;  3MQQ A;  2B02 A;  2OWJ A;  1DP6 A;  2M1C A;  4K08 A;  3IBR A;  4WN5 A;  1UWN X;  4HI4 A;  1JNU A;  1KOU A;  1X0O A;  4HIA A;  3UE6 A;  2V1A A;  4NXB A;  5F69 A;  2Z6C A;  1XFQ A;  3MQO A;  1V9Z A;  3ZQ5 A;  1DP8 A;  3VOL A;  3F1O B;  4HNB A;  3MJQ A;  3T50 A;  1S1Z A;  2PD8 A;  3P7N A;  2H28 A;  4LRZ E;  3PHY A;  3NOP C;  4HJ4 A;  3F1O A;  5G4Z A;  3RH8 B;  4I38 A;  5HZH A;  2V0W A;  3FC7 A;  3PYP A;  4JGQ A;  2WKQ A;  5HDC A;  3BY9 A;  3UB8 A;  2VLG A;  4EQ1 A;  1OTA A;  1TS8 A;  2D01 A;  4DJ2 A;  5IS1 A;  2YKF A;  3EWK A;  2YKH A;  4BBT A;  5HD5 A;  4DJ3 A;  4M4X A;  3NJA A;  4HQA A;  4JGP A;  3UB9 A;  3VE4 A;  2V9A A;  3EEH A;  4GHI B;  4EEP A;  5J4E A;  2Z6D A;  3SW1 A;  3UME A;  1GSW A;  3F1P B;  4KQD A; 
#chains in the Genus database with same CATH topology
 4EEU A;  4WEK A;  4NG2 A;  2JKR M;  4GDN A;  4E04 A;  3G2Y A;  2QHK A;  4B4X A;  2O99 A;  1IOU A;  1WYC A;  1LI0 A;  2UV0 E;  2G2U A;  4E3K A;  1CJF A;  4R38 A;  2C6W B;  3QP8 A;  5FDS A;  3H82 B;  3SH8 A;  1XGI A;  4UA9 A;  5GHX A;  3LYX A;  1F5M A;  1N9N A;  5AQ9 A;  3H82 A;  4E3M A;  4WLA A;  3IXD A;  4JF5 A;  4HP9 A;  5GLD A;  3HLC A;  4EUV A;  2BG1 A;  5DTT A;  4E3I A;  2BAS A;  2HPB A;  1JTD A;  5IHV A;  3NI9 A;  1IKG A;  5J8X A;  4WZ4 A;  3Q1F A;  2V1B A;  2K7S A;  2EX6 A;  5L10 A;  1XJ4 A;  4XT2 B;  2VGJ A;  3ZNY A;  1L0F A;  2BLS A;  4XT2 A;  1M40 A;  2PHY A;  1K55 A;  4L9F A;  4CLC C;  1MY8 A;  2P9V A;  3OPR A;  3BFC A;  3ZG7 B;  1GSX A;  3GRJ A;  1RP5 A;  2V8C A;  1MC0 A;  4EU0 A;  4LFU A;  4B9O A;  3IF6 B;  4E3N A;  1KDW A;  3T1X A;  1XA1 A;  2CMN A;  2P7J A;  4CJN A;  5TGF A;  1LI9 A;  2VV6 A;  1Z6F A;  2HV1 A;  3CI6 A;  3KSF A;  4OQH A;  5HL1 A;  1LL9 A;  3G6O A;  5FSR A;  1PWG A;  4IUH A;  4HEF A;  4DXC A;  1NY0 A;  3CLO A;  3NCK A;  2WGI A;  1MZU A;  3MZD A;  4S2P A;  4PKY G;  4MN5 A;  1SKO B;  3EQU A;  2HDS A;  3B42 A;  4OKP A;  5CED A;  1SKO A;  5FI7 A;  1SHV A;  1G6A A;  5FAP A;  1NRJ A;  1LT0 A;  4BBU A;  5L07 A;  4ZJ3 A;  4GLQ A;  2EA9 A;  3NBL A;  1IYS A;  2FFF B;  3VOZ A;  2JHE A;  3MS6 A;  3T4S A;  4LLO B;  2ZJ9 A;  1KVL A;  3C4O A;  4L9G A;  4UEY A;  4JXS A;  1NLY A;  3UMD A;  1VET B;  3CPT B;  3HUN A;  2MJ6 A;  3BLM A;  1SCW A;  4LV2 A;  2PRF A;  4LPZ A;  3IQA A;  4PPR A;  1K54 A;  1VET A;  3CPT A;  1FR6 A;  3KYZ A;  4IVK A;  2VX8 A;  4X25 A;  3UB6 A;  4K91 A;  1T1C A;  1F2K A;  4E3L A;  1PZP A;  3UB7 A;  3HVF A;  4R23 A;  4DXB A;  3B47 A;  4BD1 A;  3ZCZ A;  3UB5 P;  4JF4 A;  1ERM A;  3ULF A;  4IVI A;  3C7U A;  3LIA A;  5TJJ A;  5DKL A;  3AGF A;  3G34 A;  4EUZ A;  2ZOH A;  4K0X A;  2ZC4 B;  1YLZ A;  2QPN A;  5F1G A;  3IH9 A;  1RGZ A;  2NUP C;  4H6J A;  4XUZ A;  5FQK A;  3E0Y A;  2ZM0 A;  1XFN A;  4Y2F A;  2E8J A;  4KQR A;  4Y5F A;  2Y4A A;  4KZ7 A;  3T1S A;  1S4S A;  4WZ5 C;  4R4S A;  3ZYT A;  2O0Y A;  2CC1 A;  5TR7 A;  1T1B A;  3C30 A;  3HRE A;  5EM0 A;  4O0P A;  1DY6 A;  3N7W A;  3EEA A;  4QHC A;  1YLP A;  4HJ3 A;  2WAD A;  1KGG A;  1PYY A;  5FQJ A;  3CUE A;  1PWC A;  4XXR A;  3MFD A;  3HUM A;  3ZG5 A;  4DE1 A;  3DTK A;  3DWK A;  2GNX A;  2H5S A;  1K0K A;  4YNR A;  1K56 A;  5GL9 A;  2R9X A;  3GQZ A;  3MF0 A;  2IWB A;  3LIC A;  2DRW A;  3R7W B;  4GN2 A;  1T1A A;  5HWV A;  2LB9 A;  4FCF A;  5F68 A;  5E43 A;  1PFL A;  3FPW A;  3QP6 A;  1F9I A;  1OJG A;  4OQ0 A;  3R7W A;  1IEM A;  4KZA A;  4RQ9 A;  3EGD C;  1K57 C;  3UE3 A;  1YM1 A;  2OLV A;  3Q07 A;  1ESU A;  1AWI A;  2PAV P;  2X71 A;  3L9K A;  3E2K A;  1FCN A;  2VGL M;  3KSG A;  3VSK A;  1KGF A;  5HPF A;  3FKV A;  3HLD A;  3LI9 A;  1JWV A;  4KG5 A;  1ESI A;  2B02 A;  4BL3 A;  2O9A A;  1SZV A;  1ZHH B;  3IBR A;  2GDN A;  4WN5 A;  2EXA A;  3C5A A;  4HI4 A;  4KG6 A;  1JNU A;  2DCF A;  5FAO A;  5DF8 A;  2EX8 A;  5EVI D;  2EXB A;  3MSH A;  5I94 A;  3VOY A;  4HIA A;  1FCM A;  5F69 A;  2UWX A;  2EWW A;  3MQO A;  1K6S A;  3PXP A;  2ACG A;  5EVE A;  4BJP A;  3KO6 A;  1E25 A;  3MJQ A;  2XFS A;  4O7D A;  2B18 A;  3LR3 A;  1MWR A;  1CI8 A;  4MBK A;  3G2Z A;  3GTC A;  1ZC2 A;  2OV5 A;  1L3L A;  1YQS A;  2WKQ A;  3LO7 A;  4MDZ A;  1BT5 A;  5HDC A;  3A3I A;  3PBN A;  4WMC D;  3C4P A;  4ZJ2 A;  4RX2 A;  5IT5 A;  5EPH A;  3DW0 A;  1PRQ A;  4DJ2 A;  3EWK A;  2Y2G A;  1W8Y A;  3R4K A;  1C3B A;  3NJA A;  3NEC A;  1CK3 A;  4JGP A;  2W3H A;  2I72 A;  4WBG A;  5DTK A;  2ZQC A;  3EEH A;  3DTI A;  1NLZ A;  1YSP A;  3UME A;  4HES A;  3C38 A;  3F1P B;  4KQD A;  2Y8H A;  3MKF A;  2ZBB A;  2XR0 A;  1LSV A;  2A24 A;  3JPU A;  2ZL1 B;  5U47 A;  3SS4 A;  3F1P A;  4F3L B;  2PYP A;  2ZL1 A;  1ALQ A;  2J3T C;  4LV3 A;  5GHY A;  1YLT A;  1MXO A;  4X53 A;  1D06 A;  3IH8 A;  4F3L A;  4R3A A;  1K55 C;  2KDK A;  2WGW B;  3UPP A;  3D72 A;  3A0V A;  4KG2 A;  5CGS A;  2VV7 A;  3MXQ A;  5FI6 A;  3VE3 A;  2W3D A;  3K3D A;  4N9K A;  4M3K A;  1W7F A;  2Z2L B;  1KVM A;  1OT9 A;  1AXB A;  4D60 A;  5EVI B;  5FEF A;  4R6L A;  4CPK A;  3H7W B;  4ARZ B;  2XH9 A;  2EFX A;  1ERQ A;  1PNE A;  3S7Q A;  5EVI A;  3MKE A;  3H7W A;  4ARZ A;  1TS0 A;  3WS1 A;  3VP0 A;  2ZC5 B;  4A5R A;  4OQG A;  2WKR A;  5L2F A;  3VSL A;  3S7P A;  2ZQ9 A;  1K25 A;  3QP2 A;  4L9E A;  3TSG A;  3NIA A;  2WYX A;  4OPR A;  3VP4 A;  4XUX A;  4I39 A;  1D7E A;  2A49 A;  4EES A;  3GSG A;  2GX5 A;  1L0E A;  4WMC A;  1NJ4 A;  1NXY A;  3P01 A;  4S2N A;  4S2M A;  1M6K A;  1H3Q A;  5CEC A;  3V50 A;  4N1X A;  2XA7 S;  5FQI A;  4CLC E;  1Q2P A;  3GEC A;  4KUK A;  1HTZ A;  2OWH A;  1XXM A;  3F1N B;  2Q9N A;  1S4R A;  2QMI A;  1YSQ A;  2QYB A;  4DE2 A;  1K54 C;  1CEG A;  4ZBE A;  3HUO A;  4PHT A;  3T4O A;  2PD7 A;  3A3F A;  5G18 A;  5CXW A;  1BTL A;  3Q81 A;  5AQ7 A;  4PMA A;  4YWZ A;  4LCM A;  3RJU A;  4C6Y A;  2WKE A;  3RFB A;  3OC2 A;  3BWL A;  1PW1 A;  4PM5 A;  3D4F A;  4NXG A;  4P6B A;  2H10 A;  3GMW A;  1XJ2 A;  3Q82 A;  4GJ4 A;  4B93 A;  4LRX C;  1YAX A;  2XGN A;  2VV8 A;  3D9Y A;  3ZG9 B;  2HJE A;  3N8R A;  4G3W A;  2J7V A;  4JF6 A;  5EE8 A;  2JBF A;  3K2N A;  4ME4 A;  2ZMF A;  5M19 A;  5F83 A;  3QP1 A;  1T19 A;  5FQM A;  3WS4 A;  2ZMA A;  1FQG A;  3SH9 A;  3MZF A;  4KZ9 A;  4B88 A;  2W27 A;  3LIF A;  4OPQ A;  3W4P A;  4OLD A;  5FI2 A;  5FEG A;  4LRY C;  3IWQ A;  1IYP A;  1CF0 A;  5AVF A;  2JKF A;  3OLO A;  4Y13 A;  3N4I A;  3FPV A;  3MXS A;  2L1M A;  3ZG8 B;  5K5B A;  4FOF A;  4GOG A;  5AVE A;  1PIO A;  2XDM A;  2VEA A;  5L8M A;  2WAE A;  1BLC A;  4QB8 A;  1OTE A;  3TG9 A;  2W3E A;  4R0Q A;  1LSW A;  3MR0 A;  2NUT C;  3UY6 A;  4GD8 A;  3PBT A;  3QNB A;  1G28 A;  1XJ6 A;  2B95 A;  2JCH A;  3BJN A;  4S2K A;  3N8S A;  4OVD A;  3I7J A;  5J3W A;  5HAQ A;  4KUO A;  3IF6 A;  2DMW A;  4DMZ A;  4S2L A;  3T4L A;  3P98 A;  3LEZ A;  4R4R A;  1BSG A;  1D1J A;  1MWU A;  1GHP A;  2Y2I A;  4S2J A;  4X56 A;  2QJ7 A;  5FA7 A;  5GLA A;  3RXW A;  1VB6 A;  1H5X A;  3D3O A;  4EXO A;  3ICY A;  3HLB A;  2OOL A;  3HJI A;  4I3J A;  1E4D A;  4WF0 A;  2ZM8 A;  4X55 A;  1PI5 A;  4KZ6 A;  1GHM A;  1K56 D;  2R78 A;  1BUE A;  1NZO A;  5EV0 A;  4CLC D;  3NDE A;  1DJB A;  2FFY A;  3KSI A;  1IEL A;  1JWP A;  2PU2 A;  3ITB A;  3HLF A;  4BBV A;  4U3T A;  3BY8 A;  1BLS A;  5HWW A;  3BLS A;  5EFW A;  1N9O A;  5F5Y A;  2HP6 A;  1EWZ A;  4JXW A;  3MFX A;  3SS3 A;  2A3U A;  3FV7 A;  3MMH A;  1K38 A;  4HJ6 A;  5FDH A;  5CHJ A;  3C2W A;  3WS5 A;  1QME A;  3FWL A;  4BL2 A;  3LEQ A;  3HLW A;  4D2O A;  2OSU A;  3S7N A;  4CQH A;  3EGX C;  3T4Q A;  3VP1 A;  3AGD A;  1A0K A;  3VP3 A;  3IBJ A;  1ES5 A;  4FD8 A;  1X0O A;  3BW6 A;  1KDS A;  3S7O A;  3BEC A;  4X1M A;  4E6X A;  3VP2 A;  4NXB A;  4FH2 A;  2ZLY A;  1MKI A;  5E2E A;  1XFQ A;  2HP5 A;  4Y15 A;  4NKP A;  4LV1 A;  4WEJ A;  3VMA A;  1DP8 A;  4JXG A;  3VOL A;  1NZU A;  3F1O B;  3ISG A;  2WZX A;  3P7N A;  2H28 A;  1BLP A;  3PHY A;  5FAQ A;  5GLC A;  4FUW A;  3W2Z A;  3F1O A;  2X01 A;  2V1Z A;  1S0W A;  2PT7 A;  5HZH A;  4JLF A;  2ZQD A;  1STZ A;  2W1R A;  4PM9 A;  3P09 A;  1OTA A;  4PM8 A;  3TW8 A;  3PBS A;  3GV9 A;  2H0Y A;  4AFI A;  3PBO A;  1XGJ A;  1XKZ A;  4OLG A;  4P6Z M;  4Q8I A;  2HF6 A;  4E3O A;  2YKH A;  1J9M A;  4OPZ A;  4X6T A;  4M4X A;  4PM7 A;  3UB9 A;  2VA0 A;  4CLC B;  1H0M A;  3IX3 A;  2V9A A;  4GHI B;  4Y7P A;  3SW1 A;  4GZB A;  3RXX A;  4CLC A;  4EBP A;  5CHM A;  4GHI A;  1L0D A;  1U60 A;  4S2O A;  3GVB A;  3T1Q B;  3LGO A;  2KLI A;  4IHQ A;  3PBQ A;  4NXE A;  1F98 A;  4Q0J A;  3UN7 A;  5AQB A;  4HH3 A;  1H8Y A;  4BQM A;  2J9O A;  3O5Y A;  3BEB A;  1QMF A;  3A3J A;  5DTS A;  4DE0 A;  1CQA A;  2ZQ8 A;  3LR0 A;  1PZO A;  4R3J A;  4KZB A;  3G31 A;  4HH2 A;  3NC8 A;  1W63 Q;  5FL3 A;  5J7E A;  4HOI A;  1G6O A;  1ZG6 A;  2JC7 A;  5M1A A;  3ZVW A;  4MNR A;  1S67 L;  4L0L A;  4IUK A;  2KX6 A;  1MWS A;  4DN0 A;  1OTI A;  4UA7 A;  2A2L A;  1ODV A;  4DRT A;  1VM1 A;  2PR5 A;  1N9L A;  1Y28 A;  4I5S A;  1BZA A;  5EM1 A;  5GLB A;  2QJ5 A;  1UGU A;  5G4Y A;  1GA0 A;  2ZM2 A;  4HHD A;  4GS9 B;  3PAG A;  5KMW A;  4IBR A;  3W4O A;  1Q2Q A;  1OTB A;  4GW9 A;  5HPI A;  3CG5 A;  3CZD A;  3K3C A;  4GS9 A;  4GB7 A;  5HWT A;  2V8F A;  1FOF A;  1J3W A;  4C3Q A;  4KQO A;  3BQA A;  2Y2J A;  5A90 A;  4QU3 A;  2H0T A;  1ES3 A;  3MBZ A;  4QD4 A;  4ID4 A;  3WS0 A;  3HLG A;  1I5Q A;  3Q7V B;  2XA7 M;  2DNS A;  5KSH A;  2V2F F;  2ZOI A;  3IF5 A;  2XD1 A;  1G68 A;  1P9W A;  4KZ3 A;  4MN6 A;  1FIK A;  3LY3 A;  2P08 A;  3H9W A;  3T4T A;  2ZMV A;  4RYE A;  1CEF A;  4IBX A;  2ZQA A;  2G7U A;  3V3R A;  4ESP A;  3U2A A;  2Y2P A;  3B3X A;  3N6I A;  2Y91 A;  4IED A;  2IWD A;  1N9B A;  3G30 A;  2M7U A;  2HJ9 C;  4RA7 A;  3QNC A;  3V5M A;  1VHM A;  3PR6 A;  4DKI A;  2WKI A;  4RX3 A;  2Y2K A;  2FZ0 A;  2Y2H A;  1TS7 A;  3B33 A;  2HDR A;  5CRF A;  4FTX A;  2WGW A;  4WZ5 A;  5IU1 A;  4JGO A;  1NWZ A;  4GCZ A;  5DKK A;  2HDU A;  3WWX A;  2KOI A;  2FH5 A;  1YPR A;  3MZE A;  5KZH A;  2LB5 A;  3IF6 C;  3JVV A;  3A3E A;  2HZ5 A;  4I3I A;  1ES4 A;  1LLB A;  4GNU A;  1FSW A;  1XX2 A;  3WS2 A;  5JYO A;  4EER A;  1ONH A;  1JVJ A;  3LCE A;  3NY4 A;  4BMW A;  1K4E A;  4GDB A;  2L0W A;  2Y2M A;  3Q7Z A;  2IWC A;  3JYI A;  1K57 A;  2PYR A;  3UDI A;  3GDI A;  4BD0 A;  4MLL A;  1TD5 A;  1TF1 A;  1YLY A;  4PM6 A;  5CTN A;  3S1Y A;  1Y4O A;  1BUL A;  2X02 A;  4P85 A;  3JVU A;  3E98 A;  3ZG0 A;  2IA2 A;  4P0M A;  1W63 M;  3NDG A;  3HJK A;  4QY6 A;  3SS5 A;  1HD8 A;  3IXB A;  4HBT A;  4BLM A;  1E3U A;  3UDF A;  3T4K A;  2R9W A;  3CMZ A;  4NK3 A;  3F1N A;  2XLN A;  4N1H A;  2VK3 A;  4KEN B;  5HSQ A;  3OZH A;  2JN7 A;  2M7V A;  4ZTK A;  1MWT A;  5A93 A;  1Y54 A;  3M6H A;  4R3B A;  2B5R A;  5LBR A;  5CHU A;  4OOY A;  1YLJ A;  4WM9 A;  3CWF A;  5DVA A;  4EET B;  4UHU A;  3KX0 X;  2L4R A;  4MEZ A;  3M2K A;  5I5L A;  1EW0 A;  3LI8 A;  3VFH A;  5BOH A;  4Y3I A;  3IS2 B;  3VV4 A;  3OPP A;  2Y79 A;  4U0T A;  4K0W A;  3KYQ A;  1RCJ A;  3UPO A;  4UQI S;  5L09 A;  4KQQ A;  2PBY A;  3IS2 A;  4EW7 A;  3IX8 A;  3T1R A;  4DDS A;  3E2L A;  3OBF A;  5AQA A;  2XF3 A;  3IHB A;  3O87 A;  4S2I A;  4Y17 A;  1OJ5 A;  1OME A;  4KZ8 A;  4YOF A;  3IXG A;  3BYD A;  1XP4 A;  1DP6 A;  2M1C A;  4K08 A;  4KZ5 A;  2WAF A;  1S6R A;  1UWN X;  2ZC6 B;  4II7 A;  3TE8 A;  2ZC3 B;  2XQZ A;  2O9B A;  1XPB A;  3CUE C;  3W4Q A;  1I2S A;  2V1A A;  2Z6C A;  1V9Z A;  2P9V B;  3WRZ A;  2K2N A;  2PD8 A;  2V20 A;  3UDX A;  3QHY A;  3NOP C;  2WGV A;  4Z1W A;  4I38 A;  5M18 A;  3ZHH A;  3A3D A;  3FC7 A;  3PYP A;  4LCL A;  1WYB A;  3ITA A;  2QZ6 A;  4ZRR A;  3S22 A;  3BY9 A;  4KZ4 A;  3UPN A;  2VLG A;  3TJZ C;  5EEC A;  1TDL A;  5E2F A;  3UE1 A;  1ZTU A;  2D01 A;  3HBR A;  4Q0I A;  4OQI A;  5HAP A;  4FSF A;  1FSY A;  3IXH A;  1RGY A;  4DJ3 A;  4QJG A;  1GA9 A;  1N4O A;  3BM6 A;  2Y59 A;  4HQA A;  1P9R A;  4ZDX A;  4LV0 A;  1IYO A;  4EEP A;  1VEU B;  3HLE A;  3PAE A;  1GSW A;  1G5U A;  3LR4 A;  1K6R A;  1JTG A;  1DJA A;  1ACF A;  2Y55 A;  2PR6 A;  1VEU A;  5DJU A;  2Q9M A;  1H8M A;  3C8C A;  2JKG A;  3N8L A;  2Y2L A;  2OAP 1;  3WRT A;  2VZW A;  1XJ3 A;  1BLH A;  1LL5 A;  4X1L A;  1VQQ A;  4O01 A;  3ZVT A;  1YMX A;  3UO9 A;  1FIL A;  3BRM A;  3NUL A;  4C75 A;  4Y0T A;  3FZC A;  2PDR A;  3OCN A;  1LHY A;  5F1F A;  1IYQ A;  3E4Q A;  2JKT I;  5EVL A;  1HZO A;  4OOL A;  3SZT A;  4JPM A;  4WYY A;  2JKT M;  5DJT A;  2V0U A;  2WKP A;  3QP5 A;  5GHZ A;  1W79 A;  2ZD8 A;  3MQ0 A;  4EBN A;  4Z9Q A;  1TDG A;  4GD6 A;  2OAQ 1;  1GSV A;  2AVX A;  5C5K A;  3IWI A;  1P97 A;  2J8Y A;  2W1T B;  4UA6 A;  4WEL A;  5DF7 A;  2ZQ7 A;  1YMS A;  2OLU A;  1Z09 A;  4Y0U A;  2W1T A;  3BFF A;  2W0N A;  1CI9 A;  4EV4 A;  1SDN A;  2HGV A;  5TFQ A;  1HLU P;  1KE0 A;  5D3O A;  1YKD A;  3EOI A;  2JE5 A;  1KGE A;  4OH0 A;  3QP4 A;  3DAV A;  4FH4 A;  5HL6 A;  5CER A;  5CGX A;  3AGE A;  3G32 A;  4H6J B;  1P0Z A;  2VJW A;  4HY8 A;  3LID A;  3A0R A;  4MBH A;  1K4F A;  2RL3 A;  3CJM A;  1ES2 A;  4E6W A;  1L0G A;  1SDE A;  3PTE A;  5HAR A;  4BEN A;  2I9V A;  5HDS A;  2J9P A;  3ZFZ A;  1JWZ A;  3SH7 A;  5F6A A;  5CX7 A;  3ZNT A;  1DJC A;  4O8G A;  5JYP A;  4P87 A;  1NYY A;  5A8B A;  3NHQ A;  3BFD A;  2Y2O A;  4ZAM A;  3UE0 A;  3C7V A;  5AJG A;  4RVA A;  4JKT A;  4GKU A;  2QKP A;  2XFT A;  5A92 A;  2EX9 A;  4WUJ A;  5EVI C;  2O9C A;  4YFM A;  4U0X A;  4QWO A;  2WK0 A;  4JXV A;  4PAU A;  5CEB A;  2XRO A;  1W5D A;  3CAX A;  4OOM A;  5HFO A;  3BFG A;  4EQI A;  2J3W A;  4IJG A;  3UNW A;  2XD5 A;  5MC7 A;  1FCO A;  2BTF P;  2RCX A;  2K31 A;  4HBU A;  5FAS A;  1UWP X;  4I3A A;  2Q0O A;  4OP8 A;  1DRM A;  2VKS A;  1H8Z A;  2ZC7 A;  1HVB A;  3ZDJ A;  5A91 A;  1T18 A;  4NET A;  2XK1 A;  3HL9 A;  5E2H A;  5DF9 A;  4G3K A;  4OPY A;  4S2N C;  1O7E A;  2E8I A;  3SOI A;  2GZA A;  5FQQ A;  4PKY A;  1OPX A;  4E3J A;  3TOI A;  4B4Z A;  1KE3 A;  2WKH A;  2XEP A;  2W3F A;  4EBL A;  3IT9 A;  1EI5 A;  4ETX A;  1ZKJ A;  4H8R A;  1S66 L;  3NOT C;  2P74 A;  3IX4 A;  4QPR A;  1ERO A;  5FQ9 A;  5CTM A;  2J80 A;  4HP4 A;  2Y2Q A;  4NXF A;  4Q0H A;  3VFF A;  1XA7 A;  3L7H A;  2INW A;  3KYE A;  3NOU C;  1TS6 A;  3IHA A;  5EUA A;  3E4O A;  3GR2 A;  5KIZ A;  3DTM A;  4ZJ1 A;  1S1Y A;  3FG8 A;  4QY5 A;  3T12 B;  2WZZ A;  5TBM B;  3CHW P;  1SKF A;  4MCW A;  1PI4 A;  1O07 A;  2WUQ A;  1MBL A;  4NEE D;  4N92 A;  4MBF A;  3Q7V A;  1E3U D;  1TEM A;  3BQ8 A;  3TRC A;  1YLW A;  5TBM A;  1DP9 A;  3CIT A;  3O3V A;  5E2G A;  1NRF A;  1ONG A;  3KSH A;  1OT6 A;  3V3S A;  1L2S A;  4P6Z S;  1GCE A;  1IKI A;  1MKM A;  1W8Q A;  5EOE A;  1OTD A;  4F94 A;  5HDD A;  1LSX A;  3A0S A;  1PW8 A;  3LIE A;  4R70 A;  1WE4 A;  1LL8 A;  4WL9 A;  3RTY A;  3E4P A;  4OP5 A;  1WA9 A;  3V67 A;  3HCY A;  3V39 A;  4X69 A;  3OPL A;  2A24 B;  5KSC A;  1ZG4 A;  2EWV A;  4Y0O A;  3M6B A;  3LY4 A;  3LUQ A;  1BYW A;  5HX9 A;  3G4P A;  5HD3 A;  1MPL A;  4JBF A;  1PWD A;  3LIB A;  5HW3 A;  1V9Y A;  2GJ3 A;  2VGL S;  4JGR A;  3LR5 A;  4UQI M;  2QWS A;  4G3V A;  1IFQ A;  5EOO A;  3T4J A;  2D02 A;  3MQQ A;  3DTE A;  1YT4 A;  5DFX A;  2Z2M B;  5DFY A;  2OWJ A;  4X68 A;  2HP9 A;  4YIN A;  4MN7 A;  3G35 A;  3ZGA B;  3O86 A;  5HAI A;  4OON A;  3MXR A;  1KOU A;  5F82 A;  3M2J A;  4DE3 A;  1TVF A;  1KE4 A;  3LFV A;  3EQV A;  4LGW A;  2VGK A;  5CGW A;  3OPH A;  3UE6 A;  4DDY A;  4DF6 A;  3ZQ5 A;  2J3T D;  3O88 A;  1I2W A;  2G2W A;  4HNB A;  3T50 A;  1S1Z A;  4R1G A;  2W3G A;  2PBD P;  2HDQ A;  4LRZ E;  2C5W B;  5FAT A;  1NYM A;  1FR1 A;  4HJ4 A;  5G4Z A;  2Y2N A;  4BWI A;  3RH8 B;  2V0W A;  4JGQ A;  3DBA A;  3OCL A;  4UAA A;  2EFU A;  3BFE A;  2XSS A;  3UB8 A;  3U4L P;  4EQ1 A;  3W8K A;  1TS8 A;  3PBR A;  3FYZ A;  2XRN A;  4LEN A;  5IS1 A;  2YKF A;  1GHI A;  3DWZ A;  4BBT A;  3OOV A;  5HD5 A;  3S4X A;  4ETZ A;  2P04 A;  3FKW A;  4N9L A;  2PU4 A;  3IWO A;  4MMN A;  3VE4 A;  2EX2 A;  5J4E A;  2Z6D A;  4EWF A;  2JKR I; 
#chains in the Genus database with same CATH homology
 2Y8H A;  4EEU A;  4GHI A;  2ZBB A;  2PR6 A;  5DJU A;  1LSV A;  2A24 A;  1H8M A;  4WEK A;  2JKR M;  4E04 A;  2KLI A;  2QHK A;  4IHQ A;  2O99 A;  3F1P A;  3C8C A;  1IOU A;  3PBQ A;  2OAP 1;  4F3L B;  4NXE A;  2PYP A;  1XJ3 A;  2VZW A;  1F98 A;  4Q0J A;  2J3T C;  4O01 A;  4R38 A;  1D06 A;  4F3L A;  4R3A A;  4HH3 A;  2KDK A;  2PDR A;  3O5Y A;  3H82 B;  3D72 A;  3OCN A;  3A0V A;  3LYX A;  3E4Q A;  1F5M A;  2JKT I;  1N9N A;  2VV7 A;  3MXQ A;  3H82 A;  3LR0 A;  4OOL A;  3VE3 A;  2W3D A;  4WLA A;  3K3D A;  2JKT M;  5DJT A;  2V0U A;  2WKP A;  4HH2 A;  1W63 Q;  4HP9 A;  5FL3 A;  5J7E A;  4HOI A;  3MQ0 A;  1OT9 A;  1G6O A;  4EUV A;  2OAQ 1;  2BAS A;  1GSV A;  4R6L A;  5C5K A;  1P97 A;  1S67 L;  4L0L A;  3H7W B;  4ARZ B;  4IUK A;  3S7Q A;  2KX6 A;  2W1T B;  4DN0 A;  1OTI A;  4WEL A;  2V1B A;  2A2L A;  1ODV A;  2K7S A;  3H7W A;  4ARZ A;  1TS0 A;  1XJ4 A;  4XT2 B;  2PR5 A;  1N9L A;  1Y28 A;  2W1T A;  4I5S A;  2WKR A;  2W0N A;  3S7P A;  2HGV A;  4XT2 A;  2PHY A;  4L9F A;  4L9E A;  4CLC C;  2QJ5 A;  1UGU A;  5G4Y A;  1YKD A;  4HHD A;  3EOI A;  4GS9 B;  4I39 A;  1D7E A;  1OTB A;  4GW9 A;  4EES A;  5HL6 A;  1GSX A;  5HPI A;  3K3C A;  4GS9 A;  2GX5 A;  5HWT A;  4H6J B;  1P0Z A;  2VJW A;  4HY8 A;  4KQO A;  1MC0 A;  3BQA A;  3LID A;  3A0R A;  4EU0 A;  4B9O A;  3P01 A;  1H3Q A;  2I9V A;  2CMN A;  2P7J A;  5HDS A;  2XA7 S;  5F6A A;  2VV6 A;  2XA7 M;  5CX7 A;  4CLC E;  3GEC A;  4KUK A;  2OWH A;  5KSH A;  2HV1 A;  3CI6 A;  3KSF A;  4O8G A;  2ZOI A;  3F1N B;  1S4R A;  5A8B A;  3G6O A;  1P9W A;  3NHQ A;  1YSQ A;  4MN6 A;  2QYB A;  4IUH A;  4PHT A;  2P08 A;  3CLO A;  5AJG A;  3T4O A;  3H9W A;  2PD7 A;  1MZU A;  3T4T A;  2ZMV A;  2QKP A;  4WUJ A;  4YWZ A;  4PKY G;  4MN5 A;  3EQU A;  2O9C A;  2G7U A;  3B42 A;  3U2A A;  3RFB A;  3OC2 A;  3BWL A;  4PAU A;  4NXG A;  1XJ2 A;  4GJ4 A;  2XRO A;  4B93 A;  3CAX A;  4OOM A;  4LRX C;  1YAX A;  2J3W A;  4IJG A;  5MC7 A;  2M7U A;  2VV8 A;  2HJ9 C;  2HJE A;  2K31 A;  4G3W A;  1NRJ A;  1VHM A;  1LT0 A;  3PR6 A;  3K2N A;  4BBU A;  4ME4 A;  1UWP X;  2ZMF A;  4GLQ A;  2EA9 A;  2FZ0 A;  4I3A A;  1TS7 A;  1T19 A;  2JHE A;  3B33 A;  5IU1 A;  3T4S A;  4LLO B;  4JGO A;  1NWZ A;  4L9G A;  4GCZ A;  1DRM A;  2VKS A;  4UEY A;  5DKK A;  1NLY A;  3UMD A;  1T18 A;  2MJ6 A;  2KOI A;  4LPZ A;  2FH5 A;  5DF9 A;  4G3K A;  2W27 A;  3LIF A;  3KYZ A;  2GZA A;  2LB5 A;  2VX8 A;  1OPX A;  4PKY A;  3UB6 A;  4LRY C;  3JVV A;  1T1C A;  4I3I A;  5AVF A;  3OLO A;  2W3F A;  3FPV A;  3UB7 A;  2L1M A;  5K5B A;  4EER A;  4FOF A;  5AVE A;  3B47 A;  2JKR I;  2VEA A;  5L8M A;  4ETX A;  1S66 L;  1OTE A;  3NOT C;  4BMW A;  2W3E A;  3ULF A;  2L0W A;  4QPR A;  1LSW A;  3MR0 A;  2NUT C;  3LIA A;  5TJJ A;  5DKL A;  2J80 A;  3PBT A;  2PYR A;  1G28 A;  1XJ6 A;  3GDI A;  4HP4 A;  4NXF A;  4Q0H A;  1TD5 A;  1TF1 A;  2ZOH A;  3BJN A;  2INW A;  3NOU C;  1TS6 A;  3JVU A;  2NUP C;  3E98 A;  2IA2 A;  3E4O A;  5KIZ A;  4H6J A;  1W63 M;  3HJK A;  5J3W A;  1S1Y A;  3E0Y A;  3FG8 A;  1XFN A;  4Y2F A;  4KUO A;  4Y5F A;  1S4S A;  2DMW A;  3ZYT A;  5TBM B;  4DMZ A;  3T4L A;  4MCW A;  2O0Y A;  4NEE D;  3T4K A;  1T1B A;  3BQ8 A;  3C30 A;  4O0P A;  3TRC A;  5TBM A;  1DP9 A;  3CIT A;  3EEA A;  3F1N A;  3KSH A;  1OT6 A;  4HJ3 A;  4P6Z S;  1MKM A;  5HSQ A;  1OTD A;  2QJ7 A;  3CUE A;  1VB6 A;  2JN7 A;  2M7V A;  5HDD A;  1LSX A;  3D3O A;  4EXO A;  3A0S A;  3ICY A;  3LIE A;  2OOL A;  2GNX A;  4R70 A;  3HJI A;  1LL8 A;  4WL9 A;  4I3J A;  3E4P A;  5LBR A;  1WA9 A;  3RTY A;  3V67 A;  3HCY A;  4WF0 A;  4YNR A;  2A24 B;  3CWF A;  4EET B;  2R78 A;  3KX0 X;  2EWV A;  3MF0 A;  2L4R A;  3LIC A;  4CLC D;  3R7W B;  3LUQ A;  1T1A A;  3KSI A;  5I5L A;  1BYW A;  1EW0 A;  5HWV A;  2LB9 A;  5F68 A;  3FPW A;  5HD3 A;  1F9I A;  3LI8 A;  1OJG A;  3R7W A;  4RQ9 A;  4Y3I A;  4BBV A;  3EGD C;  3UE3 A;  3BY8 A;  3IS2 B;  3VV4 A;  2Y79 A;  5HWW A;  3LIB A;  1V9Y A;  3KYQ A;  2GJ3 A;  5EFW A;  1N9O A;  2VGL S;  5F5Y A;  2VGL M;  3KSG A;  4UQI S;  3IS2 A;  4JGR A;  4EW7 A;  3LR5 A;  4UQI M;  3MFX A;  2QWS A;  5HPF A;  4G3V A;  1IFQ A;  3LI9 A;  3OBF A;  3T4J A;  3MMH A;  4HJ6 A;  3C2W A;  1OJ5 A;  2D02 A;  3MQQ A;  2B02 A;  4YOF A;  5DFX A;  2O9A A;  5DFY A;  2OWJ A;  3S7N A;  1DP6 A;  2M1C A;  1ZHH B;  4CQH A;  3EGX C;  4K08 A;  4MN7 A;  3IBR A;  3T4Q A;  4WN5 A;  1UWN X;  4HI4 A;  1JNU A;  3IBJ A;  1KOU A;  4II7 A;  3TE8 A;  2O9B A;  3CUE C;  1X0O A;  3BW6 A;  3LFV A;  3EQV A;  3S7O A;  4HIA A;  3UE6 A;  2V1A A;  4NXB A;  5F69 A;  2EWW A;  2Z6C A;  1XFQ A;  3MQO A;  4NKP A;  1V9Z A;  3ZQ5 A;  2J3T D;  4WEJ A;  1DP8 A;  3PXP A;  3VOL A;  4BJP A;  3F1O B;  4HNB A;  2K2N A;  3KO6 A;  3MJQ A;  3T50 A;  1S1Z A;  2PD8 A;  2W3G A;  3P7N A;  2H28 A;  2B18 A;  4LRZ E;  3PHY A;  3W2Z A;  3LR3 A;  3NOP C;  4HJ4 A;  3F1O A;  5G4Z A;  4Z1W A;  4BWI A;  3RH8 B;  2PT7 A;  4I38 A;  5HZH A;  2V0W A;  3FC7 A;  3PYP A;  4JGQ A;  3DBA A;  2WKQ A;  3OCL A;  4MDZ A;  1STZ A;  2W1R A;  5HDC A;  2XSS A;  4ZRR A;  3BY9 A;  3PBN A;  3UB8 A;  2VLG A;  3TJZ C;  4EQ1 A;  1OTA A;  1TS8 A;  5IT5 A;  3PBR A;  3PBS A;  3TW8 A;  4AFI A;  1ZTU A;  2XRN A;  2D01 A;  3PBO A;  4DJ2 A;  4Q0I A;  2YKF A;  3EWK A;  5IS1 A;  4P6Z M;  2HF6 A;  3R4K A;  4FSF A;  2YKH A;  4BBT A;  3OOV A;  5HD5 A;  4DJ3 A;  4M4X A;  3NJA A;  4ETZ A;  4HQA A;  2P04 A;  1P9R A;  2W3H A;  4JGP A;  3UB9 A;  2VA0 A;  4CLC B;  4MMN A;  3VE4 A;  2V9A A;  3EEH A;  4GHI B;  4EEP A;  5J4E A;  2Z6D A;  3SW1 A;  1NLZ A;  1YSP A;  3UME A;  4CLC A;  1GSW A;  3C38 A;  3F1P B;  3LR4 A;  4KQD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...