3BWUD

Crystal structure of the ternary complex of fimd (n-terminal domain, fimdn) with fimc and the n-terminally truncated pilus subunit fimf (fimft)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
121
structure length
121
Chain Sequence
LYFNPRFLADDPQAVADLSRFENGQELPPGTYRVDIYLNNGYMATRDVTFNTGDSEQGIVPCLTRAQLASMGLNTASVAGMNLLADDACVPLTTMVQDATAHLDVGQQRLNLTIPQAFMSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chaperone protein fimC
publication title Crystal structure of the ternary FimC-FimF(t)-FimD(N) complex indicates conserved pilus chaperone-subunit complex recognition by the usher FimD
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone, structural, membrane protein
total genus 30
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2008-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.410 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3bwuD00
1ZDVA 4B0EA 4B0MA 4J3OD 1ZDXA 3RFZB 1ZE3D 3BWUD
chains in the Genus database with same CATH superfamily
1B1ZA 2DHZA 1I4XA 2RDGA 4FJZA 1VRAB 4MJSA 1BXTA 3H1UA 3Q3JA 3NZSA 3N32A 4K7WA 3N1XC 1LM8B 2XK5B 4ITKA 1F0ZA 4MM3B 5EE9A 4YXDB 2N9EB 1WH3A 4WAAA 2KVZA 3R7RA 1WXVA 4FBJB 1F9JA 3W5VB 1L2NA 2YVCA 2R2QA 1J7AA 3SR6A 2FCSA 2RR9A 2N7EA 2YEPB 1DOXA 4OVZA 2IDYA 2QILA 2ASQA 2MQJA 2DZKA 2KTFA 4C7ZA 1D5ZC 5J2RA 1RRBA 3ZQ4A 2ZVOA 3RYTA 4HVBA 4IWOA 4N6EB 3VQIA 2BF8B 1NBFC 2J42A 4URKA 4PYZA 3AU5A 4C56C 3V6CB 3RFZB 4ACFA 3ECIA 5DPWA 2BQQA 1TKYA 1Y56A 3P4QB 1X1MA 3QARA 1H4RA 2M17A 4RM9A 1NVID 4YL8A 2EMSA 2DLBA 4MH0E 3R66C 1C9FA 2NBVB 4KGTA 4BVUC 1WGRA 1K53A 1A70A 4G50A 5D6JB 1I42A 3A33B 4WURA 5LNK1 2J52A 2KWVB 2LXCA 3IG3A 1C4AA 1WGGA 2KDIA 2KQ7A 4WJQA 4C4VB 1AYFA 3W1YA 1ZXIA 5JHBA 2CJNA 2ZCCA 2L3ZA 4A90A 2GRIA 2PVGC 1V49A 3NOBA 1JCKB 3R2IA 4GMVA 4M00A 5E6JA 1WFYA 3I63C 2MBEA 1L0XB 2GBRA 5I4DA 1Y8RC 2SAKA 2KNBA 4KSKC 3WANA 3WA0A 4KGRA 4KIKA 2N1WA 2D3CA 1ZE3D 2IGDA 5FKAC 4DXGA 4XC2A 1WJ6A 3TEZA 2V3PA 3Q3OC 2JVCA 1IGDA 2AQ2B 3L13A 1SXTA 4P6VF 4ZRQA 1FNVA 1ZGUB 2KXJA 1WWTA 2FCNA 4CQNA 4MELA 2QDFA 2WHIA 4HK2A 1ZDXA 3N30A 3SD5A 4ARCA 2G3QB 4MGYE 1P9DU 2IGHA 4II3B 3RNAC 2K22A 1WE6A 4P16A 4A8XC 4BAXA 4IWQA 1OFFA 3NRZA 2HTHA 1SE4A 2CU1A 3DQVA 3AV8A 1BT0A 4IKGA 3N1YC 1N62A 1DGJA 4EOYA 2QJLA 4PS8A 2ZW1A 2INDC 2RSUA 2D07B 5T8IA 5L95C 1E8YA 2PMVA 3AECB 1UGJA 3R2TA 5IOIA 2JZPA 2O6VB 1WXAA 3I3TB 1KLGD 3P4SB 3TCAA 3URYA 3P4RB 5BMIA 1D6EC 5AZFA 2KFKA 4KV2A 2BWFA 1WX9A 2DX5B 1PQSA 3OAWA 1AARA 4HPMB 4J6IA 3U7ZA 3NS8A 5IA7A 4I6NB 4RH6A 3EA6A 4Q2JA 1STEA 1V2YA 2MLBA 3WAPA 2KAJA 3BIID 1S3SG 5KHOA 2OEDA 4R3DA 1S1QB 2K9XA 2ZW0A 4JLCA 2AL6A 1OEYA 1V80A 2ZNVC 1JRUA 1QLBB 1KFYB 2QSDA 1SEBD 1VDVA 3MC9A 2FCQA 1XO3A 3W1SA 3QWZB 5E6OA 2KOXA 4KZ0A 2REXA 4RF1A 4QAYA 3PTFC 4MACA 3MC8A 2JRHA 5DPSA 4K1RB 5GMVA 1GOZA 3VVWB 3U7DA 3Q8FA 4WWMA 4FXCA 2NBWB 2MRPA 4KDIC 3E9SA 3LYYA 4X57B 1WXMA 3V62A 5LXIB 2N0SB 2Y5CA 3IAM1 5BMHA 1XF5L 4IC7B 3HIZA 1N5XA 2KLCA 1RLFA 1TY0A 3ONSA 1KM7A 2RGFA 1M4VA 3BVMA 4MSMB 1WRIA 2MJDA 1XLQA 1P3QU 4ZRPA 3LDZE 2ZVNA 2HE7A 4NY0A 4M0WA 3DHHC 4LCDE 1ZOYB 3UIOB 1WXSA 1QKZA 1UWMA 2V4IB 4YT0B 3AEEB 3DDCB 2Z59B 2D3GA 1HE8A 1TBEA 3ZNID 4WIPA 3AE1B 5IAAC 2HJ1A 4HKQA 4FN2A 5C3JB 3AE5B 4MGKE 3L54A 1FRRA 3EC8A 2M56B 3AE3B 4AQ7A 2FBWB 2N4FA 3QCAA 1QZEA 3PV1A 1KLVA 2LWPA 1JROA 2J7QB 3TEXA 2WWZA 1Q0WB 3ETRA 2K0PA 3DVNU 4EZJA 2KX0A 1SB3C 2RPVA 2D3AA 3QAQA 4ANUA 4G0NB 1SE3A 1FXIA 4A6QA 4IUMB 3NG0A 3AEFB 1R4MI 4WWOA 2IO3B 1C4CA 1HZ6A 1VLBA 2WXQA 1D5XC 3CWIA 2VH2A 3WALA 1EU4A 2LXAA 5D3IB 2B76B 3ZLZA 3WCQA 1N60A 3DPDA 4DXFA 2L8JA 2UU7A 3KH0A 4O1NA 2EMTA 5AEKB 3KWLA 3VUXA 2XBBC 3ALBA 4YTNB 2BKFA 5C2TB 3MHZA 1JWMD 1KRHA 1TIFA 1GJZA 4BBNC 3GZNI 1J19A 3ZTDA 3AM9A 2OJRA 2ZPNA 2KX3A 4EKUA 4MGIE 4XWWA 3BZDB 1SIJA 2KKCA 3QK0A 1FFUA 1UD7A 2E6XA 3SEBA 3M62B 4LK0M 1WXQA 2J53A 2AQ3B 4JWUC 1E90A 3KYDD 1NENB 1OGWA 3MP9A 1TS2A 2KANA 1MFWA 5H8YE 4NZLB 3L0WB 4BKSA 2M0XA 1I7HA 4WJNA 1WY8A 4AWJA 2WXFA 4ZYSA 4DHJB 2KWDA 4NNJB 3QIJA 3VXWA 2O6VD 3AE4B 1R7SA 3VRBB 1TY2A 3CSTA 4OZCA 3JSVA 5DPTA 2WXJA 4YSZB 3H7PB 4GXBA 4OHJA 5C1ZA 1XLOA 1YJIA 1L7YA 2C7MB 3FILA 1YNTE 4RCOA 5TSSA 4LNOA 4KGSA 4NAWA 2MP2B 3CF6E 3X0WA 5BO4B 5AUKA 1P1AA 3ML9A 2KDFB 1SGHA 3T3OA 3X23A 1NDDA 3H9DA 2JSVX 2K39A 3PO0A 2DAJA 4JPSA 2KDEB 3KLSX 4US9A 4YWGG 2MSED 1SIFA 2G4DB 5G55A 3VTUA 1C77A 3UGBB 4BBNF 2DBYA 2MJEA 4IM0A 2QIEB 3ZTCA 2IY0B 3VR9B 4H2AA 1XD3B 3A9KA 4RNAA 3KWVA 3R7QA 2SEBD 2MW5A 4HKZE 4EFOA 3DBSA 3C8YA 4PYUA 5D2MB 2Y3AA 1RAXA 3U8ZA 1WI0A 2L0TA 4DBGA 3ZGZA 2ZPYA 4HCPB 1GC6A 2PKOA 5FR3A 3AU4A 1GAQB 3W1SC 4B0MA 4A3PA 2MX2A 2WNMA 2QMTA 4RGTA 4ANWA 2IO0B 1GB4A 4L1BA 2K8HA 2IJ0A 1LXDA 1IPGA 1KLUD 4K3CA 3TIXA 3Q3FA 2RMMA 3IFWB 4AUQC 3FC4A 3GZNB 5HHDG 2LVPA 2JF5A 2IPKD 2NPTB 2ZNVB 2FAZA 2IY1B 4AP4C 1RFAA 1GG3A 3M63B 2J0KA 1P0RA 3Q14C 3Q2AC 1V6EA 2RDHA 3W2DA 4NJ7A 5LLIA 1JQ4A 1LGRA 3ZDTA 2C5LC 4D2KA 2L05A 4LLGM 5BMGA 2WXGA 1RYJA 3AE6B 2Y5PA 4FJVB 1J7CA 2NCNA 4ZHOA 3OG5A 3T8MA 4MH8A 4WJPA 3Q3MC 1PFDA 2MEKA 2LZ6A 3CMMB 2JZZA 1EF1A 4GDLB 2WXOA 1CJEA 3GOEA 1EWYC 5D7GA 4GDKB 1XLPA 1D3ZA 1QOBA 2CHZA 2JX5A 4USAA 4A20A 1SJED 4MGZE 2MCNB 1AWDA 2DYOA 2JWUA 3NY5A 1TS5A 4MJSB 1WGHA 1T0QC 3PS6A 2AYOB 3NZ3A 4XDCA 2LHEA 3APDA 1F1HA 1M94A 2DAFA 2K6DB 4GIVA 1YQBA 2WGSA 2FNJB 1XQQA 4NPNA 1V1PA 3E56A 1T0YA 3IVFA 4DHZB 2DYBA 4GGQA 5C23A 1FPYA 4BFRA 4J3OD 2FE8A 2BKRB 1V97A 2CS4A 4OZAA 2L52A 3IT4B 3HM6X 4HLEA 4ZHPA 1CZPA 3MC0B 2G45B 2KJ6A 5J18A 4ARIA 4F7ZA 3KQ4A 5TR5A 1YN3A 3ZRCA 3AE9B 3Q8EA 1FCCC 3GB1A 2L7RA 2K3UA 4TMAB 3DBHI 4FULA 2FUG1 2LASA 1JWAD 1YQ4B 3AH7A 4A3OA 1E0ZA 3S2AA 3RCZA 2FUHB 3RZWC 1ZW7A 3ZW3A 4HEA1 1WX8A 3RNCC 4DHJD 3L4PA 1N61A 4LNKA 2DZJA 2WX0A 2KQ4X 4LNIA 5CTRC 4ZDVA 5KHQA 4JX1C 4II2B 2N9PC 1RFKA 3PRMB 4F8CB 4XZ4A 3U52E 3TJPA 2BBCA 3VUWA 2RDBC 3T9LA 2G9HD 3HRDD 3APCA 3SDLC 2MBBB 2KTRA 1R4NI 1AN8A 2PLPA 2CKHB 3RNFC 3NVZA 3ZUNA 2X38A 1Q5WB 2MBHA 3PHXB 2QCZA 4DXAB 3J9CA 4W9GA 2H88B 3PRZA 1TS3A 3DHGC 1WMHA 2V3SA 1V8CA 4PS3A 2V3NA 1WJUA 4YTMB 4KIKB 3OWEB 2PTLA 3NZUA 1ET6A 1KF6B 4JGHB 2CJOA 5HG2A 1SJHD 5D94A 1EM7A 2XN9C 1E9MA 2KWUB 2B3AA 4W9LA 5MPOA 1YD8U 4WQOB 2LGDA 4ICVA 4PS7A 1FO4A 3ZIMA 3UQBA 4ZRJA 4TKNA 4IWPA 5EE1A 2WS3B 3WIMA 4CHKA 2LJ5A 3VUYA 4MSQB 1MPEA 1WM2A 2N7DA 4WWNA 4HJKA 2HDEA 5IO9A 1GNUA 2K6QA 3RN9C 2Z8LA 3UQAA 3U2SC 3PHWB 3LJ3A 1TKGA 2GI9A 2BS2B 3EECA 1UZXB 2NTSA 1Z2MA 4YSXB 3AEBB 4PK1A 2KK8A 4LJOB 4B95A 3TMPB 4JE3B 2JWZA 3AEAB 2N9KA 2GOWA 5GXGB 1KOTA 1WF9A 1MG8A 1TTNA 4YTPB 5H92C 2KFKB 3P42A 2DNFA 2KC2A 2BB6A 3DBHB 4GOCA 3RNGC 2I2YA 3Q6BA 3K9OB 2BW2A 3HHMA 5EE3A 4S0RA 3RI7C 4EE2A 3DBRI 1OQYA 1WZ3A 4XX5A 1TGZB 2OOBB 5EDSA 3O65B 1P7EA 1T5XD 2W9NA 4HCNB 1EUVB 4ZYNA 4NQLB 5G5HA 2NVUI 1EF5A 1ISNA 2AWTA 3ZRFA 2MH7A 3RT3B 2C7NB 4AS1A 1VD2A 4GN1A 1VZ6A 2JPHA 1R4NB 1WX7A 3O13A 4PT5A 3H6NA 1ZDVA 3L10B 1YJJA 2K1FA 1PGXA 1HA5A 3VH3B 2YLMA 2BYVE 1C3TA 2Q5WD 3KVFB 1UWXA 1FXTB 1L0YB 2A4ZA 1WYGA 2X8XX 3DHIC 4LTUA 3BY4B 2IO2B 1E7UA 3AE7B 3ZNHB 1IBXA 3Q8CA 4HDOA 4OVUA 3LXFA 1TT5B 4W9IA 1BUIC 3L17A 3AEDB 1YX6B 4BZAA 3PZ8A 1E6EB 2PVOD 4WJOA 1C1YB 1DYQA 1LQBA 4HROA 1WZ0A 5DPRA 1UF0A 3ABVB 1YN4A 1L4DB 2V0GA 4M0WB 2LVOA 4M8MA 4GLSC 1CMXB 2ON8A 3NJTA 2KMMA 2WU2B 1FNWA 1UBIA 2JY6A 5IP4D 2WYQA 1PUTA 1XCTL 3PRPB 1GB1A 3IT6B 4MEMA 5CHVC 2M0AA 4KX6B 1N6ZA 1HTQA 4W9CA 2LVQA 3NHEB 3PT2B 3R3MA 2INPE 3MTNB 3ENEA 4FJYA 4FADA 3RZFA 5G5GA 1ACCA 2AEHA 3CSFA 4FHKA 2CHWA 5CHFA 1AW7A 2E3TA 2JRIB 1WM3A 5FR6A 2AL3A 1UNSA 2LUEA 2BWES 2I38A 1CQVA 2INCC 2V9HA 4KSLC 1B9RA 3NVVA 2BGFA 4REZA 3V60A 1NEKB 4F1SA 4ANXA 2M4NA 4DK5A 1FRDA 3M3JA 3EGRA 4OZBA 3EHVA 4HWIB 3N1ZC 2EKIA 2R2OA 1L6VA 4HJGE 2J0JA 2GBMA 1MJDA 1L5PA 4RGOS 1I4QA 3ZJVA 2A5UA 2BPSA 4BKTA 2LJIA 4K7UA 3IAS1 2DYMA 1A5RA 1KTKA 4W9FA 4LJPB 1WR1A 2J4XA 1PGBA 1HEZE 2BYTA 1YJ1A 3VTWA 1Z5SB 4W9HA 1N5WA 1U4AA 4US8A 2D2QA 3PGEA 3UINB 3A9JA 2QEJC 1HZ5A 2LI5A 2W82A 3A1QA 3QQ8B 3RNBC 1FMAD 1WYWB 3HUIA 2CR5A 4HPLB 3H8HA 2HTME 2ZZPB 3TSSA 1WJ4A 1Q1OA 4DWFA 1XCQL 5JZEB 2PE6B 1NI3A 1F77A 2MWSB 4RM8A 2MHJA 3U4EG 1C4PA 2WXKA 2JXXA 3D32A 1ZUD2 2V4LA 2K5PA 3DOWA 3HM3A 4P1CC 2GB1A 2K8CA 4W9JA 2O2VA 1WIAA 1H8CA 2D11A 3R8BA 3HK0A 1IGCA 2NPTA 2VRRB 5HFYA 3SU8X 1XLNA 4P1BC 3H7SA 4KZCA 4ZRKA 3JSVB 5JHAA 1R4MB 3N9YC 2IZVB 2NMQA 5AZGA 3SHQA 2XK5A 4MM3A 1E10A 2KDMA 2EKEC 4CYEA 3B9JA 4P7IA 3DWGC 1XT9B 3FILB 4ZOHC 1KJTA 4DDGD 2WLBA 4NAWB 3IXSA 2W55A 1TJEA 1E7PB 4EUTA 4ZRIA 3C0RB 1DOYA 2ONQA 3B2FA 2PE9A 1E8WA 2RD0A 4RMAA 4W9KA 3I9V1 4A9AA 4LNNA 2KJRA 4RFBA 2LD9A 2WXNA 2C7HA 3ZJUA 5BYSA 2JXTA 1FM0D 1JW9D 2NS5A 2WDQB 4KKJA 4BOSC 2W3SA 4RF0A 1ROEA 2BT6A 2RPQA 5AZHA 1SE9A 3FAHA 1WSPA 2LUMA 5LXHA 4B6WA 3A9KB 4XYCA 3DVNV 1K8RB 2ZCBA 1IUEA 1ZP0B 2ZJDA 3V05A 2N9LA 5D3DA 3PSEB 4WWPA 1J7BA 3SFDB 3DCGA 2LEKA 2L32A 3AN1A 4C4VA 4I6LB 5IKCM 5IN7A 3PLUA 3FKYA 4DDID 3Q69A 4RGMA 3GS2A 2NTTA 1YN5A 1JWUD 3GE3C 2XNAC 3VTVA 3WAMA 1FFVA 3P63A 2KN5A 1T3QA 2AQ1B 2FIDA 3AEGB 1F2RI 1VZ7A 3JVZX 4EZKA 3EUB2 2DZMA 1UUPA 3MJWA 5E6PA 2GBNA 3ZKJC 3DVGX 4DQOC 2JU6X 2WXMA 5BYQA 1I35A 2OJWA 2W3RA 3PZDA 2WXLA 4UDUC 3AE8B 2INNE 3SFEB 1YIWA 4IG7B 4TUUA 2I1JA 1NI2A 1HXYD 1WE7A 1WRDB 3UI3A 3BYTB 1IP9A 1I4RA 1D4BA 4S17A 2KDBA 1RWSA 2BS3B 5HI1A 1L4ZB 1C76A 1G6JA 1LFDA 3I5JC 2LFIA 3OJ4B 4JIOU 1ZXHA 4HXDA 1FCLA 2ICIA 2I1KA 4N9F4 1V5OA 2L0FA 4ICUA 2O6VA 2W54A 4WAFA 1V1PB 1RM6C 3TL5A 3BYYB 2DWQA 2Z0EB 2BB5A 4GU2A 1E7VA 2BYFA 3Q8BA 2L1AA 4GB9A 4BOZB 1EU3A 2ZEQA 1E8XA 3AE2B 3ZXVA 2PIAA 3NS1A 3PREA 4M01A 2KLGA 3GE8C 4I6PA 1YQ3B 3VRAB 2KWCA 1QF6A 3Q3NC 2IYDB 4FLHA 3RNEC 3PLVA 4A55A 1E8ZA 2XEWA 2TSSA 1JWBD 3QC8B 4BKSD 4FA6A 3B0AA 4ANVA 3VR8B 4AJYB 2IBIB 1WGDA 2L83A 1ENFA 1VCBA 2N1VA 2G4SA 2V1YA 3WAOA 3NUHB 3AULA 3NVWA 2PJHA 2KN4A 2BTEA 3QJZA 4E71A 3ZNGC 3B1LX 3V6EB 3RPFC 4C7YA 1VZ8A 2CU3A 4JL9A 2JZ3B 2PEAA 2H89B 2KACA 3ZJTA 1JALA 2FCMA 3KUDB 5EE0A 3VH4B 4K3BA 1TKEA 3MHSD 2M19A 2KTRB 1PDXA 4TQ1A 3VAWA 2WXIA 3JYUA 2KJHB 4LDTB 4GSWA 4XWTA 2LMCA 1WMHB 1WJNA 1WR6E 1JWSD 5AUIA 4NJCA 2K8BA 4DHZE 4JQWC 2C9WB 2WDRB 3AI5A 3ZXRA 1P7FA 2JUOA 4NAMA 4YSYB 3RMKC 1HQRD 2VZKB 3T3NA 1NYRA 2WX1A 1MG4A 1QT9A 2R61A 1V5TA 3RD2A 3A4RA 5FK9C 4E3CA 1FXAA 1UH6A 4G11A 1QQRA 4E74A 4OW0A 2PPHA 1UBQA 4W9DA 3TUOA 3ZDMC 4N58A 4C00A 4MT5A 2DENB 4KKIA 1TYGB 3AXCA 4L2YA 5E6NA 1FD6A 1Q10A 1D5MC 2MA9B 1LO5D 2WXRA 1TZ1A 4K81A 3B08A 4AJWA 2HJ8A 1GUAB 5CX3A 2LGYA 2LHDA 1ZPSA 1SBBB 2DZIA 3C19A 1V9JA 4KDLB 2D10A 3W5UB 2WDVB 2CHXA 1OEYJ 4MDKE 1ZKHA 2KYWA 1MHHE 2L76A 3L08A 4M8NA 3N20C 3ZO5B 1QOFA 3P4PB 3OJ3A 2Y5BB 3OLMD 3ZNZB 4TSSA 5JXVA 1SE2A 3B2GA 1K52A 2LGXA 4XGAB 2KHWB 2MJ3A 3CIRB 1PYWD 1T0RC 3ML8A 1UGMA 2K25A 3EFCA 1V81A 1PGAA 3HVDA 3BINA 2KFJA 3LB8C 1T0SC 4RGNA 4BKGA 1K50A 4LNFA 1V1OA 2MBOA 1IYFA 3V3XA 1FIQA 3K9PB 1L0VB 2LRWA 4W9EA 3KUZA 2N7JA 3KYCD 2JQRB 3V61A 4NQKE 2FIFA 2YEPF 5G2NA 2NBUA 4IOIE 3DBLI 3DWMA 2HD5B 5L83A 1VJKA 3IBEA 2EELA 3NVYA 3A4SC 2BVCA 2WQYB 3AMZA 3ZYYX 1MVKA 1YOVB 1JMLA 1BMLC 3TBLD 2QHOA 3QA8A 3N3KB 1C78A 3RULA 4KVGB 3H7PA 4CO7A 1QILA 3W9CB 2D3BA 1IBXB 2G1EA 2GBKA 5HKHA 4L23A 2IGGA 2LGSA 1OTRB 4B0EA 1YX5B 5BYRA 2MP2A 3UIPB 4TQ0A 1V86A 3P1MA 3PPAA 3TEYA 1K51A 2KD0A 2KC1A 3IHPC 5J17A 1KH0A 2JYEA 3AB5A 4JWSC 1N63A 2KT7A 3BK2A 2IO1B 2NR2A 2KMCA 3RUIB 2UYZB 3DVGY 1WGYA 1GPXA 3DBRB 1NYQA 1ESFA 2LGIA 2BYEA 4TV3A 3VHTC 2WDTB 2KZRA 1E5WA 2OHFA 3BVZA 1F2RC 2GMIC 3HVZA 3BWUD 1L6UA 3VFKA 4WH4A 4M02A 3UF8A 1GC7A 3Q8AA 2KMAA 3VDZA 2WXHA 1DOIA 4C80A 2M1MA 2AX5A 1J8CA 1XEEA 2ACZB 2LRUA 1MI0A 5CHWA 2KO3A 4HDQA 3KW5B 4K7SA 5JH5C 4EEWA 1J0GA 2M8SA 4LDTD 1I4HA 3APFA 3BVGA 2J0MA 3MJ5A 4IDIA 4XDDA 3QHTA 1JRPA 1WGKA 4IM2A 2JYTA 3EFUA 1YMHE 3ZVVA 1SF0A 1CK1A 1VR9A 2L00B 2GLSA 1OQQA 4G3XB 3M95A 1EWCA 1I4PA 2BS4B 3BK1A 2VZKD 2WP9B 4HPPA 1FEHA 1OQRA 3PVLA 3I57A 1FNUA 3P2BA 1P98A 2D5GA 4ASWC 2JT4B 1QOAA 1I4GA 2KVRA 2Z0DB 1C79A 2PW9A 2GBJA 4HRSA 3A9JB 3DBLB 4IW0A 3A1QB 1TZOA 4N59A 1QOGA 1T6BX 1EO6A 5DCNA 2KQSA 4IM3A 4NJ6A 2WXPA 3PZ7A 3QX1A 1UELA 4XE0A 1MHXA 2WU5B 2VH1A 1XXGA 3JW0X 1SSNA 3MFGA 2UWQA 4AOFA 4OVVA 2MBQA 1ET9A 4WQMA 3U30A 4B9KA 4GDLA 1HTOA 4GDKA 1TS4A 3GP7A 3L16A 3KUCB 4FHJA 2N9XA 2QC8A 4EZLA 2C60A 2O2VB 3TEWA 1F52A
chains in the Genus database with same CATH topology
1V1PB 1B1ZA 1RM6C 1NENB 3BYYB 3MP9A 1TS2A 1I4XA 2RDGA 1VRAB 5H8YE 2DWQA 1BXTA 4NZLB 1P7EA 1T5XD 2BB5A 1I7HA 3Q8BA 2L1AA 5G5HA 1EU3A 4ITKA 3AE2B 1F0ZA 4MM3B 2PIAA 3NS1A 5EE9A 2WXFA 1YQ3B 3VRAB 2MH7A 4YXDB 4ZYSA 2KWDA 1QF6A 4AS1A 3W5VB 3AE4B 1R7SA 3VRBB 1J7AA 1TY2A 4OZCA 3SR6A 4YSZB 2WXJA 4A55A 2YEPB 1DOXA 4OHJA 1VZ6A 4OVZA 2IDYA 2TSSA 1JWBD 3O13A 1XLOA 2QILA 4PT5A 1YJIA 3FILA 1ZDVA 3VR8B 1YJJA 1YNTE 4RCOA 1PGXA 1HA5A 5TSSA 4KGSA 4C7ZA 1D5ZC 2L83A 3ZQ4A 2Q5WD 1ENFA 1UWXA 5AUKA 1L0YB 1WYGA 4N6EB 4LTUA 3VQIA 2J42A 3NUHB 3T3OA 3NVWA 2KN4A 3AE7B 4C56C 2BTEA 3RFZB 1IBXA 3Q8CA 3RPFC 2JSVX 4C7YA 1VZ8A 2CU3A 3LXFA 3PO0A 1TKYA 1Y56A 3P4QB 4JPSA 1BUIC 3AEDB 3KLSX 1NVID 2H89B 3PZ8A 4US9A 2DLBA 1E6EB 2KACA 4YWGG 3ZJTA 2PVOD 1JALA 1DYQA 1C9FA 1C77A 4HROA 4KGTA 5EE0A 1K53A 1A70A 1TKEA 2M19A 2DBYA 2MJEA 1PDXA 3ABVB 4TQ1A 2QIEB 1YN4A 2WXIA 1L4DB 2V0GA 4WURA 3VR9B 5LNK1 2J52A 4H2AA 4GLSC 1C4AA 2ON8A 4RNAA 2KMMA 2WU2B 3KWVA 1FNWA 4XWTA 2SEBD 2LMCA 4HKZE 1AYFA 1PUTA 1XCTL 1JWSD 1ZXIA 2CJNA 4NJCA 5AUIA 3C8YA 4A90A 1GB1A 2GRIA 3IT6B 2PVGC 2WDRB 2Y3AA 1JCKB 1P7FA 2M0AA 4KX6B 3R2IA 3ZGZA 5E6JA 4NAMA 2PKOA 4YSYB 2INPE 1L0XB 5FR3A 1HQRD 1GAQB 2VZKB 4B0MA 5I4DA 3T3NA 1NYRA 2SAKA 5G5GA 1ACCA 2WNMA 2QMTA 1QT9A 4KGRA 4RGTA 1AW7A 2R61A 1ZE3D 1GB4A 2IGDA 4L1BA 2E3TA 5FKAC 2IJ0A 5FK9C 4DXGA 3TEZA 1FXAA 2V3PA 1QQRA 1KLUD 1UNSA 4OW0A 1B9RA 2I38A 1CQVA 2RMMA 3TUOA 4N58A 3NVVA 4REZA 1IGDA 3FC4A 1NEKB 5HHDG 2IPKD 2AQ2B 1FRDA 4MT5A 1SXTA 3EGRA 4KKIA 4OZBA 4P6VF 1TYGB 4L2YA 4ZRQA 1FNVA 1WWTA 2EKIA 1FD6A 4CQNA 1Q10A 1D5MC 1LO5D 2WXRA 1L6VA 4HJGE 1ZDXA 4ARCA 1L5PA 4RGOS 2LHDA 1ZPSA 1SBBB 1I4QA 2RDHA 2IGHA 3W2DA 3ZJVA 1JQ4A 2K22A 3W5UB 2LJIA 3IAS1 4P16A 2WDVB 2DYMA 4A8XC 1KTKA 1OFFA 4D2KA 3NRZA 1SE4A 4LLGM 5BMGA 1MHHE 1RYJA 2WXGA 3AE6B 2Y5PA 2J4XA 1J7CA 1PGBA 1HEZE 2BYTA 4ZHOA 1QOFA 3P4PB 1N5WA 4MH8A 3AV8A 4US8A 1PFDA 2MEKA 4IKGA 2QEJC 1HZ5A 1N62A 1DGJA 4TSSA 2W82A 4GDLB 2WXOA 1CJEA 1FMAD 1EWYC 5D7GA 2QJLA 3HUIA 5JXVA 1SE2A 4GDKB 3B2GA 2ZW1A 3H8HA 1K52A 2HTME 1XLPA 5T8IA 2PMVA 3TSSA 3AECB 1QOBA 2MJ3A 3CIRB 2JX5A 4USAA 1UGJA 3R2TA 1PYWD 1XCQL 2JZPA 1SJED 1NI3A 1F77A 1KLGD 1AWDA 2DYOA 3P4SB 3URYA 2JWUA 3U4EG 3P4RB 1PGAA 5BMIA 1C4PA 3HVDA 2WXKA 1TS5A 3LB8C 1D6EC 1ZUD2 2K5PA 4RGNA 2GB1A 1K50A 1V1OA 3NZ3A 4XDCA 2LHEA 3U7ZA 3V3XA 1FIQA 1L0VB 4RH6A 3EA6A 2N7JA 4Q2JA 1STEA 2JQRB 1V1PA 3R8BA 3E56A 2YEPF 2KAJA 3BIID 1IGCA 4IOIE 2OEDA 4R3DA 5HFYA 2K9XA 1XLNA 2ZW0A 3DWMA 1QLBB 3N9YC 1VJKA 3NVYA 2EELA 2NMQA 4J3OD 1KFYB 2FE8A 2WQYB 1V97A 2QSDA 4OZAA 1SEBD 1VDVA 2L52A 2KDMA 3AMZA 3IT4B 3B9JA 3ZYYX 3DWGC 4ZHPA 1E10A 1MVKA 1XO3A 1CZPA 1JMLA 3FILB 3W1SA 1BMLC 4ZOHC 3MC0B 4ARIA 2WLBA 4NAWB 3KQ4A 1YN3A 3IXSA 2W55A 3AE9B 3Q8EA 1C78A 1TJEA 1E7PB 1FCCC 3GB1A 4RF1A 1QILA 3W9CB 2K3UA 4TMAB 1DOYA 1IBXB 2ONQA 2G1EA 4MACA 2FUG1 3B2FA 1JWAD 1YQ4B 3AH7A 4L23A 2IGGA 1E0ZA 4B0EA 5BYRA 3I9V1 4TQ0A 3P1MA 1GOZA 3TEYA 4HEA1 4A9AA 4RFBA 1K51A 2WXNA 3Q8FA 1KH0A 3L4PA 4FXCA 4WWMA 1N61A 2JYEA 3AB5A 5BYSA 3ZJUA 2JXTA 1FM0D 1JW9D 1N63A 2KQ4X 2WDQB 4JWSC 3BK2A 4KKJA 2W3SA 3E9SA 4JX1C 4RF0A 3LYYA 1ROEA 2BT6A 1RFKA 1GPXA 3FAHA 3U52E 1WSPA 2LUMA 1NYQA 1ESFA 2N0SB 2Y5CA 3IAM1 2BBCA 1XF5L 5BMHA 2LGIA 1IUEA 1N5XA 1ZP0B 2G9HD 3HRDD 3V05A 2N9LA 1TY0A 5D3DA 2OHFA 3BVZA 1AN8A 1M4VA 1J7BA 2PLPA 3BVMA 1WRIA 1F2RC 2MJDA 1XLQA 4ZRPA 3HVZA 3BWUD 3SFDB 3NVZA 4M0WA 2X38A 1L6UA 1ZOYB 2L32A 2LEKA 4WH4A 3AN1A 3J9CA 2H88B 1QKZA 1TS3A 1UWMA 2V4IB 3Q8AA 3AEEB 4YT0B 2WXHA 1V8CA 1DOIA 4C80A 2V3NA 4WIPA 2AX5A 1XEEA 3AE1B 2ACZB 3Q69A 4YTMB 4RGMA 3GS2A 2NTTA 1YN5A 4HKQA 1JWUD 3OWEB 5C3JB 2PTLA 1MI0A 2XNAC 3AE5B 1ET6A 1KF6B 2CJOA 1FFVA 3P63A 1FRRA 5HG2A 1T3QA 1SJHD 2M56B 3AE3B 4AQ7A 1I4HA 2AQ1B 2FBWB 3BVGA 3MJ5A 4IDIA 1EM7A 4XDDA 2XN9C 1E9MA 1JRPA 3AEGB 1JROA 1F2RI 1WGKA 1VZ7A 5MPOA 2JYTA 1YMHE 3TEXA 1SF0A 1FO4A 3ETRA 2K0PA 3EUB2 1CK1A 1VR9A 1UUPA 5EE1A 2WS3B 1OQQA 1SB3C 1EWCA 1I4PA 2RPVA 2BS4B 3BK1A 1SE3A 2JU6X 1MPEA 1FXIA 2WXMA 5BYQA 4A6QA 4DQOC 2VZKD 3AEFB 2WP9B 1C4CA 2W3RA 1FEHA 1OQRA 1HZ6A 2HDEA 1VLBA 2WXQA 1D5XC 2WXLA 3CWIA 3I57A 4UDUC 3AE8B 1EU4A 2INNE 3SFEB 5D3IB 1FNUA 2Z8LA 2D5GA 2B76B 3U2SC 1QOAA 1I4GA 1TKGA 3WCQA 1C79A 1HXYD 1N60A 2GI9A 2PW9A 4DXFA 4HRSA 2BS2B 3UI3A 3BYTB 4O1NA 2NTSA 1TZOA 1I4RA 3KWLA 4N59A 1QOGA 1D4BA 1T6BX 4YSXB 3AEBB 1RWSA 2WXPA 3PZ7A 4YTNB 2BS3B 4XE0A 1MHXA 5HI1A 1L4ZB 1JWMD 2WU5B 1C76A 3MHZA 4JE3B 5C2TB 1KRHA 1XXGA 1SSNA 3MFGA 1ET9A 3AEAB 2LFIA 3AM9A 4WQMA 4XWWA 2N9KA 5GXGB 3BZDB 1SIJA 4YTPB 1ZXHA 1FCLA 1FFUA 1TS4A 3GP7A 2E6XA 5H92C 3SEBA 3P42A 2ICIA 4LK0M 1WXQA 2BB6A 2J53A 2AQ3B 2I2YA 3TEWA 2BW2A 5EE3A 2W54A 4WAFA 4JWUC 4EE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZDV A;  4B0E A;  4B0M A;  4J3O D;  1ZDX A;  3RFZ B;  1ZE3 D;  3BWU D; 
#chains in the Genus database with same CATH topology
 1B1Z A;  2DHZ A;  1I4X A;  2RDG A;  4FJZ A;  1VRA B;  4MJS A;  1BXT A;  3H1U A;  3Q3J A;  3NZS A;  3N32 A;  4K7W A;  3N1X C;  1LM8 B;  2XK5 B;  4ITK A;  1F0Z A;  4MM3 B;  5EE9 A;  4YXD B;  2N9E B;  1WH3 A;  4WAA A;  2KVZ A;  3R7R A;  1WXV A;  4FBJ B;  1F9J A;  3W5V B;  1L2N A;  2YVC A;  2R2Q A;  1J7A A;  3SR6 A;  2FCS A;  2RR9 A;  2N7E A;  2YEP B;  1DOX A;  4OVZ A;  2IDY A;  2QIL A;  2ASQ A;  2MQJ A;  2DZK A;  2KTF A;  4C7Z A;  1D5Z C;  5J2R A;  1RRB A;  3ZQ4 A;  2ZVO A;  3RYT A;  4HVB A;  4IWO A;  4N6E B;  3VQI A;  2BF8 B;  1NBF C;  2J42 A;  4URK A;  4PYZ A;  3AU5 A;  4C56 C;  3V6C B;  3RFZ B;  4ACF A;  3ECI A;  5DPW A;  2BQQ A;  1TKY A;  1Y56 A;  3P4Q B;  1X1M A;  3QAR A;  1H4R A;  2M17 A;  4RM9 A;  1NVI D;  4YL8 A;  2EMS A;  2DLB A;  4MH0 E;  3R66 C;  1C9F A;  2NBV B;  4KGT A;  4BVU C;  1WGR A;  1K53 A;  1A70 A;  4G50 A;  5D6J B;  1I42 A;  3A33 B;  4WUR A;  5LNK 1;  2J52 A;  2KWV B;  2LXC A;  3IG3 A;  1C4A A;  1WGG A;  2KDI A;  2KQ7 A;  4WJQ A;  4C4V B;  1AYF A;  3W1Y A;  1ZXI A;  5JHB A;  2CJN A;  2ZCC A;  2L3Z A;  4A90 A;  2GRI A;  2PVG C;  1V49 A;  3NOB A;  1JCK B;  3R2I A;  4GMV A;  4M00 A;  5E6J A;  1WFY A;  3I63 C;  2MBE A;  1L0X B;  2GBR A;  5I4D A;  1Y8R C;  2SAK A;  2KNB A;  4KSK C;  3WAN A;  3WA0 A;  4KGR A;  4KIK A;  2N1W A;  2D3C A;  1ZE3 D;  2IGD A;  5FKA C;  4DXG A;  4XC2 A;  1WJ6 A;  3TEZ A;  2V3P A;  3Q3O C;  2JVC A;  1IGD A;  2AQ2 B;  3L13 A;  1SXT A;  4P6V F;  4ZRQ A;  1FNV A;  1ZGU B;  2KXJ A;  1WWT A;  2FCN A;  4CQN A;  4MEL A;  2QDF A;  2WHI A;  4HK2 A;  1ZDX A;  3N30 A;  3SD5 A;  4ARC A;  2G3Q B;  4MGY E;  1P9D U;  2IGH A;  4II3 B;  3RNA C;  2K22 A;  1WE6 A;  4P16 A;  4A8X C;  4BAX A;  4IWQ A;  1OFF A;  3NRZ A;  2HTH A;  1SE4 A;  2CU1 A;  3DQV A;  3AV8 A;  1BT0 A;  4IKG A;  3N1Y C;  1N62 A;  1DGJ A;  4EOY A;  2QJL A;  4PS8 A;  2ZW1 A;  2IND C;  2RSU A;  2D07 B;  5T8I A;  5L95 C;  1E8Y A;  2PMV A;  3AEC B;  1UGJ A;  3R2T A;  5IOI A;  2JZP A;  2O6V B;  1WXA A;  3I3T B;  1KLG D;  3P4S B;  3TCA A;  3URY A;  3P4R B;  5BMI A;  1D6E C;  5AZF A;  2KFK A;  4KV2 A;  2BWF A;  1WX9 A;  2DX5 B;  1PQS A;  3OAW A;  1AAR A;  4HPM B;  4J6I A;  3U7Z A;  3NS8 A;  5IA7 A;  4I6N B;  4RH6 A;  3EA6 A;  4Q2J A;  1STE A;  1V2Y A;  2MLB A;  3WAP A;  2KAJ A;  3BII D;  1S3S G;  5KHO A;  2OED A;  4R3D A;  1S1Q B;  2K9X A;  2ZW0 A;  4JLC A;  2AL6 A;  1OEY A;  1V80 A;  2ZNV C;  1JRU A;  1QLB B;  1KFY B;  2QSD A;  1SEB D;  1VDV A;  3MC9 A;  2FCQ A;  1XO3 A;  3W1S A;  3QWZ B;  5E6O A;  2KOX A;  4KZ0 A;  2REX A;  4RF1 A;  4QAY A;  3PTF C;  4MAC A;  3MC8 A;  2JRH A;  5DPS A;  4K1R B;  5GMV A;  1GOZ A;  3VVW B;  3U7D A;  3Q8F A;  4WWM A;  4FXC A;  2NBW B;  2MRP A;  4KDI C;  3E9S A;  3LYY A;  4X57 B;  1WXM A;  3V62 A;  5LXI B;  2N0S B;  2Y5C A;  3IAM 1;  5BMH A;  1XF5 L;  4IC7 B;  3HIZ A;  1N5X A;  2KLC A;  1RLF A;  1TY0 A;  3ONS A;  1KM7 A;  2RGF A;  1M4V A;  3BVM A;  4MSM B;  1WRI A;  2MJD A;  1XLQ A;  1P3Q U;  4ZRP A;  3LDZ E;  2ZVN A;  2HE7 A;  4NY0 A;  4M0W A;  3DHH C;  4LCD E;  1ZOY B;  3UIO B;  1WXS A;  1QKZ A;  1UWM A;  2V4I B;  4YT0 B;  3AEE B;  3DDC B;  2Z59 B;  2D3G A;  1HE8 A;  1TBE A;  3ZNI D;  4WIP A;  3AE1 B;  5IAA C;  2HJ1 A;  4HKQ A;  4FN2 A;  5C3J B;  3AE5 B;  4MGK E;  3L54 A;  1FRR A;  3EC8 A;  2M56 B;  3AE3 B;  4AQ7 A;  2FBW B;  2N4F A;  3QCA A;  1QZE A;  3PV1 A;  1KLV A;  2LWP A;  1JRO A;  2J7Q B;  3TEX A;  2WWZ A;  1Q0W B;  3ETR A;  2K0P A;  3DVN U;  4EZJ A;  2KX0 A;  1SB3 C;  2RPV A;  2D3A A;  3QAQ A;  4ANU A;  4G0N B;  1SE3 A;  1FXI A;  4A6Q A;  4IUM B;  3NG0 A;  3AEF B;  1R4M I;  4WWO A;  2IO3 B;  1C4C A;  1HZ6 A;  1VLB A;  2WXQ A;  1D5X C;  3CWI A;  2VH2 A;  3WAL A;  1EU4 A;  2LXA A;  5D3I B;  2B76 B;  3ZLZ A;  3WCQ A;  1N60 A;  3DPD A;  4DXF A;  2L8J A;  2UU7 A;  3KH0 A;  4O1N A;  2EMT A;  5AEK B;  3KWL A;  3VUX A;  2XBB C;  3ALB A;  4YTN B;  2BKF A;  5C2T B;  3MHZ A;  1JWM D;  1KRH A;  1TIF A;  1GJZ A;  4BBN C;  3GZN I;  1J19 A;  3ZTD A;  3AM9 A;  2OJR A;  2ZPN A;  2KX3 A;  4EKU A;  4MGI E;  4XWW A;  3BZD B;  1SIJ A;  2KKC A;  3QK0 A;  1FFU A;  1UD7 A;  2E6X A;  3SEB A;  3M62 B;  4LK0 M;  1WXQ A;  2J53 A;  2AQ3 B;  4JWU C;  1E90 A;  3KYD D;  1NEN B;  1OGW A;  3MP9 A;  1TS2 A;  2KAN A;  1MFW A;  5H8Y E;  4NZL B;  3L0W B;  4BKS A;  2M0X A;  1I7H A;  4WJN A;  1WY8 A;  4AWJ A;  2WXF A;  4ZYS A;  4DHJ B;  2KWD A;  4NNJ B;  3QIJ A;  3VXW A;  2O6V D;  3AE4 B;  1R7S A;  3VRB B;  1TY2 A;  3CST A;  4OZC A;  3JSV A;  5DPT A;  2WXJ A;  4YSZ B;  3H7P B;  4GXB A;  4OHJ A;  5C1Z A;  1XLO A;  1YJI A;  1L7Y A;  2C7M B;  3FIL A;  1YNT E;  4RCO A;  5TSS A;  4LNO A;  4KGS A;  4NAW A;  2MP2 B;  3CF6 E;  3X0W A;  5BO4 B;  5AUK A;  1P1A A;  3ML9 A;  2KDF B;  1SGH A;  3T3O A;  3X23 A;  1NDD A;  3H9D A;  2JSV X;  2K39 A;  3PO0 A;  2DAJ A;  4JPS A;  2KDE B;  3KLS X;  4US9 A;  4YWG G;  2MSE D;  1SIF A;  2G4D B;  5G55 A;  3VTU A;  1C77 A;  3UGB B;  4BBN F;  2DBY A;  2MJE A;  4IM0 A;  2QIE B;  3ZTC A;  2IY0 B;  3VR9 B;  4H2A A;  1XD3 B;  3A9K A;  4RNA A;  3KWV A;  3R7Q A;  2SEB D;  2MW5 A;  4HKZ E;  4EFO A;  3DBS A;  3C8Y A;  4PYU A;  5D2M B;  2Y3A A;  1RAX A;  3U8Z A;  1WI0 A;  2L0T A;  4DBG A;  3ZGZ A;  2ZPY A;  4HCP B;  1GC6 A;  2PKO A;  5FR3 A;  3AU4 A;  1GAQ B;  3W1S C;  4B0M A;  4A3P A;  2MX2 A;  2WNM A;  2QMT A;  4RGT A;  4ANW A;  2IO0 B;  1GB4 A;  4L1B A;  2K8H A;  2IJ0 A;  1LXD A;  1IPG A;  1KLU D;  4K3C A;  3TIX A;  3Q3F A;  2RMM A;  3IFW B;  4AUQ C;  3FC4 A;  3GZN B;  5HHD G;  2LVP A;  2JF5 A;  2IPK D;  2NPT B;  2ZNV B;  2FAZ A;  2IY1 B;  4AP4 C;  1RFA A;  1GG3 A;  3M63 B;  2J0K A;  1P0R A;  3Q14 C;  3Q2A C;  1V6E A;  2RDH A;  3W2D A;  4NJ7 A;  5LLI A;  1JQ4 A;  1LGR A;  3ZDT A;  2C5L C;  4D2K A;  2L05 A;  4LLG M;  5BMG A;  2WXG A;  1RYJ A;  3AE6 B;  2Y5P A;  4FJV B;  1J7C A;  2NCN A;  4ZHO A;  3OG5 A;  3T8M A;  4MH8 A;  4WJP A;  3Q3M C;  1PFD A;  2MEK A;  2LZ6 A;  3CMM B;  2JZZ A;  1EF1 A;  4GDL B;  2WXO A;  1CJE A;  3GOE A;  1EWY C;  5D7G A;  4GDK B;  1XLP A;  1D3Z A;  1QOB A;  2CHZ A;  2JX5 A;  4USA A;  4A20 A;  1SJE D;  4MGZ E;  2MCN B;  1AWD A;  2DYO A;  2JWU A;  3NY5 A;  1TS5 A;  4MJS B;  1WGH A;  1T0Q C;  3PS6 A;  2AYO B;  3NZ3 A;  4XDC A;  2LHE A;  3APD A;  1F1H A;  1M94 A;  2DAF A;  2K6D B;  4GIV A;  1YQB A;  2WGS A;  2FNJ B;  1XQQ A;  4NPN A;  1V1P A;  3E56 A;  1T0Y A;  3IVF A;  4DHZ B;  2DYB A;  4GGQ A;  5C23 A;  1FPY A;  4BFR A;  4J3O D;  2FE8 A;  2BKR B;  1V97 A;  2CS4 A;  4OZA A;  2L52 A;  3IT4 B;  3HM6 X;  4HLE A;  4ZHP A;  1CZP A;  3MC0 B;  2G45 B;  2KJ6 A;  5J18 A;  4ARI A;  4F7Z A;  3KQ4 A;  5TR5 A;  1YN3 A;  3ZRC A;  3AE9 B;  3Q8E A;  1FCC C;  3GB1 A;  2L7R A;  2K3U A;  4TMA B;  3DBH I;  4FUL A;  2FUG 1;  2LAS A;  1JWA D;  1YQ4 B;  3AH7 A;  4A3O A;  1E0Z A;  3S2A A;  3RCZ A;  2FUH B;  3RZW C;  1ZW7 A;  3ZW3 A;  4HEA 1;  1WX8 A;  3RNC C;  4DHJ D;  3L4P A;  1N61 A;  4LNK A;  2DZJ A;  2WX0 A;  2KQ4 X;  4LNI A;  5CTR C;  4ZDV A;  5KHQ A;  4JX1 C;  4II2 B;  2N9P C;  1RFK A;  3PRM B;  4F8C B;  4XZ4 A;  3U52 E;  3TJP A;  2BBC A;  3VUW A;  2RDB C;  3T9L A;  2G9H D;  3HRD D;  3APC A;  3SDL C;  2MBB B;  2KTR A;  1R4N I;  1AN8 A;  2PLP A;  2CKH B;  3RNF C;  3NVZ A;  3ZUN A;  2X38 A;  1Q5W B;  2MBH A;  3PHX B;  2QCZ A;  4DXA B;  3J9C A;  4W9G A;  2H88 B;  3PRZ A;  1TS3 A;  3DHG C;  1WMH A;  2V3S A;  1V8C A;  4PS3 A;  2V3N A;  1WJU A;  4YTM B;  4KIK B;  3OWE B;  2PTL A;  3NZU A;  1ET6 A;  1KF6 B;  4JGH B;  2CJO A;  5HG2 A;  1SJH D;  5D94 A;  1EM7 A;  2XN9 C;  1E9M A;  2KWU B;  2B3A A;  4W9L A;  5MPO A;  1YD8 U;  4WQO B;  2LGD A;  4ICV A;  4PS7 A;  1FO4 A;  3ZIM A;  3UQB A;  4ZRJ A;  4TKN A;  4IWP A;  5EE1 A;  2WS3 B;  3WIM A;  4CHK A;  2LJ5 A;  3VUY A;  4MSQ B;  1MPE A;  1WM2 A;  2N7D A;  4WWN A;  4HJK A;  2HDE A;  5IO9 A;  1GNU A;  2K6Q A;  3RN9 C;  2Z8L A;  3UQA A;  3U2S C;  3PHW B;  3LJ3 A;  1TKG A;  2GI9 A;  2BS2 B;  3EEC A;  1UZX B;  2NTS A;  1Z2M A;  4YSX B;  3AEB B;  4PK1 A;  2KK8 A;  4LJO B;  4B95 A;  3TMP B;  4JE3 B;  2JWZ A;  3AEA B;  2N9K A;  2GOW A;  5GXG B;  1KOT A;  1WF9 A;  1MG8 A;  1TTN A;  4YTP B;  5H92 C;  2KFK B;  3P42 A;  2DNF A;  2KC2 A;  2BB6 A;  3DBH B;  4GOC A;  3RNG C;  2I2Y A;  3Q6B A;  3K9O B;  2BW2 A;  3HHM A;  5EE3 A;  4S0R A;  3RI7 C;  4EE2 A;  3DBR I;  1OQY A;  1WZ3 A;  4XX5 A;  1TGZ B;  2OOB B;  5EDS A;  3O65 B;  1P7E A;  1T5X D;  2W9N A;  4HCN B;  1EUV B;  4ZYN A;  4NQL B;  5G5H A;  2NVU I;  1EF5 A;  1ISN A;  2AWT A;  3ZRF A;  2MH7 A;  3RT3 B;  2C7N B;  4AS1 A;  1VD2 A;  4GN1 A;  1VZ6 A;  2JPH A;  1R4N B;  1WX7 A;  3O13 A;  4PT5 A;  3H6N A;  1ZDV A;  3L10 B;  1YJJ A;  2K1F A;  1PGX A;  1HA5 A;  3VH3 B;  2YLM A;  2BYV E;  1C3T A;  2Q5W D;  3KVF B;  1UWX A;  1FXT B;  1L0Y B;  2A4Z A;  1WYG A;  2X8X X;  3DHI C;  4LTU A;  3BY4 B;  2IO2 B;  1E7U A;  3AE7 B;  3ZNH B;  1IBX A;  3Q8C A;  4HDO A;  4OVU A;  3LXF A;  1TT5 B;  4W9I A;  1BUI C;  3L17 A;  3AED B;  1YX6 B;  4BZA A;  3PZ8 A;  1E6E B;  2PVO D;  4WJO A;  1C1Y B;  1DYQ A;  1LQB A;  4HRO A;  1WZ0 A;  5DPR A;  1UF0 A;  3ABV B;  1YN4 A;  1L4D B;  2V0G A;  4M0W B;  2LVO A;  4M8M A;  4GLS C;  1CMX B;  2ON8 A;  3NJT A;  2KMM A;  2WU2 B;  1FNW A;  1UBI A;  2JY6 A;  5IP4 D;  2WYQ A;  1PUT A;  1XCT L;  3PRP B;  1GB1 A;  3IT6 B;  4MEM A;  5CHV C;  2M0A A;  4KX6 B;  1N6Z A;  1HTQ A;  4W9C A;  2LVQ A;  3NHE B;  3PT2 B;  3R3M A;  2INP E;  3MTN B;  3ENE A;  4FJY A;  4FAD A;  3RZF A;  5G5G A;  1ACC A;  2AEH A;  3CSF A;  4FHK A;  2CHW A;  5CHF A;  1AW7 A;  2E3T A;  2JRI B;  1WM3 A;  5FR6 A;  2AL3 A;  1UNS A;  2LUE A;  2BWE S;  2I38 A;  1CQV A;  2INC C;  2V9H A;  4KSL C;  1B9R A;  3NVV A;  2BGF A;  4REZ A;  3V60 A;  1NEK B;  4F1S A;  4ANX A;  2M4N A;  4DK5 A;  1FRD A;  3M3J A;  3EGR A;  4OZB A;  3EHV A;  4HWI B;  3N1Z C;  2EKI A;  2R2O A;  1L6V A;  4HJG E;  2J0J A;  2GBM A;  1MJD A;  1L5P A;  4RGO S;  1I4Q A;  3ZJV A;  2A5U A;  2BPS A;  4BKT A;  2LJI A;  4K7U A;  3IAS 1;  2DYM A;  1A5R A;  1KTK A;  4W9F A;  4LJP B;  1WR1 A;  2J4X A;  1PGB A;  1HEZ E;  2BYT A;  1YJ1 A;  3VTW A;  1Z5S B;  4W9H A;  1N5W A;  1U4A A;  4US8 A;  2D2Q A;  3PGE A;  3UIN B;  3A9J A;  2QEJ C;  1HZ5 A;  2LI5 A;  2W82 A;  3A1Q A;  3QQ8 B;  3RNB C;  1FMA D;  1WYW B;  3HUI A;  2CR5 A;  4HPL B;  3H8H A;  2HTM E;  2ZZP B;  3TSS A;  1WJ4 A;  1Q1O A;  4DWF A;  1XCQ L;  5JZE B;  2PE6 B;  1NI3 A;  1F77 A;  2MWS B;  4RM8 A;  2MHJ A;  3U4E G;  1C4P A;  2WXK A;  2JXX A;  3D32 A;  1ZUD 2;  2V4L A;  2K5P A;  3DOW A;  3HM3 A;  4P1C C;  2GB1 A;  2K8C A;  4W9J A;  2O2V A;  1WIA A;  1H8C A;  2D11 A;  3R8B A;  3HK0 A;  1IGC A;  2NPT A;  2VRR B;  5HFY A;  3SU8 X;  1XLN A;  4P1B C;  3H7S A;  4KZC A;  4ZRK A;  3JSV B;  5JHA A;  1R4M B;  3N9Y C;  2IZV B;  2NMQ A;  5AZG A;  3SHQ A;  2XK5 A;  4MM3 A;  1E10 A;  2KDM A;  2EKE C;  4CYE A;  3B9J A;  4P7I A;  3DWG C;  1XT9 B;  3FIL B;  4ZOH C;  1KJT A;  4DDG D;  2WLB A;  4NAW B;  3IXS A;  2W55 A;  1TJE A;  1E7P B;  4EUT A;  4ZRI A;  3C0R B;  1DOY A;  2ONQ A;  3B2F A;  2PE9 A;  1E8W A;  2RD0 A;  4RMA A;  4W9K A;  3I9V 1;  4A9A A;  4LNN A;  2KJR A;  4RFB A;  2LD9 A;  2WXN A;  2C7H A;  3ZJU A;  5BYS A;  2JXT A;  1FM0 D;  1JW9 D;  2NS5 A;  2WDQ B;  4KKJ A;  4BOS C;  2W3S A;  4RF0 A;  1ROE A;  2BT6 A;  2RPQ A;  5AZH A;  1SE9 A;  3FAH A;  1WSP A;  2LUM A;  5LXH A;  4B6W A;  3A9K B;  4XYC A;  3DVN V;  1K8R B;  2ZCB A;  1IUE A;  1ZP0 B;  2ZJD A;  3V05 A;  2N9L A;  5D3D A;  3PSE B;  4WWP A;  1J7B A;  3SFD B;  3DCG A;  2LEK A;  2L32 A;  3AN1 A;  4C4V A;  4I6L B;  5IKC M;  5IN7 A;  3PLU A;  3FKY A;  4DDI D;  3Q69 A;  4RGM A;  3GS2 A;  2NTT A;  1YN5 A;  1JWU D;  3GE3 C;  2XNA C;  3VTV A;  3WAM A;  1FFV A;  3P63 A;  2KN5 A;  1T3Q A;  2AQ1 B;  2FID A;  3AEG B;  1F2R I;  1VZ7 A;  3JVZ X;  4EZK A;  3EUB 2;  2DZM A;  1UUP A;  3MJW A;  5E6P A;  2GBN A;  3ZKJ C;  3DVG X;  4DQO C;  2JU6 X;  2WXM A;  5BYQ A;  1I35 A;  2OJW A;  2W3R A;  3PZD A;  2WXL A;  4UDU C;  3AE8 B;  2INN E;  3SFE B;  1YIW A;  4IG7 B;  4TUU A;  2I1J A;  1NI2 A;  1HXY D;  1WE7 A;  1WRD B;  3UI3 A;  3BYT B;  1IP9 A;  1I4R A;  1D4B A;  4S17 A;  2KDB A;  1RWS A;  2BS3 B;  5HI1 A;  1L4Z B;  1C76 A;  1G6J A;  1LFD A;  3I5J C;  2LFI A;  3OJ4 B;  4JIO U;  1ZXH A;  4HXD A;  1FCL A;  2ICI A;  2I1K A;  4N9F 4;  1V5O A;  2L0F A;  4ICU A;  2O6V A;  2W54 A;  4WAF A;  1V1P B;  1RM6 C;  3TL5 A;  3BYY B;  2DWQ A;  2Z0E B;  2BB5 A;  4GU2 A;  1E7V A;  2BYF A;  3Q8B A;  2L1A A;  4GB9 A;  4BOZ B;  1EU3 A;  2ZEQ A;  1E8X A;  3AE2 B;  3ZXV A;  2PIA A;  3NS1 A;  3PRE A;  4M01 A;  2KLG A;  3GE8 C;  4I6P A;  1YQ3 B;  3VRA B;  2KWC A;  1QF6 A;  3Q3N C;  2IYD B;  4FLH A;  3RNE C;  3PLV A;  4A55 A;  1E8Z A;  2XEW A;  2TSS A;  1JWB D;  3QC8 B;  4BKS D;  4FA6 A;  3B0A A;  4ANV A;  3VR8 B;  4AJY B;  2IBI B;  1WGD A;  2L83 A;  1ENF A;  1VCB A;  2N1V A;  2G4S A;  2V1Y A;  3WAO A;  3NUH B;  3AUL A;  3NVW A;  2PJH A;  2KN4 A;  2BTE A;  3QJZ A;  4E71 A;  3ZNG C;  3B1L X;  3V6E B;  3RPF C;  4C7Y A;  1VZ8 A;  2CU3 A;  4JL9 A;  2JZ3 B;  2PEA A;  2H89 B;  2KAC A;  3ZJT A;  1JAL A;  2FCM A;  3KUD B;  5EE0 A;  3VH4 B;  4K3B A;  1TKE A;  3MHS D;  2M19 A;  2KTR B;  1PDX A;  4TQ1 A;  3VAW A;  2WXI A;  3JYU A;  2KJH B;  4LDT B;  4GSW A;  4XWT A;  2LMC A;  1WMH B;  1WJN A;  1WR6 E;  1JWS D;  5AUI A;  4NJC A;  2K8B A;  4DHZ E;  4JQW C;  2C9W B;  2WDR B;  3AI5 A;  3ZXR A;  1P7F A;  2JUO A;  4NAM A;  4YSY B;  3RMK C;  1HQR D;  2VZK B;  3T3N A;  1NYR A;  2WX1 A;  1MG4 A;  1QT9 A;  2R61 A;  1V5T A;  3RD2 A;  3A4R A;  5FK9 C;  4E3C A;  1FXA A;  1UH6 A;  4G11 A;  1QQR A;  4E74 A;  4OW0 A;  2PPH A;  1UBQ A;  4W9D A;  3TUO A;  3ZDM C;  4N58 A;  4C00 A;  4MT5 A;  2DEN B;  4KKI A;  1TYG B;  3AXC A;  4L2Y A;  5E6N A;  1FD6 A;  1Q10 A;  1D5M C;  2MA9 B;  1LO5 D;  2WXR A;  1TZ1 A;  4K81 A;  3B08 A;  4AJW A;  2HJ8 A;  1GUA B;  5CX3 A;  2LGY A;  2LHD A;  1ZPS A;  1SBB B;  2DZI A;  3C19 A;  1V9J A;  4KDL B;  2D10 A;  3W5U B;  2WDV B;  2CHX A;  1OEY J;  4MDK E;  1ZKH A;  2KYW A;  1MHH E;  2L76 A;  3L08 A;  4M8N A;  3N20 C;  3ZO5 B;  1QOF A;  3P4P B;  3OJ3 A;  2Y5B B;  3OLM D;  3ZNZ B;  4TSS A;  5JXV A;  1SE2 A;  3B2G A;  1K52 A;  2LGX A;  4XGA B;  2KHW B;  2MJ3 A;  3CIR B;  1PYW D;  1T0R C;  3ML8 A;  1UGM A;  2K25 A;  3EFC A;  1V81 A;  1PGA A;  3HVD A;  3BIN A;  2KFJ A;  3LB8 C;  1T0S C;  4RGN A;  4BKG A;  1K50 A;  4LNF A;  1V1O A;  2MBO A;  1IYF A;  3V3X A;  1FIQ A;  3K9P B;  1L0V B;  2LRW A;  4W9E A;  3KUZ A;  2N7J A;  3KYC D;  2JQR B;  3V61 A;  4NQK E;  2FIF A;  2YEP F;  5G2N A;  2NBU A;  4IOI E;  3DBL I;  3DWM A;  2HD5 B;  5L83 A;  1VJK A;  3IBE A;  2EEL A;  3NVY A;  3A4S C;  2BVC A;  2WQY B;  3AMZ A;  3ZYY X;  1MVK A;  1YOV B;  1JML A;  1BML C;  3TBL D;  2QHO A;  3QA8 A;  3N3K B;  1C78 A;  3RUL A;  4KVG B;  3H7P A;  4CO7 A;  1QIL A;  3W9C B;  2D3B A;  1IBX B;  2G1E A;  2GBK A;  5HKH A;  4L23 A;  2IGG A;  2LGS A;  1OTR B;  4B0E A;  1YX5 B;  5BYR A;  2MP2 A;  3UIP B;  4TQ0 A;  1V86 A;  3P1M A;  3PPA A;  3TEY A;  1K51 A;  2KD0 A;  2KC1 A;  3IHP C;  5J17 A;  1KH0 A;  2JYE A;  3AB5 A;  4JWS C;  1N63 A;  2KT7 A;  3BK2 A;  2IO1 B;  2NR2 A;  2KMC A;  3RUI B;  2UYZ B;  3DVG Y;  1WGY A;  1GPX A;  3DBR B;  1NYQ A;  1ESF A;  2LGI A;  2BYE A;  4TV3 A;  3VHT C;  2WDT B;  2KZR A;  1E5W A;  2OHF A;  3BVZ A;  1F2R C;  2GMI C;  3HVZ A;  3BWU D;  1L6U A;  3VFK A;  4WH4 A;  4M02 A;  3UF8 A;  1GC7 A;  3Q8A A;  2KMA A;  3VDZ A;  2WXH A;  1DOI A;  4C80 A;  2M1M A;  2AX5 A;  1J8C A;  1XEE A;  2ACZ B;  2LRU A;  1MI0 A;  5CHW A;  2KO3 A;  4HDQ A;  3KW5 B;  4K7S A;  5JH5 C;  4EEW A;  1J0G A;  2M8S A;  4LDT D;  1I4H A;  3APF A;  3BVG A;  2J0M A;  3MJ5 A;  4IDI A;  4XDD A;  3QHT A;  1JRP A;  1WGK A;  4IM2 A;  2JYT A;  3EFU A;  1YMH E;  3ZVV A;  1SF0 A;  1CK1 A;  1VR9 A;  2L00 B;  2GLS A;  1OQQ A;  4G3X B;  3M95 A;  1EWC A;  1I4P A;  2BS4 B;  3BK1 A;  2VZK D;  2WP9 B;  4HPP A;  1FEH A;  1OQR A;  3PVL A;  3I57 A;  1FNU A;  3P2B A;  1P98 A;  2D5G A;  4ASW C;  2JT4 B;  1QOA A;  1I4G A;  2KVR A;  2Z0D B;  1C79 A;  2PW9 A;  2GBJ A;  4HRS A;  3A9J B;  3DBL B;  4IW0 A;  3A1Q B;  1TZO A;  4N59 A;  1QOG A;  1T6B X;  1EO6 A;  5DCN A;  2KQS A;  4IM3 A;  4NJ6 A;  2WXP A;  3PZ7 A;  3QX1 A;  1UEL A;  4XE0 A;  1MHX A;  2WU5 B;  2VH1 A;  1XXG A;  3JW0 X;  1SSN A;  3MFG A;  2UWQ A;  4AOF A;  4OVV A;  2MBQ A;  1ET9 A;  4WQM A;  3U30 A;  4B9K A;  4GDL A;  1HTO A;  4GDK A;  1TS4 A;  3GP7 A;  3L16 A;  3KUC B;  4FHJ A;  2N9X A;  2QC8 A;  4EZL A;  2C60 A;  2O2V B;  3TEW A;  1F52 A; 
#chains in the Genus database with same CATH homology
 1V1P B;  1B1Z A;  1RM6 C;  1NEN B;  3BYY B;  3MP9 A;  1TS2 A;  1I4X A;  2RDG A;  1VRA B;  5H8Y E;  2DWQ A;  1BXT A;  4NZL B;  1P7E A;  1T5X D;  2BB5 A;  1I7H A;  3Q8B A;  2L1A A;  5G5H A;  1EU3 A;  4ITK A;  3AE2 B;  1F0Z A;  4MM3 B;  2PIA A;  3NS1 A;  5EE9 A;  2WXF A;  1YQ3 B;  3VRA B;  2MH7 A;  4YXD B;  4ZYS A;  2KWD A;  1QF6 A;  4AS1 A;  3W5V B;  3AE4 B;  1R7S A;  3VRB B;  1J7A A;  1TY2 A;  4OZC A;  3SR6 A;  4YSZ B;  2WXJ A;  4A55 A;  2YEP B;  1DOX A;  4OHJ A;  1VZ6 A;  4OVZ A;  2IDY A;  2TSS A;  1JWB D;  3O13 A;  1XLO A;  2QIL A;  4PT5 A;  1YJI A;  3FIL A;  1ZDV A;  3VR8 B;  1YJJ A;  1YNT E;  4RCO A;  1PGX A;  1HA5 A;  5TSS A;  4KGS A;  4C7Z A;  1D5Z C;  2L83 A;  3ZQ4 A;  2Q5W D;  1ENF A;  1UWX A;  5AUK A;  1L0Y B;  1WYG A;  4N6E B;  4LTU A;  3VQI A;  2J42 A;  3NUH B;  3T3O A;  3NVW A;  2KN4 A;  3AE7 B;  4C56 C;  2BTE A;  3RFZ B;  1IBX A;  3Q8C A;  3RPF C;  2JSV X;  4C7Y A;  1VZ8 A;  2CU3 A;  3LXF A;  3PO0 A;  1TKY A;  1Y56 A;  3P4Q B;  4JPS A;  1BUI C;  3AED B;  3KLS X;  1NVI D;  2H89 B;  3PZ8 A;  4US9 A;  2DLB A;  1E6E B;  2KAC A;  4YWG G;  3ZJT A;  2PVO D;  1JAL A;  1DYQ A;  1C9F A;  1C77 A;  4HRO A;  4KGT A;  5EE0 A;  1K53 A;  1A70 A;  1TKE A;  2M19 A;  2DBY A;  2MJE A;  1PDX A;  3ABV B;  4TQ1 A;  2QIE B;  1YN4 A;  2WXI A;  1L4D B;  2V0G A;  4WUR A;  3VR9 B;  5LNK 1;  2J52 A;  4H2A A;  4GLS C;  1C4A A;  2ON8 A;  4RNA A;  2KMM A;  2WU2 B;  3KWV A;  1FNW A;  4XWT A;  2SEB D;  2LMC A;  4HKZ E;  1AYF A;  1PUT A;  1XCT L;  1JWS D;  1ZXI A;  2CJN A;  4NJC A;  5AUI A;  3C8Y A;  4A90 A;  1GB1 A;  2GRI A;  3IT6 B;  2PVG C;  2WDR B;  2Y3A A;  1JCK B;  1P7F A;  2M0A A;  4KX6 B;  3R2I A;  3ZGZ A;  5E6J A;  4NAM A;  2PKO A;  4YSY B;  2INP E;  1L0X B;  5FR3 A;  1HQR D;  1GAQ B;  2VZK B;  4B0M A;  5I4D A;  3T3N A;  1NYR A;  2SAK A;  5G5G A;  1ACC A;  2WNM A;  2QMT A;  1QT9 A;  4KGR A;  4RGT A;  1AW7 A;  2R61 A;  1ZE3 D;  1GB4 A;  2IGD A;  4L1B A;  2E3T A;  5FKA C;  2IJ0 A;  5FK9 C;  4DXG A;  3TEZ A;  1FXA A;  2V3P A;  1QQR A;  1KLU D;  1UNS A;  4OW0 A;  1B9R A;  2I38 A;  1CQV A;  2RMM A;  3TUO A;  4N58 A;  3NVV A;  4REZ A;  1IGD A;  3FC4 A;  1NEK B;  5HHD G;  2IPK D;  2AQ2 B;  1FRD A;  4MT5 A;  1SXT A;  3EGR A;  4KKI A;  4OZB A;  4P6V F;  1TYG B;  4L2Y A;  4ZRQ A;  1FNV A;  1WWT A;  2EKI A;  1FD6 A;  4CQN A;  1Q10 A;  1D5M C;  1LO5 D;  2WXR A;  1L6V A;  4HJG E;  1ZDX A;  4ARC A;  1L5P A;  4RGO S;  2LHD A;  1ZPS A;  1SBB B;  1I4Q A;  2RDH A;  2IGH A;  3W2D A;  3ZJV A;  1JQ4 A;  2K22 A;  3W5U B;  2LJI A;  3IAS 1;  4P16 A;  2WDV B;  2DYM A;  4A8X C;  1KTK A;  1OFF A;  4D2K A;  3NRZ A;  1SE4 A;  4LLG M;  5BMG A;  1MHH E;  1RYJ A;  2WXG A;  3AE6 B;  2Y5P A;  2J4X A;  1J7C A;  1PGB A;  1HEZ E;  2BYT A;  4ZHO A;  1QOF A;  3P4P B;  1N5W A;  4MH8 A;  3AV8 A;  4US8 A;  1PFD A;  2MEK A;  4IKG A;  2QEJ C;  1HZ5 A;  1N62 A;  1DGJ A;  4TSS A;  2W82 A;  4GDL B;  2WXO A;  1CJE A;  1FMA D;  1EWY C;  5D7G A;  2QJL A;  3HUI A;  5JXV A;  1SE2 A;  4GDK B;  3B2G A;  2ZW1 A;  3H8H A;  1K52 A;  2HTM E;  1XLP A;  5T8I A;  2PMV A;  3TSS A;  3AEC B;  1QOB A;  2MJ3 A;  3CIR B;  2JX5 A;  4USA A;  1UGJ A;  3R2T A;  1PYW D;  1XCQ L;  2JZP A;  1SJE D;  1NI3 A;  1F77 A;  1KLG D;  1AWD A;  2DYO A;  3P4S B;  3URY A;  2JWU A;  3U4E G;  3P4R B;  1PGA A;  5BMI A;  1C4P A;  3HVD A;  2WXK A;  1TS5 A;  3LB8 C;  1D6E C;  1ZUD 2;  2K5P A;  4RGN A;  2GB1 A;  1K50 A;  1V1O A;  3NZ3 A;  4XDC A;  2LHE A;  3U7Z A;  3V3X A;  1FIQ A;  1L0V B;  4RH6 A;  3EA6 A;  2N7J A;  4Q2J A;  1STE A;  2JQR B;  1V1P A;  3R8B A;  3E56 A;  2YEP F;  2KAJ A;  3BII D;  1IGC A;  4IOI E;  2OED A;  4R3D A;  5HFY A;  2K9X A;  1XLN A;  2ZW0 A;  3DWM A;  1QLB B;  3N9Y C;  1VJK A;  3NVY A;  2EEL A;  2NMQ A;  4J3O D;  1KFY B;  2FE8 A;  2WQY B;  1V97 A;  2QSD A;  4OZA A;  1SEB D;  1VDV A;  2L52 A;  2KDM A;  3AMZ A;  3IT4 B;  3B9J A;  3ZYY X;  3DWG C;  4ZHP A;  1E10 A;  1MVK A;  1XO3 A;  1CZP A;  1JML A;  3FIL B;  3W1S A;  1BML C;  4ZOH C;  3MC0 B;  4ARI A;  2WLB A;  4NAW B;  3KQ4 A;  1YN3 A;  3IXS A;  2W55 A;  3AE9 B;  3Q8E A;  1C78 A;  1TJE A;  1E7P B;  1FCC C;  3GB1 A;  4RF1 A;  1QIL A;  3W9C B;  2K3U A;  4TMA B;  1DOY A;  1IBX B;  2ONQ A;  2G1E A;  4MAC A;  2FUG 1;  3B2F A;  1JWA D;  1YQ4 B;  3AH7 A;  4L23 A;  2IGG A;  1E0Z A;  4B0E A;  5BYR A;  3I9V 1;  4TQ0 A;  3P1M A;  1GOZ A;  3TEY A;  4HEA 1;  4A9A A;  4RFB A;  1K51 A;  2WXN A;  3Q8F A;  1KH0 A;  3L4P A;  4FXC A;  4WWM A;  1N61 A;  2JYE A;  3AB5 A;  5BYS A;  3ZJU A;  2JXT A;  1FM0 D;  1JW9 D;  1N63 A;  2KQ4 X;  2WDQ B;  4JWS C;  3BK2 A;  4KKJ A;  2W3S A;  3E9S A;  4JX1 C;  4RF0 A;  3LYY A;  1ROE A;  2BT6 A;  1RFK A;  1GPX A;  3FAH A;  3U52 E;  1WSP A;  2LUM A;  1NYQ A;  1ESF A;  2N0S B;  2Y5C A;  3IAM 1;  2BBC A;  1XF5 L;  5BMH A;  2LGI A;  1IUE A;  1N5X A;  1ZP0 B;  2G9H D;  3HRD D;  3V05 A;  2N9L A;  1TY0 A;  5D3D A;  2OHF A;  3BVZ A;  1AN8 A;  1M4V A;  1J7B A;  2PLP A;  3BVM A;  1WRI A;  1F2R C;  2MJD A;  1XLQ A;  4ZRP A;  3HVZ A;  3BWU D;  3SFD B;  3NVZ A;  4M0W A;  2X38 A;  1L6U A;  1ZOY B;  2L32 A;  2LEK A;  4WH4 A;  3AN1 A;  3J9C A;  2H88 B;  1QKZ A;  1TS3 A;  1UWM A;  2V4I B;  3Q8A A;  3AEE B;  4YT0 B;  2WXH A;  1V8C A;  1DOI A;  4C80 A;  2V3N A;  4WIP A;  2AX5 A;  1XEE A;  3AE1 B;  2ACZ B;  3Q69 A;  4YTM B;  4RGM A;  3GS2 A;  2NTT A;  1YN5 A;  4HKQ A;  1JWU D;  3OWE B;  5C3J B;  2PTL A;  1MI0 A;  2XNA C;  3AE5 B;  1ET6 A;  1KF6 B;  2CJO A;  1FFV A;  3P63 A;  1FRR A;  5HG2 A;  1T3Q A;  1SJH D;  2M56 B;  3AE3 B;  4AQ7 A;  1I4H A;  2AQ1 B;  2FBW B;  3BVG A;  3MJ5 A;  4IDI A;  1EM7 A;  4XDD A;  2XN9 C;  1E9M A;  1JRP A;  3AEG B;  1JRO A;  1F2R I;  1WGK A;  1VZ7 A;  5MPO A;  2JYT A;  1YMH E;  3TEX A;  1SF0 A;  1FO4 A;  3ETR A;  2K0P A;  3EUB 2;  1CK1 A;  1VR9 A;  1UUP A;  5EE1 A;  2WS3 B;  1OQQ A;  1SB3 C;  1EWC A;  1I4P A;  2RPV A;  2BS4 B;  3BK1 A;  1SE3 A;  2JU6 X;  1MPE A;  1FXI A;  2WXM A;  5BYQ A;  4A6Q A;  4DQO C;  2VZK D;  3AEF B;  2WP9 B;  1C4C A;  2W3R A;  1FEH A;  1OQR A;  1HZ6 A;  2HDE A;  1VLB A;  2WXQ A;  1D5X C;  2WXL A;  3CWI A;  3I57 A;  4UDU C;  3AE8 B;  1EU4 A;  2INN E;  3SFE B;  5D3I B;  1FNU A;  2Z8L A;  2D5G A;  2B76 B;  3U2S C;  1QOA A;  1I4G A;  1TKG A;  3WCQ A;  1C79 A;  1HXY D;  1N60 A;  2GI9 A;  2PW9 A;  4DXF A;  4HRS A;  2BS2 B;  3UI3 A;  3BYT B;  4O1N A;  2NTS A;  1TZO A;  1I4R A;  3KWL A;  4N59 A;  1QOG A;  1D4B A;  1T6B X;  4YSX B;  3AEB B;  1RWS A;  2WXP A;  3PZ7 A;  4YTN B;  2BS3 B;  4XE0 A;  1MHX A;  5HI1 A;  1L4Z B;  1JWM D;  2WU5 B;  1C76 A;  3MHZ A;  4JE3 B;  5C2T B;  1KRH A;  1XXG A;  1SSN A;  3MFG A;  1ET9 A;  3AEA B;  2LFI A;  3AM9 A;  4WQM A;  4XWW A;  2N9K A;  5GXG B;  3BZD B;  1SIJ A;  4YTP B;  1ZXH A;  1FCL A;  1FFU A;  1TS4 A;  3GP7 A;  2E6X A;  5H92 C;  3SEB A;  3P42 A;  2ICI A;  4LK0 M;  1WXQ A;  2BB6 A;  2J53 A;  2AQ3 B;  2I2Y A;  3TEW A;  2BW2 A;  5EE3 A;  2W54 A;  4WAF A;  4JWU C;  4EE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...