3BWUD

Crystal structure of the ternary complex of fimd (n-terminal domain, fimdn) with fimc and the n-terminally truncated pilus subunit fimf (fimft)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
121
structure length
121
Chain Sequence
b'LYFNPRFLADDPQAVADLSRFENGQELPPGTYRVDIYLNNGYMATRDVTFNTGDSEQGIVPCLTRAQLASMGLNTASVAGMNLLADDACVPLTTMVQDATAHLDVGQQRLNLTIPQAFMSN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chaperone protein fimC
publication title Crystal structure of the ternary FimC-FimF(t)-FimD(N) complex indicates conserved pilus chaperone-subunit complex recognition by the usher FimD
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone, structural, membrane protein
total genus 30
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2008-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.410 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3bwuD00
4J3OD 1ZDVA 3RFZB 1ZDXA 4B0EA 1ZE3D 3BWUD 4B0MA
chains in the Genus database with same CATH superfamily
3ZVVA 4OZAA 5GXGB 2ONQA 3CIRB 1HQRD 2CS4A 2DYMA 5DPSA 2FIDA 2BPSA 2N7JA 5J2RA 2LXAA 3N3KB 2H88B 1M4VA 3MP9A 2KTRA 1TKEA 1ZDXA 1WR6E 4N6EB 2KLGA 4DQOC 2HE7A 4IC7B 2ZZPB 3SR6A 3N1YC 1XQQA 4PS7A 4GMVA 3I9V1 1R4NB 4JE3B 4HRSA 4FHKA 2FCNA 2IBIB 3U4EG 1V6EA 3PLVA 2WXHA 3GB1A 4HKQA 3VTVA 1QF6A 3RNBC 2BTEA 4C7ZA 2ASQA 1BT0A 4ICVA 4FBJB 1GAQB 3PVLA 3N30A 2AQ3B 1GB4A 4M01A 2W9NA 4HDQA 4NAWA 3QC8B 3DHIC 1ZE3D 4AQ7A 2KDMA 3ZXRA 3BK1A 4C80A 4MSQB 3Q8BA 2N7EA 1RFAA 2Y5CA 2NBWB 3H1UA 1I4RA 4EOYA 3W5VB 2LGIA 4BFRA 3AE9B 2WDQB 4TSSA 1AARA 1FXTB 3Q14C 1N62A 3PSEB 4WWPA 3TEZA 3KYDD 2KANA 3JSVB 1MI0A 3KWVA 2JRHA 4C4VB 2N9PC 3AI5A 5D3IB 4BBNC 1STEA 4NZLB 1IYFA 1WH3A 2PKOA 4ANWA 4W9IA 2NR2A 3U52E 3PZDA 2MA9B 1ZDVA 3S2AA 2YVCA 5BYSA 1V49A 3PZ8A 3C8YA 1FO4A 3B2FA 4E74A 4NQKE 3IAS1 2WDRB 5L83A 4DXAB 3BZDB 5FR3A 3U2SC 3WIMA 4XWTA 3DWMA 3ZLZA 2KX3A 4N59A 2N7DA 1YN4A 1UZXB 1E8YA 3ZUNA 2G4SA 2VZKB 1EF5A 1QOBA 3NZUA 3EA6A 3Q8CA 4XWWA 3AU4A 2Z59B 1SIJA 3AH7A 5TR5A 3A9JB 2KYWA 4OW0A 2FCSA 4K7WA 2ZVNA 1T3QA 4KGTA 2DHZA 3NS1A 3P4PB 4KGRA 1FCLA 1I7HA 2PJHA 3DBRI 3N1ZC 3QHTA 1L2NA 1YQBA 2CHWA 4W9LA 1TY0A 4HPMB 4B0EA 5L95C 3L08A 1TYGB 1E6EB 4DDID 4WWMA 3ZNHB 1NYRA 4JX1C 1HTOA 2WDTB 2DZKA 3W2DA 1S1QB 3UGBB 1WY8A 2C9WB 1V9JA 1DOXA 2BB5A 2FCMA 1V97A 3H7SA 2LZ6A 3SD5A 3HVZA 5J18A 2M56B 3QJZA 3TMPB 2CJOA 1UBIA 3AU5A 1AW7A 4IM0A 4WJNA 2DYBA 3WA0A 4NJCA 4WJOA 2BVCA 3WALA 1WF9A 4NJ7A 3PS6A 4UDUC 1E8WA 1VZ8A 3NG0A 3PO0A 1WIAA 4HCNB 5DPWA 4YSXB 1VD2A 1TIFA 3VQIA 4IKGA 3QWZB 3NRZA 2KMCA 3HM6X 1OFFA 2KACA 2BYTA 2JPHA 4B6WA 1C4AA 1LM8B 3TBLD 1Q0WB 4M8NA 3H7PA 4LNOA 4A3OA 3U30A 1ZGUB 2CHXA 4PS3A 5E6OA 5KHQA 2IO1B 3KUDB 1KM7A 2JY6A 1MG4A 1JWUD 1QT9A 2H89B 4JGHB 2KO3A 4ARCA 4NNJB 4OVUA 4URKA 2PTLA 1HZ6A 4WAAA 3LXFA 2XN9C 2D3AA 2E3TA 1F0ZA 2INCC 2CR5A 1CJEA 2QC8A 3W9CB 3BVGA 3VRBB 2ZW1A 1IGDA 1JMLA 3UINB 3GOEA 2O6VD 1C4CA 3PLUA 2LWPA 1WXVA 4W9KA 1VRAB 1I4PA 1EM7A 5HHDG 2GRIA 3L17A 3B0AA 3IT6B 4C00A 3L54A 1AWDA 4M00A 3ZGZA 3P2BA 2J7QB 4FXCA 5D94A 2N1WA 3OJ4B 3A33B 3AMZA 2L00B 1P7EA 2IGDA 3DBHI 4JL9A 3GZNB 1LFDA 1J8CA 3KVFB 1NVID 4BAXA 4OZBA 4EZLA 4MSMB 1TZOA 4TQ1A 2K8BA 4GU2A 3UIPB 2HJ1A 3MFGA 3PV1A 4ARIA 2N9EB 3HHMA 3R7RA 3AM9A 3ECIA 3QK0A 1P3QU 2KVRA 4F8CB 3VR9B 2NTTA 1KLVA 5D3DA 2V4LA 2I1JA 4JPSA 3NZSA 3APDA 2MP2A 3GE8C 2V3PA 4II2B 5JZEB 5DPRA 4TUUA 4P6VF 3RNGC 4LJOB 2WNMA 2NPTB 2KZRA 3VHTC 4ZOHC 4GDLB 1PUTA 1LXDA 3AEFB 2PPHA 4BOZB 5C2TB 1K51A 2JQRB 4NQLB 1FRRA 2LVQA 1VDVA 1KF6B 2KDEB 1EUVB 2K1FA 4LDTD 1MG8A 1ISNA 1K8RB 2PVGC 4ZYNA 1PGXA 4E71A 1Q5WB 3SHQA 5IP4D 1ZXHA 2MLBA 1E5WA 2MX2A 1WYGA 2N9LA 3ZNGC 2WXOA 1YMHE 3VRAB 2JT4B 2JZ3B 1SEBD 1WE7A 3M95A 4HEA1 3DVGY 4BKTA 4REZA 2LGSA 3A9JA 2TSSA 4J3OD 1BXTA 3NVWA 1N63A 1WM3A 2PIAA 2PE6B 2LRUA 3BVMA 5AUIA 4WJQA 1DGJA 2WXQA 1VZ7A 2QIEB 1KLUD 2HD5B 3HK0A 3EFCA 2DZJA 2KFJA 2KQSA 2RDHA 2K6QA 3WANA 1RWSA 1BMLC 1WYWB 4FJVB 4HCPB 1I4GA 1L7YA 5C1ZA 4GGQA 2DLBA 2WXJA 1UUPA 2Y3AA 2UU7A 1FM0D 2W3SA 2CU3A 2M0AA 1PDXA 1YX6B 3ABVB 1KLGD 1JW9D 2C5LC 2FUG1 5AZFA 2GOWA 4C7YA 2LJIA 1HXYD 2FIFA 2L0TA 4DK5A 3AE3B 3FILB 1I4QA 1UBQA 1N60A 2N1VA 1WGRA 1JRPA 2WXRA 4CQNA 2IPKD 1FMAD 3WAPA 2ACZB 2LVOA 2KFKA 4JWUC 3NUHB 1P1AA 4G0NB 2DAFA 3H8HA 3MC0B 2JXTA 4EE2A 4P1BC 2D3BA 4MACA 4M0WB 3AEDB 2JYEA 5CTRC 3OLMD 1SJED 3I5JC 3UI3A 3U8ZA 2BS4B 2K25A 4HPPA 4PK1A 4I6LB 3NVZA 2DZMA 4TQ0A 3C19A 3BYTB 1P0RA 1KJTA 2RPVA 4CYEA 4ASWC 2PMVA 1K53A 2IJ0A 1GG3A 1SGHA 2O2VB 4HDOA 1IGCA 2I38A 2G45B 2GI9A 2DAJA 1HA5A 3AE7B 1AN8A 1YN5A 4W9DA 2WHIA 3TJPA 2WXKA 5JHBA 1WRDB 3KYCD 4ZRIA 2HDEA 4W9JA 1NI3A 4LLGM 3X0WA 3NS8A 1VLBA 2PW9A 1Q10A 2NS5A 2KDFB 2AQ1B 3AULA 3DPDA 3LDZE 1X1MA 5AZHA 1I35A 3HM3A 3PRMB 3FAHA 4YSZB 5D2MB 4LK0M 2L52A 4D2KA 3VUYA 2AYOB 2WXNA 2D07B 3H6NA 1FFVA 3NHEB 3WAMA 2AQ2B 2KJRA 1E90A 2XK5A 1MJDA 3DBRB 1SBBB 1DOIA 1IBXB 1C79A 1WM2A 2B76B 2KQ7A 4MM3B 1EU4A 2WYQA 1WXAA 1Y8RC 3AB5A 5TSSA 3ZIMA 4A55A 2KDIA 4N58A 3PT2B 2C60A 3PPAA 3OJ3A 4EKUA 3T9LA 2NVUI 3VTUA 2D5GA 4RGNA 2L32A 2MHJA 2XNAC 1QZEA 3RCZA 3QQ8B 3PZ7A 2L7RA 4IWQA 2ZNVC 4XC2A 1ET6A 4IM3A 1ZW7A 1T0QC 2D10A 2KWDA 2R2OA 2FBWB 2JUOA 3ZDTA 2OJWA 3QA8A 1TS3A 3PRZA 1OEYA 1WFYA 5IKCM 4KDIC 2V3SA 5LXIB 1J19A 1Z5SB 3AEBB 2FAZA 2RPQA 4IM2A 1GPXA 4FJYA 3I57A 3GE3C 2LGXA 4S17A 2W82A 1CZPA 1R4MB 5D6JB 2BT6A 3V60A 4PYZA 4YL8A 2IYDB 4ZRKA 4YXDB 1V86A 5CHWA 1RM6C 3KUCB 3CMMB 5IOIA 5MPOA 3ZRFA 4GDLA 2KC2A 3AE6B 4WH4A 4K7UA 4B9KA 1YN3A 2W3RA 2SEBD 4LNIA 3W1SA 2BS3B 3DHHC 3Q69A 1S3SG 1ESFA 2KJHB 2GBRA 2AWTA 3VTWA 1XLOA 4HJKA 1V8CA 4HVBA 1UGMA 4FA6A 1GB1A 1L0XB 2WXGA 4K3CA 1T0SC 3GP7A 3MC8A 2RMMA 2N0SB 1V1PB 1L4ZB 3RULA 4KSKC 4LNNA 2RSUA 3FKYA 4KIKA 1G6JA 4EZJA 3U7ZA 3PREA 2RR9A 1TJEA 2ZCBA 3ML8A 1WGHA 4OVVA 4A9AA 1V81A 2IGHA 1ZXIA 2HTHA 2IY0B 3R3MA 2QCZA 1KH0A 3MHZA 4H2AA 3V6EB 2Z8LA 2MW5A 3L4PA 2ZW0A 2UYZB 1WZ3A 3Q3JA 1F52A 1V80A 1L4DB 1ET9A 3KLSX 4KZCA 1C9FA 2LGYA 4FHJA 2QHOA 4YWGG 1LQBA 1TBEA 1WX7A 4ZHOA 1MFWA 4LNFA 1QOGA 2BKRB 1ZOYB 4MDKE 2GBMA 1MVKA 3DBHB 2MBOA 3K9OB 1MPEA 4FJZA 1SE4A 3VVWB 2C7NB 1XCTL 2LUMA 2IO2B 3LB8C 3RD2A 3FILA 3ZKJC 1KRHA 2M8SA 4NJ6A 3QCAA 2LVPA 2J52A 2JRIB 2KNBA 2R2QA 3P42A 2L1AA 4WWNA 1IUEA 3A1QA 4W9FA 1NBFC 3EGRA 3LYYA 1F9JA 2D3GA 4KZ0A 3OG5A 2ON8A 2REXA 1OGWA 2KWCA 1WGKA 4M0WA 2ZJDA 2INNE 2FUHB 4KV2A 1B1ZA 3UQBA 1MHHE 2PLPA 2XEWA 2JZZA 2A4ZA 5IA7A 2CKHB 4AJYB 2HTME 4ACFA 4XDCA 3IG3A 4O1NA 1V1OA 1Z2MA 1WMHB 4OZCA 3APFA 5T8IA 2WDVB 1C1YB 1PGAA 4IOIE 1PQSA 3DBSA 2KVZA 4KDLB 2OJRA 3NY5A 3Q8AA 5C3JB 4DXFA 2QMTA 4RM9A 2LI5A 3AE2B 1DYQA 3UQAA 2YEPB 2Z0DB 4HROA 1GC6A 1UH6A 4LTUA 4US8A 2E6XA 4KSLC 2RD0A 2VRRB 4A20A 5BMIA 1D4BA 4HWIB 1E7UA 3Q8FA 4I6PA 3MC9A 1SXTA 3RN9C 2WLBA 2J53A 3ZNZB 3J9CA 3CSFA 2L05A 2WX0A 2BWFA 2WXIA 2I2YA 1OQRA 2X38A 1RYJA 4KX6B 4BVUC 5C23A 1LGRA 3P1MA 3B08A 2AL6A 3E56A 2BYFA 1V5TA 4ICUA 2EMTA 4HK2A 2RDBC 1A5RA 2KJ6A 2D11A 4GIVA 2NTSA 4A8XC 2UWQA 3AE4B 5H92C 1D3ZA 2MQJA 5G5HA 1JWBD 3NJTA 2L76A 1IP9A 3U7DA 3JSVA 1FNVA 1N5XA 1HZ5A 3KW5B 2JX5A 2KKCA 3R7QA 4C4VA 3SFDB 3RNCC 3V3XA 2SAKA 3DOWA 3KH0A 2HJ8A 1WXQA 1J7BA 3TL5A 1E10A 2NBVB 4RGTA 1YQ3B 1TS4A 3EHVA 5LLIA 1L0VB 1TKYA 4HJGE 5BMHA 2VH1A 4DHJD 3IXSA 2M17A 3NVVA 3V62A 2JF5A 1H8CA 3Q8EA 1GC7A 4NY0A 2KX0A 3IFWB 5JHAA 3JVZX 3P4RB 2JYTA 5E6NA 1C78A 4IW0A 2MBBB 5GMVA 1H4RA 2W55A 1XD3B 1D5ZC 1CMXB 4A6QA 1WGYA 1E8ZA 4IUMB 1RRBA 1D5MC 4US9A 4RFBA 3A4RA 4L2YA 2BQQA 4R3DA 2VH2A 4GLSC 1OTRB 3AE8B 5BMGA 4WQMA 3A9KB 4RNAA 3QIJA 4LCDE 2CHZA 3N1XC 1TZ1A 2KC1A 4MH8A 1SE2A 4DWFA 2K0PA 1FPYA 2G4DB 4W9GA 2G3QB 1JWMD 5BYQA 1N6ZA 4GSWA 3RI7C 1WXMA 3HUIA 1C4PA 1QQRA 1N5WA 2LGDA 1UELA 2M19A 1IPGA 2K9XA 3BVZA 2BYVE 4BKSA 3GZNI 4AWJA 3RT3B 3ZRCA 4BZAA 2N4FA 4M02A 3W1SC 2KAJA 5FR6A 1EU3A 3B9JA 1T0RC 3RYTA 1TGZB 4RGMA 1F2RC 1RFKA 2J4XA 2V3NA 1NYQA 1VZ6A 4OHJA 3ZNID 2MBQA 3DCGA 3V05A 1QILA 3ZO5B 2IGGA 3APCA 2ZCCA 4YTNB 2MSED 4KVGB 2NMQA 3V6CB 2EMSA 4WURA 4RH6A 1D6EC 1VCBA 3PRPB 2K22A 4NPNA 1FNUA 1FFUA 5H8YE 3H9DA 3ZXVA 1EO6A 3M62B 4X57B 2GMIC 1ZKHA 3HRDD 1GOZA 1EF1A 3DBLI 2ZPYA 1UNSA 2IZVB 3W1YA 1WJ4A 2L3ZA 4RM8A 2NCNA 4PS8A 1F2RI 1UD7A 1WE6A 2DWQA 4FADA 1QOAA 4JQWC 2MBHA 4MGIE 2K8CA 4W9EA 3IHPC 3MJ5A 1PFDA 1FXAA 1WJ6A 4HKZE 1TT5B 2R61A 2EKIA 3AN1A 1SB3C 3N20C 3ENEA 3ONSA 4PT5A 4AOFA 2DBYA 3M63B 1TY2A 3B2GA 1UWMA 1FCCC 1E7PB 2M4NA 2MJEA 2FE8A 3WAOA 3AV8A 1WJNA 2C7HA 1TS2A 3T3NA 2ZEQA 3HIZA 2MCNB 2MRPA 4K3BA 2FCQA 4P7IA 3TSSA 2G1EA 3BY4B 2O6VB 3CF6E 1DOYA 1L0YB 2K6DB 2GB1A 4BOSC 4FULA 1KFYB 1PYWD 1LO5D 2GBNA 4RMAA 2OEDA 1JRUA 4BBNF 2MEKA 5AZGA 2MWSB 1HEZE 5FKAC 5E6JA 1XF5L 5DPTA 4JIOU 4A90A 1WZ0A 3T8MA 4KKIA 2WGSA 3VAWA 2LHDA 3I3TB 3V61A 4B95A 2WX1A 1B9RA 1GNUA 1M94A 2L0FA 4IDIA 2G9HD 2KOXA 3X23A 3Q6BA 2JXXA 1JALA 2OOBB 3RMKC 4ZDVA 3JW0X 1C77A 3IAM1 3EUB2 1YX5B 1I42A 1PGBA 1F1HA 4GDKB 3ZJVA 3Q3MC 4MGZE 5EE1A 3VH3B 5I4DA 4P16A 2GBJA 4K81A 1T0YA 3BIID 5G5GA 3TEXA 3P63A 2MP2B 2INDC 5AEKB 3MTNB 2NPTA 4HPLB 4ANXA 5EE3A 2MBEA 3ZTDA 4MGKE 4DBGA 3L16A 1P98A 3QX1A 3GS2A 1XXGA 1XLPA 2BW2A 1RAXA 2V1YA 3FC4A 3ZJTA 1CQVA 1ENFA 2AX5A 5JXVA 4YT0B 2EELA 2BS2B 2WP9B 2JWZA 3RNEC 3ZDMC 3HVDA 1R7SA 4F1SA 3MJWA 1JCKB 2LRWA 1WXSA 4B0MA 4KKJA 2QDFA 2RDGA 1WGDA 4XZ4A 3ETRA 3CWIA 4G11A 3P4QB 3DVNV 4DHJB 3ALBA 2B3AA 4RGOS 4LDTB 1ZPSA 3DVGX 2K5PA 5HI1A 5J17A 4DDGD 2J0KA 3ZQ4A 2M1MA 5JH5C 3D32A 4MJSB 4I6NB 1E7VA 2MJ3A 1Q1OA 1WGGA 5E6PA 4C56C 3CSTA 5BYRA 3UF8A 2LFIA 1R4NI 3A9KA 4DHZB 3I63C 3WCQA 3C0RB 1E8XA 1JROA 1UGJA 3R2TA 4ZRJA 4W9HA 1OEYJ 1SIFA 1XLNA 1KOTA 3TEYA 2Z0EB 3Q3FA 4FLHA 4WQOB 2QILA 4YSYB 1QKZA 4L1BA 1NEKB 1XCQL 5BO4B 2LEKA 1JWSD 1YIWA 5FK9C 3Q3NC 4MEMA 4WWOA 2JU6X 5HFYA 4HXDA 2KQ4X 3VDZA 4GB9A 1WSPA 3BINA 2FNJB 2J0JA 4QAYA 1SF0A 2L8JA 3KQ4A 1JWAD 3BK2A 5AUKA 3BWUD 4EZKA 5IN7A 1FIQA 3RZFA 4DXGA 3KUZA 4A3PA 1D5XC 1R4MI 4P1CC 2DENB 4L23A 1MHXA 3IT4B 4XX5A 2KWUB 2KLCA 2BWES 4OVZA 1NDDA 1WRIA 3AE5B 1WX9A 2DYOA 4LNKA 2KFKB 3R8BA 4EFOA 4II3B 4RF0A 3Q2AC 5LXHA 2RGFA 4M8MA 2INPE 2J42A 3ZYYX 4KGSA 2I1KA 3TEWA 4WIPA 1SSNA 1WI0A 2WXMA 3AEAB 2AEHA 1J7CA 2XBBC 3IBEA 2O2VA 3O65B 2BBCA 2LXCA 5EDSA 3LJ3A 4AS1A 3EECA 2YLMA 2WU2B 1NENB 1XLQA 2Q5WD 3OAWA 4EEWA 4MH0E 2K39A 3L13A 1HE8A 2KHWB 2KTRB 1SE3A 3IVFA 3OWEB 1OQYA 4F7ZA 2YEPF 1K52A 4AP4C 1SJHD 5HG2A 4ZYSA 2KD0A 2O6VA 2BGFA 4GOCA 2KMAA 4IWPA 2GBKA 2QJLA 1BUIC 4S0RA 1IBXA 1FD6A 3NZ3A 4DHZE 1XT9B 3R2IA 4MM3A 2XK5B 1YNTE 5LNK1 2J0MA 1I4HA 3RNAC 3RUIB 1T6BX 3SDLC 2ICIA 1SE9A 2LUEA 1I4XA 5G2NA 1UWXA 3SEBA 3DQVA 4NAWB 3DWGC 4TKNA 2KN5A 4WAFA 5KHOA 4G50A 1NI2A 5DCNA 2CU1A 4RCOA 1QOFA 2KK8A 5EE0A 3QARA 2M0XA 3L10B 1ACCA 2D2QA 2MH7A 1XO3A 3DDCB 5IAAC 3PGEA 3AEGB 4GDKA 2BB6A 4W9CA 3R66C 2WXPA 3ML9A 4K7SA 1OQQA 2K3UA 1YJIA 3TIXA 2IDYA 3AE1B 2JSVX 1P9DU 4AUQC 2LD9A 1GJZA 2WXLA 1L6VA 2BF8B 2KT7A 2V0GA 1HTQA 3B1LX 1TTNA 4BKGA 3ZW3A 1FXIA 2DNFA 2GLSA 4CHKA 4XGAB 1RLFA 2WU5B 4USAA 2DZIA 3URYA 2CJNA 2KDBA 1JQ4A 2K8HA 1EWCA 3VUXA 4IG7B 1WX8A 1P7FA 3VR8B 4ZHPA 1VR9A 3DBLB 4JWSC 1E9MA 4WJPA 2WWZA 2KXJA 2IO0B 1VJKA 1E0ZA 2KN4A 1TS5A 4XDDA 4N9F4 5EE9A 3EC8A 2VZKD 3TCAA 2JWUA 1V1PA 1L6UA 2LMCA 5CHFA 3A4SC 2N9KA 2JZPA 2Y5BB 4MJSA 4ANVA 3BYYB 4IWOA 2WS3B 2ZVOA 4KIKB 3K9PB 2PE9A 5HKHA 2D3CA 1YJJA 1N61A 2PEAA 1J0GA 2ZPNA 3PTFC 4YTPB 3E9SA 3JYUA 1FNWA 3NVYA 2BYEA 4J6IA 5G55A 3O13A 4FN2A 4BKSD 3SFEB 2WQYB 2KTFA 4NAMA 2EKEC 3RZWC 1L5PA 4ANUA 3VUWA 3VFKA 3NOBA 2NBUA 1ZP0B 2WXFA 5CX3A 4E3CA 2IO3B 3MHSD 2AL3A 2MJDA 3RFZB 2V4IB 3L0WB 3AEEB 4CO7A 1WJUA 2KMMA 2PVOD 1C3TA 4EUTA 4ZRQA 2JVCA 3ZTCA 3ZJUA 3DVNU 3Q3OC 1WR1A 2V9HA 3RPFC 1TKGA 1YOVB 5CHVC 1ZUD2 2QEJC 4PYUA 4ITKA 2QSDA 3W5UB 1FRDA 1V2YA 2N9XA 2LJ5A 4HLEA 4XYCA 4AJWA 1QLBB 3QAQA 3VH4B 2KWVB 3RNFC 4ZRPA 1KTKA 1K50A 4LJPB 4K1RB 3TUOA 4GN1A 3AECB 3P4SB 1GUAB 4MELA 4Q2JA 1J7AA 2A5UA 2W54A 2X8XX 4G3XB 1UF0A 2C7MB 3A1QB 1CK1A 1EWYC 1V5OA 4GXBA 3KWLA 3AXCA 2OHFA 3SU8X 1ROEA 4JLCA 1Y56A 2LASA 2Y5PA 3H7PB 1U4AA 1WWTA 2IY1B 1YJ1A 3VXWA 3EFUA 3T3OA 1F77A 1YQ4B 2BKFA 4TV3A 1AYFA 5D7GA 5IO9A 1A70A 4MGYE 1T5XD 1C76A 4RF1A 3DHGC 2DX5B 1FEHA 2LHEA 2L83A 4MT5A 4XE0A 1YD8U 3UIOB 3N32A 1XEEA 3N9YC 2ZNVB 3M3JA 4TMAB 1WMHA 3PHXB 4YTMB 3PHWB
chains in the Genus database with same CATH topology
4OZAA 1WYGA 2ONQA 5GXGB 2N9LA 3CIRB 4OZCA 5T8IA 1HQRD 2WDVB 2MJ3A 2WXOA 1PGAA 1YMHE 2DYMA 4IOIE 3VRAB 2N7JA 4C56C 3Q8AA 5C3JB 5BYRA 4DXFA 2H88B 1SEBD 2QMTA 1M4VA 2LFIA 3MP9A 3AE2B 4HEA1 1TKEA 1ZDXA 4N6EB 4DQOC 1DYQA 4REZA 2YEPB 3WCQA 2TSSA 4HROA 4J3OD 3SR6A 4LTUA 1BXTA 3NVWA 4US8A 1N63A 2E6XA 2PIAA 5BMIA 1D4BA 1JROA 1UGJA 3I9V1 3R2TA 4JE3B 4HRSA 3Q8FA 3BVMA 5AUIA 1XLNA 1SXTA 3TEYA 1DGJA 3U4EG 2WXHA 3GB1A 2WXQA 4HKQA 1VZ7A 2WLBA 2J53A 2QIEB 3J9CA 1KLUD 1QF6A 2QILA 2WXIA 2BTEA 2I2YA 4YSYB 1OQRA 4C7ZA 1QKZA 4L1BA 1NEKB 1XCQL 2RDHA 2X38A 1RWSA 1GAQB 1BMLC 1RYJA 2LEKA 4KX6B 1JWSD 1I4GA 2AQ3B 5FK9C 1GB4A 2DLBA 3P1MA 2WXJA 1ZE3D 3E56A 4AQ7A 1UUPA 2JU6X 2KDMA 2Y3AA 5HFYA 3BK1A 4C80A 1FM0D 3Q8BA 2W3SA 2KQ4X 1WSPA 2CU3A 2Y5CA 2M0AA 1PDXA 2NTSA 3ABVB 4A8XC 1KLGD 1JW9D 2FUG1 1SF0A 4C7YA 1I4RA 2LJIA 1HXYD 3KQ4A 1JWAD 3AE4B 3W5VB 5H92C 3BK2A 3AE3B 5AUKA 3FILB 2LGIA 3BWUD 1I4QA 5G5HA 1JWBD 3AE9B 2WDQB 1FIQA 4TSSA 1N62A 4DXGA 1N60A 3TEZA 1D5XC 1JRPA 4L23A 1MHXA 1FNVA 2WXRA 3IT4B 4CQNA 1N5XA 2IPKD 1HZ5A 2JX5A 1FMAD 4OVZA 1MI0A 1WRIA 2ACZB 3SFDB 3AE5B 4JWUC 3V3XA 2SAKA 3NUHB 3KWVA 2DYOA 3R8BA 5D3IB 4RF0A 1WXQA 3H8HA 3MC0B 2JXTA 1STEA 4NZLB 4EE2A 2PKOA 2INPE 1J7BA 4MACA 1E10A 2J42A 4RGTA 1YQ3B 3AEDB 2JYEA 3U52E 1TS4A 3ZYYX 4KGSA 1L0VB 1SJED 3UI3A 1TKYA 4HJGE 5BMHA 3TEWA 1ZDVA 2BS4B 3IXSA 4WIPA 1SSNA 5BYSA 3NVVA 2WXMA 3AEAB 1J7CA 3Q8EA 3PZ8A 3C8YA 3NVZA 4TQ0A 3BYTB 2RPVA 3P4RB 1FO4A 2JYTA 3B2FA 2BBCA 1C78A 3IAS1 2PMVA 1K53A 2IJ0A 2WDRB 1IGCA 2I38A 3BZDB 4AS1A 5FR3A 2GI9A 2W55A 2WU2B 3U2SC 1HA5A 3AE7B 1NENB 4XWTA 1AN8A 1YN5A 1D5ZC 1XLQA 3DWMA 4A6QA 4N59A 2WXKA 1D5MC 1YN4A 4US9A 4RFBA 4L2YA 2HDEA 2Q5WD 1NI3A 2VZKB 4LLGM 4R3DA 4GLSC 1QOBA 3AE8B 1VLBA 3EA6A 3Q8CA 4XWWA 5BMGA 4WQMA 2PW9A 1SIJA 1SE3A 1Q10A 3AH7A 4RNAA 2AQ1B 4OW0A 1T3QA 4KGTA 4MH8A 3OWEB 1SE2A 2YEPF 1K52A 3NS1A 1SJHD 3P4PB 4KGRA 1FCLA 3FAHA 4YSZB 2K0PA 5HG2A 4LK0M 4ZYSA 2L52A 1I7HA 4D2KA 2WXNA 1JWMD 5BYQA 1FFVA 2QJLA 3HUIA 1C4PA 1TY0A 2AQ2B 4B0EA 1BUIC 1IBXA 1QQRA 1FD6A 1N5WA 3NZ3A 1TYGB 1E6EB 3R2IA 1SBBB 1DOIA 2M19A 4WWMA 1IBXB 1YNTE 1C79A 1NYRA 4JX1C 5LNK1 2B76B 2K9XA 1I4HA 3BVZA 4MM3B 1EU4A 3W2DA 1T6BX 2ICIA 1I4XA 1UWXA 3SEBA 1DOXA 3AB5A 5TSSA 4A55A 4N58A 2KAJA 2BB5A 4NAWB 3DWGC 1EU3A 3B9JA 1V97A 2D5GA 4RGNA 2L32A 4WAFA 4RGMA 2XNAC 1F2RC 3HVZA 1RFKA 2J4XA 2M56B 4RCOA 1QOFA 1NYQA 2V3NA 3PZ7A 5EE0A 2CJOA 1VZ6A 4OHJA 1AW7A 1ET6A 1ACCA 3V05A 1QILA 2IGGA 2KWDA 2FBWB 4YTNB 2MH7A 2NMQA 1XO3A 1TS3A 4NJCA 4WURA 4RH6A 3AEGB 1D6EC 2BB6A 3AEBB 1GPXA 2WXPA 2K22A 3I57A 1OQQA 2K3UA 2W82A 4UDUC 1VZ8A 1FNUA 1YJIA 2IDYA 1FFUA 1CZPA 2JSVX 3AE1B 3PO0A 2BT6A 5H8YE 2WXLA 1L6VA 4YSXB 2V0GA 4YXDB 3VQIA 4IKGA 3NRZA 1RM6C 1FXIA 3HRDD 1GOZA 1OFFA 2KACA 5MPOA 2BYTA 2WU5B 1C4AA 4USAA 3URYA 3AE6B 2CJNA 4WH4A 1JQ4A 1UNSA 1YN3A 1EWCA 2W3RA 2SEBD 1F2RI 2BS3B 3W1SA 2DWQA 3Q69A 1P7FA 3VR8B 1QOAA 1ESFA 4ZHPA 1VR9A 1XLOA 4JWSC 1E9MA 1V8CA 1VJKA 1E0ZA 2KN4A 1JWUD 1GB1A 3MJ5A 1TS5A 1PFDA 1QT9A 2H89B 1L0XB 4XDDA 5EE9A 1FXAA 2WXGA 2VZKD 2JWUA 1V1PA 1L6UA 4ARCA 3GP7A 4HKZE 2LMCA 2PTLA 1HZ6A 2RMMA 2N0SB 1V1PB 1L4ZB 3LXFA 2R61A 2EKIA 2E3TA 2XN9C 2N9KA 1F0ZA 2JZPA 1CJEA 3AN1A 1SB3C 3W9CB 3BVGA 3VRBB 2ZW1A 1IGDA 3BYYB 4PT5A 3U7ZA 1JMLA 1TJEA 2WS3B 2DBYA 1TY2A 3B2GA 1UWMA 1FCCC 1E7PB 2MJEA 2FE8A 4A9AA 3AV8A 1C4CA 1N61A 1TS2A 1YJJA 3T3NA 4YTPB 3E9SA 2IGHA 1ZXIA 1FNWA 3TSSA 2G1EA 3NVYA 1DOYA 1VRAB 1KH0A 1L0YB 1I4PA 1EM7A 5HHDG 2GRIA 2GB1A 1KFYB 1PYWD 3MHZA 1LO5D 4H2AA 3IT6B 2Z8LA 3O13A 3L4PA 2OEDA 2ZW0A 1AWDA 2MEKA 3SFEB 2WQYB 3ZGZA 4NAMA 1L4DB 1HEZE 4FXCA 5FKAC 5E6JA 1L5PA 1ET9A 1XF5L 3KLSX 1C9FA 4A90A 1ZP0B 3AMZA 1P7EA 2IGDA 4KKIA 2WXFA 4YWGG 2LHDA 2MJDA 3RFZB 2V4IB 1B9RA 3AEEB 4ZHOA 4IDIA 1QOGA 2G9HD 1NVID 4OZBA 1ZOYB 1TZOA 4TQ1A 1JALA 2KMMA 2PVOD 3MFGA 1MVKA 4ZRQA 4ARIA 1MPEA 3ZJUA 1SE4A 3AM9A 1C77A 3IAM1 3EUB2 3RPFC 1XCTL 1TKGA 2LUMA 3VR9B 1ZUD2 2QEJC 3LB8C 1PGBA 2NTTA 4ITKA 4GDKB 2QSDA 3ZJVA 3W5UB 3FILA 1FRDA 5D3DA 1KRHA 5EE1A 1QLBB 4JPSA 5I4DA 4P16A 2J52A 4ZRPA 1KTKA 2V3PA 1K50A 3P42A 2L1AA 3BIID 5G5GA 3TEXA 3P63A 3TUOA 3AECB 3P4SB 4P6VF 1IUEA 4Q2JA 1J7AA 2W54A 5EE3A 2WNMA 3EGRA 1CK1A 3LYYA 1EWYC 2ON8A 1XXGA 1XLPA 3GS2A 3KWLA 2BW2A 2OHFA 3FC4A 4ZOHC 4GDLB 1PUTA 1ROEA 3ZJTA 1CQVA 2AX5A 1ENFA 1Y56A 4YT0B 5JXVA 1WGKA 2EELA 2BS2B 2WP9B 3AEFB 2Y5PA 4M0WA 1K51A 5C2TB 1WWTA 2INNE 2JQRB 3T3OA 3HVDA 1F77A 1R7SA 1YQ4B 1JCKB 1AYFA 5D7GA 1FRRA 1VDVA 4B0MA 4KKJA 2RDGA 1KF6B 1A70A 3ETRA 1B1ZA 1MHHE 2PLPA 1T5XD 1C76A 3CWIA 4RF1A 3P4QB 1FEHA 2LHEA 2L83A 4MT5A 4XE0A 2PVGC 4RGOS 1PGXA 1XEEA 1ZPSA 3N9YC 2K5PA 4TMAB 5HI1A 2HTME 4XDCA 1ZXHA 4O1NA 3ZQ4A 4YTMB 1V1OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J3O D;  1ZDV A;  3RFZ B;  1ZDX A;  4B0E A;  1ZE3 D;  3BWU D;  4B0M A; 
#chains in the Genus database with same CATH topology
 3ZVV A;  4OZA A;  5GXG B;  2ONQ A;  3CIR B;  1HQR D;  2CS4 A;  2DYM A;  5DPS A;  2FID A;  2BPS A;  2N7J A;  5J2R A;  2LXA A;  3N3K B;  2H88 B;  1M4V A;  3MP9 A;  2KTR A;  1TKE A;  1ZDX A;  1WR6 E;  4N6E B;  2KLG A;  4DQO C;  2HE7 A;  4IC7 B;  2ZZP B;  3SR6 A;  3N1Y C;  1XQQ A;  4PS7 A;  4GMV A;  3I9V 1;  1R4N B;  4JE3 B;  4HRS A;  4FHK A;  2FCN A;  2IBI B;  3U4E G;  1V6E A;  3PLV A;  2WXH A;  3GB1 A;  4HKQ A;  3VTV A;  1QF6 A;  3RNB C;  2BTE A;  4C7Z A;  2ASQ A;  1BT0 A;  4ICV A;  4FBJ B;  1GAQ B;  3PVL A;  3N30 A;  2AQ3 B;  1GB4 A;  4M01 A;  2W9N A;  4HDQ A;  4NAW A;  3QC8 B;  3DHI C;  1ZE3 D;  4AQ7 A;  2KDM A;  3ZXR A;  3BK1 A;  4C80 A;  4MSQ B;  3Q8B A;  2N7E A;  1RFA A;  2Y5C A;  2NBW B;  3H1U A;  1I4R A;  4EOY A;  3W5V B;  2LGI A;  4BFR A;  3AE9 B;  2WDQ B;  4TSS A;  1AAR A;  1FXT B;  3Q14 C;  1N62 A;  3PSE B;  4WWP A;  3TEZ A;  3KYD D;  2KAN A;  3JSV B;  1MI0 A;  3KWV A;  2JRH A;  4C4V B;  2N9P C;  3AI5 A;  5D3I B;  4BBN C;  1STE A;  4NZL B;  1IYF A;  1WH3 A;  2PKO A;  4ANW A;  4W9I A;  2NR2 A;  3U52 E;  3PZD A;  2MA9 B;  1ZDV A;  3S2A A;  2YVC A;  5BYS A;  1V49 A;  3PZ8 A;  3C8Y A;  1FO4 A;  3B2F A;  4E74 A;  4NQK E;  3IAS 1;  2WDR B;  5L83 A;  4DXA B;  3BZD B;  5FR3 A;  3U2S C;  3WIM A;  4XWT A;  3DWM A;  3ZLZ A;  2KX3 A;  4N59 A;  2N7D A;  1YN4 A;  1UZX B;  1E8Y A;  3ZUN A;  2G4S A;  2VZK B;  1EF5 A;  1QOB A;  3NZU A;  3EA6 A;  3Q8C A;  4XWW A;  3AU4 A;  2Z59 B;  1SIJ A;  3AH7 A;  5TR5 A;  3A9J B;  2KYW A;  4OW0 A;  2FCS A;  4K7W A;  2ZVN A;  1T3Q A;  4KGT A;  2DHZ A;  3NS1 A;  3P4P B;  4KGR A;  1FCL A;  1I7H A;  2PJH A;  3DBR I;  3N1Z C;  3QHT A;  1L2N A;  1YQB A;  2CHW A;  4W9L A;  1TY0 A;  4HPM B;  4B0E A;  5L95 C;  3L08 A;  1TYG B;  1E6E B;  4DDI D;  4WWM A;  3ZNH B;  1NYR A;  4JX1 C;  1HTO A;  2WDT B;  2DZK A;  3W2D A;  1S1Q B;  3UGB B;  1WY8 A;  2C9W B;  1V9J A;  1DOX A;  2BB5 A;  2FCM A;  1V97 A;  3H7S A;  2LZ6 A;  3SD5 A;  3HVZ A;  5J18 A;  2M56 B;  3QJZ A;  3TMP B;  2CJO A;  1UBI A;  3AU5 A;  1AW7 A;  4IM0 A;  4WJN A;  2DYB A;  3WA0 A;  4NJC A;  4WJO A;  2BVC A;  3WAL A;  1WF9 A;  4NJ7 A;  3PS6 A;  4UDU C;  1E8W A;  1VZ8 A;  3NG0 A;  3PO0 A;  1WIA A;  4HCN B;  5DPW A;  4YSX B;  1VD2 A;  1TIF A;  3VQI A;  4IKG A;  3QWZ B;  3NRZ A;  2KMC A;  3HM6 X;  1OFF A;  2KAC A;  2BYT A;  2JPH A;  4B6W A;  1C4A A;  1LM8 B;  3TBL D;  1Q0W B;  4M8N A;  3H7P A;  4LNO A;  4A3O A;  3U30 A;  1ZGU B;  2CHX A;  4PS3 A;  5E6O A;  5KHQ A;  2IO1 B;  3KUD B;  1KM7 A;  2JY6 A;  1MG4 A;  1JWU D;  1QT9 A;  2H89 B;  4JGH B;  2KO3 A;  4ARC A;  4NNJ B;  4OVU A;  4URK A;  2PTL A;  1HZ6 A;  4WAA A;  3LXF A;  2XN9 C;  2D3A A;  2E3T A;  1F0Z A;  2INC C;  2CR5 A;  1CJE A;  2QC8 A;  3W9C B;  3BVG A;  3VRB B;  2ZW1 A;  1IGD A;  1JML A;  3UIN B;  3GOE A;  2O6V D;  1C4C A;  3PLU A;  2LWP A;  1WXV A;  4W9K A;  1VRA B;  1I4P A;  1EM7 A;  5HHD G;  2GRI A;  3L17 A;  3B0A A;  3IT6 B;  4C00 A;  3L54 A;  1AWD A;  4M00 A;  3ZGZ A;  3P2B A;  2J7Q B;  4FXC A;  5D94 A;  2N1W A;  3OJ4 B;  3A33 B;  3AMZ A;  2L00 B;  1P7E A;  2IGD A;  3DBH I;  4JL9 A;  3GZN B;  1LFD A;  1J8C A;  3KVF B;  1NVI D;  4BAX A;  4OZB A;  4EZL A;  4MSM B;  1TZO A;  4TQ1 A;  2K8B A;  4GU2 A;  3UIP B;  2HJ1 A;  3MFG A;  3PV1 A;  4ARI A;  2N9E B;  3HHM A;  3R7R A;  3AM9 A;  3ECI A;  3QK0 A;  1P3Q U;  2KVR A;  4F8C B;  3VR9 B;  2NTT A;  1KLV A;  5D3D A;  2V4L A;  2I1J A;  4JPS A;  3NZS A;  3APD A;  2MP2 A;  3GE8 C;  2V3P A;  4II2 B;  5JZE B;  5DPR A;  4TUU A;  4P6V F;  3RNG C;  4LJO B;  2WNM A;  2NPT B;  2KZR A;  3VHT C;  4ZOH C;  4GDL B;  1PUT A;  1LXD A;  3AEF B;  2PPH A;  4BOZ B;  5C2T B;  1K51 A;  2JQR B;  4NQL B;  1FRR A;  2LVQ A;  1VDV A;  1KF6 B;  2KDE B;  1EUV B;  2K1F A;  4LDT D;  1MG8 A;  1ISN A;  1K8R B;  2PVG C;  4ZYN A;  1PGX A;  4E71 A;  1Q5W B;  3SHQ A;  5IP4 D;  1ZXH A;  2MLB A;  1E5W A;  2MX2 A;  1WYG A;  2N9L A;  3ZNG C;  2WXO A;  1YMH E;  3VRA B;  2JT4 B;  2JZ3 B;  1SEB D;  1WE7 A;  3M95 A;  4HEA 1;  3DVG Y;  4BKT A;  4REZ A;  2LGS A;  3A9J A;  2TSS A;  4J3O D;  1BXT A;  3NVW A;  1N63 A;  1WM3 A;  2PIA A;  2PE6 B;  2LRU A;  3BVM A;  5AUI A;  4WJQ A;  1DGJ A;  2WXQ A;  1VZ7 A;  2QIE B;  1KLU D;  2HD5 B;  3HK0 A;  3EFC A;  2DZJ A;  2KFJ A;  2KQS A;  2RDH A;  2K6Q A;  3WAN A;  1RWS A;  1BML C;  1WYW B;  4FJV B;  4HCP B;  1I4G A;  1L7Y A;  5C1Z A;  4GGQ A;  2DLB A;  2WXJ A;  1UUP A;  2Y3A A;  2UU7 A;  1FM0 D;  2W3S A;  2CU3 A;  2M0A A;  1PDX A;  1YX6 B;  3ABV B;  1KLG D;  1JW9 D;  2C5L C;  2FUG 1;  5AZF A;  2GOW A;  4C7Y A;  2LJI A;  1HXY D;  2FIF A;  2L0T A;  4DK5 A;  3AE3 B;  3FIL B;  1I4Q A;  1UBQ A;  1N60 A;  2N1V A;  1WGR A;  1JRP A;  2WXR A;  4CQN A;  2IPK D;  1FMA D;  3WAP A;  2ACZ B;  2LVO A;  2KFK A;  4JWU C;  3NUH B;  1P1A A;  4G0N B;  2DAF A;  3H8H A;  3MC0 B;  2JXT A;  4EE2 A;  4P1B C;  2D3B A;  4MAC A;  4M0W B;  3AED B;  2JYE A;  5CTR C;  3OLM D;  1SJE D;  3I5J C;  3UI3 A;  3U8Z A;  2BS4 B;  2K25 A;  4HPP A;  4PK1 A;  4I6L B;  3NVZ A;  2DZM A;  4TQ0 A;  3C19 A;  3BYT B;  1P0R A;  1KJT A;  2RPV A;  4CYE A;  4ASW C;  2PMV A;  1K53 A;  2IJ0 A;  1GG3 A;  1SGH A;  2O2V B;  4HDO A;  1IGC A;  2I38 A;  2G45 B;  2GI9 A;  2DAJ A;  1HA5 A;  3AE7 B;  1AN8 A;  1YN5 A;  4W9D A;  2WHI A;  3TJP A;  2WXK A;  5JHB A;  1WRD B;  3KYC D;  4ZRI A;  2HDE A;  4W9J A;  1NI3 A;  4LLG M;  3X0W A;  3NS8 A;  1VLB A;  2PW9 A;  1Q10 A;  2NS5 A;  2KDF B;  2AQ1 B;  3AUL A;  3DPD A;  3LDZ E;  1X1M A;  5AZH A;  1I35 A;  3HM3 A;  3PRM B;  3FAH A;  4YSZ B;  5D2M B;  4LK0 M;  2L52 A;  4D2K A;  3VUY A;  2AYO B;  2WXN A;  2D07 B;  3H6N A;  1FFV A;  3NHE B;  3WAM A;  2AQ2 B;  2KJR A;  1E90 A;  2XK5 A;  1MJD A;  3DBR B;  1SBB B;  1DOI A;  1IBX B;  1C79 A;  1WM2 A;  2B76 B;  2KQ7 A;  4MM3 B;  1EU4 A;  2WYQ A;  1WXA A;  1Y8R C;  3AB5 A;  5TSS A;  3ZIM A;  4A55 A;  2KDI A;  4N58 A;  3PT2 B;  2C60 A;  3PPA A;  3OJ3 A;  4EKU A;  3T9L A;  2NVU I;  3VTU A;  2D5G A;  4RGN A;  2L32 A;  2MHJ A;  2XNA C;  1QZE A;  3RCZ A;  3QQ8 B;  3PZ7 A;  2L7R A;  4IWQ A;  2ZNV C;  4XC2 A;  1ET6 A;  4IM3 A;  1ZW7 A;  1T0Q C;  2D10 A;  2KWD A;  2R2O A;  2FBW B;  2JUO A;  3ZDT A;  2OJW A;  3QA8 A;  1TS3 A;  3PRZ A;  1OEY A;  1WFY A;  5IKC M;  4KDI C;  2V3S A;  5LXI B;  1J19 A;  1Z5S B;  3AEB B;  2FAZ A;  2RPQ A;  4IM2 A;  1GPX A;  4FJY A;  3I57 A;  3GE3 C;  2LGX A;  4S17 A;  2W82 A;  1CZP A;  1R4M B;  5D6J B;  2BT6 A;  3V60 A;  4PYZ A;  4YL8 A;  2IYD B;  4ZRK A;  4YXD B;  1V86 A;  5CHW A;  1RM6 C;  3KUC B;  3CMM B;  5IOI A;  5MPO A;  3ZRF A;  4GDL A;  2KC2 A;  3AE6 B;  4WH4 A;  4K7U A;  4B9K A;  1YN3 A;  2W3R A;  2SEB D;  4LNI A;  3W1S A;  2BS3 B;  3DHH C;  3Q69 A;  1S3S G;  1ESF A;  2KJH B;  2GBR A;  2AWT A;  3VTW A;  1XLO A;  4HJK A;  1V8C A;  4HVB A;  1UGM A;  4FA6 A;  1GB1 A;  1L0X B;  2WXG A;  4K3C A;  1T0S C;  3GP7 A;  3MC8 A;  2RMM A;  2N0S B;  1V1P B;  1L4Z B;  3RUL A;  4KSK C;  4LNN A;  2RSU A;  3FKY A;  4KIK A;  1G6J A;  4EZJ A;  3U7Z A;  3PRE A;  2RR9 A;  1TJE A;  2ZCB A;  3ML8 A;  1WGH A;  4OVV A;  4A9A A;  1V81 A;  2IGH A;  1ZXI A;  2HTH A;  2IY0 B;  3R3M A;  2QCZ A;  1KH0 A;  3MHZ A;  4H2A A;  3V6E B;  2Z8L A;  2MW5 A;  3L4P A;  2ZW0 A;  2UYZ B;  1WZ3 A;  3Q3J A;  1F52 A;  1V80 A;  1L4D B;  1ET9 A;  3KLS X;  4KZC A;  1C9F A;  2LGY A;  4FHJ A;  2QHO A;  4YWG G;  1LQB A;  1TBE A;  1WX7 A;  4ZHO A;  1MFW A;  4LNF A;  1QOG A;  2BKR B;  1ZOY B;  4MDK E;  2GBM A;  1MVK A;  3DBH B;  2MBO A;  3K9O B;  1MPE A;  4FJZ A;  1SE4 A;  3VVW B;  2C7N B;  1XCT L;  2LUM A;  2IO2 B;  3LB8 C;  3RD2 A;  3FIL A;  3ZKJ C;  1KRH A;  2M8S A;  4NJ6 A;  3QCA A;  2LVP A;  2J52 A;  2JRI B;  2KNB A;  2R2Q A;  3P42 A;  2L1A A;  4WWN A;  1IUE A;  3A1Q A;  4W9F A;  1NBF C;  3EGR A;  3LYY A;  1F9J A;  2D3G A;  4KZ0 A;  3OG5 A;  2ON8 A;  2REX A;  1OGW A;  2KWC A;  1WGK A;  4M0W A;  2ZJD A;  2INN E;  2FUH B;  4KV2 A;  1B1Z A;  3UQB A;  1MHH E;  2PLP A;  2XEW A;  2JZZ A;  2A4Z A;  5IA7 A;  2CKH B;  4AJY B;  2HTM E;  4ACF A;  4XDC A;  3IG3 A;  4O1N A;  1V1O A;  1Z2M A;  1WMH B;  4OZC A;  3APF A;  5T8I A;  2WDV B;  1C1Y B;  1PGA A;  4IOI E;  1PQS A;  3DBS A;  2KVZ A;  4KDL B;  2OJR A;  3NY5 A;  3Q8A A;  5C3J B;  4DXF A;  2QMT A;  4RM9 A;  2LI5 A;  3AE2 B;  1DYQ A;  3UQA A;  2YEP B;  2Z0D B;  4HRO A;  1GC6 A;  1UH6 A;  4LTU A;  4US8 A;  2E6X A;  4KSL C;  2RD0 A;  2VRR B;  4A20 A;  5BMI A;  1D4B A;  4HWI B;  1E7U A;  3Q8F A;  4I6P A;  3MC9 A;  1SXT A;  3RN9 C;  2WLB A;  2J53 A;  3ZNZ B;  3J9C A;  3CSF A;  2L05 A;  2WX0 A;  2BWF A;  2WXI A;  2I2Y A;  1OQR A;  2X38 A;  1RYJ A;  4KX6 B;  4BVU C;  5C23 A;  1LGR A;  3P1M A;  3B08 A;  2AL6 A;  3E56 A;  2BYF A;  1V5T A;  4ICU A;  2EMT A;  4HK2 A;  2RDB C;  1A5R A;  2KJ6 A;  2D11 A;  4GIV A;  2NTS A;  4A8X C;  2UWQ A;  3AE4 B;  5H92 C;  1D3Z A;  2MQJ A;  5G5H A;  1JWB D;  3NJT A;  2L76 A;  1IP9 A;  3U7D A;  3JSV A;  1FNV A;  1N5X A;  1HZ5 A;  3KW5 B;  2JX5 A;  2KKC A;  3R7Q A;  4C4V A;  3SFD B;  3RNC C;  3V3X A;  2SAK A;  3DOW A;  3KH0 A;  2HJ8 A;  1WXQ A;  1J7B A;  3TL5 A;  1E10 A;  2NBV B;  4RGT A;  1YQ3 B;  1TS4 A;  3EHV A;  5LLI A;  1L0V B;  1TKY A;  4HJG E;  5BMH A;  2VH1 A;  4DHJ D;  3IXS A;  2M17 A;  3NVV A;  3V62 A;  2JF5 A;  1H8C A;  3Q8E A;  1GC7 A;  4NY0 A;  2KX0 A;  3IFW B;  5JHA A;  3JVZ X;  3P4R B;  2JYT A;  5E6N A;  1C78 A;  4IW0 A;  2MBB B;  5GMV A;  1H4R A;  2W55 A;  1XD3 B;  1D5Z C;  1CMX B;  4A6Q A;  1WGY A;  1E8Z A;  4IUM B;  1RRB A;  1D5M C;  4US9 A;  4RFB A;  3A4R A;  4L2Y A;  2BQQ A;  4R3D A;  2VH2 A;  4GLS C;  1OTR B;  3AE8 B;  5BMG A;  4WQM A;  3A9K B;  4RNA A;  3QIJ A;  4LCD E;  2CHZ A;  3N1X C;  1TZ1 A;  2KC1 A;  4MH8 A;  1SE2 A;  4DWF A;  2K0P A;  1FPY A;  2G4D B;  4W9G A;  2G3Q B;  1JWM D;  5BYQ A;  1N6Z A;  4GSW A;  3RI7 C;  1WXM A;  3HUI A;  1C4P A;  1QQR A;  1N5W A;  2LGD A;  1UEL A;  2M19 A;  1IPG A;  2K9X A;  3BVZ A;  2BYV E;  4BKS A;  3GZN I;  4AWJ A;  3RT3 B;  3ZRC A;  4BZA A;  2N4F A;  4M02 A;  3W1S C;  2KAJ A;  5FR6 A;  1EU3 A;  3B9J A;  1T0R C;  3RYT A;  1TGZ B;  4RGM A;  1F2R C;  1RFK A;  2J4X A;  2V3N A;  1NYQ A;  1VZ6 A;  4OHJ A;  3ZNI D;  2MBQ A;  3DCG A;  3V05 A;  1QIL A;  3ZO5 B;  2IGG A;  3APC A;  2ZCC A;  4YTN B;  2MSE D;  4KVG B;  2NMQ A;  3V6C B;  2EMS A;  4WUR A;  4RH6 A;  1D6E C;  1VCB A;  3PRP B;  2K22 A;  4NPN A;  1FNU A;  1FFU A;  5H8Y E;  3H9D A;  3ZXV A;  1EO6 A;  3M62 B;  4X57 B;  2GMI C;  1ZKH A;  3HRD D;  1GOZ A;  1EF1 A;  3DBL I;  2ZPY A;  1UNS A;  2IZV B;  3W1Y A;  1WJ4 A;  2L3Z A;  4RM8 A;  2NCN A;  4PS8 A;  1F2R I;  1UD7 A;  1WE6 A;  2DWQ A;  4FAD A;  1QOA A;  4JQW C;  2MBH A;  4MGI E;  2K8C A;  4W9E A;  3IHP C;  3MJ5 A;  1PFD A;  1FXA A;  1WJ6 A;  4HKZ E;  1TT5 B;  2R61 A;  2EKI A;  3AN1 A;  1SB3 C;  3N20 C;  3ENE A;  3ONS A;  4PT5 A;  4AOF A;  2DBY A;  3M63 B;  1TY2 A;  3B2G A;  1UWM A;  1FCC C;  1E7P B;  2M4N A;  2MJE A;  2FE8 A;  3WAO A;  3AV8 A;  1WJN A;  2C7H A;  1TS2 A;  3T3N A;  2ZEQ A;  3HIZ A;  2MCN B;  2MRP A;  4K3B A;  2FCQ A;  4P7I A;  3TSS A;  2G1E A;  3BY4 B;  2O6V B;  3CF6 E;  1DOY A;  1L0Y B;  2K6D B;  2GB1 A;  4BOS C;  4FUL A;  1KFY B;  1PYW D;  1LO5 D;  2GBN A;  4RMA A;  2OED A;  1JRU A;  4BBN F;  2MEK A;  5AZG A;  2MWS B;  1HEZ E;  5FKA C;  5E6J A;  1XF5 L;  5DPT A;  4JIO U;  4A90 A;  1WZ0 A;  3T8M A;  4KKI A;  2WGS A;  3VAW A;  2LHD A;  3I3T B;  3V61 A;  4B95 A;  2WX1 A;  1B9R A;  1GNU A;  1M94 A;  2L0F A;  4IDI A;  2G9H D;  2KOX A;  3X23 A;  3Q6B A;  2JXX A;  1JAL A;  2OOB B;  3RMK C;  4ZDV A;  3JW0 X;  1C77 A;  3IAM 1;  3EUB 2;  1YX5 B;  1I42 A;  1PGB A;  1F1H A;  4GDK B;  3ZJV A;  3Q3M C;  4MGZ E;  5EE1 A;  3VH3 B;  5I4D A;  4P16 A;  2GBJ A;  4K81 A;  1T0Y A;  3BII D;  5G5G A;  3TEX A;  3P63 A;  2MP2 B;  2IND C;  5AEK B;  3MTN B;  2NPT A;  4HPL B;  4ANX A;  5EE3 A;  2MBE A;  3ZTD A;  4MGK E;  4DBG A;  3L16 A;  1P98 A;  3QX1 A;  3GS2 A;  1XXG A;  1XLP A;  2BW2 A;  1RAX A;  2V1Y A;  3FC4 A;  3ZJT A;  1CQV A;  1ENF A;  2AX5 A;  5JXV A;  4YT0 B;  2EEL A;  2BS2 B;  2WP9 B;  2JWZ A;  3RNE C;  3ZDM C;  3HVD A;  1R7S A;  4F1S A;  3MJW A;  1JCK B;  2LRW A;  1WXS A;  4B0M A;  4KKJ A;  2QDF A;  2RDG A;  1WGD A;  4XZ4 A;  3ETR A;  3CWI A;  4G11 A;  3P4Q B;  3DVN V;  4DHJ B;  3ALB A;  2B3A A;  4RGO S;  4LDT B;  1ZPS A;  3DVG X;  2K5P A;  5HI1 A;  5J17 A;  4DDG D;  2J0K A;  3ZQ4 A;  2M1M A;  5JH5 C;  3D32 A;  4MJS B;  4I6N B;  1E7V A;  2MJ3 A;  1Q1O A;  1WGG A;  5E6P A;  4C56 C;  3CST A;  5BYR A;  3UF8 A;  2LFI A;  1R4N I;  3A9K A;  4DHZ B;  3I63 C;  3WCQ A;  3C0R B;  1E8X A;  1JRO A;  1UGJ A;  3R2T A;  4ZRJ A;  4W9H A;  1OEY J;  1SIF A;  1XLN A;  1KOT A;  3TEY A;  2Z0E B;  3Q3F A;  4FLH A;  4WQO B;  2QIL A;  4YSY B;  1QKZ A;  4L1B A;  1NEK B;  1XCQ L;  5BO4 B;  2LEK A;  1JWS D;  1YIW A;  5FK9 C;  3Q3N C;  4MEM A;  4WWO A;  2JU6 X;  5HFY A;  4HXD A;  2KQ4 X;  3VDZ A;  4GB9 A;  1WSP A;  3BIN A;  2FNJ B;  2J0J A;  4QAY A;  1SF0 A;  2L8J A;  3KQ4 A;  1JWA D;  3BK2 A;  5AUK A;  3BWU D;  4EZK A;  5IN7 A;  1FIQ A;  3RZF A;  4DXG A;  3KUZ A;  4A3P A;  1D5X C;  1R4M I;  4P1C C;  2DEN B;  4L23 A;  1MHX A;  3IT4 B;  4XX5 A;  2KWU B;  2KLC A;  2BWE S;  4OVZ A;  1NDD A;  1WRI A;  3AE5 B;  1WX9 A;  2DYO A;  4LNK A;  2KFK B;  3R8B A;  4EFO A;  4II3 B;  4RF0 A;  3Q2A C;  5LXH A;  2RGF A;  4M8M A;  2INP E;  2J42 A;  3ZYY X;  4KGS A;  2I1K A;  3TEW A;  4WIP A;  1SSN A;  1WI0 A;  2WXM A;  3AEA B;  2AEH A;  1J7C A;  2XBB C;  3IBE A;  2O2V A;  3O65 B;  2BBC A;  2LXC A;  5EDS A;  3LJ3 A;  4AS1 A;  3EEC A;  2YLM A;  2WU2 B;  1NEN B;  1XLQ A;  2Q5W D;  3OAW A;  4EEW A;  4MH0 E;  2K39 A;  3L13 A;  1HE8 A;  2KHW B;  2KTR B;  1SE3 A;  3IVF A;  3OWE B;  1OQY A;  4F7Z A;  2YEP F;  1K52 A;  4AP4 C;  1SJH D;  5HG2 A;  4ZYS A;  2KD0 A;  2O6V A;  2BGF A;  4GOC A;  2KMA A;  4IWP A;  2GBK A;  2QJL A;  1BUI C;  4S0R A;  1IBX A;  1FD6 A;  3NZ3 A;  4DHZ E;  1XT9 B;  3R2I A;  4MM3 A;  2XK5 B;  1YNT E;  5LNK 1;  2J0M A;  1I4H A;  3RNA C;  3RUI B;  1T6B X;  3SDL C;  2ICI A;  1SE9 A;  2LUE A;  1I4X A;  5G2N A;  1UWX A;  3SEB A;  3DQV A;  4NAW B;  3DWG C;  4TKN A;  2KN5 A;  4WAF A;  5KHO A;  4G50 A;  1NI2 A;  5DCN A;  2CU1 A;  4RCO A;  1QOF A;  2KK8 A;  5EE0 A;  3QAR A;  2M0X A;  3L10 B;  1ACC A;  2D2Q A;  2MH7 A;  1XO3 A;  3DDC B;  5IAA C;  3PGE A;  3AEG B;  4GDK A;  2BB6 A;  4W9C A;  3R66 C;  2WXP A;  3ML9 A;  4K7S A;  1OQQ A;  2K3U A;  1YJI A;  3TIX A;  2IDY A;  3AE1 B;  2JSV X;  1P9D U;  4AUQ C;  2LD9 A;  1GJZ A;  2WXL A;  1L6V A;  2BF8 B;  2KT7 A;  2V0G A;  1HTQ A;  3B1L X;  1TTN A;  4BKG A;  3ZW3 A;  1FXI A;  2DNF A;  2GLS A;  4CHK A;  4XGA B;  1RLF A;  2WU5 B;  4USA A;  2DZI A;  3URY A;  2CJN A;  2KDB A;  1JQ4 A;  2K8H A;  1EWC A;  3VUX A;  4IG7 B;  1WX8 A;  1P7F A;  3VR8 B;  4ZHP A;  1VR9 A;  3DBL B;  4JWS C;  1E9M A;  4WJP A;  2WWZ A;  2KXJ A;  2IO0 B;  1VJK A;  1E0Z A;  2KN4 A;  1TS5 A;  4XDD A;  4N9F 4;  5EE9 A;  3EC8 A;  2VZK D;  3TCA A;  2JWU A;  1V1P A;  1L6U A;  2LMC A;  5CHF A;  3A4S C;  2N9K A;  2JZP A;  2Y5B B;  4MJS A;  4ANV A;  3BYY B;  4IWO A;  2WS3 B;  2ZVO A;  4KIK B;  3K9P B;  2PE9 A;  5HKH A;  2D3C A;  1YJJ A;  1N61 A;  2PEA A;  1J0G A;  2ZPN A;  3PTF C;  4YTP B;  3E9S A;  3JYU A;  1FNW A;  3NVY A;  2BYE A;  4J6I A;  5G55 A;  3O13 A;  4FN2 A;  4BKS D;  3SFE B;  2WQY B;  2KTF A;  4NAM A;  2EKE C;  3RZW C;  1L5P A;  4ANU A;  3VUW A;  3VFK A;  3NOB A;  2NBU A;  1ZP0 B;  2WXF A;  5CX3 A;  4E3C A;  2IO3 B;  3MHS D;  2AL3 A;  2MJD A;  3RFZ B;  2V4I B;  3L0W B;  3AEE B;  4CO7 A;  1WJU A;  2KMM A;  2PVO D;  1C3T A;  4EUT A;  4ZRQ A;  2JVC A;  3ZTC A;  3ZJU A;  3DVN U;  3Q3O C;  1WR1 A;  2V9H A;  3RPF C;  1TKG A;  1YOV B;  5CHV C;  1ZUD 2;  2QEJ C;  4PYU A;  4ITK A;  2QSD A;  3W5U B;  1FRD A;  1V2Y A;  2N9X A;  2LJ5 A;  4HLE A;  4XYC A;  4AJW A;  1QLB B;  3QAQ A;  3VH4 B;  2KWV B;  3RNF C;  4ZRP A;  1KTK A;  1K50 A;  4LJP B;  4K1R B;  3TUO A;  4GN1 A;  3AEC B;  3P4S B;  1GUA B;  4MEL A;  4Q2J A;  1J7A A;  2A5U A;  2W54 A;  2X8X X;  4G3X B;  1UF0 A;  2C7M B;  3A1Q B;  1CK1 A;  1EWY C;  1V5O A;  4GXB A;  3KWL A;  3AXC A;  2OHF A;  3SU8 X;  1ROE A;  4JLC A;  1Y56 A;  2LAS A;  2Y5P A;  3H7P B;  1U4A A;  1WWT A;  2IY1 B;  1YJ1 A;  3VXW A;  3EFU A;  3T3O A;  1F77 A;  1YQ4 B;  2BKF A;  4TV3 A;  1AYF A;  5D7G A;  5IO9 A;  1A70 A;  4MGY E;  1T5X D;  1C76 A;  4RF1 A;  3DHG C;  2DX5 B;  1FEH A;  2LHE A;  2L83 A;  4MT5 A;  4XE0 A;  1YD8 U;  3UIO B;  3N32 A;  1XEE A;  3N9Y C;  2ZNV B;  3M3J A;  4TMA B;  1WMH A;  3PHX B;  4YTM B;  3PHW B; 
#chains in the Genus database with same CATH homology
 4OZA A;  1WYG A;  2ONQ A;  5GXG B;  2N9L A;  3CIR B;  4OZC A;  5T8I A;  1HQR D;  2WDV B;  2MJ3 A;  2WXO A;  1PGA A;  1YMH E;  2DYM A;  4IOI E;  3VRA B;  2N7J A;  4C56 C;  3Q8A A;  5C3J B;  5BYR A;  4DXF A;  2H88 B;  1SEB D;  2QMT A;  1M4V A;  2LFI A;  3MP9 A;  3AE2 B;  4HEA 1;  1TKE A;  1ZDX A;  4N6E B;  4DQO C;  1DYQ A;  4REZ A;  2YEP B;  3WCQ A;  2TSS A;  4HRO A;  4J3O D;  3SR6 A;  4LTU A;  1BXT A;  3NVW A;  4US8 A;  1N63 A;  2E6X A;  2PIA A;  5BMI A;  1D4B A;  1JRO A;  1UGJ A;  3I9V 1;  3R2T A;  4JE3 B;  4HRS A;  3Q8F A;  3BVM A;  5AUI A;  1XLN A;  1SXT A;  3TEY A;  1DGJ A;  3U4E G;  2WXH A;  3GB1 A;  2WXQ A;  4HKQ A;  1VZ7 A;  2WLB A;  2J53 A;  2QIE B;  3J9C A;  1KLU D;  1QF6 A;  2QIL A;  2WXI A;  2BTE A;  2I2Y A;  4YSY B;  1OQR A;  4C7Z A;  1QKZ A;  4L1B A;  1NEK B;  1XCQ L;  2RDH A;  2X38 A;  1RWS A;  1GAQ B;  1BML C;  1RYJ A;  2LEK A;  4KX6 B;  1JWS D;  1I4G A;  2AQ3 B;  5FK9 C;  1GB4 A;  2DLB A;  3P1M A;  2WXJ A;  1ZE3 D;  3E56 A;  4AQ7 A;  1UUP A;  2JU6 X;  2KDM A;  2Y3A A;  5HFY A;  3BK1 A;  4C80 A;  1FM0 D;  3Q8B A;  2W3S A;  2KQ4 X;  1WSP A;  2CU3 A;  2Y5C A;  2M0A A;  1PDX A;  2NTS A;  3ABV B;  4A8X C;  1KLG D;  1JW9 D;  2FUG 1;  1SF0 A;  4C7Y A;  1I4R A;  2LJI A;  1HXY D;  3KQ4 A;  1JWA D;  3AE4 B;  3W5V B;  5H92 C;  3BK2 A;  3AE3 B;  5AUK A;  3FIL B;  2LGI A;  3BWU D;  1I4Q A;  5G5H A;  1JWB D;  3AE9 B;  2WDQ B;  1FIQ A;  4TSS A;  1N62 A;  4DXG A;  1N60 A;  3TEZ A;  1D5X C;  1JRP A;  4L23 A;  1MHX A;  1FNV A;  2WXR A;  3IT4 B;  4CQN A;  1N5X A;  2IPK D;  1HZ5 A;  2JX5 A;  1FMA D;  4OVZ A;  1MI0 A;  1WRI A;  2ACZ B;  3SFD B;  3AE5 B;  4JWU C;  3V3X A;  2SAK A;  3NUH B;  3KWV A;  2DYO A;  3R8B A;  5D3I B;  4RF0 A;  1WXQ A;  3H8H A;  3MC0 B;  2JXT A;  1STE A;  4NZL B;  4EE2 A;  2PKO A;  2INP E;  1J7B A;  4MAC A;  1E10 A;  2J42 A;  4RGT A;  1YQ3 B;  3AED B;  2JYE A;  3U52 E;  1TS4 A;  3ZYY X;  4KGS A;  1L0V B;  1SJE D;  3UI3 A;  1TKY A;  4HJG E;  5BMH A;  3TEW A;  1ZDV A;  2BS4 B;  3IXS A;  4WIP A;  1SSN A;  5BYS A;  3NVV A;  2WXM A;  3AEA B;  1J7C A;  3Q8E A;  3PZ8 A;  3C8Y A;  3NVZ A;  4TQ0 A;  3BYT B;  2RPV A;  3P4R B;  1FO4 A;  2JYT A;  3B2F A;  2BBC A;  1C78 A;  3IAS 1;  2PMV A;  1K53 A;  2IJ0 A;  2WDR B;  1IGC A;  2I38 A;  3BZD B;  4AS1 A;  5FR3 A;  2GI9 A;  2W55 A;  2WU2 B;  3U2S C;  1HA5 A;  3AE7 B;  1NEN B;  4XWT A;  1AN8 A;  1YN5 A;  1D5Z C;  1XLQ A;  3DWM A;  4A6Q A;  4N59 A;  2WXK A;  1D5M C;  1YN4 A;  4US9 A;  4RFB A;  4L2Y A;  2HDE A;  2Q5W D;  1NI3 A;  2VZK B;  4LLG M;  4R3D A;  4GLS C;  1QOB A;  3AE8 B;  1VLB A;  3EA6 A;  3Q8C A;  4XWW A;  5BMG A;  4WQM A;  2PW9 A;  1SIJ A;  1SE3 A;  1Q10 A;  3AH7 A;  4RNA A;  2AQ1 B;  4OW0 A;  1T3Q A;  4KGT A;  4MH8 A;  3OWE B;  1SE2 A;  2YEP F;  1K52 A;  3NS1 A;  1SJH D;  3P4P B;  4KGR A;  1FCL A;  3FAH A;  4YSZ B;  2K0P A;  5HG2 A;  4LK0 M;  4ZYS A;  2L52 A;  1I7H A;  4D2K A;  2WXN A;  1JWM D;  5BYQ A;  1FFV A;  2QJL A;  3HUI A;  1C4P A;  1TY0 A;  2AQ2 B;  4B0E A;  1BUI C;  1IBX A;  1QQR A;  1FD6 A;  1N5W A;  3NZ3 A;  1TYG B;  1E6E B;  3R2I A;  1SBB B;  1DOI A;  2M19 A;  4WWM A;  1IBX B;  1YNT E;  1C79 A;  1NYR A;  4JX1 C;  5LNK 1;  2B76 B;  2K9X A;  1I4H A;  3BVZ A;  4MM3 B;  1EU4 A;  3W2D A;  1T6B X;  2ICI A;  1I4X A;  1UWX A;  3SEB A;  1DOX A;  3AB5 A;  5TSS A;  4A55 A;  4N58 A;  2KAJ A;  2BB5 A;  4NAW B;  3DWG C;  1EU3 A;  3B9J A;  1V97 A;  2D5G A;  4RGN A;  2L32 A;  4WAF A;  4RGM A;  2XNA C;  1F2R C;  3HVZ A;  1RFK A;  2J4X A;  2M56 B;  4RCO A;  1QOF A;  1NYQ A;  2V3N A;  3PZ7 A;  5EE0 A;  2CJO A;  1VZ6 A;  4OHJ A;  1AW7 A;  1ET6 A;  1ACC A;  3V05 A;  1QIL A;  2IGG A;  2KWD A;  2FBW B;  4YTN B;  2MH7 A;  2NMQ A;  1XO3 A;  1TS3 A;  4NJC A;  4WUR A;  4RH6 A;  3AEG B;  1D6E C;  2BB6 A;  3AEB B;  1GPX A;  2WXP A;  2K22 A;  3I57 A;  1OQQ A;  2K3U A;  2W82 A;  4UDU C;  1VZ8 A;  1FNU A;  1YJI A;  2IDY A;  1FFU A;  1CZP A;  2JSV X;  3AE1 B;  3PO0 A;  2BT6 A;  5H8Y E;  2WXL A;  1L6V A;  4YSX B;  2V0G A;  4YXD B;  3VQI A;  4IKG A;  3NRZ A;  1RM6 C;  1FXI A;  3HRD D;  1GOZ A;  1OFF A;  2KAC A;  5MPO A;  2BYT A;  2WU5 B;  1C4A A;  4USA A;  3URY A;  3AE6 B;  2CJN A;  4WH4 A;  1JQ4 A;  1UNS A;  1YN3 A;  1EWC A;  2W3R A;  2SEB D;  1F2R I;  2BS3 B;  3W1S A;  2DWQ A;  3Q69 A;  1P7F A;  3VR8 B;  1QOA A;  1ESF A;  4ZHP A;  1VR9 A;  1XLO A;  4JWS C;  1E9M A;  1V8C A;  1VJK A;  1E0Z A;  2KN4 A;  1JWU D;  1GB1 A;  3MJ5 A;  1TS5 A;  1PFD A;  1QT9 A;  2H89 B;  1L0X B;  4XDD A;  5EE9 A;  1FXA A;  2WXG A;  2VZK D;  2JWU A;  1V1P A;  1L6U A;  4ARC A;  3GP7 A;  4HKZ E;  2LMC A;  2PTL A;  1HZ6 A;  2RMM A;  2N0S B;  1V1P B;  1L4Z B;  3LXF A;  2R61 A;  2EKI A;  2E3T A;  2XN9 C;  2N9K A;  1F0Z A;  2JZP A;  1CJE A;  3AN1 A;  1SB3 C;  3W9C B;  3BVG A;  3VRB B;  2ZW1 A;  1IGD A;  3BYY B;  4PT5 A;  3U7Z A;  1JML A;  1TJE A;  2WS3 B;  2DBY A;  1TY2 A;  3B2G A;  1UWM A;  1FCC C;  1E7P B;  2MJE A;  2FE8 A;  4A9A A;  3AV8 A;  1C4C A;  1N61 A;  1TS2 A;  1YJJ A;  3T3N A;  4YTP B;  3E9S A;  2IGH A;  1ZXI A;  1FNW A;  3TSS A;  2G1E A;  3NVY A;  1DOY A;  1VRA B;  1KH0 A;  1L0Y B;  1I4P A;  1EM7 A;  5HHD G;  2GRI A;  2GB1 A;  1KFY B;  1PYW D;  3MHZ A;  1LO5 D;  4H2A A;  3IT6 B;  2Z8L A;  3O13 A;  3L4P A;  2OED A;  2ZW0 A;  1AWD A;  2MEK A;  3SFE B;  2WQY B;  3ZGZ A;  4NAM A;  1L4D B;  1HEZ E;  4FXC A;  5FKA C;  5E6J A;  1L5P A;  1ET9 A;  1XF5 L;  3KLS X;  1C9F A;  4A90 A;  1ZP0 B;  3AMZ A;  1P7E A;  2IGD A;  4KKI A;  2WXF A;  4YWG G;  2LHD A;  2MJD A;  3RFZ B;  2V4I B;  1B9R A;  3AEE B;  4ZHO A;  4IDI A;  1QOG A;  2G9H D;  1NVI D;  4OZB A;  1ZOY B;  1TZO A;  4TQ1 A;  1JAL A;  2KMM A;  2PVO D;  3MFG A;  1MVK A;  4ZRQ A;  4ARI A;  1MPE A;  3ZJU A;  1SE4 A;  3AM9 A;  1C77 A;  3IAM 1;  3EUB 2;  3RPF C;  1XCT L;  1TKG A;  2LUM A;  3VR9 B;  1ZUD 2;  2QEJ C;  3LB8 C;  1PGB A;  2NTT A;  4ITK A;  4GDK B;  2QSD A;  3ZJV A;  3W5U B;  3FIL A;  1FRD A;  5D3D A;  1KRH A;  5EE1 A;  1QLB B;  4JPS A;  5I4D A;  4P16 A;  2J52 A;  4ZRP A;  1KTK A;  2V3P A;  1K50 A;  3P42 A;  2L1A A;  3BII D;  5G5G A;  3TEX A;  3P63 A;  3TUO A;  3AEC B;  3P4S B;  4P6V F;  1IUE A;  4Q2J A;  1J7A A;  2W54 A;  5EE3 A;  2WNM A;  3EGR A;  1CK1 A;  3LYY A;  1EWY C;  2ON8 A;  1XXG A;  1XLP A;  3GS2 A;  3KWL A;  2BW2 A;  2OHF A;  3FC4 A;  4ZOH C;  4GDL B;  1PUT A;  1ROE A;  3ZJT A;  1CQV A;  2AX5 A;  1ENF A;  1Y56 A;  4YT0 B;  5JXV A;  1WGK A;  2EEL A;  2BS2 B;  2WP9 B;  3AEF B;  2Y5P A;  4M0W A;  1K51 A;  5C2T B;  1WWT A;  2INN E;  2JQR B;  3T3O A;  3HVD A;  1F77 A;  1R7S A;  1YQ4 B;  1JCK B;  1AYF A;  5D7G A;  1FRR A;  1VDV A;  4B0M A;  4KKJ A;  2RDG A;  1KF6 B;  1A70 A;  3ETR A;  1B1Z A;  1MHH E;  2PLP A;  1T5X D;  1C76 A;  3CWI A;  4RF1 A;  3P4Q B;  1FEH A;  2LHE A;  2L83 A;  4MT5 A;  4XE0 A;  2PVG C;  4RGO S;  1PGX A;  1XEE A;  1ZPS A;  3N9Y C;  2K5P A;  4TMA B;  5HI1 A;  2HTM E;  4XDC A;  1ZXH A;  4O1N A;  3ZQ4 A;  4YTM B;  1V1O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...