3BX1A

Complex between the barley alpha-amylase/subtilisin inhibitor and the subtilisin savinase
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
269
structure length
269
Chain Sequence
AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAATR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Mutational Analyses of the Interaction between the Barley alpha-Amylase/Subtilisin Inhibitor and the Subtilisin Savinase Reveal a Novel Mode of Inhibition
pubmed doi rcsb
source organism Bacillus lentus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Subtilisin Savinase
total genus 94
structure length 269
sequence length 269
chains with identical sequence B
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2008-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3bx1A00
1SUPA 2G4VA 3DWEX 1WMDA 3DW1X 4GI3A 2Z2YA 1Y1KE 1TK2A 3ZXXA 3WIUA 4H6VA 1T1GA 2IXTA 3LPCA 2Z57A 4J94A 3AJ8A 1AV7A 2X8JB 1SCDA 1Q5PA 2W2PA 3DVRX 4DJ5X 2PWBA 1P7WA 1R0RE 4WOBA 5AVJA 4NE7A 2Z56A 1IC6A 3DVQX 1T1EA 3LPDA 3PTLA 1SBCA 3TI9A 2DP4E 4DZTA 1WMEA 3CO0S 3AFGA 1TM4E 3AJ9A 3GCXA 1SIOA 1Y48E 3DE3X 3DYBA 2W2NA 3BGOS 1Y33E 1CNMA 1YJBA 4JP8A 3D43A 1EA7A 2GKOA 1TM1E 4OMDA 3GT3A 4OMCA 4C3VA 1C9NA 4C3UA 1TM7E 4RYDA 4CFZA 1A2QA 4K8RB 2WV7A 1KE2A 1T1IA 1PFGA 1AVTA 1SBTA 1GNVA 3D9QX 1C9MA 2PKCA 1LW6E 2PMWB 2WUWE 3DE7X 4AKSA 1NLUA 3EIFA 1BFKA 2TECE 3Q40A 1UBNA 5JXIA 1SN7A 5ARDA 3QMPA 1SBIA 1ZVJA 2Z58A 2ID4A 3EE6A 4KPGA 3L1KA 1Y4AE 2W2MA 3Q5GA 1GT91 1WMFA 1ZVKA 5JXHA 5SICE 4Z2AA 4CFYA 1HT3A 1SUEA 1SVNA 1TO2E 1V5IA 3F7OA 3QTLA 3TI7A 5JXJA 2X8JA 4LVNA 1Y3DE 3VTAA 1BH6A 4DWWA 1BE8A 3BX1A 3DVSX 2PWAA 3GCWA 3DE4X 1SIUA 1SBNE 5JMOA 1SCAA 5I9SA 4BWGA 1AK9A 5B1DA 1SPBS 3DDZX 3EDYA 1THMA 5FAXA 3LXUX 4OV6B 3VV2A 3WQBA 1YJAA 1DUIA 1S02A 1TECE 2PRKA 2ST1A 2Z2XA 5ARCA 3A3PA 2PQ2A 4I0WB 1KDVA 1SCNE 2ID8A 4KG7A 1EGQA 1Y3FE 4CG0A 4MZDA 4NMXB 1SELA 1Y4DE 4HX2A 1TO1E 3SQOA 1WVMA 1AF4A 1C9JA 2HPZA 3HJRA 4H6XA 2SNIE 5JXGA 1AH2A 5AVKA 4WOCA 3VHQA 2SICE 1TMGE 5AMXA 3UNXA 2ZRQA 1SCBA 1AQNA 1PTKA 5FBZA 2XTJA 2DQKA 2W2QA 1AU9A 1GA4A 1SUAA 2WWTA 4KB5A 1MEEA 2SBTA 3I2YX 2Z2ZA 2V8BA 1NDUA 3A3OA 4NE9A 3VSBA 3OSZA 5ARBA 5B1EA 1C3LA 1CSEE 1BJRE 1SUBA 3A3NA 3TECE 1SUDA 3F7MA 1GTJ1 3F49S 3DE0X 1JEAA 4H6WA 2WUVA 1PJ8A 1SBHA 1Y3BE 1NDQA 2DUJA 1Y3CE 1P7VA 1R64A 2HD4A 2PYZA 2XRMA 1BE6A 3H42B 1KDYA 1P8JA 1GCIA 1MPTA 1TM5E 3PRKE 3VYVA 1GTG1 3WHIA 1XF1A 1PEKE 1DBIA 1OT5A 1OYOA 2ZWOA 2SECE 3I37X 4AKTA 1SUCA 1VSBA 4HVLA 1YU6A 4B5LA 1GA1A 1WSDA 5K7SA 3ZXYA 1V6CA 2W2OA 1GA6A 2ZWPA 3VV3A 1BFUA 3T41A 1Y9ZA 1ST3A 3LPAA 5FFNA 3DE2X 1S2NA 4FONA 1S01A 4YN3A 1KE1A 2P4EA 3SICE 3I34X 1IAVA 1SCJA 1R6VA 1TM3E 1Y34E 2IY9A 3DE6X 3P5BA 4LVOA 3BPSA 2Z30A 1KDZA 1GNSA 4ZARA 4M1ZA 1OYVA 2B6NA 3DE1X 1ST2A 2QTWB 2E1PA 3WIVA 3I30X 4ZOQI 3GT4A 3QFHA 5CW1A 5AQEA 3DW3X 1SH7A 1YJCA 3CNQS 1GTL1 1SIBE 3DE5X
chains in the Genus database with same CATH superfamily
2Y1EA 3VJKA 4FBLA 4HDNA 4V24A 1RLIA 1H66A 1IQUA 2EQBA 4DV7B 2J9ZB 4IIXA 1YSCA 3SHFA 2QN3A 3FDZA 4MQEB 4AMZA 4PG5A 2OLEA 5IX8A 5EUCA 3A36A 4TYPA 1N5KA 2WJJA 2Q1XA 3NWEA 5BVHB 1G59A 1YQ9A 2HOQA 1D7AA 1F20A 1XZDA 1E59A 1IDOA 3CF2A 2O52A 1IAQA 1GAEO 1FU7A 2J4CA 4FDMA 1W88B 4GR5A 4BMDA 1WW3A 4IX9A 1EAMA 4JOSA 3H8WA 4PEVA 4PPYA 4CCSA 1XX6A 1RTTA 2ILTA 2VLIA 4YRCA 3VI3B 1YVDA 3QMPA 4NZZA 3UGKA 4V2IA 4A27A 2C2GA 2YHIB 1ZINA 1E9DA 4HDKB 4EO9A 1GPLA 2C2KA 3ESXA 4Z9YA 3B5EA 2HRCA 1NF3A 2DWQA 2O9JA 4YBZA 1ZM7A 3ZD8A 2ODPA 1JJ7A 4LVNA 2FMIA 4CL3A 4E14A 3UXYA 2EG5A 1T43A 4BMPB 1IQ0A 1KVUA 1ZHHA 4PAQA 1WPXA 1IHYA 1OJLA 3A1NA 2WM2A 3PPVA 1Z34A 3BL6A 3LUJA 1YQDA 1THTA 2I9PA 2ZZMA 2QUZA 4KUHA 3HK2A 5CIWA 3NWJA 1Y4SA 3ADOA 3FB1A 3IILA 3KO8A 3JQEA 3PPWA 3QUSA 1CQJA 4KX5A 3K8QA 4EG8A 3LT5A 4INAA 1FU8A 2XSZA 5DSXA 1RU3A 5KJCA 2MSDB 3T3HA 1W8IA 1U90A 4L4XA 1EX9A 4GRIA 3ZHRA 4QDTA 4KSYA 1LNQA 2CSUA 1VMEA 3HJHA 1M8PA 4I08A 4NK5A 2XUGA 1Z37A 1F0YA 3THSA 3QUAA 5EGNA 1TA0A 2B8JA 4LQLA 2ZBQA 3BWBA 1WSBA 3GG2A 2EJTA 3EVGA 4G07A 2FH5B 4RACA 1RPZA 1WHTB 1D0SA 2P9JA 4CRWB 3OCWA 4QTYA 3TOVA 4N03A 3U4GA 3PFCA 1OKKA 3RD5A 4LDPA 4AI6A 2G1KA 1LF5A 2O2IA 3V4OA 4MPJA 1VHLA 2D4AA 3TR6A 1SUDA 1NBWB 1EUDA 3HCCA 1PYGA 1SD1A 3PQDA 3ZH2A 2KLBA 4BO8A 2OC4A 3P20A 1WOMA 2BJVA 4GAEA 1K6EA 4FT2A 4YACA 4DGSA 1QQ7A 3QI7A 4FXOA 1A2OA 2J4DA 4P54A 1FNDA 1BX0A 4U6QA 3JXEA 3RFXA 4MS1A 4ZXFA 4EW2A 1HZJA 2WHEA 4WKNA 5AXDA 5M04A 2HPAA 1U02A 2VJQA 3IBSA 3GXBA 2VNHA 2QN2A 1AHIA 3TQTA 3HEMA 1LA2A 4TTQA 3WKCA 3PE3A 4B4KA 2QJFA 3EY4A 3NORA 4HQFA 4JMLA 4XARA 3WTBA 5L7WA 2DJ5A 3G7UA 3B82A 2P9TA 3F3MA 2DUWA 2GCOB 4ANFA 3KSAC 4ETIA 4O33A 1DWQA 1JYSA 2FB9A 2PZAA 3PQ7A 4KIFA 1HQDA 1AKEA 2IYTA 2TMKA 3JQGA 4UBLA 1FNCA 1NU8A 1GJRA 1U6KA 2XCIA 3GO4A 2NU8B 1GITA 1KKLA 1OXTA 4OHKA 4NV0A 4ND1A 3VKWA 4COKA 4C30A 5CFPA 1TVEA 3CN7A 4P9NA 4S1OA 3AB8A 2DSNA 1EKXA 4KGVA 1XP5A 1R15A 3AJ8A 4HDQB 4N3AA 1FTNA 1F8UA 1OFUX 1PR5A 3QEJA 1CVLA 4RADA 2JJ8A 3OM8A 5HK9A 3IQHX 3AVUA 1F1BA 1P73A 2IP2A 5CTJA 1RAEA 3AFGA 3DULA 2JBAA 4ALIA 1VDZA 4XX0B 5AJWA 8ADHA 2G9VA 2I99A 4ZCIA 5T4FA 2G5PA 2ORYA 4AS3A 3Q7EA 1X1EA 3S2SA 1B8VA 2PSEA 2Y2UA 2Z2KA 1IZZA 4OBBA 4O2BB 5JNTA 4FGKA 2WJWA 5JJBA 1NI4A 1WPQA 3MS7A 4XLZA 4ZHQB 4CL2A 2PKCA 5HCNA 2IPAB 1M1UA 5JSYA 5JRJA 1HG0A 4EY4A 3WO0A 5DKFA 3IQWA 3GRYA 1FX0B 2IHJA 2PWYA 3OZXA 1JQ3A 3DHYA 1ZCJA 4I55B 3RTDA 3HGMA 3FWZA 3QEMA 4KDRA 2YKGA 1A98A 1BE1A 3EMVA 4JJKA 2FPWA 2PKRA 2XSZD 2YHBA 1ZK3A 3DBIA 1CUSA 3GCWA 1MKYA 4MIKA 4YLYA 1S3GA 4PNPA 4R9UC 5AM5A 3U4DA 4BNNA 2ZUTA 4Q16A 3HLKA 3BREA 1ZESA 3LZCA 1K8QA 1JKXA 3DGFC 5KOJA 4FWTA 2HNAA 3L1HA 2CVZA 3IJ5A 4H3VA 4IDHA 5GZ6A 2R1VA 2HDHA 2ODTX 3R75A 3TW8A 4EBBA 3BT7A 4KXFB 3LKBA 4P80A 4BE7B 5CYPA 1MAUA 4QXPA 2GT1A 4E46A 4F2DA 3KX2A 1WPGA 3F71A 4TPKA 4DRYA 2GBFA 4RPCA 1THGA 3JATA 2XYHA 5CA1F 1LI7A 1NI4B 1YZLA 2FX2A 2RG7A 5C34B 2IU3A 5SY6A 3TSYA 4C01A 4DV1B 1QTIA 4AY4A 1OB5A 1PE0A 5E9AA 4B3TB 4DNXA 2FGKA 3F6YA 3HB7A 3TTXA 5DB4A 1YACA 5DGXA 1BU8A 1NQVA 5A3VA 3K96A 5JYEA 5A62A 4NJEB 5IDYA 3IEXA 2GXQA 4Z9BA 1USIA 4EFNA 4U5XA 4ZOCA 4QKQA 1CKEA 1CXZA 1WCYA 4Z51A 1F0NA 2XYQA 1Y9DA 2ZJAA 3L49A 1WXGA 4RMJA 3KQYA 4CW7A 2OGZA 1UPAA 3AV0B 1F2VA 1PJRA 3NYQA 4P2GA 1OYOA 5CT8A 4D4JA 1Q84A 4L8YA 3WIOA 1M6WA 1VLQA 3TZEA 3OCCA 3UUWA 4US1R 4BYGA 4DLAA 4NCNA 1GA6A 2QROA 2B98A 3K15A 2CXUA 5IKEA 1UWLA 4FM9A 5EJEA 2GKGA 3JD3A 4X9XA 5K4AA 3NCHA 1FUIA 1PT6A 4G85A 3P9KA 1HE5A 2GPSA 2BTOA 2F9MA 1QOPB 3H87A 2EX1A 3L7IA 2E55A 3BERA 2IXGA 1Y37A 2WTEA 1TYBE 3P9IA 1AT1A 2IS2A 4AP5A 2L0XA 1R8YA 4OHWA 5FLEX 2HUPA 3I4LA 3LDHA 3NBYC 1T9HA 3OZBA 1BROA 4DIBA 1Z88A 1J21A 1IZ9A 3JZFA 5FNZA 4IGAA 2WHQA 3U4HA 1ORHA 1BXKA 4TTIA 3BSYA 3UAGA 2ZAIA 1Z74A 4RQTA 4ONEA 3VZPA 1FJ2A 2FW8A 1J0CA 4PU0A 3WYNA 2YWHA 3L0ZA 4K9SA 1U8TA 2W2LA 3H7IA 7REQB 3F3YA 4D4MA 1LDGA 3NHPA 3T3IA 3X1DA 3RRNA 1D0VA 2NUBA 5HDQA 3DBRA 1A9OA 3OM9A 4R84A 4TTSA 3DLPX 2C4MA 4XVQA 3IE1A 1JLHA 3PC4A 1KEVA 4HSGA 1J4AA 4KFTA 1UZAA 1YIAA 3NEJA 4OLHA 4TXJA 2GZAA 4N47A 5CW2A 221PA 3TUJC 3U62A 1I4WA 4XJVA 2ZGVA 5JZBA 2GAAA 1ABBA 1MDBA 1HEUA 2OE2A 2CCKA 3MG9A 3F2IA 1EB9A 2Y8EA 1OIWA 4FDLA 1LLFA 1W75A 3E8XA 3NH6A 5EPUA 5CB0A 1JH9A 1QTQA 5TQJA 4DRXA 1UMDB 3ONDA 2ZZNA 4FZJA 5E38A 4UASA 5A3RA 1N0UA 2J59A 2OYSA 5D84A 5K3BA 3TZHA 4TWIA 5HIMA 1W76A 1NWCA 2IY7A 4P83A 3LCJA 5FWXB 3WJ1A 1D2EA 2UUBB 5JCXA 3CNOA 2IIBA 3P9NA 4DUGA 1T4BA 1J8DA 3NTUA 2FZWA 1KP3A 4JASB 4IAOA 4Q3OA 2VHUA 3ZE1B 1SK8A 2D59A 3ZW7A 1E5XA 4OAPA 4LWQA 1O6GA 5JSHA 3V9AA 2VNJA 1XLVA 3IDZA 4YLGA 4D2IA 1AKMA 1HTBA 3U7IA 5E4JA 5IXJA 3OKFA 3BDVA 2G36A 1X14A 3AHCA 1P5RA 1TMKA 1UEJA 1O6ZA 3PYMA 3FDFA 4G86A 3DBHB 4XQCA 1TA9A 2LD4A 2Z3WA 3GRPA 3G9XA 4I3FA 3HGTA 2J3JA 1XPJA 1W30A 3AG5A 5AK3A 4N48A 1ZX1A 2A8YA 2RHMA 5TVKA 3WJAA 1WNTA 4JX9A 3EX7C 4RE5A 4AZ3B 3F6CA 1H4SA 1XV5A 3HDJA 1N78A 1KAQA 2VZEA 3RRMA 1SBHA 1M0WA 1U80A 4QBIA 5KVAA 3LTEA 4WIAA 2XRFA 5J2UB 4Q4HB 4RCYA 5CFMA 1QHIA 4W1PA 4UTOA 3SXJA 5IAAA 1QE0A 1ZXLA 3OJEA 4LQCA 2BOVA 3AGQA 2FNAA 1QR2A 3CGWA 4UCWA 3CNBA 4IO0A 1JDSA 2Q6IA 4YB8A 1LD3A 3T9EA 1EZ1A 2XCOA 3ENKA 5JVDF 1PTJA 2EGUA 2RGXA 1SBZA 4Z4FA 3EXFB 4BMZA 2QW8A 5A7GA 3LOPA 2IEGA 2OO5A 2QLJA 2X13A 4AUNA 3WR5A 3SQWA 3OQOA 1QG6A 1PL6A 2QX8A 3ORSA 4R3UC 4CJXA 4IIYA 4E11A 1WHSA 1TOAA 4CTJA 1CJTC 3D7SA 3N7TA 4KQXA 4JR2A 4OJNA 4DANA 4ZI7F 4JC0A 3MOGA 4P3NA 4QUHA 2JFQA 2XNJA 2XWQA 4V0ME 3VC7A 5KQSA 1A4XA 1XNGA 4MV0A 1D1TA 3LY9A 5CEFA 3FCSB 4GBMA 4AWAA 3HUTA 2Q5QA 3QIVA 2OYRA 5EJ7A 5KCZA 3S4YA 5LUAA 2GUWA 3LVFO 1NW7A 1TEHA 3QQ5A 4FJ2A 3GPCA 1RYNA 5EP4A 4RZUA 1Q0UA 2PR2A 3OFJA 3WWZA 1C9YA 3TGPA 2VDLB 4HZUB 4JL8A 1MZVA 2WF9A 2HFKA 1XL1A 1GU7A 4P4SB 3ZKWB 1ZNQO 2OMEA 4YTEA 3PKJA 4BWYA 5I45A 4U7DA 4AC9A 1ZY2A 4KPFC 1KJWA 2H06A 2HADA 3AHEA 1E0JA 2JAOA 1UINA 3BL8A 4PYKA 1YDWA 4HGRA 1K1EA 1UF9A 2ODWA 2GAIA 1M2GA 4N3GA 4OQPA 1N3BA 4KZPA 3LQKA 3UHJA 3E84A 2R751 3RGWS 5IW8A 3FFTA 4QU9A 1RZRD 3ERCA 4B4DA 3ONFA 3FWHA 3I39X 4CM9D 4EYEA 2NQ8A 3L7OA 4FI3C 2QSUA 3X2FA 3OJLA 2MDTA 3V6LA 3TD6A 1NNEA 3MT8A 3HV0A 1E3WB 4BGIA 1N6OA 5AKKA 1E0KA 1VL2A 3PI7A 1TO6A 2ZRCA 4P0TA 5KTSA 3EXEA 1E4YA 4IUBS 1QOZA 3L8DA 2I03A 1ODSA 1Y8ZA 1Z9BA 4GXTA 5JSKA 3T9FA 4D7AA 1L5HB 1Q21A 3D8RA 3ICQB 1SOMA 2L2QA 3DVSX 5IH3A 5I7HA 5IAOA 1P0MA 3N7UA 3PDIA 5KVVA 2NV2B 4D45A 2IVFA 3DE4X 3I12A 1QHGA 3L8GA 4CF4A 3O1HB 3MQ2A 4CDMA 2VSQA 4JXZA 4UTPA 1QRAA 1ZU5A 1A77A 1A7AA 1AE1A 1P2SA 1WTAA 2X5JO 1P8AA 3HCBA 4K6GA 3B3GA 4Y8VA 5DLDA 4IDBA 4ZTBA 1CUCA 3WLRA 4A8JC 2M6KA 4B09A 1UAYA 3FFBA 5JS7A 4FFDA 2CHEA 1W47A 2Y4NA 4C20A 1HI9A 1R8QA 1PZEA 3W3AD 2BM8A 2ZIFA 4YRKA 4R41A 1AH2A 1U2RA 3ROFA 3GNLA 1QPZA 3MJSA 4MW9A 5DN9A 4XVHA 4PE5B 4PLYA 5CNMA 5FUXA 2OFPA 5F98A 4HX5A 5CAEA 1COZA 1B43A 3I2YX 1O5OA 1SULA 3AKCA 1K7FB 3K32A 3KHKA 3NXKA 3IDOA 3PVZA 2VWPA 4OAQA 4UE3S 1C1DB 1JPUA 5B1EA 3KPYA 4FYYA 1S3IA 2WPDA 4LY3A 3SS7X 2JHGA 4CVNA 1FVFA 1W87A 3SDBA 3WB0A 4EHBA 2IU0A 3FHCB 2CUNA 1HDRA 3KAPA 3WLTA 3ZCRA 4ARVA 4EKDA 3T7SA 1E9CA 2MJLA 2J46A 1MDFA 5JQGA 1P1FA 1VXOA 3ADDA 2QPOA 4F7DA 3DOCA 3N8DA 3IKMB 3TW8B 3TFOA 1U7PA 1ZYUA 2FWNA 4AKTA 2G06A 4YJ2F 3ZU2A 1MORA 5ESWA 2HF8A 2W2XA 2IEDA 2W2OA 2XMCA 3OZDA 4O1MA 1DJLA 1E2KA 4YNBA 3WMRA 4LSZA 9GPBA 1QGUB 5F2KA 4LVCA 4Q1CA 1U3WA 4HTFB 3B6MA 2GASA 1JHUA 1YDFA 3AB3A 4II2A 1V25A 2FQ1A 1W581 3SJZA 3VZDA 4DBVO 5IUNC 1E5LA 4WZBA 5D3MA 4YQFA 3H1TA 4J0KA 4XDZA 4CIVA 2HK9A 5KVQA 3QX8A 4RKQA 5C37A 3P9CA 1DXQA 1IE3A 1RJ9B 4M1EA 2FFHA 3UATA 4F9GA 5HA5A 3PNLA 1SB8A 2C5BA 2FLKA 2LCFA 1Q17A 2BLLA 2ORIA 1Z7EA 4F04A 1PP4A 3C6KA 1ACJA 1C14A 1XDSA 1ZUNB 2W71A 5DNVA 1XMPA 5AVZA 1XROA 3EDOA 4NHOA 2YUIA 5AVUA 1X3SA 3QSGA 1JQDA 1P44A 3GEMA 4ABTA 5F33A 3VO8A 5DK6A 1J0BA 2AG8A 3D3JA 1UBMS 2GX6A 2VJYA 3PFKA 2WRZA 2CLFB 1UOPA 2NTYC 1PWHA 3PB3A 4G1CA 4ZO7A 4JQZA 5GZ3A 1I7QB 4UD6A 1FFXB 2GN2A 3D8UA 5E6SB 3Q7TA 3AVXA 1O9BA 1XLUA 1R9GA 3IKJA 3QVVA 3AR7A 5LDGA 3PNPA 3UK2A 1K8YB 1W6RA 1EFUA 4MV3A 2ZAOA 5ALZA 3EWNA 4PBRA 3V4VB 1AVTA 1HURA 2WSLA 3G7SA 3ZN2A 3THYA 1FIUA 4R51A 1WB9A 1R4MA 3A1TA 2VSFA 4XR4A 1EPUA 1WEHA 3P45A 1M1YE 3M34A 3QWHA 4HDNB 4S12A 2AG5A 1I2MA 4ENSA 5JEEA 1H6DA 3FB4A 3FVVA 3LL7A 3D1VA 4OXNA 4UBKA 2OOKA 2X8LA 4PPFA 3T9CA 3MWDB 4WZAE 2EFDB 4YP7A 1BWRA 4B46A 4IDOA 5I01A 3VC1A 1UKYA 1NVEA 3DNFA 3N0VA 1P1RA 1XNHA 3FX2A 4MPDA 1OIVA 4KN6A 1OXSC 5EZYA 4ZYWA 721PA 2IH5A 3CSDA 2GBGA 2VHTA 1KMHA 3SI7A 2IS1A 1MFPA 3JALB 2R8XA 4ZVKA 4AECA 3E5NA 3GLHA 1JR3E 3T5MA 4QEKA 7ADHA 3GHYA 1KQNA 4XD2A 4DQXA 2PX6A 2OMKA 1UP7A 3L6EA 5EWMA 3ZHZA 3VAYA 1ESDA 1G3RA 4MQFB 2R66A 2YJ5A 1XDUA 3CFYA 4N5NA 1PWEA 3W77A 1YB4A 4IWYA 4UUMA 3TVYA 2QLFA 3M5CA 4W1RA 5JXGA 5I7OA 3RC9A 4OHCA 1O89A 1R5BA 2WIKA 3AETB 1K06A 3FVQA 2OXIA 4ARIA 3OFND 2HB6A 3N86A 4LKRA 3GEPA 1AF7A 2JJMA 3NETA 3DFKA 3EOAI 2ZTLA 1NP6A 4Q7LA 3MCWA 1LPNA 3NP7A 2PMFA 2CMKA 2CCJA 1PJ8A 3GPIA 5DTIA 4PLHA 4Q4AA 4Q1VA 2HD4A 4IH4A 1PT9A 2XXJA 3ETJA 3S28A 1YQQA 1Y5IA 1FDIA 2X0IA 3BMOB 3DZKA 3BYZA 2NXJA 3KYIB 3MBIA 4W8GA 3OUUA 3ZU6A 4DWJA 2MOKA 5L6MB 1P4HA 5IZ4A 1VSQA 5DLYA 1EDEA 1EFVA 4X24A 2XNDA 1DZ3A 1JE1A 1YZNA 2ZRLA 3AMVA 3ECSA 3FPJA 1LK0A 3A9RA 1NWHA 3CLSD 3GUYA 3QLJA 4LJ8A 4YHBA 1N6RA 5JRZA 4RETA 1JJFA 1H5QA 4BHTA 3MD0A 4FMDB 1S2NA 2HA0A 3LBFA 4GFDA 3RTEA 4F4HA 5BXQC 1IAVA 1YRQA 5F78A 3G8AA 1JYEA 3S7ZA 1E20A 1LSUA 2F3TA 3LIIA 4AJ2A 3AZQA 1EFRD 1AXRA 1F6DA 3FNIA 3WA6A 1JHXA 3AILA 3I8OA 3O8DA 2P6PA 1ONOA 2GM5A 3K5WA 3FJ1A 3Q87B 4UEJA 5SYAA 5KWIA 3W6OA 2CNKA 2XQVA 1ZCAA 2GOYA 2Q1WA 3PDJA 1CQIA 2VJMA 3PTZA 1KWGA 4LNUB 4HVAA 1HDZA 2BFNA 2VRCA 4NR0A 1AX9A 2ZUFA 1YOVA 2PH7A 4BTEA 4Q00A 4C4SA 5CR9A 5IASA 3WTCA 4LMAA 4P4NA 4A36A 2E0IA 2CV1A 4R1TA 2GCNA 3WKDA 3ZTTA 2F55A 3Q2OA 2C8VA 4MP3A 4MMXB 3CS3A 7MDHA 1PG0A 1RYZA 4IUDS 4DA0A 3LF1A 3HS3A 1AURA 2C7OA 1CRWG 4L8GA 1OLSA 3CF4A 3SX0A 3DG9A 3O94A 4QUJA 2QZ9A 1BG6A 3C3MA 4IDQA 2BW0A 1TMYA 4OMCA 1NXTA 4RYDA 4P7BA 2RDMA 4YJKA 4D9CA 4X0EA 1BXGA 4OP2A 1IUOA 2AEJA 5BW5A 1LRJA 4TVOA 2QBYB 1U2GA 2H3HA 5T5QA 1N6IA 1LW6E 2PMWB 1G5PA 2Q3EA 4TMYA 1Z47A 4D8VA 4PLVA 3CKMA 3M1AA 2FAXA 2GNOA 1IBLB 1T5TA 4TRNA 1L7VC 5REQA 3T52A 4EQZA 1NOIA 1SKYE 2PZLA 1Y4AE 4MVJF 1STOA 1NQWA 5AW7A 1CYEA 3KYCA 3Q3VA 1BVUA 1YE3A 2J3DA 4HS9A 1HT3A 2BEVA 3TBKA 4NHEA 1P0QA 2XB4A 3GFPA 3V8MA 2OBNA 4UAJA 1HDIA 3JQ6A 2UVQA 4UBNA 3FW1A 5AOVA 1D2AA 4ZQGA 5DX0A 1DAEA 4X61A 2QY6A 1R9MA 3CT4A 3R4VA 1BW9A 3VYRB 1E8NA 1L0BA 3TLZA 4B6PA 1LQTA 3DKVA 2DKOA 3G9QA 2WA2A 5CVCA 1ECGA 1SCKA 1UM9B 5ESXA 3LHSA 3FKJA 4M7RA 5FQOA 1HSZA 3LHFA 2DKFA 2XNHA 1WXHA 2Q2OA 5CVDA 1H8HD 1SK9A 2OD2A 4ARZA 4WK0B 3K9WA 4MQ5A 4MW5A 5T3YA 3AR4A 2O48X 5BT9A 1GPBA 3KTAB 1OFIA 1GZ6A 4O29A 4KO1S 1D8AA 4HB0A 1JKJB 1IEVA 2C82A 2ZEJA 5GPBA 1DINA 3FGOA 5EIFA 4URVR 1B0AA 1IB0A 3P9SA 1SXJD 1J6UA 2FPPA 4N5LA 5J47A 1FRZA 1DG9A 4F9FA 3VZCA 1ZRMA 4ZOAA 4CIBA 3R6LA 1XYVA 4MAFA 3FUWA 5BSFA 2G5CA 3OSUA 4MMYB 1QO0D 4CE6A 3K20A 1CEQA 2FFQA 1Q77A 2R2AA 1LSOA 2CZQA 3GXOA 2QL5A 4RIEA 4KAXA 1CHNA 3MM4A 2A78A 3W6PA 2I8LA 1PGJA 3H11B 3UUEA 3CNEA 5CB6A 1XZBA 1B2RA 5F73A 3OQNA 3Q3HA 4TWRA 1A69A 4ENTA 4P8RA 4JGBA 4RHYA 3K0KA 2R7MA 5G0SA 2J5KA 1ZKDA 4JJ7A 4L95C 2VKQA 2GJ4A 2BRUC 1B93A 2L82A 4FEYA 2WM8A 1CW2B 1HDEA 3E27A 5I9MA 4EECA 1IHUA 1ZI9A 1M1YB 5K9ZA 4GBGA 2HQOA 1RLJA 2F00A 4W99A 1G8FA 1OXUA 4AO8A 1ZC3A 2FWIA 4EITA 1AQJA 3OE5A 4EGJA 1M5RA 4TVSA 4U9HS 2Q2WA 3GAMA 1ZD4A 1LH0A 2ZJYA 2C3YA 2PCLA 3C3KA 1SJ9A 3ISTA 3BL5A 1QPBA 3F0TA 1ONNA 2VJAA 1CDOA 2HV8A 3DDWA 1NNI1 2PT5A 1JXQA 1P2FA 2JFWA 2X76A 3MCZA 1RYHA 5CDGA 3NHSA 1Z0AA 4AZSA 5E7JA 3Q9UA 1HZZA 4G0PA 4H4CA 1QKIA 1MH9A 4FDUA 4X3CA 2UYYA 3LPDA 5TMPA 2YWGA 2CXQA 4BV8A 2GEJA 1JWBB 1X38A 3CE9A 4P36A 2QM8A 3R74A 1GAJA 2OQ2A 4F7WA 5PGMA 3CX4A 4CMBA 1Q50A 5CLGA 3QSYA 1M6VB 1OGJA 5IHXA 2FSUA 3D3WB 2GAJA 3KBOA 3IMKA 5CT9A 1IK4A 3BCHA 4TLCA 3W6ZA 3G0BA 5E1OA 2A86A 3LFUA 2P3LA 4F93B 1OH8A 4D3ZA 2UUAB 5CXSA 3WP1B 1OLUA 4DLZA 3WAKA 1YI1A 1YHYA 3TOCA 4EUNA 1YDGA 1GOTA 3E3OA 3O26A 4Q93A 2DB3A 2CFSA 4UBIA 5FUWA 3OPNA 5C1PA 3DEKA 3EQ2A 3HMKA 2GMWA 4JUCA 4C2AA 2BVNA 3NHLA 2DHCA 3L05A 2NX2A 1JGTA 3ASVA 4FFOA 5JVDB 1HR0B 4D3YA 2FMFA 4ZVTA 3UV7A 4BXOA 1Q0HA 3P94A 4BO4A 2SCUB 4HBGA 4Z7JA 2P4QA 2PK3A 5EFZA 4D92A 3I1IA 4YRZA 1XKTA 1V71A 2I1WA 3TDKA 2B5WA 3WL8A 1PX2A 4OX9B 1EEHA 5EHXA 1QE3A 5FA6A 2PX2A 3FCYA 4Z4HA 3FYTA 3SM9A 4DJTA 1UBTS 3P9RA 4WY8A 1XMSA 1FVHA 2A88A 2Y1LA 3HYSA 4AYTA 4DCSA 3R3WA 5E7MA 1EDBA 1L3IA 1XWFA 2P0AA 3GLRA 1IY1A 1MOQA 4PRLA 4Q1AA 2W42A 4KK3A 5DNYB 1WE2A 1IUKA 1CS0A 3C3JA 3DZFA 3F78A 3OWXA 4G5OA 4HN9A 1Z39A 5JD4A 3AR2A 2PGAA 4B6JA 4K6MA 3HJRA 4BFSA 4YUAA 5LB2A 4JAVC 5IPFA 3TLJA 2XMRA 1WV0A 1NLFA 5BSWA 1MXHA 5BSGA 4JI8B 3D5EA 3WK8A 2HU8A 2W90A 3C5CA 4WADA 3GJRA 5H9WA 4RZQA 4JI0B 3SNKA 4LMPA 2JHAA 3N8GA 3N3BC 2PD6A 3DHVA 1BX3A 3KQHA 4IIGA 3GVHA 3UV3A 4AF6A 4LYHA 1G3QA 4UFNA 3MUEA 1RJFA 2CEKA 1EUDB 1ORVA 3O2JA 1T4CA 3T5AA 2PKXA 3A1UA 4RANA 5J1SB 5C51B 3QYAA 2HJRA 3CB2A 4E2XA 1SQ5A 4G84A 3AY6A 2C3UA 3E7XA 3U16A 4Q7EA 1UJNA 2FR8C 3A6DA 3IO3A 4D3SA 4EH1A 4GIBA 1KMIY 2K2QB 3T0FA 3JATB 4Z5XA 4KN5A 1J7KA 4WJKB 2HW8A 1TZMA 2VBFA 3VBEA 2XIQA 4OXIA 2OFWA 4KXVA 4BNZA 1DKQA 5ICMA 1MRZA 4AL4A 1D09A 3NVDA 1XMVA 3AJRA 1ZGZA 4JFRA 2H5EA 4MW2A 2BD0A 4WXMA 4GLOA 3TSOA 1MRSA 4JLBA 2O8BA 4RV5A 1SZPA 2DPXA 5H68A 2Q9AA 1NXQA 2Y3IA 3GVPA 3ZU5A 1XLWA 1UM8A 1BRMA 1US8B 3E4CA 1TL7C 3ZXXA 4DQUA 3V4PB 5I5GA 5ALQA 1ILWA 2FUKA 4BNVA 1O0CA 2CV0A 5CEEA 3PU6A 4JLNA 1AV7A 1MGOA 5EQTA 4TYQA 1YS9A 4V3BA 2GXAA 1T15A 4IEIA 4Q1FA 3AR3A 3NHWA 2EFJA 2FWRA 2UVPB 4KIGA 1IJBA 5K3FA 2A2ZA 3FCXA 1PS8A 1A5SB 4LXQA 2PL1A 3EZ2A 1N8TA 3AJ9A 4NZYA 5G41A 5IT4A 2NM0A 2GM4A 1G42A 1CQXA 1GDDA 5G4LA 3CC8A 3R6WA 3U3XA 1Q1BA 4A7PA 3ZZTA 2OB2A 2ZFUA 1YQGA 1CUUA 3IS3A 4WE3A 1CDZA 2PUFA 4KOEC 1NC3A 1XJ5A 2AHRA 4F3NA 3EEOA 5DEOA 1VPWA 2EG9A 1NX6A 2I65A 2OQVA 1H2AS 4DAEA 3EPHA 3TM4A 1N7JA 1E79A 2QD5A 2QS9A 3L1JA 3TEFA 3AUJB 4UCXA 4XYLA 2ECPA 4KXXA 4MV1A 1DEHA 3NNDA 3V8VA 3HR4A 2XE7A 4TTVA 4X93A 3LK7A 3IV6A 2CHVA 2HJSA 1EFAA 1M67A 1UIMA 1DLJA 1ND5A 1NXXA 1WBJB 3CZPA 3HSYA 4L9AA 2Q5CA 5C7LO 3PX7A 2L69A 1N5JA 3N58A 3QLVC 5ALVA 1PFYA 4N4AA 4EDFA 2IYZA 4WHMA 4X62B 1TMOA 2C7VA 3K1AA 4ZI7A 3D1JA 1PUJA 3S2ZA 4O2AB 4OB8A 2HCJB 1DC8A 3QE3A 4KBYA 3RVNA 4CI0B 1LZKA 4L73A 4EJSA 1M0EA 1PAUA 3LO5A 4UREA 3T9DA 4RK1A 1FC0A 4B3HA 1I0LA 2F7SA 4MKHA 2WUEA 4CTOA 4QULA 4ARCA 3S1AA 3CRMA 3QNWA 2W6JD 3BGVA 5BR7A 4CEJA 1KY4A 2XTAA 1NJ1A 2AN1A 4UUQA 2ZE8A 2B2NA 3WE7A 1Z3IX 3LQ4A 3PGKA 3NJRA 3V8PA 4AO6A 1WU8A 2YMPA 3JZDA 4EG1A 3IUPA 1BJTA 1FTYA 3CEPB 4FBMA 3WVNA 4EUSA 1ICEA 1MR3F 2HFJA 2HU5A 2XQJA 1F1JA 4OQEA 2YCBA 1DAGA 1RQRA 3OT5A 1RKVA 4BMCA 4A5SA 3PDIB 1JBEA 2C4WA 2GVZC 2V3CC 1F2TB 3EJWA 1N33B 2PPLA 4RV4A 4NAHA 4WXHA 2JFGA 2CZGA 2QTHA 2D1QA 4HMPA 1KDYA 1X3LA 4UXHA 1M2VA 1T0UA 2YYSA 3LL4A 3PZBA 4LOKA 4QTUB 4RVFA 4BY9E 1RHJA 1QIIA 2BFPA 3QVGA 4H15A 3FKSD 1HDOA 1GZ7A 2H59A 4QYXA 3GZJA 2OXFA 2YRFA 1BN6A 1QIEA 4K86A 2B4KA 2MSWA 4DV5B 2O3JA 4I1VA 3M3PA 1N2BA 2DQ4A 2GN9A 4PAOA 1RI1A 3A3KA 2YR0A 1AA9A 3E3LA 2PV7A 3O74A 4U00A 2QRJA 1FOEB 2XGGA 3BWVA 3H6KA 3LLUA 3BULA 3KDAA 1NBME 1I2ZA 2JGKA 3EGWA 3SZOA 2DEUA 3LNTA 3AYXB 1EI9A 4FYJA 4UM7A 1QAQA 3QF4B 4FD2A 4QJBA 2NTVA 3VOTA 2LCQA 4P4SA 3WQSB 4QOHA 5J59A 4ILEA 1ULBA 3P0IA 4K40A 4C0KA 4BVKA 1P5ZB 2X1MA 1YFJA 3RSCA 3T5CA 5KCMA 4MRSA 2G1AA 1T1GA 4H6VA 4RO0A 4P7JA 3VAAA 5KYWB 1HE3A 3U0VA 3EEYA 2W70A 1MC8A 4DYHA 5DM4A 3DMTA 2BFEA 3B6IA 3DXFA 4CDRA 1IQPA 1Q0QA 4FDAA 4NE7A 3KT8A 5B3JC 4OAOA 3A2LA 4R4JA 2EIHA 3L8FA 4C1NA 1GKUB 1PK8A 2CJWA 3GNQA 4JLWA 4EHFA 1VPDA 1SKYB 3RYFB 3W8FA 1CNEA 1CD5A 3OA0A 4ZD6A 3GR6A 3R5KA 1Z5WA 3EAGA 3A6LA 2WTNA 3MS4A 3TIVA 4YV7A 2VF2A 5JFOA 2YWBA 2WV7A 4HMQA 1TKCA 2JGAA 3QYFA 1E3DA 4F3CA 1AHNA 5KNBD 4PZPA 4MUGA 4TKZA 1RXVA 1SKBA 4FFSA 1EVJA 1N2CA 2HLHA 5ALWA 1KR5A 4MVJD 2FMUA 2WU8A 1G9SA 1Q74A 2CXNA 1JAIA 1XCGB 2BHLA 2DHDA 4CMIB 1ZSNA 2NYRA 1NQOA 4I19A 4LTDA 4ZI5A 1IVNA 2C9CA 1ZIXA 2ZI4A 4DARA 5G1NA 4R0MA 1RHKA 1U31A 1U8YA 4YJGB 5CXXA 2FX3A 3LPNA 5T41A 4HRAA 3U49A 3WC4A 2HIHA 3W7VA 3JYNA 2F9FA 1CE8B 1L8XA 2VYQA 1FY2A 2R00A 3KVNA 4FOSA 1BHQ1 1Y42X 1XCLA 3FGNA 1K5DA 4OM8A 3R23A 4YH1A 5EEHA 5JV5A 4X20A 1IG3A 3S1LA 3GD7A 3CLVA 4B2PA 4DQ0A 6REQA 4HP8A 3AW8A 5JAZA 1YZ3A 1H3NA 5DX1A 3E03A 3KVVA 3LWZA 3D1LA 4Y9TA 2PO5A 1E7RA 1UFQA 3RC7A 5HZGA 1NE7A 5HBRA 3T7TA 1SELA 1VSTA 3NR2A 1TO1E 4OFXA 3ZOZA 3GA0A 3UAVA 1P1BA 4EENA 5JNUA 4ZRDA 1ZCBA 3UK1A 4NOLA 1CF9A 5DI3A 1X86B 5JE8A 4QDZA 4L3OA 1T0PA 2SBTA 2AOTA 2JH9A 1KVSA 3NO4A 1DAOA 1IPEA 2P62A 2ODQA 2ZSIA 4QQKA 1XDZA 2H2HA 3DTTA 4RORA 4Y2SA 2ZTVA 2IK8A 4D0GA 2P3OA 1W46A 4EHAA 3RR2A 2GH1A 3OP4A 2G40A 2R5FA 3SQDA 3W7BA 4A15A 3MRXA 4WDRA 2BPOA 3BUSA 5FUVA 3T95A 3RYTC 1SC1A 2XUHA 1VYTA 3Q1KA 1E5TA 1EBUA 1LBQA 1EXNA 1NR7A 2AWOA 1IXKA 3BSSA 2IEZA 5AVQA 1KPIA 4G5HA 3G23A 2DE0X 1D2RA 2FWJA 3MTEA 4FKBA 3ZLTA 1HBJA 1QANA 1S7GA 4ZVLA 5LIRA 3TZLA 3A1EA 5BQ5A 2YFQA 3VYWA 2C97A 2F1RA 1VMIA 2C5AA 2XBLA 1CUBA 4LAFA 4BN4A 3JYHA 2X9NA 1JH8A 1PDVA 2AG1A 3L4EA 5BSRA 3CTMA 4UTXA 5ES3A 5TSDA 3I52A 5EN4A 4C7BA 3A27A 1C7IA 3R1IA 4B84A 3FPSA 4G0OA 1NF2A 1XK7A 1XVTA 2D7CA 5GONA 5KEIA 2NXCA 2Y1FA 4AO7A 1XZPA 5TV2A 4R1PA 1Y0BA 4E22A 2Z43A 5DM70 4KPYA 2BBTA 1G7RA 4NZNA 5TMEA 1W44A 1WB5A 2QTVA 3TWOA 1ZW1A 4U2CA 4FOOA 3RO7A 5IKPA 2DKNA 4IF6A 3CLRC 5C4MA 1EIWA 2C5FA 3GI1A 4MDHA 2AMYA 1WP4A 4U4AA 3DT6A 1ZK0A 3TI9A 4OA5A 4D80A 3QVKA 4J7AA 1JFRA 2JCYA 4I4LA 3TNDA 2JEYA 3C3EA 4ZCRA 5B3LA 4RZHA 2GVDC 4RJJA 1LJUA 3LECA 4NYMR 4NZPA 4EWLA 3U9TA 4D4HA 1YCDA 3P9PA 4I2NA 4CFZA 4D3DA 3COJA 4XIGS 3KWLA 4EHIA 4CM8A 4J7UA 5A05A 4EDHA 4XUEA 1P7CA 1FXWF 1QX3A 1NUPA 3OFSA 3KXDA 4B4UA 5L51A 4MULA 3W1EA 1BFKA 4HCJA 2FF5A 5BMVF 1O9GA 2IYWA 2V9PA 2C4NA 1TVKB 4IUCS 4KKXB 4M9XA 5E9QA 1E66A 1QXSA 4F85A 1KDOA 4BLSA 2WWGA 2HA6A 5CM8B 1TUIA 3TQCA 1SVNA 1W4ZA 3HACA 4UEKA 3RIMA 1YRBA 3OAAA 1Y3DE 1DJOA 2F90A 3EZ6A 4ZQBA 2QDXA 3COVA 3URMA 4MKIA 3UT0A 5C0OE 4AJ4A 2AMFA 3ZI7A 4BQFA 1M8KA 2QDKA 1F7UA 1FSPA 1RTKA 4GLLA 1OY1A 3DDZX 2WKPA 3GVXA 4L72A 4YP6A 4G0WA 1Q7GA 3O90A 4M8NE 3A6ZA 3AUUA 1JKIA 2V7QA 3MJHA 3JVDA 4X3PA 5HKOA 1AQ6A 2OZLB 3LKZA 1Q6YA 5CNIA 3W2TA 1JIQA 2HSZA 3AVTA 3QVJA 4IQ4A 4FQ8A 4QAQA 4UMFA 3G17A 3T8YA 1QH1A 5HX7A 1EJ0A 1K63A 3V1KA 2R1ZA 1SCIA 1YB7A 3WB1A 4PQRA 1D4OA 2C4TA 3PGLA 3K73O 4F6RA 2ZRQA 2CLIB 2WD7A 1CBUA 4TT8A 5JRDS 1L8OA 3BFJA 2XYPA 4QO8A 3PRJA 3RSQA 1JDBB 3GFBA 5K0ZA 3PGJA 1J9ZA 3HI6A 4MS3A 4NJMB 3NHBA 1VJ0A 2Q8NA 4MHSA 1UK7A 3N53A 4RK7A 4UOQA 3TLEA 3WIEA 5LLSA 5GJBA 3DOHA 4K88A 5E0OA 2PY6A 3A1CA 1YZYA 4JH0A 1FE8A 2W6ZA 3LHDA 4MI9A 3WGJA 2A5DA 3ODGA 3LA8A 4UZSA 3BAZA 4G5RA 1U2DC 1NATA 1UOQA 1V48A 1Y7LA 2FN7A 5DHPA 4BEJA 4BEWA 4OMFG 2Z8XA 2B5OA 3D2LA 3RK0A 3BIJA 5FWNA 1XZAA 5COAA 2JRCA 2QN6A 4BLRA 1GXSA 2FP4B 3QMWA 1KEUA 5F7OA 1LS1A 3AY7A 3TLCA 5K5EA 2QZJA 1JV2B 1HYEA 1KKMA 4JP1A 1E98A 4NNPA 2AE2A 1B2LA 4GPTA 3HH8A 3KB8A 3U6BA 3IP6A 4K8OA 4BVJA 3W5UA 4P98A 1FMJA 5WRFA 1ORDA 2M98A 2QRVB 3AUKA 3HUUA 2RHGB 3DB2A 4OSEA 3KR1A 3WRVA 4A2WA 1YT5A 1YOVB 4MUAA 1C30A 5ED4A 1GTL1 4Q3CA 3PC7A 3OZ7A 3V1TC 4UEQA 2FOIA 5HM8A 1CJVC 5F1OA 4MRAA 2DWPA 3KKNA 3NTOA 3L01A 4CU2A 1O08A 1X74A 5JH7A 4ZGBA 2IYNA 3MAAC 4KMOA 4L74A 1FYEA 3E2MA 5EJ5A 4HPWA 5F7XA 2FPSA 3GRUA 3JTEA 2ZRPA 4IJQA 2IOFK 2NXNA 1CPYA 2Q41A 3N8IA 4BBJA 1TX4B 2X42A 3IAM1 4OH1A 3ZHUA 1K88A 5E4YA 1XI2A 4BNIA 1LBSA 3M82A 4FLMA 3EF3A 2FP4A 3F1KA 4ENQA 2UYCA 4DR7B 3BGOS 5JS2A 1GPJA 5C8XA 3PPXA 2XCRB 1HT1E 3MIIA 4OMDA 4FMPA 3E81A 4FOTA 4M9CA 1UK9A 4YJ2B 2Z6QA 3H2KA 3CPEA 3PX3A 1CP3A 5LNK1 4U2DA 3CO5A 1N2EA 3T1OA 1T34A 2POCA 4EKEA 5DW3A 3OICA 1E6EA 5TC4A 1PKEA 5A9SB 5CITA 5AUNB 1ULUA 1KH3A 2Q6LA 2AR7A 1HOTA 4HH4A 1P33A 5CHEA 4EGCB 2G3YA 5DNUA 3RARA 4R81A 5TS2A 1QE5A 2X1VA 3LX4A 4F2WA 1AA6A 4QZVA 4PVCA 3QA3E 4RESA 3RSLA 4DA7A 1KK2A 3AXTA 3O75A 4X1YA 2FE4A 3IH5A 3OPQA 2FCAA 4P84A 2PGIA 4O4JF 5TJ9A 2WOJA 5HM6A 4E5YA 1FP1D 3LLVA 5T8KC 1NFFA 4HLQB 2ZIUB 2OPBA 5CEJA 1B8UA 2QAGC 3RW9A 2W6MA 3UPTA 2V65A 3LP5A 4KJXA 1MVOA 4PSVA 1XZ8A 5DBIA 2ST1A 3RUCA 4FU0A 3GV0A 5IEBA 1RNLA 2IQIA 4J0CA 4QDUA 1QWOA 1ZSVA 2QSYA 3OTIA 4PHTA 4ZT4A 2FPGA 2O8CA 3Q3JB 1U4NA 3DDNA 3IOMA 5EWMB 1GN8A 1GPH1 1S8OA 1N6LA 1BOOA 1WCV1 1WVMA 1O87A 2J33A 4R8SA 4XWGA 1H3EA 1KY5A 1ISIA 2Y9MB 5DBGA 4L0CA 5TDHA 3TB4A 1YS7A 1PG5A 3WMXA 1SOAA 3TXXA 2OV4A 3U13A 1QQBA 1XYYA 3MS2A 3FBGA 1YQTA 3BE5A 4YYEA 4XGNA 4MS1B 4BB6A 1E7SA 1OF1A 1RP1A 3NAMA 4HKTA 4U2BA 4UEOA 5CD9A 1XMOB 3MJ4A 5K0LA 3L6CA 3V2UA 4E15A 1XR3A 5DVZA 5DYNA 3DOUA 1TYAE 3H11A 3HYTA 3I6ZA 4RA6B 2G6TA 3WZLA 3L1VA 4EF6A 1V8OA 1NVBA 1FS6A 4IV5A 4Q1DA 3W2IA 1RPJA 4MQ6A 1ZM2A 5FJIA 4ALMA 4A8TA 3S81A 4FC7A 3MT9A 1L5ZA 3D6FA 1U9IA 5AOCA 1UXJA 3AC0A 4Z1MA 1FTSA 1XSEA 2A0YA 2AD1A 4DLYA 2G0TA 3K9CA 3TMKA 4OG2A 4DCGA 5KMGB 1TJ4A 1EFTA 1GWNA 4NMMA 1O4VA 4XX0A 5FL7A 3IMCA 5HSGA 2V98A 2FPIA 4X60A 4F56A 3ZZ1A 1Q2XA 5JANA 3QXXA 4BNDB 3ASYA 2H1SA 3KOOA 2IBTA 1RSZA 3V34A 4C29A 4AJNA 5D3KA 5JSQA 1X7GA 1ORRA 3AR9A 4L76A 5DV9A 3H13A 2FVYA 2O50A 5I8ZA 3NJ8A 2O4UX 2QR5A 1W25A 4ZAGA 2DECA 1BXRA 4HDMA 1GFZA 1D9ZA 3ETEA 3OA2A 3N3AC 1UODA 1XTJA 1K5HA 1SHJA 4DC9A 5LBIA 2NPOA 1T9DA 4XYGA 1PIWA 4YRTA 5EE3A 5LBUA 3ZUPA 1AKUA 1T1RA 1U2SA 1W1UA 3K0AA 1ML4A 2R1TA 3OF3A 3TAXA 1AGNA 2CL0X 4MB0A 1KJIA 2F3UA 5BRJA 1MZPA 2I4MA 5CBPB 2E1RA 2FEAA 1P3DA 4X7RA 1EEXB 1Y33E 4KC0A 4OREX 5AJTA 3FR8A 2ZBEA 3M6LA 3T38A 3MSCA 3L07A 2JLYA 5IJ9A 5KSWB 2AZMA 4DHEA 3WL5A 5DN6D 1D2GA 4AJKA 3Q5DA 2GFHA 2CXPA 2PL5A 2WINI 3VHXB 1DIOB 1MJ5A 1ADYA 3T4EA 1GNVA 4YMGA 2I4TA 2WD9A 3SHWA 2X40A 3ZLVA 3GP8A 3FFAA 4RHEA 3ICPA 1Q20A 4MR7A 1J0EA 4HFJA 5JZOA 4TQ9A 3AEXA 1ZQ9A 3LC0A 1SVIA 4FMBB 4JQYA 3HCNA 3OMWA 1XWWA 4GZ3A 3ZY2A 5GTDA 2EJBA 3G0IA 3IBFA 4LXIA 2ACEA 4XIIA 4X1KB 1TAGA 3DXYA 4XRGA 4IXNA 2PWAA 4MWDA 1D07A 4LECA 2DYKA 3R9XA 1WVGA 3KU4A 3ORYA 4MJ7A 3NGXA 2VDOB 1KBZA 3ABRB 2HMWA 1Q1ZA 1FDWA 3QXJA 4QL3A 4ZO4A 2X4IA 3OTHA 3VJMA 3TDMA 3DMYA 3B2EA 1P29A 1H2ZA 1VFPA 4MV4A 4JLSA 1U8XX 1ESCA 4YC7A 2GEDA 3OJ0A 4JJIA 3KJHA 3W5CA 3DOJA 4XWYA 5ICEA 3CEJA 1D03A 2OFFA 3GQVA 4FX2A 3TUZC 1V0JA 1X8XA 5LP6C 3B6EA 1N6PA 4H6XA 2IHUA 4LKOA 4S2UA 1A8SA 3ESRA 3MJCA 1VE6A 1XMJA 1PTKA 2CKMA 2I1LA 3MTAA 2VNIA 2X4GA 4B3IA 4Z1MD 2Z1NA 4Z53A 1B3RA 4H16A 2H7YA 1N3LA 2QVLA 1R7RA 1T24A 3D64A 4QRIA 2H9AA 2VPYA 4E2YA 3O91A 4JOQA 4PYLA 4E5VA 1P9LA 3CLUC 2B0CA 5ADWA 5I3CA 2BFCA 3KQLA 3FTQA 4U7HA 3T4XA 2B3DA 1DKOA 3QW4B 2QG4A 2LWIA 5KNCA 1Z6XA 1R0ZA 3ZV6A 1KBQA 4A2QA 2HMUA 4M88A 2J7KA 1IBMB 1ZGBA 3F4BA 2W37A 3EQZA 3ZX4A 1AMNA 3H9EO 4JYCA 4DPLA 1MIOA 4BU1A 3RTCA 3W04A 4DM7A 2VYND 3L1UA 3OM0A 1CYDA 2G25A 2FK7A 3I34X 5BYJA 2Y76A 2OBFA 2YWEA 3TJZA 4EMUA 1Z6PA 3EF0A 3C48A 1DQSA 3KEFA 1J8FA 1O95A 4KRGA 4O5AA 2QQEA 2RK4A 1GNSA 2H0RA 1ODTC 2Z8ZA 5E1DA 2WUGA 1G3MA 2HWYA 2JFVA 2X14A 3O4IA 5EZ6B 4DM3A 2JZCA 1E3SA 2IU4A 1DC3A 1SQSA 3NGMA 3S99A 2YXPX 2X4DA 2O20A 1JXAA 3GDFA 2E4AA 3QBDA 4MLDA 4D6PA 1PK7A 2CE7A 4YJHA 4C0WA 2UU9B 3FTFA 5EE5B 3KNZA 4LSMA 3T6KA 1YJQA 4E7PA 3W5BA 4O3MA 1BFDA 5KYVA 2V1XA 5ENZA 3LRTA 1WW2A 4NAVA 1QONA 3DUFA 5AVJA 3R5FA 1NVVR 2R86A 1Y89A 3QVWA 3F6SA 1XALA 1XN1A 3W6UA 4LY0A 3ENWA 2Q5HA 4RV9A 5LQJA 1G4AE 2I6TA 2KS6A 1WQ4A 1KR2A 1MX3A 3CRVA 3OBBA 1EXDA 2P2CA 4I5EA 3QU5A 3MILA 4G4IA 3GAZA 5CVVA 4DDKA 5JBQA 2IRWA 4KE9A 4ZTZB 2FG5A 1PNVA 1CJUC 1Z2DA 3NVAA 2DBZA 3TCNA 3TQIA 1LPBB 3AH8A 5KX5A 1XTRA 4DOMA 1DX9A 3WAJA 1PLJA 4TKVA 3OOJA 4KPGA 4LBVA 3BMQB 3RUHA 1T35A 2HLNA 2JVIA 4OP3A 1C0IA 1T8RA 1LUAA 2C00A 2G9RA 1HM5A 2HHAA 3Q41A 2WMNB 2IIPA 3KV3O 4TYYA 3O31A 4XPZA 5AJUA 3HYCA 3IQGX 5BUZA 4KO3S 2V3VA 3CH5A 3TQSA 2AQ8A 1F17A 4V38A 4BQEA 2FY8A 4OF4A 1Y6GA 2HT1A 1J99A 1I3OA 2R85A 2K4MA 2BKVA 4FOPA 4L85A 2BDEA 3PIDA 3S68A 2OV1A 1RRCA 3E9NA 3EG9A 4RK6A 3K6RA 1N6KA 2B37A 2XT0A 3Q3GE 4PYOA 1J2EA 1J90A 3HR8A 1ZK4A 3OAAD 1XKLA 1EQAA 5T4EA 1H1LB 4YV0A 5FLXA 4XIJA 3MHTA 5LP6F 4K1XA 5LZ7A 2AN5A 4RZ3A 5C1IA 5GY7A 4CNBA 2V4UA 2CYAA 4JLUA 4WD3A 3A31A 1R00A 3VNAA 3UMBA 2Q27A 3OKAA 3ZNNA 4LVUA 1DELA 2UZAA 1IBCA 4JUAA 4XQGA 1EVIA 2MSEB 3KU1A 3HBJA 5BWOA 4YJGA 8GPBA 1UKVY 3CG0A 4M86A 4IGIA 3AFIA 2NGRA 5EJFA 4CGYA 1EFDN 3CUYA 3PUYA 1RVDA 1O8CA 2CHFA 1NRXA 2AD5A 1R64A 2F8MA 4K9QA 3D8NA 2ZB3A 4DLBA 1MPTA 4UMVA 3X1ZA 5ELMA 4JUDX 5FBKA 5BQOA 2QMZA 4F3RA 4RTSA 3RUIA 5TQ2A 3CCCA 3W0LB 1U3GA 4GXNA 4BFYA 2BMEA 4LX8A 1GCGA 4B9AA 5IAJA 2FQXA 5GJWC 3A4VA 3FI0A 2EERA 2QTGA 1RLMA 3K0SA 4QODA 4WGFA 1S01A 2P4EA 1R3UA 3D6UA 4U39A 2V6GA 4DNOA 2V7EA 2AF4C 2WAAA 1T4DA 3RKUA 1N2CE 1PI3A 2B30A 1A9TA 2O3SA 3P2IA 3NOQA 1E9VA 3GFSA 1EHCA 5JJCA 2B3TA 3I1YA 3THWB 5M5BA 2DFPA 1RWOA 3G2JA 3KV1A 4LZWA 4M0FA 4BJ5A 521PA 4P1ZA 1R16A 3W5SA 1QUFA 1WM1A 4U1RA 1CEXA 3IBCA 3UB4A 3W90A 3MIZA 2VBIA 3OT4A 4MVJH 4MW7A 1P31A 2PEYA 2AN3A 4FGLA 5GJCA 5EHQA 4C14A 4AF8A 4BX9A 1FSFA 3OLWA 5KNBH 3KQNA 1VKOA 2HBYA 3VZBA 3RSOA 1AZSC 2OM6A 1EX1A 1TD1A 3M5DA 5HIAA 5M29A 5ELLA 3L7NA 2P65A 3HA2A 4IJVA 1RXEA 1KMMA 2QVZX 4C4PA 1GNQA 1YMVA 2FLVA 1I5RA 1G2OA 1NVAA 2EDCA 4IPTA 3HRHA 3NEYA 4EIWA 1LVHA 5AVRA 4MPRA 4N5IX 5DXAA 5C7IO 3UENA 1E2NA 3NHJA 3HB5X 5LWHA 1RWKA 4QBFA 1E1RD 1ZC4A 1TM1E 1N5RA 3WLMA 1OLOA 1GUFA 3AT1A 2P6NA 2EZ8A 3ODPA 4RQBA 2HYDA 2IP4A 1YKGA 4J9UE 2DWOA 5LXTB 1DCKA 1ZI8A 4TWAA 1G3UA 2VDVE 2AQIA 1SBTA 1KDRA 4IICA 5ED0A 3ZU3A 1B26A 3SVZA 5HQ3A 4ZRNA 4Z7OB 4U9IS 4XSGA 5KYXA 1OAAA 4LF8B 3FPAA 3ONNA 3I9KA 5IT9A 3SEAA 2GCGA 1FNMA 3RSGA 1E89A 1XQ6A 3NBFA 5HGJA 1YI8A 3I2HA 1RLOA 3OPXA 2DLDA 1WCWA 4BV2A 4E3WA 3BORA 1FRFS 1VIAA 2MSKA 3I09A 4IWNA 1D2HA 1HQKA 2WIJA 4MRNA 4URXR 3IEPA 3UJAA 5IP5A 4IFEA 1J42A 5DYIA 4BGUA 3OC6A 4JI2B 1HORA 5HJ5A 4YRJA 3WLLA 1T3HA 4PC3A 2VDQB 3WQBA 3O8NA 4QUEA 2FI1A 2ZYVX 2G9NA 3J7AC 4CMEC 5B6IA 5JZMA 2BMWA 4B3XA 2PSSA 3WSVA 2FUCA 2FEXA 2OKGA 5FB3A 2JJYA 2Q21A 2QG9A 3INNA 4DJAA 4PLZA 4ZP1A 1C9JA 4RX1A 1NHGA 3MXOA 3OQPA 1DGQA 3IUJA 3SXUA 4XYEA 1R8JA 2AW5A 1EVEA 3BTOA 4S1TA 2CMHA 5AK0A 4XW2A 4WUVA 1OTYA 1YJ8A 2C78A 2JIOA 2ZR7A 3BCUA 3HYLA 3MZ0A 4K03A 2P75A 2PNJA 1Q6ZA 3SF8A 3TSCA 3A3NA 4LHVA 3H2YA 5JQGB 3CYFA 1WXIA 4QEZA 4OQFA 1XXLA 2YTZA 3MCTA 2ZDHA 5D01A 3DOOA 4WKOA 4I5FA 3FWNA 1VQ1A 2Y6VA 3KOXA 4LJ7A 1U5BB 3RTBA 2GPJA 5KTRA 1EINA 2O3TA 3V1LA 2FN3A 5HEKA 3RIYA 5I9TA 2ZW9A 1VP3A 4U0JA 2MTBA 1L5OA 1RPTA 4RABA 5ITZB 1CZOA 3N05A 4XDHA 4CEIA 1SMKA 5JYDA 1QH0A 1E63A 3TE7A 3OO1A 4HH1A 2CFIA 2NMVA 3ZHTA 3U3ZA 4BVAA 4HO1X 4CUJA 1OPXA 4IDNA 4P3KA 4MUKA 2ZTUA 3OWHA 2PXCA 2D06A 3DKIA 3EB9A 4RY2A 4YFYA 3D7KA 3SQLA 5JROA 1Z7GA 2YJ6A 4ZVQA 4D8YA 1OBCA 4REQA 1PBNA 2X5XA 3FAKA 1B41A 5FNVF 2G08A 2R8EA 4I1UA 4JYBA 3QFHA 1GG2A 3OY7A 1DHRA 4KWEA 5SY9A 1OYWA 1DTWB 4BEBA 3W3ZB 1HLFA 2EKQA 2BYTA 3KYJB 2NPIA 1I0ZA 4L5IA 2SKEA 1VLLA 3B1JA 3H2SA 3ZD7A 1VA5A 3B8HA 4UULA 4MQFA 3H1BA 3DPIA 3EVBA 2O7RA 1M2WA 2QWXA 4QD3A 1USKA 2HWWA 4MRRA 1E2QA 3KQMA 2PJDA 2BE9A 3EWAA 1ZQ1A 2WSIA 1OC2A 2BGMA 2Z56A 3IXLA 4WDQA 2H1LA 3PKIA 2R96A 4XEHA 2JFPA 4KAAA 4PSCA 4XCXA 3B3FA 1D6MA 2RAVA 4J0GA 1A04A 4QPNA 4MVCA 4PO3X 1J2RA 4QVGA 4K2HA 3I6MA 3IURA 5JCOA 2AB0A 5K09A 1CUJA 1ZITA 4JFAA 3X1XA 1L5MA 3H6HA 5KU7A 2AJBA 3ECCA 4ITRC 2EGGA 2V96A 3RYFA 3W8RA 1EM6A 2ZIXB 4QFMA 4AJHA 5BSHA 3AL2A 4J07A 3EFOB 3RG8A 1UPCA 2JHFA 2PS0A 3FMFA 1T91A 1N0HA 3B38A 2HBZA 4S1PA 5DTQA 3AEKB 1X1BA 4D79A 5H3HA 5KWSA 3WYEA 4AQYB 1YIOA 1ZVJA 1SBYA 4B1FA 1JXOA 2I4RA 3R3YA 5CB4B 3M6IA 3RIEA 2BM1A 3B9QA 2PUVA 4PFKA 1PLKA 1U7TA 4GGOA 3B51X 3EASA 1HL3A 3JWEA 4QOJA 1KQPA 1Z75A 3G2OA 3K5PA 3G9TA 4K26A 4RH1A 2Q7XA 3MINA 2EP7A 2C20A 5A5DA 4JEIA 1ZA1A 3T61A 1YFLA 1R6XA 4W5HA 1ZJ6A 1GTVA 2EZ9A 4JL5A 3HPRA 5AOBA 3TNLA 4WK2B 3SJCA 2O3RA 4UXJA 5IEJA 3K09A 4GM1A 2C7RA 5L8VA 1L5NA 2D2XA 5JSZB 5DYTA 1T1SA 5DCWA 1E6CA 3UCFA 2VUSA 2HDOA 3F6EX 3FMOB 4NBWA 2WK1A 2XUAA 2VXOA 3WQQA 1OT3A 5JH7F 2UZ4A 4ZQEA 1R27A 4NOJA 3OZTA 3WFZA 2FXIA 4D9JA 3B1FA 3J81A 2O8FA 3PR3A 5FXMA 3M4ZA 2O05A 2EBWA 4B7UA 5CA1B 5KQLA 4R9SA 3SQOA 3BGIA 3GGDA 3H8VA 1U9ZA 4DL9A 3HABA 2QOEA 4HNRA 3Q6MA 3O47A 3HZOA 2QD3A 4LC0A 4W82A 2JBHA 2J5XA 1T9GR 3LCCA 1IU9A 4LX0A 2NZVG 1XQXA 1OC4A 2FR0A 2C59A 1MQAA 1NLYA 1W0KD 2G0AA 3H3JA 3LCMA 4LE2A 4C0JA 5JJ5A 1J7JA 1E1QD 4OLJA 3UYLA 2ZYHA 1UKBA 5KQPA 1DIAA 4WVFA 4DBLE 5ICCA 1UXGA 3P2EA 2GLUA 4RHUA 4ALKA 3ANNA 3IQIX 4LDQA 4LPSA 4B4VA 1K6XA 3ZY3A 1B8OA 4GLJA 4Q9LA 4IV0A 1C0LA 1K3TA 1LPAB 2XJ9A 1ETHA 3E9YA 5J3JA 4J3FA 1EE2A 3HCRA 4TWZA 4BN5A 3FMIA 4BZWA 3PITA 2OGWA 4HVLA 1VE5A 1G9TA 1NURA 1CWUA 2QU7A 4MROA 3L6UA 3T9AA 1EHIA 3OD5A 2ISCA 5TR9A 3RBXA 3IPLA 4RL6A 3VR6A 4NYIQ 4Z7QB 3ND8A 2AC4A 1EVKA 1U7DA 4HDCA 5A0FA 2EW8A 4RS3A 3ADCA 2VJMB 4PAGA 1O94D 4OHBA 4LNUA 4YUXA 1Q92A 4YRIA 3CISA 2BEUB 2E82A 4V1CA 1FFHA 2PXHA 1E2JA 3L8MA 4N8SA 4XDGA 3H1GA 2JI7A 3GT4A 3MVEA 5I9BA 1TF5A 2ZUUA 3ID6C 4NG4A 3FSJX 3GC6A 4AQ7A 3A37A 3HWSA 3IPYA 4RF4A 3T3OA 3TL3A 3H0EA 1T13A 2X3FA 5HOEA 1SPXA 3DMHA 2FW7A 3HKBA 2PUDA 4AXBA 9ABPA 2E4VA 1X70A 5DX8A 1RC0A 3TVDA 2ZYTX 4IG9A 3K05A 2IYEA 2OORC 5F21A 1A5TA 4HWPA 1GZHB 5LPNA 3QA9A 3SEZA 1KMHB 5EXSA 1JEYB 4DSTA 2G1UA 2JZOA 5JECA 1T8PA 1BWSA 2W8BA 3WGKA 4JT9A 1XXHB 4L8VA 5CB8A 4LN1A 2BR4A 3A14A 4Z9FA 2VP6A 1WUJS 3Q6NA 3KFLA 4F1KA 2DUUA 4JQSA 2I3GA 2LE0A 4NF2A 2C83A 5BYAA 7AT1A 1Z5UA 4OOEA 3JVIA 3HNRA 1H05A 2ZIEA 3AU8A 4KHZA 1UT6A 2E89A 1CLEA 3ELYA 3Q7IA 2NUPB 2HJVA 1PEAA 5H80A 2JKVA 2ONJA 5HS4A 2BZ1A 3IT2A 2P9BA 3V1UA 3EISA 3RI3A 4E1VA 4BC0A 4QFDA 4Z3KA 3LD9A 5KPDA 1V4VA 3KAJA 3A06A 2GJ9A 2O5CA 2NLOA 4TL8A 5IT0A 4YPVA 4BLOA 2WILA 4C4XA 1RWQA 1Y8CA 2HAEA 4Z2YA 5JU6A 2BMAA 1CZHA 2GAOA 2Y0EA 3B1ZA 1TADA 3X0DA 4GXQA 1J1UA 3OU6A 3GFFA 3L7DA 4NC9A 3HZHA 1YCFA 5E4TA 2NZWA 3FPFA 4JLAA 1CQZA 4EKYA 1RI2A 3WX0A 4Z4IA 3UJ7A 1X77A 3Q0IA 5JZSA 2IH4A 1P5JA 1I6MA 1P1CA 2HWXA 5LCXA 2XB6A 3A6GA 1S5PA 3H1EA 4LDAA 4TSFD 3QNUA 4ZT3A 3VX3A 4A3SA 4ES6A 3NEPX 2Z4SA 4H7EA 4M21A 5KTPA 3CX6A 2Q2NA 2I2BA 2YVAA 1GGEA 4PHCA 4XGKA 3IP1A 3DKPA 1PTJC 3TM5A 4EZIA 4K3UA 3H65A 4D1YA 1IWPB 2QNIA 3KPVA 1J22A 7ABPA 3UBTA 4BL5A 2PM8A 2ZR0A 1YHNA 1N92A 5EKXA 1D6JA 2AOUB 1SRQA 2J3IA 1PDWA 2WQZA 1O9HA 1MB4A 4QYSA 5EWJA 2Z1MA 2C92A 4QPCA 3ESYA 4YCCA 3SHQA 3HSSA 4YX9A 1KSHA 3M4JA 2X0JA 1NVMB 1YTLA 4FS8A 2QY9A 3AEUA 2ZRMA 2GZMA 4MH0R 3ES9A 5FEMA 4OI1A 3AFNA 3MQFA 4EM6A 4MIEA 3CJQA 1M5UA 3DAGA 1YZVA 3TR0A 3RVSA 5CDUA 1GZSA 2JBWA 1EXWA 1Z4LA 2HO5A 2NO7A 2QNRA 4ID3A 1NXPA 3OURA 4HR7A 5D7BA 3RC2A 1XRJA 2WT4A 3ZZUA 2O2YA 1KOFA 4N01A 2E4XA 3AQIA 4QLOA 3FTCA 4KR2A 5CLHA 4EHNA 4PN7A 1AHPA 4GHWA 3GFVA 1XCOA 2OLJA 1KPHA 2YHUA 3HM2A 1QFZA 5B3AA 2XGOA 2PSJA 4LC9A 3HB4X 4TLBA 2I6UA 4TMFA 1V8PA 2CBZA 3GEDA 3BRWA 4GSYA 1E3IA 3K0AB 3RUEA 2WIBA 3DXXA 2R84A 2VBGA 1WUIS 3Q1LA 1QIJA 2LP4Y 2IU6A 2QRVA 1WMDA 2WHPB 1CS0B 5FX2A 4CQLB 1RKXA 4YS6A 3ZDFA 4G0UA 1ZK2A 2B6HA 4X7PA 1RHRA 5FLKA 5C8ZA 2X8JB 1M0SA 2D1SA 1DNPA 4ZICA 5HRAA 3PEWA 1JU3A 1X1RA 2X41A 3O2SB 5LMCA 1F4LA 1XBTA 2W98A 3DO8A 4B0PA 2FQWA 1ONBA 3QTTA 3W5AA 4WPGA 1QF6A 5DT2A 2HF7A 4MR7B 4ZHQA 1OLUB 2HQBA 2JIMA 1MF7A 3IC5A 4C9BA 3EGIA 3H2BA 4FZ5A 3DEAA 5TPZD 4CL0A 1Y3IA 5CDTA 2CNWD 4YAWA 3UAXA 1XZFA 2VH2A 4J0DA 2WSMA 1R3DA 3CUUA 1A4RA 2ZKIA 4H7DA 1G38A 4C0AC 2PL9A 5HS6A 3MERA 3N0WA 4AJEA 5A06A 4YAEA 5KC9A 5TF4A 3A25A 4XD7D 1M1NA 4P0QB 4X92A 4X8HA 5I7EA 2P2LA 4KLNA 3UAZA 5BN1A 3HVUA 5H4HA 5JDIA 3QTLA 4PXAA 2DBYA 1U98A 2JHPA 3HUEA 3CEHA 5CFQA 3I01M 2DLCX 1N3IA 2C4KA 2EZTA 2FZLA 1JHOA 2NXEA 2W9XA 1E0SA 4ZCMA 3T4UA 1I80A 4PX3A 5FWXA 1PJTA 1CUVA 3QENA 1A50B 2W0MA 2P35A 5ITZA 2XMPA 3PA8A 1DEKA 3JY6A 3UJBA 5LVAA 4ZXPA 1WL8A 2AWNA 3JD2A 3PE6A 3T9BA 4DLSA 2HJWA 5C5EA 3QKIA 3BXXA 1QU2A 1B0UA 1PEDA 3GJTA 4AN0A 5ALDA 2YJNA 1J9EA 1GTRA 1PR6A 2IHKA 4I9UA 4DNQA 5C8YA 1DEXA 4F4DA 2ZVPX 2HXYA 1G21B 3C45A 4FZRA 4BAUA 1GAXA 5L3QA 2XOKA 3JYOA 5G4KA 4BPRA 3OBIA 5I7VA 1WWKA 3K2IA 1Y6FA 4HXEB 5EXDA 3ZXIA 4OHRA 3F6PA 4QWMA 1JFTA 2JJ2A 5E3JA 3TZCA 2E4ZA 1XRQA 3E2IA 5CFZA 4YIHA 1N9GA 5DIFA 4DMRA 2BAGA 4LJ6A 3GLHE 1YUMA 2J32A 2QRHA 3ICVA 4UFOA 4WY2A 5CYFA 3R3JA 1AMOA 2XMQA 5J23A 2JGDA 4ZC8A 4L6IA 5IVDA 5FA8A 4Y6LA 5LKRA 4DTIA 4OQZA 4OJMX 1SUCA 1XNJA 4KKVA 4WCFB 5CA0A 3ZBUA 5IANA 3NAZA 2PMBA 5FHQA 2Y93A 4G0MA 3PNYA 1K7CA 1LTHR 4Q4JB 1H4QA 4XCVA 3ZHBA 3GYGA 1BHJA 1EAYA 4OJQA 1VGVA 4XFJA 1NSTA 3WXMA 3FA2A 5D85A 4WZ6A 2D7JA 3RTAA 5BQFA 2NP7A 4Z49A 4GI7A 4XDYA 3KHUA 1US8A 4H7PA 4R9VA 1XMXA 2BT4A 3P4XA 1SQ6A 4RY0A 1WZ2A 3FOCA 1Y80A 2PRSA 3IMGA 5D1HA 3HY6A 1EFRA 3X43A 1JFFA 1YJCA 3S40A 4DV2B 4J75A 4K6OA 1DRWA 5CTAA 1M5TA 4KYTA 4EL0A 4KQ2A 3RAFC 1ZONA 3DYIA 2IQ5A 2JA2A 2G17A 4CEHA 1E2LA 2BSAA 3QJGA 1O94C 4IIBA 1WMAA 2QSZA 5JWRA 3FYUA 2GEBA 4WUTA 5CT5A 3VKHA 4Y3UA 1JNXX 3M7IA 3VDNB 4BJ1A 4C04A 3BJZA 3I9LA 3K0FB 4CMAA 5CLFA 3S27A 5B7QA 4X6XA 5FPSA 1ZU4A 4XGRA 2Z8YM 5BN5A 4J2TA 4AUKA 2VAVA 3GBPA 5DT9A 2IDJA 4W5NA 1DIHA 2BI8A 3PWSA 2K7ZA 2OCPA 4RTJA 2OENG 1AC5A 3GARA 1WZNA 1F51E 1PDOA 3EYWA 4P2BA 4ESEA 2RGNC 4FD3A 4KQJA 4RVNA 3JAWA 3RF7A 5IBCA 1W36B 4ZOLF 5JXIA 1JTEA 3RS0A 4OHZA 3UOAB 1FMFA 3BKXA 1OW3B 5KU1A 1V11B 3BM5A 4LHYA 5HFNA 1WMFA 5A04A 2PT6A 3K2BA 4MCJA 1GAWA 1X7XA 3AKYA 3LS2A 3WNBA 4PXYA 5M7EA 1JG4A 1B15A 1JIUA 2OPHA 3ZE2B 1B42A 1SGWA 1ZVVA 1RHQA 2KJQA 3WRXA 4BFCA 4JSRA 2CNLA 4EJSC 1KHHA 2OFXA 3LP6A 4ID9A 3HDTA 4MKGA 2GJSA 1H1TA 4REOA 4X3OA 5IAGA 3KETA 1K7SN 4CETA 4ICIA 2P9EA 1A9SA 5JS1A 4ZCTA 2XCUA 1AZLA 5E2AA 4FT4A 1EESA 4IOLA 1N57A 3MBOA 1LRLA 3TN7A 1DMRA 4NLLA 2IYRA 4DFDA 1UMDA 4E5PA 1I7SB 4BO9A 2Q6OA 4UBMA 5IKOA 3I5MA 4KYUA 1FFEA 3UNXA 1XOIA 3H5WA 5B2ZA 1OUMA 1QGYA 2VP3A 4IOMA 1A7UA 2J3QA 2A5GA 3H9JA 4U3JA 4PM4A 3UGTA 2O7NA 3UT6A 4AX4A 1QWSA 5TS3A 1PFUA 2Q8QA 2QN7A 3F49S 3F7MA 1UK6A 2H5IA 2ZVQX 4R2WA 2H8KA 4KSBA 3G1TA 3LNCA 5JBNA 2X58A 4YJ3F 3Q7RA 3QLTA 1QBKC 4HEHA 4D9IA 4GWGA 1II8A 4HV4A 1EZ4A 3TLXA 4OKSA 2B78A 1SXGA 5L7YA 5AUQA 3D59A 3CINA 2P8JA 1SVOA 2CE2X 1C3VA 3CWZA 1UKAA 4QOSA 5CVEA 4YP1A 5K51A 2XOKD 4DY4A 3D3QA 4EGQA 5HZMA 4IJUA 3RT7A 5AW1A 4JYZA 1OXBB 1WMSA 3IUMA 3UMJA 5BWBA 4S1VA 4ZYVA 3WQHA 4XIFA 3TCXB 5J4LA 4UU0A 5MF6A 4GF5A 3EWSA 3GCDA 3PF8A 4LF5B 1G8SA 1KZGB 1P4JA 2AE1A 1BS9A 3EZYA 3B48A 4PGHA 1WEKA 2RGYA 3R7BA 5I48A 1W5SA 4D8TA 3S7TA 3KKZA 4L4SA 4ZAVA 3EH1A 4R1NA 2PU5A 3ESQA 4M87A 2O1XA 3UEOA 3M9WA 3RSZA 2BF7A 3W3AA 1A8QA 3GMSA 3SWWA 3VUEA 2PIAA 2V5AA 2ZRAA 3C8MA 3KHSA 4JBHA 4M6WA 4MGYR 5GM1A 4BQRA 2DPYA 4U7JA 1NUSA 5LXTA 1MC4A 4V0MA 5F4ZA 1PL0A 1XD2A 1P9WA 1ITZA 2WPDD 4F1JA 2PJRA 2VT6A 3OIGA 4CLOA 3JWJA 4QYWA 3AF4A 1FFXA 1HFEL 5TJHA 1NBOA 4AK9A 4IS2A 2TECE 1LS6A 3LUFA 3R09A 1NSFA 1R4NA 1DHTA 4FX5A 1SN7A 5C80A 5KINB 4Q3EA 3U7HB 2LGJA 3QUBA 2A1UA 4Q6BA 3R7AA 2GNAA 2I6QA 3SE7A 1H1DA 3R5HA 1HFWA 1EQ2A 2IUEA 3BGDA 4I5GA 4LXTA 4M9QA 4NRDA 1I2AA 1GNLA 2I4LA 3QGMA 4B2YA 1X7ZB 2CLLB 2XWBF 2PEZA 3C41J 4JBIA 1LBIA 3GB9A 3IOYA 1F06A 1PNRA 1TYCA 4P3PA 3A6KA 4MMZB 1IY0A 3K4HA 4FE7A 1NOJA 4WZBB 1GR1A 2CCGA 3QPCA 2GPTA 2XQIA 2G5TA 2P6OA 3UKOA 3L41A 2C77A 3H9QA 4OQQA 3B9BA 5AK4A 5M3BA 3TX6A 3WICA 1GPYA 4F84A 2NV6A 5JMTA 4ESVA 2ZWVA 2UYQA 3BQ9A 4LK2A 2BZSA 1GZDA 1GG5A 1OASA 1YIDA 2H07A 2OP1A 2VNKA 1ZWLA 1LF0A 5LZ5A 4YT4A 4MV5A 3C5HA 1Z28A 3R7FA 3QRWA 4RU1A 2IPMA 1P0FA 5K0JA 1QC5B 4IFIA 2XX3A 4CM4A 4MGHA 1LWOA 4R2HA 3DHNA 5I5EA 3OCVA 3KOWA 4TTTS 1BQ4A 2VCEA 4JB2A 4TS3A 5TB5A 5LN1A 1SUAA 2BR3A 4BNYA 2ZDGA 5KKAA 3RSFA 3ZVKA 2NAPA 1C3LA 1JT2A 1SC4A 3PVSA 2W6PA 3TECE 2RMKA 1CJCA 1YNOA 2G9ZA 3V97A 16PKA 1FTWA 3WMEA 2Q3DA 3DFZA 3K1TA 2IXFA 1E96A 2C2BA 1SHLA 3QP9A 2JLBA 4L2IA 5J5VA 4E94A 2CL6X 2VA8A 3SJ7A 4BVHA 1GUBA 3X1YA 2X9GA 3I37X 1QYCA 3AW9A 1CUEA 4JMPA 4NNJA 1YJ5A 1E1NA 2VSYA 3NCTA 5K7SA 4ZVMA 5F9MA 1KGSA 1O3YA 3W4JA 1HFJA 3BSFA 1BU5A 1U8ZA 4WH0A 2NUTA 1IZ8A 5K2OA 5F9HA 2IUTA 4EPTA 2J1LA 3L8YA 5AW4A 1VI2A 1G20E 2Q6TA 3KZCA 4GYKA 1G5RA 1T36A 5DBHX 4HX9A 5E8JA 1WSAA 4G8BA 4C88A 3K70C 3CH7A 1NMYA 1R0CA 3BXOA 4JELA 1TJ5A 5F9FA 3EULA 4ZZIA 4RK5A 2JANA 4LYDA 3GW8A 2BRUA 1K92A 4DDMA 2V7VA 4TS9A 4MWTA 5G3YA 2ZXUA 3G82C 2JGRA 5B1IA 1SVWA 3VU0A 2EFYA 1FP4B 1QJCA 2ZZKA 3T3PB 4D6YA 1WVIA 3D8BA 3NBAA 1SCDA 3DVRX 1XHEA 2OO3A 3AUAA 4L5JA 1V8DA 4EGAA 1S8FA 5IVHA 1DAKA 2XMZA 3B3JA 2I78A 4ZO8A 5FBVB 2H48A 3ZTYA 4D0NA 3SVTA 5L4NA 2I4NA 2ZRBA 1VKJA 4GS5A 4YLEA 5B6PA 3LOUA 3I2KA 2WAXA 5KNCD 3O8RA 1FXUA 2H65A 3PNOA 4DMCA 1Z17A 4IHAA 2RBEA 3Q8MA 2GK6A 3E9QA 4H9GA 3VH1A 1JDJA 2Q8PA 3I6BA 4HAVA 4HAYA 4S35A 4F2HA 2J0VA 2XV1A 3S2EA 2H7CA 5LJIA 1LLCA 4DIDA 3UXMA 2AF3C 3CR3C 3H9CA 3PUJA 1VPLA 4QTTB 3D2BA 4CMHA 2V7PA 1NVFA 4G8JA 5ECDA 3TTVA 4B85A 1WHTA 1A95A 4IW3B 4PTZA 1HEYA 4ZYYA 3RWMB 1YFKA 1OBOA 5J4KA 4KE7A 2P5TB 3WMGA 3TVTA 2HQSA 2OD9A 2A59A 2A1TS 2OCBA 1LNSA 3GRKA 4KV9A 4PZUA 1JP7A 2EIXA 4ZVUA 1XXHA 2G76A 2WAYA 2QRNA 3LXMA 4BO0A 1HMYA 4Y98A 1SZDA 2QL6A 5COBA 4AN1A 2D1TA 1TCUA 2YOFA 4FR2A 5ULLA 4AU1A 1IHPA 4QVIA 2QX6A 4S04A 4RCVA 1RWPA 3LO8A 2PRKA 5KC8A 5F4BA 1GGMA 2I62A 2OK7A 4EB8A 5E2BA 1FLAA 3GK3A 4WY5A 1U0OC 3A1VA 1A2KC 1ZXBA 3A70A 2JKZA 3O7MA 5AK6A 5AHOA 4X94A 2LPMA 1VL6A 2W2LD 1NAHA 3CY6A 3H8JA 1L1RA 5DP2A 5EKUA 4D9BA 4RPJA 1D1SA 1UR5A 4EZBA 1OXXK 5B7GA 4FBGA 4MWCA 2X0FA 1RHMA 3BH6A 2IE0A 3K6KA 1DV2A 4FCCA 5SZHB 4M7PA 2FMHA 3GLKA 1U0JA 2OTCA 3D7NA 2O14A 4EG4A 3PXBA 3NKLA 3AHIA 3OSZA 1GQYA 1AGRA 4IJ6A 4ZU3A 1OV6A 1OX4B 2V5VA 1ONPA 4I1RA 5AJXA 2OHVA 4IH9A 5FPYA 1ZICA 1DUSA 4AZ0A 2UZ1B 2ID9A 2V8OA 4LWZA 1Y6QA 1E4EB 1NV9A 3HU3A 1G2QA 4HK4A 4B3BA 4B82A 4M22A 5C52B 2IELA 2OUKA 3NX4A 4UNPA 4B74A 2VP0A 2A9PA 1T8UA 3NRBA 3CNLA 4GDMA 1HRDA 3I0ZA 1HNNA 3OQ1A 3QWAA 3BOSA 4YEDA 5DHAA 4WACA 3GLIE 4R9RA 4MS4B 4TV9B 3ZXYA 2JIBA 1Q7CA 2HDWA 1F3OA 4N8EA 3VSCA 2XYRA 3NHUA 1DCFA 1FFBA 1QCCA 5AJHA 1U3FA 2Q7OE 3ZPXA 4DQVA 1PWZA 3TPZA 3PHHA 3UPUA 4ALLA 1EG2A 4Q19A 1P75A 1C30B 2XVXA 1C80A 2WD8A 2WU3A 3SPXA 1B16A 1S2OA 2P2SA 1JVBA 4N39A 2XQFA 5DHTA 3L0CA 3IAS6 2QTWB 1Q7TA 3ESCA 4FFMA 5THKA 1RJDA 4DLVA 5TNXA 4QGHA 1Y7PA 3H99A 3S2FA 5G53C 1JQJC 5JTUA 2PZEA 1XN4A 4NTZA 3R3SA 4Q01A 5ISMA 4YPFA 4KQ1A 4O59O 2VTEA 4LF7B 3IR5A 4I7EA 1L7AA 1TAQA 4Q4LA 5ALOA 1DV1A 2O0JA 4KSCA 3VPCA 4BTVA 3WWYA 5HKBA 1HOXA 4RLFA 4OLFA 3SYNA 4XVUA 1RRMA 4HZIA 2EFHB 1NQXA 1TZKA 5ALXA 4F92B 1FRQA 5GGXA 3DZIA 4KIUA 2EC5A 4D4KA 5HWSA 4EHHA 5KOIA