3BX1A

Complex between the barley alpha-amylase/subtilisin inhibitor and the subtilisin savinase
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
269
structure length
269
Chain Sequence
b'AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAATR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Subtilisin Savinase
publication title Structural and Mutational Analyses of the Interaction between the Barley alpha-Amylase/Subtilisin Inhibitor and the Subtilisin Savinase Reveal a Novel Mode of Inhibition
pubmed doi rcsb
source organism Bacillus lentus
molecule tags Hydrolase/hydrolase inhibitor
total genus 94
structure length 269
sequence length 269
chains with identical sequence B
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2008-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3bx1A00
1AQNA 1SIBE 4DWWA 3VHQA 1Y1KE 4CFYA 3DE7X 5ARCA 3GCXA 1CSEE 3D9QX 3A3PA 2WWTA 1Y3CE 3CO0S 4FONA 3CNQS 3D43A 1Q5PA 5ARBA 1BH6A 1TM5E 5B1DA 1EA7A 4H6XA 1SCDA 4NE9A 2XTJA 3EDYA 3GT4A 1V5IA 2Z2ZA 2HPZA 2Z56A 3TI9A 1P7WA 1BJRE 3PTLA 2HD4A 2E1PA 1BFUA 1AK9A 3WQBA 1S02A 3VV2A 1SPBS 1AF4A 1SBTA 4YN3A 4HVLA 2IXTA 2PYZA 3P5BA 3ZXXA 4H6VA 3F7OA 2V8BA 5FBZA 3Q5GA 2PMWB 1WMEA 2W2QA 2PWAA 3TI7A 3WHIA 1PFGA 3DYBA 5SICE 1T1EA 3ZXYA 1DUIA 4B5LA 1Y3DE 4K8RB 1GTJ1 4ZOQI 2Z30A 3WIVA 1T1IA 3F7MA 3GCWA 1SVNA 1Y3BE 2DQKA 1LW6E 1AVTA 1ST2A 2ST1A 1R6VA 3I30X 5AVJA 4KPGA 3VV3A 1SUEA 1GT91 4JP8A 3OSZA 5FFNA 1SCBA 1KDYA 1Y3FE 3DW1X 1OYVA 5I9SA 4LVNA 4BWGA 1YJCA 3QTLA 1SBNE 5JXJA 1SCNE 1SIOA 2SECE 5JXGA 2Z57A 3I34X 4RYDA 3DE3X 1YJAA 1GA6A 2W2PA 1ST3A 4DZTA 3A3NA 3T41A 1TM3E 1C9JA 3DVQX 3BX1A 4C3VA 2W2MA 1SBIA 1GNSA 1Y48E 2ZWOA 3TECE 4Z2AA 1PEKE 1UBNA 3DE0X 1AV7A 1V6CA 1GNVA 1P8JA 1SELA 1SUAA 5ARDA 3DVSX 1SUBA 5AVKA 2TECE 1MEEA 1SBCA 1SUPA 4ZARA 3I2YX 1THMA 1ZVKA 1BE6A 1NDQA 5AQEA 2SBTA 1BE8A 3DE1X 3DWEX 3AJ8A 4MZDA 4WOCA 1R0RE 1NDUA 3VTAA 3AFGA 2WV7A 4HX2A 3BGOS 3WIUA 2GKOA 2DUJA 3EIFA 1TM1E 2Z2YA 1IC6A 2ZRQA 1XF1A 2ID8A 4AKTA 5K7SA 1TM7E 3LPAA 1GA4A 2P4EA 1Y33E 2WUWE 2ID4A 5B1EA 3F49S 2X8JA 1PTKA 3DE5X 3DE2X 4KB5A 4M1ZA 2SNIE 3LPCA 1DBIA 1YU6A 3VSBA 4CG0A 1S01A 4GI3A 3VYVA 1TM4E 1NLUA 3HJRA 1A2QA 3DW3X 3A3OA 1GTL1 1C3LA 4CFZA 3L1KA 2XRMA 2PRKA 3LXUX 1OT5A 1AU9A 3DE6X 1GTG1 4H6WA 2B6NA 2DP4E 1SUCA 3SQOA 4C3UA 3DDZX 3BPSA 3GT3A 1KE1A 5CW1A 1SIUA 1Y4AE 2PQ2A 1SCAA 3H42B 1SUDA 3AJ9A 1SCJA 1S2NA 1OYOA 4NMXB 4AKSA 1SN7A 3DE4X 3QFHA 4I0WB 3UNXA 4OMCA 1TO2E 4OMDA 1WMFA 1C9NA 3LPDA 3EE6A 1EGQA 4DJ5X 2W2OA 1Y9ZA 2Z2XA 1VSBA 1KE2A 1P7VA 3PRKE 1C9MA 2QTWB 1IAVA 3DVRX 1GA1A 1R64A 2PKCA 1MPTA 1AH2A 3Q40A 1WMDA 4LVOA 1WSDA 2ZWPA 1TK2A 4WOBA 2SICE 2W2NA 4OV6B 2IY9A 2WUVA 5JMOA 4J94A 5AMXA 1BFKA 1KDZA 1SBHA 2G4VA 1Y4DE 5JXHA 1PJ8A 5FAXA 1YJBA 4NE7A 3QMPA 1TMGE 3I37X 1TO1E 1CNMA 1ZVJA 5JXIA 1T1GA 2PWBA 3SICE 1SH7A 1TECE 4KG7A 1WVMA 1KDVA 2Z58A 1Y34E 1GCIA 2X8JB 1JEAA 1HT3A
chains in the Genus database with same CATH superfamily
2GJ8A 3QE4A 2BFCA 4MV5A 1PYDA 1Z4PX 4C87A 1USWA 4FEAA 4WACA 4BDSA 4DR2B 1PEYA 4D25A 2F9MA 1G8PA 1P4AA 3S8YA 4LOAA 3IB6A 3OCUA 2JI8A 1JQ5A 1SQ0A 4LRTB 1L7MA 1X1QA 4C0WA 1AS0A 1YNOA 3L79A 1PT7A 4IH1A 7GPBA 4MHTA 5IJ9A 1IM2A 2NU9B 5L3QB 2SHKA 3CZ4A 2QEQA 4PS0A 4HNUA 1SGWA 3LQ1A 3EZ6A 4MW1A 2BT4A 2QR5A 3CUYA 1P18A 3MBOA 4RDIA 4B2LA 4L6AA 3OIGA 2WU0A 2BKUA 3LHIA 1YBAA 1SD2A 3P0RA 4BCDA 2EFJA 2GZRA 4OJNA 3TXYA 7ABPA 1CSEE 5JRDS 3X1XA 2R5WA 4UPVA 2ODAA 3NWJA 3WGYA 4D4HA 1CW2B 4UM9D 4WZZA 1WCV1 4CM3A 2RK4A 1V7QA 3BWEA 5BMVA 3O8LA 4L9WA 5IWCA 3F1LA 2ZM6B 1KI4A 2DMRA 2FCAA 4FN4A 3UMJA 1NUQA 4BFWA 4MKIA 4QYTA 4YCLA 2DCMA 4C76A 4BYGA 2BISA 1TTPB 3K7EA 4C0KA 1JWLA 3BCUA 1MAVA 4ID9A 4TV9F 1RKVA 4ZAWA 3T9FA 3I1IA 4K46A 1HFWA 4I1IA 1Q83A 3PBKA 2Y93A 4H7KA 1KYQA 3OF5A 4I55A 3SVLA 2QRHA 2YHIA 3PIIA 4WXHA 3QV1A 3GAAA 4LF9B 4W7IA 3WXBA 2WAXA 3K2BA 3PFNA 3AFMA 4QQRA 2OENG 1TIKA 1VYUA 1YZVA 4F5ZA 1Y3HA 2BE7A 3FBGA 3MINA 1T0UA 3CLHA 4X92A 3TVDA 1F5SA 2ZTLA 2WD9A 3BHMA 1A27A 1PJ4A 2ID9A 1T2EA 3OI7A 3ASUA 1NQAO 5EJEA 2B4AA 5EXPA 3VC7A 3GI1A 5IBQA 1T9GS 4PAMA 4PAWA 1SZPA 2XB8A 3G8CA 2RI0A 2HSZA 1JE0A 1PK7A 4IOKA 3HE3A 1R15A 4BO7A 1UPAA 2TSYB 5U9CA 2J5KA 5AXAA 1K8RA 4JJIA 3VPBA 1NUPA 2WAAA 3H9UA 4HVTA 4A82A 5DNYB 2WM3A 3GBVA 3I52A 4JODA 3IAXA 4EVRA 1SPBS 3ENNA 3JZFA 3RRXA 4D56A 2IBMA 2PMFA 1MV8A 1OKKA 2PYZA 4GNKA 5CB6A 2B4YA 4GF5A 3E0XA 3TZKA 1ODKA 3MM4A 2ALJA 4PRKA 1CUFA 1I4EB 4ZU1X 2JCVA 1RTTA 1VSTA 4BTEA 1SC4A 1UK7A 1YCFA 4HAWA 3BGSA 5BUZA 2XEXA 2B4KA 1IWOA 1EHIA 4EJ0A 1QV6A 3MERA 3MJTA 5AJHA 1URPA 4QUKA 4DXDA 1T6YA 2I8LA 2XTMA 5ADWA 4LFCB 1VJCA 2DFPA 4LS3A 1CERA 2XMPA 1B0AA 3M82A 2OCKA 4RHXA 5DF1A 5DM60 5C8DA 5I3ZA 4KC0A 5FNZA 3CJRA 3TQQA 2H85A 4MV4A 4M1SA 1W9MA 1DADA 4ZO6A 5TDHA 3DCJA 1RQNA 3WHIA 3VR2A 3K0HA 4DA7A 3H84A 4IO0A 4IV0A 1T1EA 3IE0A 4PF1A 1JE1A 2P41A 1G9TA 3IBTA 2ZAMA 3GGCA 4IJQA 4K26A 2GWHA 4J76A 4MEJA 3FZGA 3WB0A 4GBED 3MXOA 1V43A 2M6KA 4L27A 1QRDA 3NH9A 5K0EA 1BGWA 1LVUA 4MWGA 2GFIA 1IZ8A 1G5FA 3H5WA 4RX1A 3SBDA 3VGJA 4CLHA 1NJ8A 2A5GA 3NTOA 3GJ3A 3QU4A 1M75A 2HF8A 1QXSA 3SLGA 5EKDA 1DHTA 1F2TA 3B9PA 4RTOA 2GN2A 2JA2A 5EE5B 3LWNA 2JLAA 1DWQA 1MR3F 3TH5A 5AJWA 5AKLA 2RIRA 1NYRA 4JQOA 4M38A 1LPAB 2RCYA 2X4GA 1VBNA 1X38A 2Y1EA 2GZAA 3LCMA 2Q5EA 2AI1A 2WTMA 1QTRA 3MTEA 3SZLA 1R6VA 3WBKA 2OL4A 3I30X 5JADA 2C8LA 1WUHS 4AYTA 4GI7A 1WSAA 1LQ2A 4G1VA 3C3CA 1L1EA 1SG0A 2QZSA 3GZNA 1R12A 1E77A 3IH5A 5B4VA 2BM9A 4JP8A 1KDRA 1Y82A 3B9QA 3MT7A 5CLHA 5ENDA 4X6LA 4N6GA 2GT1A 3LY8A 4MR8A 4BGUA 1SU7A 5HF5A 1MOQA 1FDWA 1ZICA 2ZIAA 4YJHA 4BLWA 4CIWA 1U5BB 5GZ1A 5HGXA 2F2TA 2EYQA 4HQ6A 4EPRA 2NSHA 5H59A 1GRCA 4R2MA 4E21A 3EPPA 3CG4A 1LI7A 5BXYA 1OYVA 3ESXA 1EQUA 1OWOA 1XZQA 1ZK1A 3SMQA 1XTTA 1KAOA 2J5XA 4DIOA 4PLHA 4K9MA 2VF4X 4KN8A 4FQ5A 5EQFA 2AFHA 2GJSA 1NT2A 3IMCA 4H3VA 1M1ZA 5AO9A 4PCAA 4PY2A 5F9FA 5CT5A 3KLPX 1JH8A 2VBGA 4OUKX 2IK8A 2H1VA 2JBAA 1P31A 3I34X 1KGDA 3KT6A 3WX0A 4WUTA 3DOFA 5E4FA 4N9WA 1N2CE 3N0WA 5JO9A 5GAJA 3N05A 1R18A 4D8TA 1KH1A 4XUEA 3LQRA 4MQ5A 3LZ6A 4UATA 4CMIB 4DBLC 5KJ6A 3A3NA 3EODA 2ZS7A 5TVKA 4MI3A 3PPWA 4KREA 1RS0A 4R2JA 3GEMA 8ABPA 2QJOA 4F4HA 4AB1A 3IIIA 4DRYA 2PRIA 4K9NA 2EKZA 1I30A 3M49A 1SOVA 4ITVA 4CTJA 4GL2A 1OT3A 1QG6A 2WUFA 4BWYA 4YP7A 1GPH1 1T5DX 4DQ0A 1XZLA 2I0FA 3UA4A 1YF3A 5FBLB 3LHDA 3CLVA 5JRJA 3U5TA 3UMSA 4X66B 3PE6A 3TUJC 4TTSA 4X95A 2PGAA 2WTEA 1E64A 4KN9S 4Y2QA 3OLCX 1UBNA 5DNWA 3J7AC 1BE0A 1ANKA 4IBOA 3ZG6A 3P0FA 3DJYA 1N6PA 2ESRA 2LNDA 4F12A 1H6DA 2WTXA 4GXRA 4DA0A 4EG8A 3C97A 1EE1A 2QENA 2WM2A 4I4LA 3HDHA 1GZDA 1T6XA 4GYYA 2WYIA 4HLQB 3IOMA 1SHLA 3DUFA 5AW3A 3DMTC 1KEEA 2XCQA 1YVDA 3O92A 1K6EA 1XCOA 1OBCA 2GCOA 4US2R 3ST7A 1DU4A 3CLUD 3QUQA 1E1YA 4PG5A 1MEEA 3EOAI 2QMQA 2WKSA 4EW6A 1FPMA 3DCYA 4HX9A 4AYWA 3F47A 4ZI7A 4NYMQ 4B6JA 5H80A 2ODTX 1NF9A 2FZWA 4NCNA 3M1AA 3QEKA 4J0HA 3JZDA 5IAJA 4B8ZA 4R1UA 2HO4A 4DAEA 5ALNA 5EFOA 1Y37A 4JR1A 4X6UA 1S96A 2GPTA 5BRJA 1X7YA 3Q2OA 3WL5A 5DWVA 4JI0B 5DHPA 4I6GA 4P32A 1MOPA 2I80A 4JXZA 3V1NA 2E4VA 4HVCA 4JNKA 4DLRA 3DDUA 4IZIA 4GAEA 3R7SA 4GGPA 4QHTA 1DBVO 1NV8A 3DF7A 3V4SA 1J25A 1TTHA 1C7ZA 2O3UA 1ULZA 3FW1A 3IBGA 3O9MA 3OZ7A 1NI4A 2BEUB 3IELA 3LBFA 3SDBA 3MBIA 3CG0A 3QVOA 4MUFA 2MSEB 1V9LA 1E8MA 2FSIA 4KXUA 2R3SA 3OTQA 4TKZA 4DSOA 1PHPA 3ET4A 2REOA 3OLWA 4BQRA 3R7FA 2O7SA 3AJ8A 2QYTA 2QMUA 4LWPA 4MPDA 3HP4A 5COAA 4KLNA 4H7JA 4FR2A 4MYCA 2QU8A 2Q7OE 3F73A 4QDUA 4R9RA 5BMVF 4GKBA 3B1YA 1M1YB 5KHAA 5L7TA 2B4RO 2JZCA 1KOGA 3MTJA 1NDUA 3LKZA 1JIUA 2PXHA 1N9KA 4G5YA 2XE8A 1C8VB 1EP1B 2PZJA 3EXEB 4XWWA 1R6DA 5ALZA 2IYXA 1GL9B 1M34A 4R2WA 4R2XA 5A05A 1PFQA 1XU4A 3HB7A 1Z13A 3BGOS 1J9GA 2QPLA 4I55F 2AF4C 1O94D 4O2BA 2Q3JA 3VZRA 2ECFA 4L5JA 1HT2E 5EQDA 4D3DA 1Y8QB 3LO5A 1F2UB 2NP6A 5K8UA 1YB1A 2HCJB 2ZRNA 2GSDA 3WGUA 5ALVA 2DBYA 3FDXA 3RHSA 4OGKA 2C4MA 3A7EA 1H1LA 1EFLA 3TQIA 4B7CA 3H0EA 4KODA 5MGNA 4Q3KA 3FMIA 3WYEA 3P2OA 4AMYA 3ZI4A 1AK1A 3NBKA 1TD9A 1Z8HA 4W82A 1OR8A 5AKJA 5HG0A 4Z0HO 5B58T 3RK0A 3TZCA 3VR1A 4EQ6B 5ADVA 3O83A 4YECA 4XX0B 2XBUA 4ZYLA 2PWZA 1Y3IA 3QW4B 1G3RA 4E7OA 4DNOA 5A0VA 1JP7A 3D6MA 2IE8A 3U26A 2WI8A 1QHYA 3QXHA 1I7QB 1DBPA 1MO3A 4BNHA 3G3EA 3CEHA 4ABYA 4R69A 2PEYA 3Q2IA 3RVQA 5FBQB 5HIMA 4JASB 5KOHA 4DLSA 4YB8A 1J2TA 2VTDA 2MCFA 3QBJA 1WNTA 4B46A 3ZDEA 1UKCA 3TK1A 1RC1A 4UBMA 3A9CA 5ALIA 1EWTA 3KYDB 3X43A 4FB4A 3ANSA 5K8LA 5JLJA 3PC8A 2O3SA 4DDUA 2IA5A 4HNTA 1LTHR 3AEKB 4PE5B 2O14A 4DAOA 1KYVA 4NENA 5FWAA 3EIXA 5CG2A 1D2HA 7ADHA 1E5DA 3KE8A 2J7PA 3NKLA 3VZCA 3WWZA 5KAMA 1SXJE 1PW5A 3G8YA 4RSHA 4E09A 4JX9A 3ZH9B 1RPZA 1NLUA 2GRUA 3SXUB 2VQDA 4BGDA 4J7XA 5JD5A 2A14A 3M9LA 5TGZA 3HYCA 3UOAB 4RXUA 5FA5A 4HLUA 2IYWA 3PQ8A 4ID3A 4DDWA 3AY6A 1CZNA 5HBGA 3VRHA 2W11A 3KFXA 3KUUA 2O0LA 2QF7A 3LDGA 2N1BA 3VPSA 2AE2A 2QYOA 4BWFB 1T2CA 3CONA 2AFVA 1U2RA 5AXDA 1ISJA 2B8WA 4UOEA 1H2BA 5AW2A 1AIPA 3DKKA 3G2HA 3OEYA 2V6BA 2DT8A 4KSBA 2Y1XA 2YY6A 4NBRA 2HMYB 3AF6A 3AUAA 4IXWA 3UAWA 5LQAA 2Z1NA 3EFOB 4D9EA 3OKPA 3UPDA 2DQZA 3WGMA 1TYAE 5FCDA 3W2FA 3VM6A 2IS6A 5DXJA 3A1DA 2YOHA 4B75A 1M2NA 4CF3A 2OCIA 1FP7A 3HK2A 1XNGA 2ERCA 1XCJA 2ZE7A 4GZ6A 2YS6A 4NMHA 5L7YA 3FIUA 4ZICA 5CW1A 3S8EA 1TEVA 4N4AA 2C2KA 2C82A 2PQ2A 3R7WB 4CKCB 3S1SA 2O8EA 3AR4A 2QRZA 1NBOA 2VQ6A 3WV5A 5D5PA 1ULSA 1YO6A 1S5PA 3L7JA 3VUEA 2PFSA 3R9KA 4AX8A 1OKKD 1ISRA 2QUHA 4X44A 4OMCA 3QQ5A 1Q0UA 2OZLB 3EVNA 4YMUA 4I9GA 2V6IA 4S1TA 4CBVA 1I2CA 4N40A 2Z83A 1NBWB 1YFLA 3HABA 2XHZA 1ISHA 4H0FA 4S0ZA 4ZREA 3D5QA 3CRNA 2AOUA 3RGGA 2D7DA 1I13A 4PZEA 3KPVA 4UVEA 4UNIA 1DNPA 2Z2XA 3AZPA 2CVQA 4F7DA 2ORVA 5I4KA 3U17A 4IW3B 2ZSBA 1X7DA 3Q8WA 4RKRA 2GEKA 1NXQA 1C9MA 1KZ7B 1JECA 5EP1A 2JJ1D 3SJBA 2DPGA 3GEIA 3AFOA 3JQ8A 3GEHA 3VR2D 4NCKA 2C4HA 3ETHA 3DS8A 2QN2A 5JYDA 1LRKA 3CS3A 4IDQA 4REQB 4E5DA 3IP9A 1SHTX 3EEQA 4LXIA 3B6JA 4M88A 3P0IA 1BSVA 1NW5A 1O97D 1NSYA 1QQ5A 1SG6A 2ZTUA 3I9NA 2HQBA 2OQ2A 4FZRA 4WOBA 4BTLA 1FBNA 2OBYA 5FBRB 2YUIA 3OG9A 4P7KA 4LOHA 5K2MA 4EYEA 6CHYA 5HJ5A 4PX2A 2HIHA 5HJ7A 1H2RS 4MGKR 1EWVA 3VPXA 4BVEA 5DRYA 1VJRA 3ESZA 5KMGB 1L7XA 1J56A 3BXOA 1S1CA 3L0DA 3SHOA 1X15A 4AECA 3EEFA 3B70A 3I45A 2VT6A 3ILVA 1RI5A 2J0UA 3HJTA 3LWDA 2QAIA 3DKRA 4LNHA 4E2WA 3KJEA 3DPUA 3K5PA 1Z63A 4C0AC 3G0DA 4PLZA 5KWVA 3W5DA 1N3IA 1QP4A 4MUAA 3DZCA 5ER9A 1Z2NX 1TO1E 3RSHA 4RKQA 2I65A 2BJVA 4TVOA 4I8XA 1X13A 4Q6WA 4X61A 5IBCA 2ZPUA 4YC7A 4KKXB 3JQRA 2LCQA 1VJTA 4V3CA 3RU2A 1M6HA 4DRXA 3K4QA 1TECE 1U0EA 1ZCBA 1ZJZA 3AHIA 4GSLA 4PC1A 1WVMA 2JLUA 2AWNA 1XF9A 4I66A 4ZI7F 3PFWO 4F56A 2Z58A 5IVDA 4XASA 3UHOA 1AUXA 4N8EA 1NNEA 5DCLA 3NHUA 4H4CA 5AXCA 3NFRA 4QPCA 1F3LA 2ZIUB 4WA8A 3TVTA 5A4MS 1ARZA 3TLJA 3ZIAA 2R7LA 4BKUA 1FMFA 2BSAA 5GTDA 1KVRA 2JFUA 2R25B 3A06A 4RZQA 3KUXA 4CR8A 3PRHA 5ULLA 3VHQA 4S2EA 4F93B 2O2YA 2FWIA 5DTRA 4KXMA 2JDIA 3MRVA 1H3EA 4WXMA 4RV5A 2WJHA 3TF5A 4DS3A 2WDZA 4HEQA 2ZUCA 1PJTA 1NYQA 4NNJA 4A0FA 4CQLA 1PQPA 1UXIA 3CNNA 1JQEA 1SVKA 3EQ9A 3QNWA 1FFEA 1V3QE 3CF2A 1ZMXA 5EXXA 5JAIA 1IUKA 2OM2A 2Q4OA 4E3WA 1FCJA 1L9XA 1W581 1YMQA 3OUZA 3PZRA 4EGFA 4DSAA 5C5IA 2ZIVB 3GLGA 2VJPA 2QGFA 5LP6C 5C46F 3HYSA 1RI4A 4R9UC 1XJCA 1ZXLA 4MUBA 4WH0A 1ZK2A 3I9OA 4WNCA 2FN8A 3ONNA 2VJMA 2DU8A 4P0PB 3STVA 1FYXA 4FFLA 4RZ3A 1G5HA 4X7MA 5H4GA 4H6XA 1NU8A 2QP9X 4O2BF 2DBRA 2ZRPA 3FBTA 3C3JA 5FF9A 1T91A 5LMZA 3H5RA 3NALA 3OQ6A 1CFZA 3Q10A 2BKVA 4HP8A 2FZCA 1G19A 2CW5A 2FPSA 3D2AA 3E7DA 3NHKA 4NE9A 3UFXB 3OTIA 2ZB2A 3IP7A 5SZIA 2VLIA 5JATA 2RGWA 3B6MA 4LXYA 1L4HA 1XZKA 2R9VA 3PC7A 5TQ0A 3ZLBA 1FNSA 1GG8A 2B7BA 3ML1A 1IXYA 1MB0A 3KYJB 4HB3A 1UZNA 3AIIA 2RHDA 3EA5A 5CA0B 3UXYA 4HTAA 3ETCA 2IHTA 1L3IA 3BOSA 3DNPA 1AK9A 2EJUA 1JKJB 4KYVA 4OM7A 2XXAA 4RVOA 3TTTA 1K3TA 3K94A 3O26A 1OXTA 5IARA 4D80A 2EKBA 2ZANA 4NBVA 4R9SA 1UDWA 3V1MA 3CLSC 3RVOA 1FBTA 3FCUB 4LG1A 1ECFA 1MC4A 2IYOA 3RKSA 3ROTA 5BSRA 1OREA 4GXQA 3F71A 4UDOA 2ICAA 5C5CA 2VAWA 3CX3A 3LX4A 3MAAC 5T3UA 1LPSA 4LWOA 4L74A 4MWOA 1RXSA 2B7CA 1PK8A 3AQIA 4JXJA 4B73A 3GLHE 3P97A 1QORA 3ACDA 4GS5A 4AQDA 3IJ5A 3CZQA 5EIBD 2DBVO 4MO9A 1CE8A 3D6FA 2GN4A 3F6SA 4GQBA 4IHKA 5FBZA 1H4SA 1TUBB 4B09A 3KO8A 2NMVA 2PKWA 1M3SA 2ZLBA 5T5QA 1FLVA 1AKQA 2GF2A 1GTMA 1ULTA 3MJHA 1WU7A 1EG7A 2ASEA 2OV8A 3EQ7A 2OHIA 4JXKA 4IS3A 4HNQA 2WF6A 3GNSA 3AVYA 2I9PA 3KB6A 3I62A 1RJDA 3MZ0A 1A77A 5B6IA 3CH6A 4DIBA 2ZJ3A 5J4YA 3C15C 1UK9A 1YBMA 2CB9A 2O1EA 2OHVA 3T52A 4EEXA 3I23A 3AXSA 2CXUA 3IESA 4F96A 4HNGA 3IVXA 3EC2A 4OL9A 3HY4A 3NVMB 2C0CA 5CAEB 3V8PA 3ANLA 3QX9A 1UBOS 3F5FA 2ZBQA 4R84A 3G2JA 5KPJA 2JKVA 5TPZA 3SNKA 5A9RA 3HY6A 3CR7A 3EXIA 5EGSA 3S5JA 4ACBA 1EK0A 1EXNA 2XRZA 2V6FA 1HOTA 1IHXA 2CXPA 1B8UA 1RXCA 2OSBA 3C6XA 3I0NA 2OT3B 2UYOA 3K8ZA 3T5MA 3T9CA 4JR0A 1EVKA 4BQNA 2ZQ5A 1BHO1 1C3EA 2K2QB 2B20A 3JYNA 2UDPA 1DG3A 3B6ZA 3CCCA 4BNVA 3EIQA 4PHTA 4DCCA 4HB2A 1FSZA 1EZ1A 2J3LA 2ZBEA 5D5QA 1O5IA 1MCZA 4PAQA 1EK6A 1HRKA 3BULA 2LVBA 1Q0ZA 2IVZA 2X8LA 1EFKA 4IFEA 2WYHA 2XUPA 3EB9A 4ATNA 4R1MA 4ZMSA 3CGWA 1P75A 1FL9A 1KZ1A 4YJ2B 3SPXA 2ERXA 4X71A 4KQCA 2IXFA 4L6CA 4CDGA 5LWHA 3AOEA 1RKBA 2DBQA 2FZGA 3NDIA 5ETJA 3WA7A 1KDOA 3DT9A 2VK1A 1V2HE 4B3SB 3PKZA 2Z5LA 1IWBB 5IC6A 4RXTA 3KLOA 1GZ5A 2PXCA 1QZTA 2AVDA 3RSZA 2HR1A 1X70A 4A6PA 2V7XA 1B1CA 2PH7A 2J7PD 3OF2A 4HDMB 5AUQA 4OAQA 4ZOLA 5K99A 1DXOA 1G3UA 2Z5VA 3NFYA 3GJ4A 3OT1A 2LGJA 2VRNA 2ZEJA 3MJCA 1XDWA 1P29A 3GGSA 1C29B 1GA6A 4NH0A 3MGCA 4WK0B 3NYRA 2ISCA 4H7FA 1C5KA 4EX6A 1Z22A 5EWJA 5EUMA 1LPMA 4YDHB 5EMJA 3UV7A 5DNCA 1UM9A 1G8FA 1N92A 3BS4A 4MMZB 3HB0A 4M89A 1XXLA 2PG3A 3QVXA 2D59A 2PCJA 3IUJA 4BNNA 4HNHA 2BKXA 4MVCA 2QBYB 4Y3UA 3VR5H 4E7PA 5HMLA 1PX0A 4W1SA 2KX7A 2X22A 4KDFA 4Y9TA 2BY4A 1PWEA 3BIFA 3IT1A 3ORQA 1Q1ZA 4QYWA 2GJKA 4V0LA 2WP8J 4S2UA 4RBNA 4QSHA 1JR6A 2EERA 4LXGA 3FOAA 5IK2A 4AF8A 3DEJA 2D00A 3V9AA 3EAGA 2C4TA 1X94A 2BYTA 2OXTA 1N0HA 2EZ8A 3K0EA 1MQAA 4ZZ3A 4MCHA 4C43A 4OXYA 1VCHA 3VKUA 3H1FA 1O95A 4QJBA 3QPDA 4ZVQA 2PUWA 2I4RA 2I6QA 2GLXA 3OZIA 3EA0A 1SG9A 3DDOA 1R4AA 1YUNA 3IVAA 1IBCA 2B1JA 1P39A 2CCJA 2ZULA 3OIFA 4MYSA 1OAOC 3M5WA 4MVJM 4M8LA 3Q3JB 3SX0A 4JI4B 4IV8A 4EGCB 1NAIA 2ZAIA 2ATIA 5ARDA 1DLJA 3L0SA 3I73A 3FNHA 1AKMA 3LP5A 1GAEO 3TXAA 1PGJA 2BIFA 5TE9A 1TD1A 3T9DA 1KZHA 1N1EA 4LDQA 4FFBA 1U11A 1VRWA 1M7GA 1RCTE 2WWIA 2K6GA 2IZ7A 1DWPA 1SBCA 3GGOA 3L04A 4XLZA 5FPSA 3WK4A 5HOQA 1Q12A 3B3GA 2XWSA 2ZJ8A 7MHTA 2EC5A 4C7BA 4UHHA 2W4IA 3BTSA 3KR2A 3FHOA 1U1EA 3BMCB 3FOCA 5I9TA 4ENWA 1JDVA 2JI6A 4R1TA 1T13A 2AOVA 4YV2A 2FLWA 2FPGA 1THMA 4IOLA 2VUTA 1OROA 1ISPA 4IF6A 1JIJA 3L4JA 5CT8A 1M73E 3P9SA 1U1CA 4TT3A 3R9XB 1TQ8A 5IDWA 1UKZA 3LYAA 1SD1A 3AERB 3VYWA 2JBHA 3QHPA 4LOKA 4GUAA 3ZV6A 4E2FA 2GEFA 3JSXA 1DE0A 5E1BA 1RI2A 4HRAA 1UDCA 1VHJA 3SC2B 2BR5A 1VSUA 2LIVA 3VTZA 3PSAA 1DAPA 1YQTA 1C7IA 5JXWA 1TVEA 1MW9X 2ZCUA 4II7A 3RJTA 1E0AA 1ZG3A 2PR7A 1ESNA 4MK4A 2WQZA 3MWGA 3PUHA 4D9CA 3QW2A 3DOJA 3N2ZB 1Z0ZA 1ECCA 2A1IA 2P9FA 2PK3A 4U0JA 1ADFA 1E59A 4WFQA 4LZZA 1NVKA 4EUNA 3DYVA 4ZWNA 1V8PA 3KQLA 5FTMA 4P86A 4Z3DA 1XK7A 5REQA 5BWCA 1J24A 2QPOA 2FFHA 2X41A 4TWJA 2HFKA 5CX4A 1DOHA 2NVUB 1S8AA 2HSJA 5JNVA 3JPWA 3O95A 2Q99A 2B9VA 2I33A 5CU7A 3H9GA 2UZAA 3CV3A 4HWRA 4IOMA 2J59A 1ZHFA 1G98A 4QUIA 3GFVA 3EIFA 1KS9A 2J9RA 3DR3A 3KQSA 3HHEA 4EOGA 5JTTA 2WVJA 4FCVA 1OFUX 4CR7A 2OLKA 2QI9C 3K92A 4EAQA 4JUFA 3KQKA 2ZIZA 3P2EA 4NR0A 2YFYA 3Q0TA 4WXYB 3EXHC 2XT9A 3WOHA 5CIQA 1KDPA 3LPLA 4BNMA 4J0IA 1UQTA 3DT8A 1EQAA 3GLKA 5JEDA 3ZIAD 2ZSFA 2G36A 1E1DA 2X58A 3DHNA 3U37A 1NAHA 3Q3HA 3PGMA 4ROTA 3C3WA 4RGVA 3W5JA 3FYUB 1RLOA 1CPYA 1IJBA 4FWBA 2YFQA 4MUEA 2YHBA 4XXHA 3PHCA 3ZS8A 4DVGA 3WHPA 5A03A 2JDID 2FZLA 1OAAA 4A92A 3B85A 3A2KA 1XK6A 5AXBA 4H1UA 1X1EA 3DE2X 4RIFA 1OFGA 1EMDA 2FMKA 1R9GA 5AJVB 2VCEA 1YDWA 2ODEA 1NQVA 3DMPA 4M86A 4XD2A 2PVPA 2B8NA 2BFFA 2VKQA 4M1ZA 4UVIA 3RBAA 4EHBA 3UGKA 5EJFA 4CMGA 1B6GA 3HVJA 4MINA 1Y5MA 3K31A 2WQ7A 5I9LA 4F60A 3HRKA 4BCCA 2E0IA 2XGSA 3WKDA 1I1HA 3DL4A 4X3PA 3TRKA 3WO0A 1QIJA 2HC9A 4MX8A 3RS7A 3HJCA 1W94A 3EF1A 1A7UA 2HBQA 4G6ZA 4HDQB 2X19A 2JFBA 3SI7A 3SS8A 3NRCA 3I6BA 1QUEA 4LRWA 5EPUA 1E0SA 1UXHA 3A4IA 1G8AA 4R7ZA 3HFGA 4TVBA 4V2IA 2V0NA 2YCLA 2LUOA 1UQRA 5TF4A 3GVCA 1SURA 2GPYA 3UBMA 2GVZC 2Q1SA 3WB2A 3MHTA 1TRHA 2ZBRA 4XWGA 3ZDFA 1R27A 3ZWAA 1UJMA 1GTG1 4C05A 5K0JA 3JQCA 4H08A 3FSEA 2OFXA 5T3YA 3LKBA 3QUCA 2VPIA 1GQFA 4RK4A 4XJXA 2X6QA 1YA6A 2BMVA 2QUKA 3ETJA 1K6MA 3WZLA 3T5AA 3AVWA 5AH0A 2BFWA 2PZGA 3DBVO 4Y2UA 3N8GA 1EVJA 1G8JA 1G18A 4FHZA 4FE7A 4KWIA 2XJ9A 4UFPA 3RSLA 1IB0A 2GPJA 3JWHA 4G0NA 3AR3A 4J2OA 2ZI4A 4KQGA 4BL5A 2ZETA 2A9PA 4OGLA 1PZXA 4DABA 3KG2A 5LQKA 2PNJA 2BH2A 4NVRA 1L5WA 3I5UA 1ZGBA 2C5EA 1XEXB 3IE2A 1DIHA 4DG8A 2GILA 4BX8A 1Y5LA 4P7BA 2OFOA 1IY1A 1ADBA 3EE6A 3FCEA 3PDCA 1Y8RA 2A5JA 3E61A 4P9NA 4BTVA 3B82A 2NO5A 5LDDC 4WCFB 2IUUA 3RD5A 5IH7A 1QG0A 3T4XA 1QOQB 2UAGA 4H7IA 4MO2A 1B8PA 1UM8A 2N42A 3L7BA 4ZOLF 4UMVA 4AY4A 2CYBA 1JLKA 3M7IA 2VSNA 3FNBA 4E0BA 3D0QA 4DV6B 1Y7TA 2JFYA 4ZT3A 1CQZA 4G0PA 3JZAA 5FPPA 3EG9B 1IAVA 5I45A 2X2PA 3N5KA 1J9ZA 5CVJA 4YLYA 6NULA 5K5EA 2J3MA 4M1EA 3RJ5A 1T25A 5A0FA 3WKBA 4EPXA 3O91A 2VDQB 1ZC4A 1Z6TA 1M2FA 4MXDA 4Y2PA 3I4FA 4IDOA 4UD6A 3E1KA 4PHHA 4Y67A 1ES9A 3X2SA 1MG0A 1Q74A 1WSDA 2BGUA 1WCXA 4WDRA 3AMVA 3U7FB 3DLHA 2K7ZA 4EG1A 1JHDA 2ODWA 3TL6A 5HZGA 2B35A 1FIUA 3RVJA 4PC6A 4Q03A 5KZMB 3H05A 1UBMS 4TLMB 1U0JA 3FAZA 1GPDG 2FSVC 1TMYA 5CXXA 3RAFC 5TPZD 4FHFA 1T15A 1Y5RA 2QRPA 1XXHB 3A1TA 4C89A 2Q9BA 3MK31 2H2AA 2X8WA 2FW1A 3ICOA 4ND1A 4YCNA 1A9QA 3BWMA 2AD1A 4FCWA 2JG3A 1AZWA 4BC0A 3ZU6A 2HRBA 3GDGA 3R2JA 2PO7A 1NRWA 4YCDA 2PQMA 3MTAA 1AN9A 1CUZA 3EVFA 4AQ7A 3K1YA 3MWYW 1VMAA 5E4YA 1DAIA 3LSTA 3L8HA 1DEAA 1OE0A 4WVLA 1BX3A 3AVOA 3FF4A 4D98A 4F45A 4ZK2A 3GLQA 4ZU3A 2X5NA 2PAFA 2O1WA 3KUCA 1XZCA 1DL5A 1V96A 2JD0A 1QF9A 2IFTA 1BH2A 3D1VA 3IMKA 3KXDA 3I6ZA 5D00A 5ALDA 3RG8A 3VPGA 4EZBA 2R1VA 2ECQA 3P9IA 4JJ6A 4IF4A 1Z88A 5K6TA 4BHTA 3FFWA 2ABWA 3QKRA 2YNMC 3CLTD 4DWVA 4MR9B 1D6JA 2OYSA 1W85B 4K0RA 1IEWA 1JZSA 1YR2A 3B38A 3NTRA 4C4ZA 1L4LA 4QOJA 4WERA 1IZ0A 3K96A 5JROA 4EVSA 5JT1A 1N9GB 2B6HA 2BDUA 2XZTA 5ELMA 1IATA 3IKJA 4H77A 3W79A 4OJKA 3OTGA 3L1UA 1LPBB 1R3DA 4JEHA 2FUKA 2ARKA 4UNRA 2HQ1A 1IBLB 1KL7A 2IXGA 3ADBA 1KVSA 2WK1A 3KB8A 3E5NA 4I4TA 2JJYA 1ZI8A 1LJ8A 4M9RA 3U40A 1M2JA 2YY5A 3VC3A 1ZCJA 3DBLB 2HHJA 5GGYA 1JUDA 4CM9A 2WZCA 2VEDA 4LJ5A 4XYBA 1VLQA 3DXXA 4RZSA 1JILA 5JYCA 5ITVA 3ESBA 4PSVA 1P1KA 5JJBA 5SYNA 3KAKA 3DKIA 1U02A 5IK2D 2VHQA 4Z54A 5H81A 1BDHA 3JVIA 1DWOA 5A3SA 2HQSA 3RHTA 2OHJA 3D43A 2QV0A 2W58A 5JBNA 4AUNA 1RQPA 4AJOA 2X7JA 3CVWA 1O95D 4RACA 2GNOA 6PFKA 2Y4OA 3PFHA 2W5UA 1YULA 2H5JA 2WUEA 3DONA 4FJ2A 1JHOA 2ZB7A 4JT4A 1FX1A 5DNAA 4B33A 3PRJA 4ZRDA 5FTWA 1EAMA 4Q7JB 3O8CA 1E63A 3HU5A 1EA7A 2F6RA 1RFLA 1UL1X 3AIMA 3BKWA 3MILA 4G26A 4J2TA 2VYVA 3UHPA 3B12A 2RJ3A 3I9V1 3AI3A 3KALA 3LIIA 2XE4A 3PU6A 2P4SA 3SDSA 4Z7QB 1X7ZB 4FI3F 2QVBA 3OQJA 4LHEA 4Y2VA 3FMGA 4RD2A 5H82A 4B2IA 4D7AA 2R7MA 1RIFA 1NVBA 2OQVA 4FZVA 5AVUA 4YVFA 2C2HA 3T5GA 1KYZA 2FP3A 4LZJA 4INJA 3SVZA 4PZUA 4HWTA 2CBXA 1HDOA 2MINB 2KB0A 4D1YA 1HTTA 3CJQA 4GWKA 1ORVA 1JLHA 2ID7A 1BXRB 1W5EA 3CRRA 4Z9FA 2Z6AA 3AFHA 3W05A 3GEDA 2FMTA 1HE8B 2FETA 4UEOA 4TT3D 2HI0A 3COWA 3V4FA 1WIWA 1YHNA 4HDCA 1D2NA 1TJ5A 3RYFA 2Y8EA 5SZHB 5BN4B 4IIXA 4DUPA 2XUOA 5FQOA 4KVZA 4IDGA 1POWA 4RF3A 3SC3A 3GD7A 5JZBA 3O8RA 1MGPA 2YY7A 1UDXA 5LMCA 1JLMA 3EBOA 3ZE8A 2F17A 1JIKA 2D06A 1XMPA 3PDJA 2R85A 2I8AA 2PCLA 3WQSB 1LU9A 3G0OA 2QU7A 4U1RA 3W5CA 3OHPA 2Q8NA 5B6PA 4EYQA 3ZDCA 1VKNA 3BZBA 3OMWA 4EB3A 2TMGA 1P1FA 2O3JA 5IAKA 4CEJA 1EM6A 2BAGA 2UZ3A 1E6KA 3AKZA 1Z18A 4CGYA 3DPIA 1W9HA 4PNEA 1OY1A 2VF7A 3H83A 1FSFA 1MABB 3TUIC 1SB9A 2HMTA 4COKA 4DLYA 5SICE 2RH4A 4KPUA 5ICEA 5TR9A 1LK7A 3FYTA 3R4VA 2FSGA 2QQ0A 2WF9A 4L7QA 3OJWA 4FCCA 2GEUA 1NLMA 3T4PA 5FLEX 4HO1X 1VLHA 3WNDA 3KJNA 4X00A 1G1AA 1ACLA 1F38A 2Y9MB 5FBWB 1NOKA 2GD2A 3T61A 2WUDA 5KVAA 2WA2A 1KARA 2Z30A 3IVRA 3LA8A 4Q4JB 1Y9JA 2JC3A 3CNLA 1DINA 4JP3A 3GZJA 2F4NA 1GRQA 2YZKA 1TQ4A 4QQ8A 4XB1A 1YZHA 1Y3BE 2GLUA 3FWHA 1XQ9A 3IQXA 4Y9SA 1H5QA 1ZM9A 3QFSA 4XDHA 1CJSA 5FNVB 2JIMA 3PLAE 1TIBA 4G3XA 1GGFA 3FCYA 3SOPA 2FQXA 1Q22A 2IWRA 5KJ1A 4RANA 5CIYA 2VUIB 3QWIA 2AEEA 4KPGA 4IQGA 5DWQA 4RD0A 4KGZA 1VIVA 2CLIB 3IQIX 5SY9A 5K3OA 4YRLA 1T4CB 3DAFA 5DTEA 1M6VB 3I53A 4MS4B 2XCIA 3AF0A 4JKYA 1QBGA 2JD1A 4ED9A 3OTOB 1FU8A 1SCBA 1U3DA 2VUSA 5F33A 3K0SA 1KDYA 1YQGA 3S3TA 4URUR 3UKDA 2Q28A 1E2KA 3PVZA 2O0KA 3GG9A 4O29A 4TYWA 1RBMA 3HBLA 5K4HA 1T3TA 2RGDA 1WKCA 3JVEA 4YCAA 5AW1A 3MTIA 3DQZA 4W8GA 4RHEA 4NIMA 3BDIA 4QNNA 5L8VA 4ZAFA 3AWDA 5JXJA 1SCNE 3ZGOA 4ZV9A 2FMHA 2SKDA 4EY7A 2G40A 2W6NA 5LUAA 3TQTA 3DE3X 3IUYA 5DV9A 3ZVKA 3ZWMA 5E9QA 1LC3A 3PZBA 3RIEA 1B43A 2PD6A 2W2PA 2P9ZA 3BKXA 3HVHA 3L0ZA 1UMCB 2B99A 2VJNA 5DVZA 5HOEA 2CK3D 2Y92A 4KFSA 4O5OA 3R7BA 4YAGA 1H6CA 1R6TA 1NOIA 3KSAC 3H7AA 2XQIA 1UCFA 4IJMA 2PLWA 3PDHA 3EHEA 3MXTA 2X5KO 1TVMA 2P5YA 4DM7A 2Z6VA 2D2XA 3U62A 2A78A 3HUFA 3PUJA 5IT0A 4JA0A 4P4UA 2QSJA 4KLRA 1NU6A 2ZVDA 1XZDA 3WY9A 4ZEVA 1TF7A 1ZQ9A 3ZJ5A 4FMCB 3FVRA 2C3UA 2OOKA 1OXSC 1NVEA 3Q6IA 4KGXA 3DE0X 5HP4A 3PHIA 1PSDA 5C1DA 3Q5EA 5HZMA 1QDUA 1XZFA 4EJ6A 1GNVA 1I36A 3OHMA 3FAKA 4P3OA 3M6VA 3OOJA 1SBYA 4OHPA 2I78A 4H4EA 5C1IA 3T8YA 4PRZA 1INLA 3DR5A 4PV7A 4RPGA 3CURA 1L4BA 3DUFB 3HN6A 3LYHA 1WXXA 4HGOA 2NWQA 4YO7A 3HJFA 1JJBA 4I9HA 4JEIA 1U4OA 4JLNA 3V8NA 2QIPA 2ZREA 3O4IA 1ONPA 1RWVA 1BHJA 3KQUA 1E9SA 3A6FA 3QI2A 3STTA 3HDJA 1XRMA 4D43A 4ZI7B 3LZCA 2WNSA 3DBOB 3CRVA 4O0LA 4MVJA 4D8XA 2PA3A 2FPKA 5CDFA 1VCMA 5DGTA 2C84A 3GDWA 3KJGA 2Z1MA 5A7HA 4LCEA 3HNRA 4DCNA 1PK9A 4CKEB 1EZZA 1DJOA 2V97A 1EJ2A 2X9NA 1H8EA 2AOTA 4MRMB 4QGFA 5LQMA 5ILOA 4OI4A 1W5AA 4I4TF 3WGKA 2WJVA 1DRKA 3IEPA 2ZG6A 3NEJA 2QUZA 4Y6SA 1O8BA 2X76A 4KE7A 3M3HA 4PX5A 1YZTA 5CCDA 5F78A 4URXR 3JD2A 1ZIPA 3DKVA 5JHGB 3DZIA 3SCZA 2MYPA 4FFNA 4GI5A 3G9ZA 3B20A 4YQFA 1REQA 5K3SA 5IT9A 3V4RA 3MS4A 4NQZA 2ZZNA 2PU7A 3M0EA 2ROQA 3GH3A 2QRMA 4QAQA 4W9RA 5H02A 2IPNA 3KQHA 1MIOA 3AZQA 4KPEC 4LECA 2Q6TA 3RASA 1ZJ4A 3K9CA 4D96A 4HXYA 1YUBA 1UBUS 4MICA 3Q5DA 4TMZA 2R68A 4A0RA 3GNTA 2ZYUX 4TM7A 4O0MA 3DHYA 3GJXC 4Y6LA 2RIPA 1LVGA 2CNDA 3NHBA 3ZCVA 2PJUA 2O59A 3H8WA 3IFSA 5ALSA 3WIUA 3ZI0A 2PMKA 1SRRA 1FU7A 1Z6YA 2C1XA 1AXEA 1WZUA 3IRVA 2IEDA 3IAM1 4C3OB 3PG5A 3CHYA 2NADA 3E23A 3HV0A 3K3PA 4J0EA 1RHJA 4UTRA 1XF1A 4Q00A 3HJUA 2C7OA 1HL3A 4EHHA 1BS9A 2FP4B 4BMVA 5GM1A 1UMBA 1PJCA 1PJ3A 2ACVA 3O3MB 3RTDA 2YMQA 4EUFA 3Q98A 3AP1A 3G7UA 1F0NA 1RCFA 2I2CA 3AR7A 4EDFA 3EH1A 1LH0A 3FTDA 4NG4A 4O4JB 2RAVA 4FGWA 4QYIA 4AWXA 4Z6KA 1DKOA 4WJZA 5I5GA 5A1JA 1HMPA 5BR8B 3JQPA 1KIMA 4HB4A 1Y33E 4QTUB 5KYKA 3B1XA 3KCNA 4QDXA 3LMKA 3OPVA 2EKLA 1RDFA 1T1RA 3KAQA 1U2GC 4Y2GA 2EFHB 3F49S 1PJLA 4LDNA 2Y1CA 5KVSA 5B36A 1PBNA 3INNA 3RC3A 3PEWA 2B92A 2YFKA 1KDTA 2Z95A 1CIVA 1G16A 2GN6A 4M0EA 5KSZA 1Z6GA 2JFHA 1GQ2A 2Q2VA 5IAGA 1U8AA 1HLFA 4RFVA 3V2IA 3I6IA 2NSDA 1NUAA 1ZKDA 5EP3A 1X3SA 1EP9A 2ORWA 2Y0EA 2KHZA 3GA5A 4C4TA 2H48A 1G42A 1EDZA 1EXDA 3GBPA 4CL0A 3GJSA 3UUEA 3EGXA 4JHXA 1LRLA 1Y80A 2O8FB 1KH3A 3N5CA 4D57A 2VHXA 2V54A 1V5EA 4KIFA 5CTAA 3U80A 1UPTA 5J4KA 4M37A 5CNMA 4ZEMA 5C81A 3ANYB 2XDWA 5LA6A 2VYVD 4KDCA 4LTMA 4BUCA 3THWB 1UPCA 2QOEA 3RS8A 2IZ6A 3GIDA 5T67A 1JG2A 4RC9A 2E55A 1F51E 3SIWA 4FFMA 2JLQA 3V00A 1NQ5A 4C4RA 4FEEA 3JQDA 4G23A 1QRTA 2WU3A 4QFMA 2AFHE 4OAOA 4UXHA 3U9TA 3N2KA 3NW9A 1T9KA 1RTKA 2HDOA 5IH3A 4YRSA 4YMHA 3K73O 4L5YA 5I4IA 2GB4A 1SQGA 1Z4MA 4B7XA 1O94C 1EFDN 1OVMA 3AQ4A 4CKXA 3CW8X 4E6EA 3L4EA 1YE8A 3R09A 4DMMA 4XDYA 1C9KA 2HB6A 3AINA 3OX1A 3EF3A 3DEKA 3O2NA 3TZHA 4DJJA 5C8YF 3U4QB 4QD3A 4F5DA 2Z2IA 4FMBB 1IN8A 5JYEA 3KV1A 1QTQA 2O2HA 5JCPA 1Z36A 2JK0A 2NLOA 5T57A 3FUXA 3P9KA 2F3PA 3LL4A 4FOLA 3UJ9A 5BPFA 4BNDA 1NVAA 1QDLB 1SCAA 3IPLA 5JCOA 4FN5A 1ZI9A 4O4IB 1U3UA 1XZGA 2OMKA 2VNJA 2I8CA 2AFIA 3QLTA 4CLXA 2XT0A 4MPTA 3AHHA 2CCGA 4Q34A 5KNCH 3FJOA 2R86A 4JYBA 1V4BA 4PLFA 4OQQA 4X93A 3AIKA 4GUDA 5LNK6 3UWPA 3EWAA 1TCAA 2HK9A 4HQRA 4R3WA 1OLOA 2YHAA 2Z2JA 1WBBA 3KOOA 1CVIA 1VHDA 4NC9A 4MRSA 4E33A 5KEIA 5AJTA 3UK0A 4R6WA 2JGFA 4YRMA 1DV1A 3DEZA 2NIPA 2W2OA 3NANA 4PIVA 3EIUA 3GJ5A 4HEA6 1B8NA 1APBA 2XMCA 2LV8A 5TT1A 4PX3A 5M34A 1W44A 3H2YA 3SJAA 2QTWB 1Z2PX 1DEOA 1NHGA 2YVUA 4V0KA 5EKUA 4AXXA 3CVYA 1U2SA 1YOVA 1LVHA 5J9FA 4C20A 2PKCA 3EPRA 4YJDA 1EDEA 3OKAA 1DXHA 3FB4A 4IIBA 1PLLA 4BGEA 2VQSA 3VJRA 2GRJA 3HYRA 1D07A 4IPTA 4BU1A 1BNCA 2CL6X 5KDLA 2MMGA 1XKXA 2Q8PA 3KM0A 3OJXA 4DTCA 2Q0QA 2Q6LA 3RS4A 4PFKA 2GRAA 5EIWA 2WUVA 4JN6B 2YVKA 2YWGA 3HSYA 3A9RA 1K2VN 3HU1A 3HSKA 3JQAB 1KI2A 1RZ3A 1X1TA 4FHEA 4TKMA 2VBFA 1EX1A 1N6RA 3AJAA 2CBGA 3P4YA 4MPJA 5AMXA 5EG5A 3TQSA 4E5PA 2EDCA 1OX6A 3V1YA 2BGWA 1DOZA 2D1FA 1RYZA 1XOIA 2FZ5A 4YCJA 4YFVA 4BV3A 1P4SA 4FDVA 5KUTA 1R74A 4X1YA 2VR1A 3Q6MA 1CQIA 3QFTA 2H4HA 2W8BB 2ZAOA 3BYZA 2OD7A 2NZVG 2RKWA 4IYRA 2Q4BA 1ODLA 3KIPA 3ZWYA 5JVDA 3DOIA 4H2DA 3G59A 5KSWB 4OBBA 2BGNA 5KBYA 2JFOA 2JI7A 2WW8A 4M3NA 4TWIA 5JANA 1WNFA 3L1VA 3IEMA 3D6AA 1I7DA 5EKTA 1CUWA 3AV3A 3EVBA 1NW3A 2AN3A 5CFNA 1A4IA 1T1GA 3SICE 3TLZA 4L75A 1ECBA 4LTNA 3F6CA 3V33A 2NUPA 3OBIA 4QUGA 4RJTA 5AM2A 2OGTA 1N5OX 3BHJA 3MS7A 4UTZA 4DRXB 2A0UA 2GBPA 3ENWA 2E4UA 4KJXA 4B2PA 2GYYA 1Y34E 4KXWA 1K9VF 1U8EA 1OPRA 3FI9A 3FROA 4EB8A 2AK3A 4IZ6A 3FJYA 5EZQA 3DMNA 4MVJF 4D3YA 4E15A 2YYYA 4ZDKA 1QK3A 4II3A 1PNRA 5DBOA 2VP5A 1X7XA 2CC2A 3WAGA 4IG4A 2ZRDA 5E6SB 3J80A 1XNJA 2X9GA 1G8MA 2A0KA 1W46A 5C5DA 3AVUA 4JBWA 4M36A 2GBGA 2VDOB 1NGSA 2Q4DA 2AR9A 3ZIDA 1EUYA 3WRXC 1UEXC 1L7PA 1EB8A 3DE7X 2HZBA 5KYXA 2G63A 3K4PA 2G5TA 2KS6A 1MVLA 4BNZA 1L5RA 3D59A 1RE1A 1EHCA 3LUDA 4G84A 3A3PA 4MR7B 2NX2A 2HJHA 2F67A 3CO0S 4R9NA 5BN5A 1W35A 1VE3A 3EMKA 1XUOA 3WJ2A 2P9QA 2QUIA 4OGFA 1WXEA 2GPWA 2NAFA 2WIKA 1NOJA 3TXXA 3GQBA 2RKOA 3P9XA 1V8OA 3QVMA 2ZB3A 4DTIA 3QVWA 5C7OO 3DZJA 2NTVA 2ZIEA 5KCZA 3WYGA 3ZOKA 3VU3A 3EH2A 4Y0AA 1EA5A 3U2QA 3FGOA 2WPDA 4OQMA 3FUTA 4AJHA 3UMYA 1RXVA 5E1MA 1ZGCA 1D09A 2ZIXA 1GG2A 1CUCA 1L4GA 4KE6A 5EJ2A 1GM5A 1E7WA 4QBKA 3OE4A 1GLVA 2GM5A 4RK1A 2RI6A 2WVHA 4RPCA 3ZEAA 5IF3A 3VYTB 1MB3A 1JW9B 2PT9A 1IPHA 2A9FA 4M8KA 3H4VA 3P2YA 4TL7A 3RFXA 4AKHA 3NTXA 2IS2A 3UYKA 4AUMA 1ODTC 2EL9A 1KOJA 2PGNA 2WF5A 3FD8A 4MVJD 3GCDA 3P19A 1FFHA 2HD4A 4HJXA 2GNPA 2RGGA 3CX4A 2RBKA 1RMTA 1EQ2A 1UBEA 2NO9A 4YALA 1GZ3A 2BTEA 1RKUA 1UZAA 2Q3MA 3UK7A 2O3QA 4Z9XA 1WAMA 1C30B 1OBOA 3UT0A 3KZXA 3FZEA 3N7UA 4MVJG 1Q3HA 1KSJA 4Q3OA 3T1OA 2HW8A 4LJAA 2JJ2A 1C1XA 3DMYA 3P2MA 4KWEA 3QA3E 2HIGA 3RVLA 5E4TA 5JOQA 3P5BA 4JLUA 4M46A 5E7IA 1T9GR 2QV7A 5K0NA 4CIXA 1KEZA 4S04A 4JA2A 1R9JA 3RRFA 4RULA 3RHZA 2R6AA 4Y98A 2UVPA 5EVJA 3AHJA 3O21A 3TZBA 3LUHA 5HR5A 1CF9A 3C3MA 2OP0A 2IYLD 1GL3A 4QXMA 5EZSA 2BP7B 2A35A 1EJBA 1WZCA 2PL5A 3SEFA 3UXEA 1RACA 2DWUA 4F9GA 5K8VA 3PEFA 3CMMA 1Q7RA 1NVXQ 1ZR4A 2WA1A 2ZROA 1XRNA 4F84A 3I2FA 4QBGB 4QDOA 3IQWA 1PJRA 5DJ5A 4D3FA 2Y6UA 2A59A 4GMXA 4HL6A 4OU5A 4EFMA 1HI9A 2QNIA 5IZ4A 1LX7A 3KJXA 3QVKA 4NS1A 4NTZA 2I6SA 4R40A 5LA6F 4PHGA 3S70A 4DANA 4B5LA 2V4UA 2OG2A 3HLYA 4XJVA 4UM8B 1C9YA 5DSZA 1T2AA 5DWDA 2R79A 1UKEA 4V1CB 2UYCA 4PO9A 1E6LA 2PRYA 3BRWD 3HWWA 3OE7A 1AK2A 5ICCA 1G3QA 3HN7A 3W06A 3EEOA 4P4LA 4XM2A 3U1BA 2BMEA 4I1UA 4KGVA 3D3WA 2GN8A 2MR6A 5G40A 2NZYA 3RIXA 5HKKA 2P67A 2A4MA 2FQ1A 5DLEA 1XLUA 4RE5A 3B60A 2RGYA 1SVNA 1Q1BA 4EYOA 3T7RA 5TGDA 4ILKA 3QUAA 3RK4A 4ETMA 5IFLA 4G1UC 3HL0A 5C7YA 3RVKA 2DXIA 4ENRA 3OCJA 5JZMA 3GLIA 2HPHA 1N7IA 5D3QA 4ZQGA 1AQUA 5KYUB 4RTRA 2YBEA 5KYGA 3I01M 1TX4B 4MVJP 3T3DA 2Y0BA 4BNFA 4D9BA 1E9VA 4L2IB 1L5GB 1GSIA 1EK2A 3V9PA 4XH9B 1M8JA 5T4BA 4Y1RA 4ESVA 3R5FA 4J7AA 4LBYA 4R1QA 4R1LA 5AJXA 2WSMA 1C8LA 3HC7A 4WDQA 4YASA 1L4FA 3RNOA 4GO1A 3SJUA 4RQBA 3PC4A 4TUYB 2ZRJA 4CTKA 4DNXA 4R68A 1QHGA 2CLHB 4LJ8A 5EZYA 5E3HA 3OQBA 1ZY2A 5I9SA 5B53A 4MS1B 1I4LD 3NOVA 3VQTA 4BFUA 1FJXA 1JMYA 1T29A 3FR7A 3C98A 2H1RA 2UUAB 2G6TA 5AM5A 3EHDA 4MGIR 3PWZA 2XJ4A 5AKHA 2DETA 1GNLA 3IX7A 4II2A 2P8SA 3AY7A 4DCUA 4F97A 5JQGA 2VSFA 1QKKA 4IIEA 3WLJA 2FUG6 1B14A 1E1CB 2R84A 2Z57A 3JATA 4H9GA 2OTCA 5A3VA 3STUA 1OB2A 5M29A 2VXCA 4MDYA 5D1HA 3O1LA 3I3OA 5TF0A 2I6FA 3ZV7A 1R5OA 1SKYB 1TAQA 1XKTA 2BF4A 2XLCA 2ACEA 3LUKA 3SBEA 5JI2E 2AXEA 1E3WA 3L3BA 2XTZA 2BGLA 3RRJA 4OBWA 3P20A 2E4YA 3ZPXA 2W2MA 1FJHA 2QN6A 2HZ7A 2EW8A 4WXEA 2V96A 3BGVA 3F97A 3NBMA 4RUKA 4B44A 5I48A 5T4FA 4Q39A 1HSZA 4EBBA 4L4YA 3ZQKA 3PLNA 1NN5A 4JGIA 3JQFA 4KYIB 1B1AA 2J85A 5IVHA 1EGMB 3R5SA 3DV0B 2ENUA 2MYUA 3G0GA 3AF2A 3MCZA 4NJEA 1UBRS 1L7DA 2ZI3A 5I9BA 2W4QA 3OQ1A 4L7VA 3E8SA 3THXB 1NJGA 1P5HA 1R5BA 2KLBA 3NEPX 3ZLVA 3DQPA 4LC1A 5JVDF 1LBEA 5H4HA 3CBGA 1JSXA 2HJSA 1FXWA 1UH5A 1T3ZA 3F98A 4IX9A 3TW8A 1T0PA 3STWA 1M7BA 3MJSA 5ICMA 1M5RA 5MF6A 1XTZA 1YOBA 5ALLA 4BMSA 1VM6A 1ZRNA 4EK9A 2HMUA 3U4MA 3MCAA 2VSOA 4QBTA 2R6HA 5GOZA 2YN0A 2V9CA 3UUGA 1TA0A 5EZ5A 3VI4B 1TZJA 3PS9A 1USKA 3IUPA 1TVKB 3GLGE 3F7NA 3RWMB 3ZD9A 2BKLA 1VL8A 4UEQA 4QTXA 4U2BA 3N7TA 1GY8A 4F3CA 3OQMA 3H2SA 1OWPA 3SBOA 4F9TA 3K0KA 3AESA 1KP9A 2UZIR 5LOVA 1X7GA 2E3JA 4EJSC 4A36A 4US0R 1YT5A 2F43B 4XWYA 2X0FA 3O3OB 1V45E 2QMEA 3TGWA 5GADl 1JHUA 3WB9A 5K8JB 4ZCSA 1FFXA 4PBTA 1A88A 1NQUA 2OO5C 5BV8A 4QM6A 1E1QD 4Q4CA 1BE6A 3HXOA 2FPGB 2C9ZA 2O6LA 2D54A 3EWSA 2JHAA 3MCTA 3I1YA 2BLLA 3JQBA 4GBJA 4KYUA 5CLLA 1K68A 1GN8A 1GIAA 3JQQA 5KX5B 1EFVB 2YH2A 2XCOA 1BAPA 4K9RA 4QDZA 1RWNA 5HKLA 3ND5A 4X3CA 3VMMA 5HM6A 3IAFA 3LK7A 4E32A 5LXTB 5C32A 3ELBA 3WYCA 1CG6A 1FRNA 2J6CA 3IULA 4CM8B 2X23A 2BUAA 1EUCB 1JA1A 5TPWB 1KU6A 4WOCA 1PG0A 3GHYA 1KTIA 3F78A 4R5HA 1FYEA 1YRYE 3OTHA 2DQYA 4KH0A 1JHVA 1M0SA 1ORTA 4D0NA 2BGMA 4B3HA 1YVPA 5ALGA 3I64A 5I51A 3FUVA 2IQ5A 4BLUA 1QTIA 5M3BA 1K3FA 2YTZA 3N8NA 3WYNA 5C1OA 3N39C 2Z8ZA 1VOTA 1GTZA 2NUTB 3VPFA 1XQYA 2OZVA 4ALLA 1XVAA 4MUKA 4Y30A 2A57A 2H2IA 3L8GA 1QFSA 1UJ6A 5H5JA 5LKRA 4XTCS 1M1NB 1USIA 4NNOA 3DOCA 4JLMA 4HMPA 2XYRA 3U1TA 4CL2A 5LN1A 1GPLA 4R81A 4AN0A 3QXCA 4IH9A 1EVEA 1A8PA 1TM1E 3PITA 4HNAB 2QJWA 4K9KA 5CM9C 4Z53A 5KTOA 2WZQA 3OP1A 1VLLA 2JVJA 3CZ5A 2DLCX 5F77A 1J1ZA 3RAPR 2Y6VA 4YMWA 1MENA 3WGGA 1IC6A 1G7RA 4PPFA 3A4TA 5FTKA 2VPPA 2ILTA 3ADDA 4HGNA 5FV7A 2OLJA 2PBRA 4PBRA 5LIRA 2P9YA 1EWQA 1Q2XA 3LCUA 2P3QA 1B16A 3KKZA 4ZTUB 3HN2A 4BQIA 4DV2B 4HNVA 3FTEA 1QGZA 3CE9A 3G2LA 4F7WA 1SQFA 3FMVA 1RZVA 3KHSA 1NE2A 2Y27A 3G9TA 1S4MA 1XVTA 4FYYA 5EIHA 2P9TA 1GA4A 5JCXA 3CYFA 1BD4A 4B9EA 4YUAA 2M9MA 4FD2A 1DAEA 3GJ6A 4L8GA 1WETA 3JCZA 4JH0A 2IXEA 1OFIA 3PR3A 4Q15A 4GPZA 5B1EA 3W04A 4OP1A 2QRLA 1JRLA 2RHJA 3L7YA 1HYBA 1VI5A 4K9QA 3PDWA 4YP5A 3E7PA 1M6YA 3GK3A 1W75A 4KXFB 4YREA 3RH0A 2AQ8A 2C0PA 3KT3A 4KO1S 2Y66A 4QL3A 4JOSA 1OTYA 3LS2A 3QEMA 5HUHA 1BVHA 1YL7A 2Z08A 4OSOA 4BZWA 3AF5A 1BQEA 1EJ6A 1OLUA 4A03A 2BFFB 3TFWA 3U6KA 1XRLA 2P2ZA 2W2TA 1EEXB 1WZNA 3GN2A 3WMEA 5F9MA 4BO3A 4MMYB 5E9AA 2OORA 2XOXA 3B5EA 3H0KA 2VJKA 2QZ4A 1FJGB 5CCBA 3F6RA 3HO1A 8MHTA 3RVMA 3SHTA 4ZIRA 4YJFA 4TTPA 3KTOA 5GGXA 1P73A 2XMBA 3CUVA 3EASA 3KVVA 4N0DA 2ZR8A 3T0FA 2DQSA 5KI6A 2O8CB 2R8EA 2F1HA 2V1XA 3JXEA 5A3RA 5AI9A 2GXQA 2Q8QA 1NM5A 2CJFA 1NNLA 4PPQA 2WPDD 3NV9A 2JARA 4FFPA 3SZ3A 2CXNA 2AJBA 2QP3A 1GR0A 2PUGA 3K53A 5MN6A 1YHYA 3S1AB 1KETA 3SHQA 2VHYA 4TRMA 3JARB 4KBYA 4HLDA 5CVUA 5F3RA 3RRNA 4DMGA 5C80A 1O96B 2C4VA 2MSLA 3K1AA 3ZXSA 1MB2A 2JFPA 1M6WA 1A8HA 4IR7A 4JP1A 3MUFA 3MYYA 1RWQA 4G25A 4Y7DA 5AW4A 1KI8A 2JFZA 2BW0A 5KREA 1Q1AA 2VVTA 1SKYE 1L3CA 1U28A 2ZDGA 5J63A 4QOHA 3JASA 3WR5A 4YAKA 3UQZA 4OREX 3N3BC 3KOUA 2PEZA 2P75A 3LPMA 1QMGA 3NIFB 2LDBA 4NDZA 3K1ZA 2P2CA 1E2JA 1O58A 3PT5A 1LDYA 5JE8A 3AJ9A 4EUEA 5CFLA 3UJPA 4ZVTA 4NCJA 3ZWKA 4Q02A 1VP3A 1G5TA 4OUDA 5K0LA 1TO2E 1IOWA 2Z9BA 3KPYA 3NKFA 4OMFG 4XWKA 5EZYF 4E5UA 4P7FA 2WIGA 3Q3CA 1T5SA 5IZCC 2QG6A 2AXPA 1K4YA 3GGGA 5CLQA 3RARA 4EW1A 4YEDA 3A4LA 1OIVA 1DXQA 1ONSA 1GN9A 2RG7A 5JQGF 3AX6A 2MYNA 4NFLA 2PUCA 1XHEA 4WAUA 4U4AA 5BQXA 1XZBA 3NBQA 4RTQA 1RWOA 4UQPA 4XGIA 2JLZA 4TYMA 2PUBA 1F0YA 4HFJA 1JEOA 3N6XA 4L9AA 4PLTA 5SZJA 2P9HA 2DH6A 5DBGA 4FE3A 5IBPA 2M32A 1XPJA 1MPTA 4OLJA 4FS3A 1L4EA 2LDXA 3AF4A 4L3VA 1KTVA 2JGAA 1AKTA 4RWZA 1VRVA 3LBHA 4RQUA 4UCWA 4XWTA 5JAHA 2Y1DA 3D8RA 4LVOA 1EDDA 1JFLA 3IURA 3OE7D 3DOUA 1XFDA 4CQMA 5EIEA 1D8AA 3G49A 2IY9A 2WZDA 2PS9A 2AYZA 4ZAZA 3ZBTA 3S7ZA 1M1UA 2PWPA 3TBHA 1ESMA 3PNYA 4EFKA 1PL7A 2CL0X 1CJCA 2PGLA 1IRIA 4K1LA 1U8TA 1CB0A 1XRJA 3NATA 3C6MA 1U8XX 7REQA 3TX2A 2O5EA 4P7GA 1RPAA 1Y4DE 4WWHA 1QLHA 2VJQA 3B3AA 4WECA 4HS9A 5G0SA 3KT8A 2XVZA 2ZBPA 3NUGA 1OIXA 4L4RA 4M6WB 1I3LA 3K9BA 5G0VA 1OV4A 3TBKA 1AKVA 1AUQA 3FY4A 3QLUA 5LJIA 5FKJA 2DUUA 5K0BA 4KR6A 5ESDA 4IGKA 1QCZA 4TTVA 4OHUA 3UK6A 5TXGA 4KFCA 5CHYA 5DX0A 1FXWF 4JVNA 2RHRA 3OUUA 4NE7A 4YI3A 3WLRA 5JY1A 3TOSA 3K30A 3FSJX 4ITUA 1RADA 3R5KA 1P19A 2V7BA 4UUMA 4MPRA 4YRCA 3BILA 3ED1A 1CNMA 2QLTA 3ZVLA 1Z5UA 1TKRA 4LX8A 4Q66C 4B71A 4CMAA 4DLXA 1KJYA 4N48A 2V55B 4RETA 2V7WA 3IGFA 2EZTA 3E1SA 5EGNA 1VIDA 4BJ3A 3IAS1 5EE0A 1PZMA 2D0IA 2Q5IA 2R1VB 3E9CA 3EVDA 3AEXA 1LW7A 3AEUB 1P3DA 4MKZA 3T9EA 1E89A 2VRBA 4O8ZA 1LNSA 4WOKA 2HHLA 5LOVF 3SIRA 2C4KA 1XMJA 1EE9A 1RPJA 2OK7A 3QBDA 1G4AE 4UHBA 5A3JA 4JDPA 5JJIA 4EFDA 2CMHA 1P3Y1 4AJIA 3C45A 1SIWA 3ICCA 5AKYA 5ADUS 4H0NA 1NF8A 1SRQA 3ZXIA 4K2HA 3RAGA 1NMYA 3FN4A 4IIGA 3UJ8A 4YRDA 3SVTA 3H1GA 4INPA 2SKEA 2FB9A 2I99A 5DCUA 4M55A 3VGPA 4EPVA 1A9PA 1IY0A 1TKAA 3W9UA 3JD4A 4HTFB 4ZEWA 1Z0AA 3UH0A 1T10A 2BEJA 2QQFA 1MO5A 2B8JA 3FNQA 3H97A 4BMCA 1NATA 4XIFA 4JZKA 3GW8A 1E4EB 2RHOA 4IDBA 1KVTA 2P6OA 3UN1A 3B1ZA 3JQ7A 2W00A 3KQVA 3OU2A 2ZWVA 2RAUA 4PCLA 2JHFA 2XAAA 3L8CA 1KO4A 1NNI1 1QO7A 4G4SP 2WD7A 2ECPA 2WVAA 2VAPA 3JQ9C 3MGBA 4RJ2A 1PQUA 4UPDA 2VF2A 2ACKA 4TXHA 2I7VA 4MOWA 5DHRA 4RY2A 4CCWA 1BH6A 3LH5A 3KKPA 2J4CA 1ZGZA 4YP9A 3NZEA 1S2LA 3IKMB 2V1UA 5NLLA 1QHIA 4JI2B 4G5QA 5FL7A 2C4WA 2ZR7A 2WF7A 1ZMRA 4PLYA 3C70A 2HA6A 2HJWA 2JCSA 5AQ1A 4DLKA 3ONDA 2GHQA 5LZ9A 1JNXX 1C7RA 2YIMA 4LDAA 2YWCA 2Z2KA 1LBSA 3AILA 3VKWA 3INTA 3TLKA 3WNVA 5A04A 3LTEA 1X80B 4OP2A 2WSSD 2XTJA 1HQYE 4A8JA 1EK5A 3RG2A 3L8ZA 2BBWA 2G0TA 4MWZA 4GOXA 4U63A 1RFGE 1LA2A 2C2ZA 4K7JA 4YT4A 3LY7A 3U49A 4X41A 4WKPA 2Q45A 3DAGA 3KL4A 4E31A 1M54A 4TYQA 1AKEA 3ABZA 4PLGA 1YH3A 3HKDB 5BVGA 5EFZA 1JEYA 4KK4A 4YWJA 4DR7B 5HKKD 5HYVA 1JLRA 4RD4A 3RANA 2VNIA 3BXHA 3A1NA 1Q91A 2ZT8A 3AOEC 3B7GA 5E6RA 3EDCA 1R4NA 2PR2A 3PKJA 4NYMR 3TKLA 2LBPA 4PSAA 3G2PA 4UUPA 1E9BA 2JGIA 10MHA 5DCYA 4CNBA 4IEFB 5CFMA 2AG1A 4N7MA 4U7PB 3ND6A 2I1VB 1GLNA 3AG5A 2HYIC 4B5KA 1T1JA 3ZJTA 1Q15A 1ZESA 2NTJA 3IL2A 3ZC3A 2JLVA 3AW8A 3FDZB 3IHKA 4O6VA 2B9EA 1NRIA 1I51A 1MJHA 2GJ9A 4J2HA 2L17A 5FORA 3ZV5A 4DN6A 3ZLJA 2HFJA 5FWXA 2C9OA 5KSYA 1QVVA 4J6EA 2V8BA 3IQGX 4ILEA 1MMFB 1N8KA 3ZYZA 2Y77A 1J99A 2C2WA 1KQNA 4EHNA 4EM6A 2GZ1A 3K0CA 4HNSA 1NJSA 1XTIA 3G88A 2BI7A 3VNVA 2VOEA 1EFUA 2OZEA 3WDKA 1FSPA 1CJTC 2B5WA 2LP4Y 4KUEA 1ZIDA 4CEJB 5MN4A 3IP8A 4HYQA 1FJ2A 4HDNB 3SKXA 3B8HA 1KY4A 4Z1MA 3SM9A 2C9MA 2DM6A 1FB5A 1KBOA 2EVWX 4UPEA 1PKXA 5CB4A 1SNYA 3RS5A 5I6DA 4LA4A 5LD2C 3SWWA 1E61A 1FMLA 3H0CA 4ZI3A 3I3SR 4WCVA 2BEWA 1JEEA 1U2ZA 2G7ZA 2JJQA 4NKRA 1O95C 5DK4A 1THTA 1Q19A 1LTKA 2XVYA 2WTUA 1L8OA 1Z5NA 3DNFA 3LVQE 4DIFA 2MOKA 4Z7NB 3ABQB 2Q3EA 1MNAA 2ZUWA 3KYCB 4V2UA 3WKEA 3U44A 1MQ9A 2BMFA 4A26A 2IU3A 2RK6A 3KRTA 1FUKA 3AETA 1NSTA 3IUQA 1EVQA 1NZDA 1C7QA 1TZCA 2WMOB 3ASVA 3KDPA 4O8CA 4RU1A 3A6KA 3SU8A 4INAA 2FEAA 4AZ3B 1N2SA 1Q1GA 4BJ5A 5BV7A 5BVHB 4IQFA 1EU1A 4PG7A 3QLVC 1JFTA 4LPSA 3LP6A 3NNNA 2BRUA 2XQFA 4GP6A 2O3TA 4D9JA 4YA6A 1NONA 2XLBA 3V7NA 1VMDA 1YGYA 1L5LA 1JIVA 1XVUA 4GRAA 5EIOA 2FW8A 3SX4A 4TYNA 2R96A 2GK6A 5DNDA 2BMWA 3RF6A 1DCTA 3A70A 3M3PA 1K7CA 3AHFA 1U0SY 4IHQA 3TLAA 1C2TA 3AFIA 1CY8A 4UHEA 1K08A 1QZUA 2QUBA 4P0TA 4P35A 2O54A 3PNKA 1JJFA 3F4KA 2F1KA 4A2QA 2VXYA 3IIKA 3WKAA 1ZSYA 3EGDB 2JAUA 1G5QA 2H54A 2YZ7A 3I01A 5I3CA 4LY0A 1VGRA 1PSZA 5CK5A 1E32A 1X92A 1Z29A 5IC4A 1BQ4A 4WZAA 3WLMA 4UNPA 1ZOOA 1Q20A 4JC8A 2BGRA 2IEBA 2IOFK 3E0QA 4G8JA 5KJEA 3U0BA 4ER3A 4B3FX 1JEQB 1UJ2A 1IHUA 4PANA 4TROA 4E14A 4BE7B 5JU6A 1P0QA 2AYXA 3LDAA 1BZYA 2VJDA 4P22A 3C43A 3GEGA 1FX0A 2C5HA 4B6QA 5ELLA 3QPAA 1ST3A 1MU0A 4UQLA 2DR3A 1XNHA 1RM0A 3B5IA 2RD2A 5JC8A 1ZU5A 6YASA 1R0KA 4WK6A 3D7SA 3QWHA 2GF9A 4YCBA 3DVQX 1THGA 3BFJA 2B2NA 2P8JA 3COZA 1SKBA 1AXRA 3BTOA 1ISMA 2AJCA 2GBLA 3RYCA 2E85A 2CFTA 3BX1A 1JG7A 2I6UA 1P7CA 3F4LA 4GFDA 5GM2A 3FMOB 2VNKA 1Y48E 3F9IA 1YMVA 4A0GA 1T0HB 4LRUA 3WB1A 1JU4A 3HBAA 1ZM3A 4GOLD 4UREA 2P5SA 3GBSA 4AFNA 2ZBUA 3MGGA 1C80A 3AVPA 4I1RA 2R4TA 2Q0XA 2IUEA 4MDHA 4O59O 3WC4A 3A7DA 4KDRA 2YJ5A 4XQ9A 4DJFC 1I33A 2NSJA 3A25A 1C1DA 4FYJA 3OM8A 4MKHA 3L8FA 4Q05A 3FZYA 2WY2D 1SELA 5ITZB 3V4VB 1DFGA 1W88A 4NJOA 4OSEA 4UU7A 4D74A 3DFIA 5IVIA 2AUMA 3TZEA 3UA3A 1GQQA 4IUYA 2GH1A 2HXYA 2L19A 2OD2A 1W87A 2C54A 1OZ0A 2FFBA 4IDEA 3M83A 4L15A 1G20B 4R1PA 1DX9A 1BG6A 2X1MA 3DVSX 5CA1F 3IKTA 2FGKA 3C0KA 3LSYA 2WFLA 4V3BA 2M1XA 4B3RB 2IHZA 2D5BA 2X1VA 2BDTA 1QHHA 3RTBA 3KXIA 2KJQA 4ON9A 1FQJA 2IJGX 4W99A 4R2IA 1NUSA 2REBA 3ORFA 4S3MA 3DZFA 2V03A 4B3XA 3UXMA 4EPTA 2GEBA 2R6ZA 1JEJA 1GGHA 1WMSA 3ZBUA 1ZD4A 2LPMA 4DC1A 1HORA 3KKQA 3Q8MA 3EFHA 3ESDA 1K0FA 3TE6A 4BJ6A 2UUCB 1JB9A 4LSZA 2HEGA 5H7XA 1JPJA 1RBYA 2K4MA 2AZTA 2NXCA 4IVPA 2X9LA 1J00A 2P40A 2QM0A 2ZYWX 1U2DC 4F6LA 1KQFA 4MIOA 2L69A 1YS1X 3AUTA 3AR2A 4XCQA 1U90A 4BATA 1Z16A 2HA4A 3LUFA 4PZCA 1V5WA 4UDNA 1X7WA 1E3QA 1EB9A 1M0WA 1I3NA 2V7VA 4KTTE 2BR3A 1G7CA 5J1TB 4CQMD 9ATCA 3DXZA 3CA8A 4XWAA 1SM4A 1F5NA 4GOND 1SWVA 4IUCS 1WB4A 3TN7A 1NVMB 3L8YA 2H4JA 5MDHA 3F74A 2NPOA 4FE4A 4J4TA 2IHYA 4QYMA 3GR6A 5C7LO 2D0DA 4G89A 4GC9A 4KSCA 1IM8A 2Q4EA 4RA9A 3H4TA 1R0RE 3CR8A 3I83A 5ANRB 4E12A 4DY4A 4EY8A 5AI4A 2X0NA 2I91A 2GFQA 3GQVA 3SR0A 1K5DA 2F59A 4FR0A 5GONB 3RWOA 3MGAA 8ATCA 3FWPA 4I9NA 1RYYA 4HEHA 1PDWA 3COPA 1RZRA 4QFDA 3SBXA 3S99A 4D79A 4IWYA 2PRZA 4ZQIA 3W2GA 4AJ4A 3ITEA 3ENKA 3IO5A 1BN7A 2FA9A 1J5XA 4N54A 3VSCA 4XW2A 4CCYB 2GKOA 5L3SB 5F1KA 1H69A 3EEIA 4QDKA 2UXDB 3PWKA 3HO8A 3K9GA 1QH1B 4IDPA 2QTCA 4ZXFA 3RC2A 3VDXA 1J70A 1F9AA 2LWIA 1QQ6A 2JIOA 3OOHA 2HQRA 1IY2A 1VPWA 2ZRQA 4JL8A 1OYYA 4G0MA 1V3UA 4C30A 3OLQA 2XKAA 3R77A 4GRDA 3V8QA 4DQDA 5HF8A 4X5OA 2I1WA 1GUFA 2QSYA 4EGQA 1KMHA 5AM1A 2QXUA 3G89A 4OXIA 1FDUA 1Z7YA 4Q24A 1ORIA 1U0LA 5L51A 2CD9A 1DP4A 1ZXBA 2C29D 3HKBB 2CB0A 4I3GA 3ADOA 4K9OA 5LBIA 4YMLA 4V24A 2A9JA 5FIUA 1TAUA 1HT0A 4REOA 3RIGA 4B4UA 1VA5A 3BD7A 4HN9A 4L0DA 1AKWA 2PWYA 1JB1A 3OPYB 4M49A 3EW9A 4DZTA 1ZAYA 2JHPA 2K87A 2ZRLA 3DE5X 4H3KB 3TEMA 5BNTA 4RK7A 4N5MA 1A3CA 2GM4A 2XNSA 1Z6QA 3CTMA 4JT8A 4CLOB 1D5WA 5FUQA 3PPYA 3CT6A 3PFIA 2PN1A 2W6IA 4EI7A 1L5QA 4Q7QA 1MRSA 1AHNA 1U9ZA 3BE5A 2QM8A 3W3AH 2ZRMA 5LMUB 3DO6A 3LPCA 5CK4A 1XELA 1VBMA 1YAHA 1Z62A 2C7BA 3FUCA 2NU9A 5L3QA 1W4ZA 4G37A 1WULS 3CISA 1AHHA 1SQ5A 4CIDA 3N8DA 2JH9A 4WZ6A 4U2GA 4EJFA 4LY3A 2EX4A 2P5TB 1ZITA 3O0TA 3ZZNA 1MAAA 3WLSA 2D1YA 2VDJA 3EGXB 3OQOA 3FVTA 3O82A 3ZI7A 1IVSA 3FOFC 2UXBB 1VG8A 2BELA 2ZBGA 1AN0A 5DRTA 1BWSA 5FL7D 4KRXA 1JA9A 4YONB 4UZFA 4CT4B 5CB4F 3DB1A 1PR3A 3EN0A 4Z2YA 4P54A 2YWDA 2HA5A 4OOFA 1CT9A 2DOKA 1ZJ5A 1GCGA 3H5NA 3I2JA 4KAFA 5BQ5A 1J1UA 4DLPA 3HPRA 5K03A 3L18A 2YIDA 2JGNA 1ICEA 4LQDA 3E2PA 4V0ME 2C8VA 1WKBA 2H3HA 4Q4HB 2NVOA 2VAVA 5AESA 2IITA 3HYTA 4RZHA 4YY3B 1Q7CA 2ZIGA 3O2SB 4FKMA 3V80A 4CDNA 3W6ZA 1FU4A 4ZC8A 1PFWA 2WILA 1V9CA 3DAPA 2A5YB 4KMRA 5EUBA 4C6TA 1ZCZA 4B8YA 2QGNA 1JMVA 3L6OO 1LDMA 5A7FA 1T9AA 3MUOA 1DKPA 5CDSA 3HCOA 4AIRA 1DHRA 4NOJA 4JWTA 5IKOA 3TTWA 3G85A 1K92A 1WPGA 4PZYA 1Q0HA 3NYQA 3PF8A 1R00A 1SEPA 4GU5A 4H7HA 3ZW7A 3M33A 1EP2B 1FFDA 1GRRA 1U7PA 2AB0A 2OWDA 3S6JA 4DKJA 3LHKA 5FFFA 3KR9A 4KQJA 1SXPA 3VNSA 1Y1LA 2HLDD 4L9RA 1FDSA 1G5RA 4WE3A 4A8TA 3T7JA 5BT8A 5DTQA 5JMWA 3FWNA 1LFAA 2DY1A 4LJLA 3MRSA 4RWEA 2X77A 4CMEA 4ZCTA 3D7MA 4GHWA 4TSKA 2JCXA 5KDDA 3H1AA 3RYTC 6GPBA 1EGQA 4W5NA 2Y1WA 3QP9A 3RTGA 3ZHVA 1U1GA 4DJ5X 3C7TA 2JLSA 3L6EA 2G3YA 1W36B 3QUTA 1N5MA 3H13A 3X2EA 1CU1A 3GVIA 2D2EA 3CLRC 1EESA 2W6CX 2E2WA 2JCBA 4FEGA 1N5JA 1NQWA 2VK2A 3MLAA 2E5WA 2W6PA 3WIDA 1XCGB 2D5CA 2FRDA 1NI5A 4Z1MD 1T8YA 3H2BA 1KK0A 1R64A 3WGJA 3LOUA 3KTAB 5FHRA 1HQDA 3HHPA 2QLLA 4L28A 1WXIA 3L49A 4L5CA 4N0PA 4W5HA 3RAJA 5L53A 2BLNA 5C7IO 4FGLA 4FT4A 3R3JA 4W7SA 1FYDA 1TJNA 2QL6A 2W22A 4A5SA 5ED4A 3R9IA 2ZJ2A 4P92A 4RZUA 1KJ9A 2HA0A 3ZXXA 1FXSA 1JQBA 2QRVB 3AI2A 3N2EA 4KL8S 1P62B 3AR9A 4LJ4A 1NF3A 5FPHA 3RJZA 4EFLA 4J94A 1VE7A 3BL8A 1G9SA 2XB4A 4WD3A 2K7FA 5CDFE 4YT5A 4BAZA 3IDFA 1IM5A 2VQ3A 3AVTA 4O3FA 5EY5B 4EKDA 4W63A 4CM9D 2AIRA 2XECA 3ANNA 2CJWB 1DAMA 3BG5A 4JXXA 4GECA 1X86B 1IXKA 3CWCA 3PX2A 4INZA 2FXVA 2Q9UA 4E1AA 5JBQA 4HV4A 4ZI5A 4JCOA 3AK4A 5E7MA 3RR2A 3G13A 1P5FA 3RFCA 1WOYA 3C3EA 3D6HA 2A30A 3DLAA 2ZOSA 3LJKA 4PZLA 4DC9A 3U6BA 4M9CA 4X3OA 2VYND 3NV7A 4G0QA 3RJ9A 4BKMA 4CKBB 1HZJA 2B0CA 2WE8A 2ENWA 2EU8A 2EZUA 2G8LA 2VHTA 4EB6B 2BD0A 3DBIA 3ZHOA 2O5CA 2PZAA 3EZXA 1PVVA 3O4GA 2JFNA 5J2TA 3EIEA 4JJ4A 5I8WA 1GQSA 2X8JB 2NPFA 1JEAA 4WNYA 4TLAA 5H9VA 3UJBA 4R8LA 4RPIA 1U5BA 4M87A 4U6SA 4YV7A 3G2KA 1SIBE 2AMLA 3PNVA 3A3KA 3U7QB 4UCXA 1Z4NA 2AEFA 1X7XB 1DWUA