3BX8A

Engineered human lipocalin 2 (lcn2), apo-form
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
174
structure length
167
Chain Sequence
b'SDLIPAPPLSKVPLQQNFQDNQFHGKWYVVGLAGNRILRDDQHPMNMYATIYELKEDKSYNVTSVISSHKKCEYTIATFVPGSQPGEFTLGIKSYSYLVRVVSTDYNQYAVVFFKLAEAEFFAITIYGRTKELASELKENFIRFSKSLGLPENHIVFPVPIDQCIDG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENGINEERED HUMAN LIPOCALIN 2
publication title High affinity molecular recognition and functional blockade of CTLA-4 by an engineered human lipocalin
rcsb
source organism Homo sapiens
molecule tags De novo protein, protein binding
total genus 40
structure length 167
sequence length 174
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2008-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 3bx8A00
1GX9A 2CZUA 5DG4A 1OPAA 1D3SA 3FR4A 4I3BA 1OBUA 3P6HA 1OEJA 4GETA 4EXZA 1BEBA 2AT8X 1SY0A 1YWDA 1DC9A 1JYJA 2W2AA 1X8QA 4YFQA 5HTEA 3FR5A 1LPJA 1ADLA 1QY1A 1S2PA 3FLLA 4O9SA 1B4MA 2NNEA 1VPRA 4ORRA 5F7GA 4XMCA 1G5WA 1FE3A 2RD7C 4YCHA 5HZ9A 1X8NA 4GH7A 2L68A 3VG5A 4ORUA 1LFOA 1QY0A 3VG6A 2RA6A 1E06A 1OPBA 3BU1A 3UEWA 4Y0SA 1ZNKA 3IA8A 4IB6A 1ICNA 3G7XA 1ZNLA 1BM5A 2G78A 1JBHA 4AYHA 4Y0RA 5FFHA 4I9RA 4NNSA 3BSZE 5FENA 4QYPA 3C77X 1I06A 1YWCA 2LBAA 5HZ6A 3U03A 4YFPA 5D48A 3FENA 4TJZA 1ZRYA 3WBGA 1XCAA 4IMOA 3MVFA 4BQUA 3APXA 4D6BA 3EMMA 1OBQA 1CBRA 4XMHA 1X71A 4YH0A 1VYFA 1PBOA 2QOSC 4QAEA 3BS2A 1TOWA 5EEDA 4A1YA 3GAQA 3PECA 1PEEA 1A3YA 1EPAA 1KT4A 1MX7A 2ACPX 2W2FA 2AT3X 3WJFA 5KHPA 2ANSA 5KICA 2Q39A 3CBSA 3BRNA 2BLGA 3PEDA 4IB8A 1HBQA 1AVGI 4QGXA 1JJXA 3EBWA 1SY1A 2XKLA 3EYCA 4AZNA 5HA1A 4BVMA 3OJYC 3ELZA 3O19A 2HMBA 3KFGA 4ZHGA 3KFFA 1E5PA 4NYRA 5CE4A 2OZQA 1U0XA 1CBIA 1FDQA 1OBPA 1QFTA 3BY0A 2ACOA 4A60A 4ZH9A 2CM9A 4OMXA 4ARHA 5HA0A 1DFVA 1IFCA 3EBKA 2AT5X 1EIIA 1IFBA 1JYDA 4I9SA 3P6EA 1GXAA 2HLVA 3NADA 3WJCA 2OVAA 1BSYA 2AT0X 1U18A 3D97A 2QM9A 2FS6A 4ORXA 1QY2A 3FEPA 1XKIA 5KIDA 3RZYA 4ZGUA 3QKGA 3NX1A 2F73A 3C78X 3C76X 2Q2PA 4YGZA 1I05A 4NYQA 1KT3A 4GE1A 4EEJA 4WFVA 1HMTA 4HPCA 4XMEA 5BVQA 4LKPA 4IBAA 3D95A 3L4RA 4I3DA 5F1EA 1YP7A 1LIEA 2EU7X 3HWDA 3PH6A 1GKAB 2CBSA 1KQXA 2FWVA 3PH5A 1QQSA 2ASNX 5L8NA 2HZRA 3CQNA 1ZNHA 2GJ5A 4A8ZA 4AZMA 1YIVA 2RCQA 3NQ3A 5HCEC 4TQ2A 4YGGA 3RSWA 3ELXA 1O1UA 4NNTA 4QZTA 4HPDA 1YUPA 1ZNDA 2FRSA 1LICA 5L8IA 3CBCA 1SXXA 4KIIA 2NNQA 2WSJA 1GKAA 5K06A 3FA9A 3WJEA 2GC9A 4QYNA 3APUA 3P6FA 5FAZA 1JV4A 3K3LA 3FR2A 1QABE 1KQWA 5JR8A 1TVQA 1QG5A 3FELA 1KGLA 4WBKA 4HPAA 5DPQA 3VG3A 5H8TA 3TGAA 1IIUA 2A3FX 3B2LA 4RUNA 4PSQA 1DZJA 5EEEA 1N0SA 1SXYA 1TW4A 1JJJA 4MVLA 2Q2MA 2HZQA 1UZ2X 4GNWA 4EFGA 4QZUA 1BRPA 2NNDA 1SY3A 1BWYA 1IKJA 4N7CA 1MX8A 3FMZA 1GX8A 1A18A 4ORWA 2A13A 4LZVA 3KZAA 3APWA 4IAWA 4AZRA 3AKNA 1RBPA 5H9AA 4M6SA 4TKHA 1QFVA 1HQPA 3AKMA 4AW8A 3D96A 2OFRX 1CJ5A 2Q9SA 2KT4B 4YBUA 1DZPA 3UEUA 1GT1A 1PMPA 2A2UA 2AL0X 1MDCA 3U0DA 1YWAA 3F9DA 3JS1A 3WJDA 3T1DA 1FTPA 1U17A 2A0AA 4ZHDA 3U9PC 3B2KA 1ACDA 1NP4A 5LJCA 2WEXA 1ICMA 1KT5A 2FT9A 1GGLA 1KT7A 1E00A 2FR2A 3STKA 1MUPA 3CR6A 3CQRA 3STNA 1LNMA 2JU7A 1A57A 4QGVA 3PP6A 2JN3A 2L5PA 3BLGA 4ALBA 4ZJ0A 4YGHA 1BSOA 1DZKA 1X89A 3DTQA 4AZOA 3VG4A 4YBPA 2XSTA 4TKBA 1AELA 2LB6A 3BDRA 1JZUA 2RQ0A 1CBQA 4GKCA 1HN2A 3EM0A 2OVDA 4LKTA 3TZSA 4HPBA 4RUUA 2JU8A 1DF3A 3FA8A 4AZQA 1G85A 4ORYA 1O1VA 1DZMA 2YG2A 3HK1A 4TNNA 3WVMA 3B2IA 4I3CA 1FELA 3APVA 4YKOA 4A1HA 1EALA 2Q4NA 1GT4A 3B2JA 1FENA 1GM6A 4UU3A 1LKEA 2HNXA 1SA8A 2MO5A 5IO7A 2AH7X 4ALOA 3TGBA 2POAA 3I0AA 2PY1A 2FR3A 5EDBA 3I17A 2G7BA 3UEVA 1T8VA 1TXLA 1EUOA 1Z24A 4Y0PA 4NLIA 3NR3A 4D6AA 3CMPA 2N93A 3PPTA 5B27A 1HMRA 3UEXA 1GT3A 1MVGA 2R74A 4MVIA 2WQAE 3TGCA 1P6PA 5HAEA 1ALBA 1EPBA 5BVSA 1EW3A 2WUTA 3O2YA 1YWBA 1EXSA 2K62A 4YFRA 5HCCC 3VG2A 1OEEA 1YP6A 1ERXA 2AT6X 2MM3A 3WXQA 1G7NA 3FA7A 1TOUA 3BU9A 4HFOA 1X8UA 5AQ6A 4IB9A 2P8GA 1KOIA 2CM4A 4ZCBA 2WR6A 3MBTA 3S26A 4ZHHA 1CBSA 4AZPA 4ZH6A 2K23A 5HZ8A 5D8JA 5D4AA 4GRJA 2RCTA 2OFMX 1EIOA 2CBRA 1D2UA 3B2HA 1QWDA 5IO5A 3Q6LA 2MJIA 3FW4A 1KZWA 4IMNA 1HMSA 3IFBA 3NX2A 1KZXA 2AMMX 1CRBA 4ZR2A 5HCDC 5D45A 2WQ9A 4Y0QA 5D47A 5LJGA 2QO4A 1S44A 1I04A 3TF6A 2G79A 3NPOA 4QGWA 3P6CA 2GTFX 1O8VA 4N7DA 5F6BA 3ZUIA 2CZTA 1S7DA 3P6DA 5H9KA 1IKEA 4IAXA 2E4JA 5B29A 2FTBA 2JOZA 4TLJA 5F58A 4DQ3A 5C0NA 2FLJA 5H9NA 3NQ9A 5LKFA 3O22A 3HWEA 1SXWA 2L9CA 1OEKA 2LBVA 3FW5A 1UREA 3DSZA 2W2BA 3F8AA 1LIDA 4XMFA 3HWGA 1T0VA 1GT5A 4DQ4A 3FA6A 2JU3A 4OS0A 1SY2A 4ZHFA 1X8OA 4TKJA 3WJBA 4LZUA 4NP1A 5HZ5A 2IFBA 3ZUOA 1H91A 2LFOA 1SXUA 5LJBA 2FS7A 2LKKA 4ZHCA 4M7MA 3ZQ3A 2WEWA 5F6ZA 2DM5A 1HBPA 4YDBA 4ODDA 5L8OA 1RLBE 2L67A 1X8PA 5HTDA 1BBPA 2NP1A 4OS3A 2HYSA 1LIBA 3P6GA 4GNYA 4EDEA 2R73A 1A2DA 3WJGA 3FEKA 4ZFXA 5HBSA 2QO6A 1B0OA 4CK4A 5HWZA 5LJEA 4YDAA 1I4UA 1LF7A 1ZNGA 1B56A 4YCEA 1NGLA 1BJ7A 5HZQA 1LIFA 4XMDA 4XMGA 1DV9A 1NP1A 1ERBA 5BVTA 3KFHA 4YKMA 5LKEA 3BX8A 5LJHA 4IB7A 2A2GA 5LJDA 1AQBA 1ZNEA 5EDCA 2WWPA 2R56A 5LJKA 1R0UA 1PM1X 1BLRA 3KFIA 1EQDA 1E02A 4K19A 5EPQA 2AKQA 2ALLX 4MVKA 3STMX 1G74A 5EZ2A 5IO6A 1KT6A 1FEMA 1IW2A 3KQ0A 1ML7A 3CWKA 4UU2A 1L6MA 3BX7A 1KXOA 2OVEA 1BRQA 3VG7A 3SAOA 4WFUA 4OS8A 3NP1A 4ES7A 2KTDA 3HWFA 1AB0A 4R0BA 2X45A 4YMYA 2X46A 2QO5A 1BSQA 1T68X 4BOEA 4ORSA 4OMWA 4NLJA 3FIQA 1VYGA 1B8EA 5H9LA 2O62A 3JSQA
chains in the Genus database with same CATH superfamily
1GX9A 4IRWA 3ZW0A 2CZUA 2IZHB 1OPAA 1D3SA 2YMSA 5DG4A 3HOLA 3FR4A 4I3BA 1OBUA 4CPHB 1VWKB 3P6HA 1OEJA 3CKGA 4GETA 4EXZA 1BEBA 2AT8X 4Z2VA 1N43A 1SY0A 1YWDA 1DC9A 1JYJA 2W2AA 1X8QA 4YFQA 5HTEA 3FR5A 1N4JA 2X8TA 1LPJA 3RE5A 1ADLA 1FJ1E 1QY1A 1S2PA 3RDOA 4Z2PA 3FLLA 4O9SA 5BVQA 2RTIB 2NNEA 1B4MA 1VPRA 1VWJB 4ORRA 5F7GA 4XMCA 2Y3FA 4O4XA 1G5WA 2Y32A 1FE3A 2RD7C 4YCHA 2A5CA 5HZ9A 1X8NA 4GH7A 2L68A 3VG5A 3ZW1A 1VWMB 1LFOA 1QY0A 4ORUA 3T2WA 3VG6A 2RA6A 1VWEB 1E06A 2X4MA 1OPBA 3BU1A 3SLJA 4ID2A 4Y0SA 1ZNKA 2RTGB 3IA8A 1ICNA 3G7XA 1ZNLA 4IB6A 3UEWA 3VGWA 2G78A 4FBRA 3VHIA 1HXLA 4Y0RA 4AYHA 4WHIA 1JBHA 4O3XB 5FFHA 4I9RA 4NNSA 3BSZE 5FENA 3RWXA 4QYPA 2IZAA 3C77X 1MM9A 1I06A 1YWCA 2LBAA 3FIDA 5HZ6A 4YFPA 3U03A 5D48A 3FENA 4TJZA 4MVEA 1ZRYA 3WBGA 1XCAA 4IMOA 1W5RA 3MVFA 5B10O 2Z4IA 5AJBA 4BQUA 3APXA 4NV8A 4D6BA 3EMMA 1OBQA 1CBRA 4BX6A 4XMHA 1X71A 4YH0A 1VYFA 1PBOA 1Y55X 2QOSC 2ZAGA 2C1SA 1VWPB 4FBVA 4QAEA 3BS2A 1TOWA 2MHDA 1SWOA 2Y3EA 1SWQA 3EC5A 4O3YA 4O3ZA 5EEDA 3GAQA 3PECA 1PEEA 1SWJA 1A3YA 1EPAA 1KT4A 1MX7A 2ACPX 2AT3X 2W2FA 3WJFA 5KHPA 2AF5A 2ANSA 5KICA 1SRGA 1OSPO 2Q39A 4CDFA 3CBSA 3BRNA 2BLGA 3PEDA 4IB8A 1HBQA 1AVGI 4QGXA 1JJXA 1SWLA 1SY1A 2BT9A 2XKLA 3EBWA 3EYCA 3MX7A 2IZDB 1LUQA 5HA1A 3RDQA 4AZNA 3OJYC 3ELZA 4GD9A 2X55A 2A8GA 3O19A 2HMBA 4BVMA 4YVBA 3KFGA 4ZHGA 3KFFA 1E5PA 4NYRA 5CE4A 2OZQA 1U0XA 1CBIA 1FDQA 1OBPA 1QFTA 1SWHA 3BY0A 4I6SA 2ACOA 2RTJA 4A60A 4BX7B 4ZH9A 2CM9A 4OMXA 4JNJA 2KD2A 4ARHA 5HA0A 1DFVA 1IFCA 3T2XA 3EBKA 2AT5X 1VWRB 2RTEB 1EIIA 2VDFA 1IFBA 1JYDA 4I9SA 4MISA 3P6EA 1GXAA 2HLVA 3NADA 3WJCA 3HPEA 1WUBA 2OVAA 1BSYA 2AT0X 1U18A 3D97A 2O62A 2QM9A 2FS6A 4ORXA 5K68A 4KC8A 1QY2A 3FEPA 1STPA 3D9WA 1XKIA 5KIDA 3KVNA 3RZYA 1SWUA 4L1NA 3QKGA 3VE2A 4ZGUA 3NX1A 2F73A 4BX7A 4DCBA 1KFFA 2BS6A 3C78X 1VWAB 2OL6O 3C76X 2Q2PA 4YGZA 2X34A 4GZVA 1I05A 2G5LA 2ZSCA 1SWFA 5F2BA 3WZPA 1KL5A 4NYQA 4GGRA 2KW1A 1KT3A 4GE1A 2IZBA 4EEJA 4WFVA 2A5BA 1HMTA 2IZIA 2FKGA 4GGZA 2FHNX 4HPCA 4LKPA 1K24A 4IBAA 4XMEA 3RBYA 3D95A 3L4RA 4I3DA 4OKAA 1VYOA 1MK5A 1LIEA 1YP7A 2EU7X 3HWDA 3P24A 3PH6A 4Y5DA 1GKAB 2FKJA 2CBSA 1KQXA 1SWGA 2FWVA 1QQSA 2ASNX 3PH5A 2HZRA 5L8NA 4DNEA 3WOVA 3S5VA 3CQNA 1ZNHA 2GJ5A 4A8ZA 4AZMA 1WBIA 4A1HA 1YIVA 2RCQA 3NQ3A 5HCEC 4TQ2A 4YGGA 2RTFB 3RSWA 2I5ZO 5B3MO 4CPFA 3ELXA 1O1UA 4NNTA 4QZTA 3ZZVA 4HPDA 1YUPA 3VPJE 1ZNDA 2FRSA 3FYFA 1LICA 5L8IA 3CBCA 1SRHA 1SXXA 4GDAA 2NNQA 4KIIA 2WSJA 2RN4A 3RDSA 4CDCA 1GKAA 5K06A 3FA9A 3QQ2A 4FQBB 3WJEA 2GC9A 4QYNA 3ZI8A 3APUA 1JJUA 3P6FA 4L3RA 5FAZA 3MG5A 1JV4A 1SWEA 2RTNB 3FR2A 3K3LA 1QABE 1KQWA 4JGLA 4QRLA 4U46A 1TVQA 1QG5A 5JR8A 3FELA 5B2AO 1KGLA 4WBKA 4HPAA 4NV7A 2RTMA 5DPQA 1N9YA 5H8TA 3VG3A 3TGAA 1IIUA 2A3FX 3B2LA 4RUNA 4PSQA 1DZJA 5EEEA 4GUZA 3SLTA 2IZJA 1N0SA 1SXYA 1TW4A 4MEEA 1JJJA 4CPHA 4MVLA 2HZQA 2Q2MA 1UZ2X 4EQAC 2BHVA 4GNWA 4EFGA 2GTLN 1SWPA 2RTQB 4QZUA 3SZIA 1BRPA 2NNDA 1SY3A 5AEOA 1IKJA 1VWLB 1BWYA 2PI3O 4N7CA 1MX8A 3FMZA 1GX8A 1A18A 4ORWA 4U8UN 2A13A 2F01A 4LZVA 3KZAA 3N91A 3APWA 4IAWA 4GK9A 4CSBA 4AZRA 3AKNA 1RBPA 1SLGB 3RDXA 5H9AA 4M6SA 4TKHA 1QFVA 1HQPA 2QCBA 3AKMA 4AW8A 3ZW2A 4I95A 4CPIA 3D96A 2OFRX 1SWNA 3ZWEA 1CJ5A 2C1QA 2OYBO 1I9HA 3RDUA 3LHNA 3LV4A 2Q9SA 1HY2A 2KT4B 1SWCA 4YBUA 1DZPA 3UEUA 4LQZA 1GT1A 1PMPA 2A2UA 2Z4HA 2AL0X 2RTBB 2RTRB 1MDCA 3OBLA 5JD2A 1SLFB 1YWAA 3U0DA 1IJ8A 3F9DA 3JS1A 1LDOA 2CAMA 3P02A 3PK2A 2JMBA 3WJDA 3T1DA 1FTPA 1U17A 2A0AA 4ZHDA 3U9PC 3B2KA 4KH8A 2X56A 1ACDA 1NP4A 5LJCA 2GTLM 2WEXA 4QNIA 1ICMA 4O3WA 1KT5A 2FT9A 1GGLA 1Y52X 3EW2A 1KT7A 1NC9A 1E00A 2OFAA 2FR2A 3STKA 4O4UA 4U8UM 1MUPA 3CR6A 2OVSA 3CQRA 5B11O 1LNMA 2JU7A 5F1EA 5IRAA 3STNA 4QGVA 1A57A 2IZCB 1NBXA 2JN3A 3PP6A 4PJ2A 3UAQA 2L5PA 3BLGA 5FQ8E 4ALBA 4YGHA 4ZJ0A 1BSOA 1DZKA 1X89A 1VWGB 3DTQA 4AZOA 3VG4A 4QQ1A 5FQ7E 4YBPA 2XSTA 1UYOX 4TKBA 1AELA 2LB6A 4ZGFA 1LCWA 3BDRA 1JZUA 1SLEB 3D4RA 2RQ0A 1CBQA 2IZEB 1K3BA 4GKCA 3HOEA 4R0BA 1HN2A 1NDJA 3EM0A 2OVDA 4Z27A 1NQMA 4LKTA 1VWDB 3TZSA 4HPBA 1AVEA 4RUUA 2JU8A 3X00A 1BM5A 1Y0GA 3SZHA 2OL7A 1DF3A 3FA8A 4AZQA 1SWRA 1G85A 4ORYA 1EI5A 1O1VA 1DZMA 2OFBA 2YG2A 2DJFA 3HK1A 4FGIB 5IRUA 1VYGA 4TNNA 3B2IA 4I3CA 1FELA 3APVA 4YKOA 3WVMA 4O4SA 2Q4NA 3T6LA 3LTWA 1GT4A 3B2JA 1EALA 1FENA 1GM6A 2UZ2A 2WPUA 4UU3A 1LKEA 2HNXA 1SA8A 2MO5A 5B5FA 1SLDB 5IO7A 2AH7X 4ALOA 3TGBA 2POAA 3I0AA 2PY1A 2FR3A 5EDBA 4EKVA 3I17A 2G7BA 3UEVA 1T8VA 1TXLA 1EUOA 3RY2A 1Z24A 4Y0PA 4NLIA 3NR3A 4D6AA 3WYQA 3CMPA 2N93A 3PPTA 3WZOA 2OY1O 5B27A 1HMRA 1NQNA 1GT3A 1MVGA 2R74A 4MVIA 2WQAE 3UEXA 3TGCA 1P6PA 5HAEA 1VWQB 1SWSA 3ZW0B 1ALBA 1EPBA 5BVSA 1EW3A 2WUTA 4KCAA 3RE6A 3O2YA 2OF9A 1YWBA 2RTDB 1EXSA 2K62A 2DJGA 4JO6A 4YFRA 3F6ZB 2UYWA 1LELA 3PDFA 5HCCC 2QOMA 3VG2A 1OEEA 1YP6A 1ERXA 4GJSA 2KTSA 2AT6X 2MM3A 2OY8A 2C4IA 3NQKA 3WXQA 2IZKA 1G7NA 1VWHB 1Y53X 4GU8A 2RTLA 3FA7A 1TOUA 3BU9A 4Y59A 4HFOA 1X8UA 5IRWA 5AQ6A 3EW1A 4IB9A 2M4LA 2P8GA 1SWDA 1KOIA 1RXKA 2CM4A 2WR6A 4ZCBA 3MBTA 3RKGA 3ZW1B 1VWIB 5FQ6E 3RDMA 3S26A 3VHHA 3H3IA 4ZHHA 1CBSA 4AZPA 4ZH6A 2K23A 4OEMA 5HZ8A 1LDQA 2X32A 3AEHA 2IZLB 5D8JA 5D4AA 4GRJA 4INNA 2OY7A 2RCTA 2OFMX 1EIOA 1PTSA 4CV7A 2CBRA 2BC3A 2BS5A 1D2UA 1Y9LA 4CDEA 5L3YA 3B2HA 1QWDA 4GDZA 5IO5A 1VWBB 2MJIA 3Q6LA 3FW4A 3WYPA 1KZWA 4IMNA 2I5VO 1HMSA 3IFBA 2OF8A 2X8SA 3NX2A 1KZXA 1STRB 1VWOB 2AMMX 1CRBA 5AJCA 4ZR2A 5D45A 5HCDC 2WQ9A 4Y0QA 3WZNA 3VHMA 3SOTA 5D47A 3SLOA 3S5XA 3OE3A 2BSZA 4U9CA 2MWHA 2QO4A 5LJGA 4BX6B 4I60A 5BYPA 1S44A 1I04A 3TF6A 2G79A 3NPOA 4QGWA 3P6CA 2GTFX 1O8VA 4N7DA 5F6BA 3S60A 3ZUIA 2CZTA 1RAVA 2QMIA 1S7DA 3P6DA 5H9KA 1IKEA 4IAXA 2E4JA 5B29A 2FTBA 2JOZA 4TLJA 5F58A 1RXHA 4A1YA 4DQ3A 5C0NA 2FLJA 5H9NA 3NQ9A 5LKFA 4FBOA 3O22A 3HWEA 4ON1A 2VFCA 1SXWA 2L9CA 2GH7A 1STSB 2FHLA 2RTAA 1OEKA 2LBVA 3VU1A 4MIRA 3FDCA 3FW5A 4KT5A 1UREA 3DSZA 4BBOA 3HTYA 1SREA 1N9MA 2W2BA 1GX3A 3F8AA 1LIDA 4XMFA 3HWGA 1I78A 1GT5A 4DQ4A 3FA6A 1JMXA 1Y9TA 2JU3A 4OS0A 1JQPA 1SY2A 2IZFB 4ZHFA 1SWAA 1X8OA 3PQUA 4TKJA 2ZAIA 3WJBA 1HXZA 4LZUA 4ML7B 2IFBA 4NP1A 2FGSA 4COTA 5HZ5A 3ZUOA 4HWMA 1H91A 2MF6A 2LFOA 1SXUA 4BJ8A 5LJBA 1KL4A 2FS7A 3JQOA 1VWNB 2LKKA 4ZHCA 4M7MA 3GE2A 3ZQ3A 3MM0A 4BX5B 2HKDA 2OL8O 1MOYA 2WEWA 2G8CO 5F6ZA 1MEPA 2DM5A 2LA7A 4C5PA 1JMZA 3T6FA 1HBPA 4GJVA 4YDBA 4ODDA 5L8OA 1RLBE 1RXJA 2JW1A 2L67A 5CYBA 3WZQA 1W6FA 1X8PA 5HTDA 1BBPA 2NP1A 4CDDA 4OS3A 3Q34A 1LCVA 2HYSA 1LIBA 1RSTB 3P6GA 4GNYA 3SZJA 4EDEA 2R73A 1A2DA 2X8FA 3FEKA 3WJGA 4ZFXA 5HBSA 5CHKA 2QO6A 5K67A 1PBYA 1B0OA 4BGFA 2GTLO 5B5GA 4CK4A 4Z28A 5HWZA 5LJEA 1DF8A 4YDAA 1I4UA 4GGTA 1LF7A 4BX5A 1ZNGA 1SRJA 1B56A 4O49A 4YCEA 1SWKA 1NGLA 1BJ7A 2RTHB 1LIFA 1SRFA 5HZQA 4Z2OA 1LCZA 4XMDA 4U8UO 1NP1A 1ERBA 1AVDA 3KFHA 4XMGA 3V8UA 5BVTA 1DV9A 4YKMA 1SWTA 5LKEA 3PQSA 3BX8A 5LJHA 5IXGA 4IB7A 2A2GA 4CPEA 5LJDA 1AQBA 2OY5O 4NW4A 1ZNEA 5EDCA 3VE1A 3OD9A 2WWPA 2R56A 5LJKA 1R0UA 1PM1X 2RTCB 3AUMO 2JGSA 1BLRA 1SWBA 3KFIA 1EQDA 5CSEA 4K19A 5EPQA 4O4OA 2AKQA 2ALLX 1SMPI 1E2TA 1W4TA 4MVKA 3STMX 1G74A 1HQQA 1N7YA 5EZ2A 1KT6A 1FEMA 5IO6A 1SRIA 1IW2A 3KQ0A 2RTOB 1ML7A 3CWKA 2VFBA 1L6MA 3BX7A 3E3CA 4UU2A 2F09A 1KXOA 2OVEA 1BRQA 1JIWI 2RTKA 3VG7A 1VWFB 3SAOA 4WFUA 1VWCB 4OS8A 3NP1A 4ES7A 4U3QA 1UYNX 2KTDA 1AB0A 3HWFA 2X45A 2AVIA 4IABA 2X46A 2QO5A 1BSQA 4YMYA 1KL3A 4JHQA 3RY1A 4Z6JA 1T68X 2RTPB 4KC7A 4BOEA 4ORSA 4OELA 4OMWA 4BCSA 3CKFA 2IZGB 4NLJA 1RSUB 3NBXX 3FIQA 1T0VA 1B8EA 5H9LA 4B55A 1E02A 3JSQA
chains in the Genus database with same CATH topology
1GX9A 3ZW0A 2CZUA 5DG4A 1OPAA 1D3SA 2YMSA 3HOLA 3FR4A 4I3BA 1OBUA 3P6HA 1OEJA 4GETA 4EXZA 1BEBA 2AT8X 1SY0A 1YWDA 1DC9A 1JYJA 2W2AA 1X8QA 4YFQA 5HTEA 3FR5A 2X8TA 1LPJA 1ADLA 1QY1A 1S2PA 3FLLA 4O9SA 1B4MA 2NNEA 1VPRA 4ORRA 5F7GA 4XMCA 4O4XA 1G5WA 1FE3A 2RD7C 4YCHA 5HZ9A 1X8NA 4GH7A 2L68A 3VG5A 3ZW1A 4ORUA 1LFOA 1QY0A 3VG6A 2RA6A 1E06A 1OPBA 3BU1A 4ID2A 4Y0SA 1ZNKA 3IA8A 4IB6A 1ICNA 3G7XA 1ZNLA 3UEWA 1BM5A 2G78A 4FBRA 1JBHA 4AYHA 4Y0RA 4WHIA 4O3XB 5FFHA 4I9RA 4NNSA 3BSZE 5FENA 3RWXA 4QYPA 3C77X 1I06A 1YWCA 2LBAA 5HZ6A 3U03A 4YFPA 5D48A 3FENA 4TJZA 4MVEA 1ZRYA 3WBGA 1XCAA 4IMOA 3MVFA 2Z4IA 5AJBA 4BQUA 3APXA 4D6BA 3EMMA 1OBQA 1CBRA 4XMHA 1X71A 4YH0A 1VYFA 1PBOA 2QOSC 2ZAGA 4FBVA 4QAEA 3BS2A 1TOWA 2MHDA 4O3YA 4O3ZA 5EEDA 4A1YA 3GAQA 3PECA 1PEEA 1A3YA 1EPAA 1KT4A 1MX7A 2ACPX 2AT3X 2W2FA 3WJFA 5KHPA 2ANSA 5KICA 2Q39A 3CBSA 3BRNA 2BLGA 3PEDA 4IB8A 1HBQA 1AVGI 4QGXA 1JJXA 2BT9A 1SY1A 2XKLA 3EBWA 3EYCA 3MX7A 5HA1A 4AZNA 4BVMA 3OJYC 3ELZA 3O19A 2HMBA 3KFGA 4ZHGA 3KFFA 1E5PA 4NYRA 5CE4A 2OZQA 1U0XA 1CBIA 1FDQA 1OBPA 1QFTA 3BY0A 4I6SA 2ACOA 4A60A 4ZH9A 2CM9A 4OMXA 2KD2A 4ARHA 5HA0A 1DFVA 1IFCA 3EBKA 2AT5X 1EIIA 1IFBA 1JYDA 4I9SA 4MISA 3P6EA 1GXAA 2HLVA 3NADA 3WJCA 2OVAA 1BSYA 2AT0X 1U18A 3D97A 2QM9A 2FS6A 4ORXA 4KC8A 1QY2A 3FEPA 1XKIA 5KIDA 3RZYA 3VE2A 4L1NA 3QKGA 4ZGUA 3NX1A 2F73A 3C78X 2BS6A 3C76X 2Q2PA 4YGZA 4GZVA 1I05A 4NYQA 2KW1A 1KT3A 4GE1A 4EEJA 4WFVA 1HMTA 4HPCA 4XMEA 5BVQA 3RBYA 4LKPA 4IBAA 3D95A 3L4RA 4I3DA 5F1EA 1YP7A 1LIEA 2EU7X 3HWDA 3P24A 3PH6A 1GKAB 2CBSA 1KQXA 2FWVA 3PH5A 1QQSA 2ASNX 5L8NA 2HZRA 3WOVA 3S5VA 3CQNA 1ZNHA 2GJ5A 4A8ZA 4AZMA 1YIVA 2RCQA 3NQ3A 5HCEC 4TQ2A 4YGGA 3RSWA 3ELXA 1O1UA 4NNTA 4QZTA 3ZZVA 4HPDA 1YUPA 3VPJE 1ZNDA 2FRSA 3FYFA 1LICA 5L8IA 3CBCA 1SXXA 4KIIA 2NNQA 2WSJA 2RN4A 1GKAA 5K06A 3FA9A 4FQBB 3WJEA 2GC9A 4QYNA 3ZI8A 3APUA 3P6FA 4L3RA 5FAZA 1JV4A 3K3LA 3FR2A 4JGLA 4QRLA 1QABE 1KQWA 5JR8A 1TVQA 1QG5A 3FELA 1KGLA 4WBKA 4HPAA 5DPQA 3VG3A 5H8TA 3TGAA 1IIUA 2A3FX 3B2LA 4RUNA 4PSQA 1DZJA 5EEEA 1N0SA 1SXYA 1TW4A 1JJJA 4MVLA 2HZQA 2Q2MA 1UZ2X 4EQAC 2BHVA 4GNWA 4EFGA 2GTLN 4QZUA 1BRPA 2NNDA 1SY3A 5AEOA 1IKJA 1BWYA 4N7CA 1MX8A 3FMZA 1GX8A 1A18A 4ORWA 4U8UN 2A13A 4LZVA 3KZAA 3N91A 3APWA 4IAWA 4GK9A 4CSBA 4AZRA 3AKNA 1RBPA 5H9AA 4M6SA 4TKHA 1QFVA 1HQPA 3AKMA 4AW8A 3ZW2A 4I95A 3D96A 2OFRX 3ZWEA 1CJ5A 3LHNA 3LV4A 2Q9SA 2KT4B 4YBUA 1DZPA 3UEUA 4LQZA 1GT1A 1PMPA 2A2UA 2Z4HA 2AL0X 1MDCA 3OBLA 3U0DA 1YWAA 3F9DA 3JS1A 3P02A 2JMBA 3WJDA 3T1DA 1FTPA 1U17A 2A0AA 4ZHDA 3U9PC 3B2KA 4KH8A 1ACDA 1NP4A 5LJCA 2GTLM 2WEXA 4QNIA 1ICMA 4O3WA 1KT5A 2FT9A 1GGLA 1KT7A 1E00A 2FR2A 3STKA 4O4UA 4U8UM 1MUPA 3CR6A 2OVSA 3CQRA 3STNA 1LNMA 2JU7A 1A57A 4QGVA 3PP6A 2JN3A 4PJ2A 3UAQA 2L5PA 3BLGA 5FQ8E 4ALBA 4YGHA 4ZJ0A 1BSOA 1DZKA 1X89A 3DTQA 4AZOA 3VG4A 4QQ1A 5FQ7E 4YBPA 2XSTA 4TKBA 1AELA 2LB6A 4ZGFA 3BDRA 1JZUA 3D4RA 2RQ0A 1CBQA 4GKCA 3HOEA 1HN2A 3EM0A 2OVDA 4LKTA 3TZSA 4HPBA 4RUUA 2JU8A 1DF3A 3FA8A 4AZQA 1G85A 4ORYA 1EI5A 1O1VA 1DZMA 2YG2A 4FGIB 3HK1A 4TNNA 3WVMA 3B2IA 4I3CA 1FELA 3APVA 4YKOA 4A1HA 4O4SA 2Q4NA 1EALA 1GT4A 3B2JA 1FENA 1GM6A 4UU3A 1LKEA 2HNXA 1SA8A 2MO5A 5IO7A 2AH7X 4ALOA 3TGBA 2POAA 3I0AA 2PY1A 2FR3A 5EDBA 3I17A 2G7BA 3UEVA 1T8VA 1TXLA 1EUOA 1Z24A 4Y0PA 4NLIA 3NR3A 4D6AA 3CMPA 2N93A 3PPTA 5B27A 1HMRA 3UEXA 1GT3A 1MVGA 2R74A 4MVIA 2WQAE 3TGCA 1P6PA 5HAEA 3ZW0B 1ALBA 1EPBA 5BVSA 1EW3A 2WUTA 4KCAA 3O2YA 1YWBA 1EXSA 2K62A 4YFRA 3F6ZB 5HCCC 3VG2A 1OEEA 1YP6A 1ERXA 2KTSA 2AT6X 2MM3A 3NQKA 3WXQA 1G7NA 4GU8A 3FA7A 1TOUA 3BU9A 4HFOA 1X8UA 5AQ6A 4IB9A 2M4LA 2P8GA 3RKGA 1KOIA 2CM4A 4ZCBA 2WR6A 3MBTA 3ZW1B 5FQ6E 3S26A 3H3IA 4ZHHA 1CBSA 4AZPA 4ZH6A 2K23A 5HZ8A 5D8JA 5D4AA 4GRJA 4INNA 2RCTA 2OFMX 1EIOA 4CV7A 2CBRA 2BS5A 1D2UA 1Y9LA 3B2HA 1QWDA 4GDZA 5IO5A 3Q6LA 2MJIA 3FW4A 1KZWA 4IMNA 1HMSA 3IFBA 2X8SA 3NX2A 1KZXA 5AJCA 2AMMX 1CRBA 4ZR2A 5HCDC 5D45A 2WQ9A 4Y0QA 3SOTA 5D47A 3S5XA 3OE3A 5LJGA 4U9CA 2MWHA 2QO4A 5BYPA 1S44A 1I04A 3TF6A 2G79A 3NPOA 4QGWA 3P6CA 2GTFX 1O8VA 4N7DA 5F6BA 3S60A 3ZUIA 2CZTA 2QMIA 1S7DA 3P6DA 5H9KA 1IKEA 4IAXA 2E4JA 5B29A 2FTBA 2JOZA 4TLJA 5F58A 4DQ3A 5C0NA 2FLJA 5H9NA 3NQ9A 5LKFA 4FBOA 3O22A 3HWEA 4ON1A 1SXWA 2L9CA 1OEKA 2LBVA 3VU1A 4MIRA 3FW5A 4KT5A 1UREA 3DSZA 3HTYA 2W2BA 3F8AA 1LIDA 4XMFA 3HWGA 1T0VA 1GT5A 4DQ4A 3FA6A 2JU3A 1Y9TA 4OS0A 1SY2A 4ZHFA 1X8OA 3PQUA 4TKJA 2ZAIA 3WJBA 4LZUA 4ML7B 4NP1A 2IFBA 4COTA 5HZ5A 3ZUOA 4HWMA 1H91A 2LFOA 1SXUA 5LJBA 2FS7A 3JQOA 2LKKA 4ZHCA 4M7MA 3GE2A 3ZQ3A 2WEWA 5F6ZA 2DM5A 2LA7A 1HBPA 4YDBA 4ODDA 5L8OA 1RLBE 2JW1A 2L67A 5CYBA 1X8PA 5HTDA 1BBPA 2NP1A 4OS3A 2HYSA 1LIBA 3P6GA 4GNYA 4EDEA 2R73A 1A2DA 2X8FA 3FEKA 3WJGA 4ZFXA 5HBSA 2QO6A 1B0OA 2GTLO 4CK4A 5HWZA 5LJEA 4YDAA 1I4UA 1LF7A 1ZNGA 4O49A 1B56A 4YCEA 1NGLA 1BJ7A 5HZQA 1LIFA 4XMDA 4XMGA 4U8UO 1NP1A 1ERBA 3V8UA 3KFHA 5BVTA 1DV9A 4YKMA 5LKEA 3PQSA 3BX8A 5LJHA 4IB7A 2A2GA 5LJDA 1AQBA 4NW4A 1ZNEA 5EDCA 3VE1A 3OD9A 2WWPA 2R56A 5LJKA 1R0UA 1PM1X 1BLRA 3KFIA 1EQDA 1E02A 4K19A 5EPQA 4O4OA 2AKQA 2ALLX 1SMPI 4MVKA 3STMX 1G74A 5EZ2A 5IO6A 1KT6A 1FEMA 1IW2A 3KQ0A 1ML7A 3CWKA 3E3CA 1L6MA 3BX7A 4UU2A 2F09A 2OVEA 1KXOA 1BRQA 1JIWI 3VG7A 3SAOA 4WFUA 4OS8A 3NP1A 4ES7A 4U3QA 2KTDA 3HWFA 1AB0A 4IABA 2X45A 4R0BA 4YMYA 2X46A 2QO5A 1BSQA 1T68X 4KC7A 4BOEA 4ORSA 4OMWA 4NLJA 3NBXX 3FIQA 1VYGA 1B8EA 5H9LA 2O62A 3JSQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GX9 A;  2CZU A;  5DG4 A;  1OPA A;  1D3S A;  3FR4 A;  4I3B A;  1OBU A;  3P6H A;  1OEJ A;  4GET A;  4EXZ A;  1BEB A;  2AT8 X;  1SY0 A;  1YWD A;  1DC9 A;  1JYJ A;  2W2A A;  1X8Q A;  4YFQ A;  5HTE A;  3FR5 A;  1LPJ A;  1ADL A;  1QY1 A;  1S2P A;  3FLL A;  4O9S A;  1B4M A;  2NNE A;  1VPR A;  4ORR A;  5F7G A;  4XMC A;  1G5W A;  1FE3 A;  2RD7 C;  4YCH A;  5HZ9 A;  1X8N A;  4GH7 A;  2L68 A;  3VG5 A;  4ORU A;  1LFO A;  1QY0 A;  3VG6 A;  2RA6 A;  1E06 A;  1OPB A;  3BU1 A;  3UEW A;  4Y0S A;  1ZNK A;  3IA8 A;  4IB6 A;  1ICN A;  3G7X A;  1ZNL A;  1BM5 A;  2G78 A;  1JBH A;  4AYH A;  4Y0R A;  5FFH A;  4I9R A;  4NNS A;  3BSZ E;  5FEN A;  4QYP A;  3C77 X;  1I06 A;  1YWC A;  2LBA A;  5HZ6 A;  3U03 A;  4YFP A;  5D48 A;  3FEN A;  4TJZ A;  1ZRY A;  3WBG A;  1XCA A;  4IMO A;  3MVF A;  4BQU A;  3APX A;  4D6B A;  3EMM A;  1OBQ A;  1CBR A;  4XMH A;  1X71 A;  4YH0 A;  1VYF A;  1PBO A;  2QOS C;  4QAE A;  3BS2 A;  1TOW A;  5EED A;  4A1Y A;  3GAQ A;  3PEC A;  1PEE A;  1A3Y A;  1EPA A;  1KT4 A;  1MX7 A;  2ACP X;  2W2F A;  2AT3 X;  3WJF A;  5KHP A;  2ANS A;  5KIC A;  2Q39 A;  3CBS A;  3BRN A;  2BLG A;  3PED A;  4IB8 A;  1HBQ A;  1AVG I;  4QGX A;  1JJX A;  3EBW A;  1SY1 A;  2XKL A;  3EYC A;  4AZN A;  5HA1 A;  4BVM A;  3OJY C;  3ELZ A;  3O19 A;  2HMB A;  3KFG A;  4ZHG A;  3KFF A;  1E5P A;  4NYR A;  5CE4 A;  2OZQ A;  1U0X A;  1CBI A;  1FDQ A;  1OBP A;  1QFT A;  3BY0 A;  2ACO A;  4A60 A;  4ZH9 A;  2CM9 A;  4OMX A;  4ARH A;  5HA0 A;  1DFV A;  1IFC A;  3EBK A;  2AT5 X;  1EII A;  1IFB A;  1JYD A;  4I9S A;  3P6E A;  1GXA A;  2HLV A;  3NAD A;  3WJC A;  2OVA A;  1BSY A;  2AT0 X;  1U18 A;  3D97 A;  2QM9 A;  2FS6 A;  4ORX A;  1QY2 A;  3FEP A;  1XKI A;  5KID A;  3RZY A;  4ZGU A;  3QKG A;  3NX1 A;  2F73 A;  3C78 X;  3C76 X;  2Q2P A;  4YGZ A;  1I05 A;  4NYQ A;  1KT3 A;  4GE1 A;  4EEJ A;  4WFV A;  1HMT A;  4HPC A;  4XME A;  5BVQ A;  4LKP A;  4IBA A;  3D95 A;  3L4R A;  4I3D A;  5F1E A;  1YP7 A;  1LIE A;  2EU7 X;  3HWD A;  3PH6 A;  1GKA B;  2CBS A;  1KQX A;  2FWV A;  3PH5 A;  1QQS A;  2ASN X;  5L8N A;  2HZR A;  3CQN A;  1ZNH A;  2GJ5 A;  4A8Z A;  4AZM A;  1YIV A;  2RCQ A;  3NQ3 A;  5HCE C;  4TQ2 A;  4YGG A;  3RSW A;  3ELX A;  1O1U A;  4NNT A;  4QZT A;  4HPD A;  1YUP A;  1ZND A;  2FRS A;  1LIC A;  5L8I A;  3CBC A;  1SXX A;  4KII A;  2NNQ A;  2WSJ A;  1GKA A;  5K06 A;  3FA9 A;  3WJE A;  2GC9 A;  4QYN A;  3APU A;  3P6F A;  5FAZ A;  1JV4 A;  3K3L A;  3FR2 A;  1QAB E;  1KQW A;  5JR8 A;  1TVQ A;  1QG5 A;  3FEL A;  1KGL A;  4WBK A;  4HPA A;  5DPQ A;  3VG3 A;  5H8T A;  3TGA A;  1IIU A;  2A3F X;  3B2L A;  4RUN A;  4PSQ A;  1DZJ A;  5EEE A;  1N0S A;  1SXY A;  1TW4 A;  1JJJ A;  4MVL A;  2Q2M A;  2HZQ A;  1UZ2 X;  4GNW A;  4EFG A;  4QZU A;  1BRP A;  2NND A;  1SY3 A;  1BWY A;  1IKJ A;  4N7C A;  1MX8 A;  3FMZ A;  1GX8 A;  1A18 A;  4ORW A;  2A13 A;  4LZV A;  3KZA A;  3APW A;  4IAW A;  4AZR A;  3AKN A;  1RBP A;  5H9A A;  4M6S A;  4TKH A;  1QFV A;  1HQP A;  3AKM A;  4AW8 A;  3D96 A;  2OFR X;  1CJ5 A;  2Q9S A;  2KT4 B;  4YBU A;  1DZP A;  3UEU A;  1GT1 A;  1PMP A;  2A2U A;  2AL0 X;  1MDC A;  3U0D A;  1YWA A;  3F9D A;  3JS1 A;  3WJD A;  3T1D A;  1FTP A;  1U17 A;  2A0A A;  4ZHD A;  3U9P C;  3B2K A;  1ACD A;  1NP4 A;  5LJC A;  2WEX A;  1ICM A;  1KT5 A;  2FT9 A;  1GGL A;  1KT7 A;  1E00 A;  2FR2 A;  3STK A;  1MUP A;  3CR6 A;  3CQR A;  3STN A;  1LNM A;  2JU7 A;  1A57 A;  4QGV A;  3PP6 A;  2JN3 A;  2L5P A;  3BLG A;  4ALB A;  4ZJ0 A;  4YGH A;  1BSO A;  1DZK A;  1X89 A;  3DTQ A;  4AZO A;  3VG4 A;  4YBP A;  2XST A;  4TKB A;  1AEL A;  2LB6 A;  3BDR A;  1JZU A;  2RQ0 A;  1CBQ A;  4GKC A;  1HN2 A;  3EM0 A;  2OVD A;  4LKT A;  3TZS A;  4HPB A;  4RUU A;  2JU8 A;  1DF3 A;  3FA8 A;  4AZQ A;  1G85 A;  4ORY A;  1O1V A;  1DZM A;  2YG2 A;  3HK1 A;  4TNN A;  3WVM A;  3B2I A;  4I3C A;  1FEL A;  3APV A;  4YKO A;  4A1H A;  1EAL A;  2Q4N A;  1GT4 A;  3B2J A;  1FEN A;  1GM6 A;  4UU3 A;  1LKE A;  2HNX A;  1SA8 A;  2MO5 A;  5IO7 A;  2AH7 X;  4ALO A;  3TGB A;  2POA A;  3I0A A;  2PY1 A;  2FR3 A;  5EDB A;  3I17 A;  2G7B A;  3UEV A;  1T8V A;  1TXL A;  1EUO A;  1Z24 A;  4Y0P A;  4NLI A;  3NR3 A;  4D6A A;  3CMP A;  2N93 A;  3PPT A;  5B27 A;  1HMR A;  3UEX A;  1GT3 A;  1MVG A;  2R74 A;  4MVI A;  2WQA E;  3TGC A;  1P6P A;  5HAE A;  1ALB A;  1EPB A;  5BVS A;  1EW3 A;  2WUT A;  3O2Y A;  1YWB A;  1EXS A;  2K62 A;  4YFR A;  5HCC C;  3VG2 A;  1OEE A;  1YP6 A;  1ERX A;  2AT6 X;  2MM3 A;  3WXQ A;  1G7N A;  3FA7 A;  1TOU A;  3BU9 A;  4HFO A;  1X8U A;  5AQ6 A;  4IB9 A;  2P8G A;  1KOI A;  2CM4 A;  4ZCB A;  2WR6 A;  3MBT A;  3S26 A;  4ZHH A;  1CBS A;  4AZP A;  4ZH6 A;  2K23 A;  5HZ8 A;  5D8J A;  5D4A A;  4GRJ A;  2RCT A;  2OFM X;  1EIO A;  2CBR A;  1D2U A;  3B2H A;  1QWD A;  5IO5 A;  3Q6L A;  2MJI A;  3FW4 A;  1KZW A;  4IMN A;  1HMS A;  3IFB A;  3NX2 A;  1KZX A;  2AMM X;  1CRB A;  4ZR2 A;  5HCD C;  5D45 A;  2WQ9 A;  4Y0Q A;  5D47 A;  5LJG A;  2QO4 A;  1S44 A;  1I04 A;  3TF6 A;  2G79 A;  3NPO A;  4QGW A;  3P6C A;  2GTF X;  1O8V A;  4N7D A;  5F6B A;  3ZUI A;  2CZT A;  1S7D A;  3P6D A;  5H9K A;  1IKE A;  4IAX A;  2E4J A;  5B29 A;  2FTB A;  2JOZ A;  4TLJ A;  5F58 A;  4DQ3 A;  5C0N A;  2FLJ A;  5H9N A;  3NQ9 A;  5LKF A;  3O22 A;  3HWE A;  1SXW A;  2L9C A;  1OEK A;  2LBV A;  3FW5 A;  1URE A;  3DSZ A;  2W2B A;  3F8A A;  1LID A;  4XMF A;  3HWG A;  1T0V A;  1GT5 A;  4DQ4 A;  3FA6 A;  2JU3 A;  4OS0 A;  1SY2 A;  4ZHF A;  1X8O A;  4TKJ A;  3WJB A;  4LZU A;  4NP1 A;  5HZ5 A;  2IFB A;  3ZUO A;  1H91 A;  2LFO A;  1SXU A;  5LJB A;  2FS7 A;  2LKK A;  4ZHC A;  4M7M A;  3ZQ3 A;  2WEW A;  5F6Z A;  2DM5 A;  1HBP A;  4YDB A;  4ODD A;  5L8O A;  1RLB E;  2L67 A;  1X8P A;  5HTD A;  1BBP A;  2NP1 A;  4OS3 A;  2HYS A;  1LIB A;  3P6G A;  4GNY A;  4EDE A;  2R73 A;  1A2D A;  3WJG A;  3FEK A;  4ZFX A;  5HBS A;  2QO6 A;  1B0O A;  4CK4 A;  5HWZ A;  5LJE A;  4YDA A;  1I4U A;  1LF7 A;  1ZNG A;  1B56 A;  4YCE A;  1NGL A;  1BJ7 A;  5HZQ A;  1LIF A;  4XMD A;  4XMG A;  1DV9 A;  1NP1 A;  1ERB A;  5BVT A;  3KFH A;  4YKM A;  5LKE A;  3BX8 A;  5LJH A;  4IB7 A;  2A2G A;  5LJD A;  1AQB A;  1ZNE A;  5EDC A;  2WWP A;  2R56 A;  5LJK A;  1R0U A;  1PM1 X;  1BLR A;  3KFI A;  1EQD A;  1E02 A;  4K19 A;  5EPQ A;  2AKQ A;  2ALL X;  4MVK A;  3STM X;  1G74 A;  5EZ2 A;  5IO6 A;  1KT6 A;  1FEM A;  1IW2 A;  3KQ0 A;  1ML7 A;  3CWK A;  4UU2 A;  1L6M A;  3BX7 A;  1KXO A;  2OVE A;  1BRQ A;  3VG7 A;  3SAO A;  4WFU A;  4OS8 A;  3NP1 A;  4ES7 A;  2KTD A;  3HWF A;  1AB0 A;  4R0B A;  2X45 A;  4YMY A;  2X46 A;  2QO5 A;  1BSQ A;  1T68 X;  4BOE A;  4ORS A;  4OMW A;  4NLJ A;  3FIQ A;  1VYG A;  1B8E A;  5H9L A;  2O62 A;  3JSQ A; 
#chains in the Genus database with same CATH topology
 1GX9 A;  4IRW A;  3ZW0 A;  2CZU A;  2IZH B;  1OPA A;  1D3S A;  2YMS A;  5DG4 A;  3HOL A;  3FR4 A;  4I3B A;  1OBU A;  4CPH B;  1VWK B;  3P6H A;  1OEJ A;  3CKG A;  4GET A;  4EXZ A;  1BEB A;  2AT8 X;  4Z2V A;  1N43 A;  1SY0 A;  1YWD A;  1DC9 A;  1JYJ A;  2W2A A;  1X8Q A;  4YFQ A;  5HTE A;  3FR5 A;  1N4J A;  2X8T A;  1LPJ A;  3RE5 A;  1ADL A;  1FJ1 E;  1QY1 A;  1S2P A;  3RDO A;  4Z2P A;  3FLL A;  4O9S A;  5BVQ A;  2RTI B;  2NNE A;  1B4M A;  1VPR A;  1VWJ B;  4ORR A;  5F7G A;  4XMC A;  2Y3F A;  4O4X A;  1G5W A;  2Y32 A;  1FE3 A;  2RD7 C;  4YCH A;  2A5C A;  5HZ9 A;  1X8N A;  4GH7 A;  2L68 A;  3VG5 A;  3ZW1 A;  1VWM B;  1LFO A;  1QY0 A;  4ORU A;  3T2W A;  3VG6 A;  2RA6 A;  1VWE B;  1E06 A;  2X4M A;  1OPB A;  3BU1 A;  3SLJ A;  4ID2 A;  4Y0S A;  1ZNK A;  2RTG B;  3IA8 A;  1ICN A;  3G7X A;  1ZNL A;  4IB6 A;  3UEW A;  3VGW A;  2G78 A;  4FBR A;  3VHI A;  1HXL A;  4Y0R A;  4AYH A;  4WHI A;  1JBH A;  4O3X B;  5FFH A;  4I9R A;  4NNS A;  3BSZ E;  5FEN A;  3RWX A;  4QYP A;  2IZA A;  3C77 X;  1MM9 A;  1I06 A;  1YWC A;  2LBA A;  3FID A;  5HZ6 A;  4YFP A;  3U03 A;  5D48 A;  3FEN A;  4TJZ A;  4MVE A;  1ZRY A;  3WBG A;  1XCA A;  4IMO A;  1W5R A;  3MVF A;  5B10 O;  2Z4I A;  5AJB A;  4BQU A;  3APX A;  4NV8 A;  4D6B A;  3EMM A;  1OBQ A;  1CBR A;  4BX6 A;  4XMH A;  1X71 A;  4YH0 A;  1VYF A;  1PBO A;  1Y55 X;  2QOS C;  2ZAG A;  2C1S A;  1VWP B;  4FBV A;  4QAE A;  3BS2 A;  1TOW A;  2MHD A;  1SWO A;  2Y3E A;  1SWQ A;  3EC5 A;  4O3Y A;  4O3Z A;  5EED A;  3GAQ A;  3PEC A;  1PEE A;  1SWJ A;  1A3Y A;  1EPA A;  1KT4 A;  1MX7 A;  2ACP X;  2AT3 X;  2W2F A;  3WJF A;  5KHP A;  2AF5 A;  2ANS A;  5KIC A;  1SRG A;  1OSP O;  2Q39 A;  4CDF A;  3CBS A;  3BRN A;  2BLG A;  3PED A;  4IB8 A;  1HBQ A;  1AVG I;  4QGX A;  1JJX A;  1SWL A;  1SY1 A;  2BT9 A;  2XKL A;  3EBW A;  3EYC A;  3MX7 A;  2IZD B;  1LUQ A;  5HA1 A;  3RDQ A;  4AZN A;  3OJY C;  3ELZ A;  4GD9 A;  2X55 A;  2A8G A;  3O19 A;  2HMB A;  4BVM A;  4YVB A;  3KFG A;  4ZHG A;  3KFF A;  1E5P A;  4NYR A;  5CE4 A;  2OZQ A;  1U0X A;  1CBI A;  1FDQ A;  1OBP A;  1QFT A;  1SWH A;  3BY0 A;  4I6S A;  2ACO A;  2RTJ A;  4A60 A;  4BX7 B;  4ZH9 A;  2CM9 A;  4OMX A;  4JNJ A;  2KD2 A;  4ARH A;  5HA0 A;  1DFV A;  1IFC A;  3T2X A;  3EBK A;  2AT5 X;  1VWR B;  2RTE B;  1EII A;  2VDF A;  1IFB A;  1JYD A;  4I9S A;  4MIS A;  3P6E A;  1GXA A;  2HLV A;  3NAD A;  3WJC A;  3HPE A;  1WUB A;  2OVA A;  1BSY A;  2AT0 X;  1U18 A;  3D97 A;  2O62 A;  2QM9 A;  2FS6 A;  4ORX A;  5K68 A;  4KC8 A;  1QY2 A;  3FEP A;  1STP A;  3D9W A;  1XKI A;  5KID A;  3KVN A;  3RZY A;  1SWU A;  4L1N A;  3QKG A;  3VE2 A;  4ZGU A;  3NX1 A;  2F73 A;  4BX7 A;  4DCB A;  1KFF A;  2BS6 A;  3C78 X;  1VWA B;  2OL6 O;  3C76 X;  2Q2P A;  4YGZ A;  2X34 A;  4GZV A;  1I05 A;  2G5L A;  2ZSC A;  1SWF A;  5F2B A;  3WZP A;  1KL5 A;  4NYQ A;  4GGR A;  2KW1 A;  1KT3 A;  4GE1 A;  2IZB A;  4EEJ A;  4WFV A;  2A5B A;  1HMT A;  2IZI A;  2FKG A;  4GGZ A;  2FHN X;  4HPC A;  4LKP A;  1K24 A;  4IBA A;  4XME A;  3RBY A;  3D95 A;  3L4R A;  4I3D A;  4OKA A;  1VYO A;  1MK5 A;  1LIE A;  1YP7 A;  2EU7 X;  3HWD A;  3P24 A;  3PH6 A;  4Y5D A;  1GKA B;  2FKJ A;  2CBS A;  1KQX A;  1SWG A;  2FWV A;  1QQS A;  2ASN X;  3PH5 A;  2HZR A;  5L8N A;  4DNE A;  3WOV A;  3S5V A;  3CQN A;  1ZNH A;  2GJ5 A;  4A8Z A;  4AZM A;  1WBI A;  4A1H A;  1YIV A;  2RCQ A;  3NQ3 A;  5HCE C;  4TQ2 A;  4YGG A;  2RTF B;  3RSW A;  2I5Z O;  5B3M O;  4CPF A;  3ELX A;  1O1U A;  4NNT A;  4QZT A;  3ZZV A;  4HPD A;  1YUP A;  3VPJ E;  1ZND A;  2FRS A;  3FYF A;  1LIC A;  5L8I A;  3CBC A;  1SRH A;  1SXX A;  4GDA A;  2NNQ A;  4KII A;  2WSJ A;  2RN4 A;  3RDS A;  4CDC A;  1GKA A;  5K06 A;  3FA9 A;  3QQ2 A;  4FQB B;  3WJE A;  2GC9 A;  4QYN A;  3ZI8 A;  3APU A;  1JJU A;  3P6F A;  4L3R A;  5FAZ A;  3MG5 A;  1JV4 A;  1SWE A;  2RTN B;  3FR2 A;  3K3L A;  1QAB E;  1KQW A;  4JGL A;  4QRL A;  4U46 A;  1TVQ A;  1QG5 A;  5JR8 A;  3FEL A;  5B2A O;  1KGL A;  4WBK A;  4HPA A;  4NV7 A;  2RTM A;  5DPQ A;  1N9Y A;  5H8T A;  3VG3 A;  3TGA A;  1IIU A;  2A3F X;  3B2L A;  4RUN A;  4PSQ A;  1DZJ A;  5EEE A;  4GUZ A;  3SLT A;  2IZJ A;  1N0S A;  1SXY A;  1TW4 A;  4MEE A;  1JJJ A;  4CPH A;  4MVL A;  2HZQ A;  2Q2M A;  1UZ2 X;  4EQA C;  2BHV A;  4GNW A;  4EFG A;  2GTL N;  1SWP A;  2RTQ B;  4QZU A;  3SZI A;  1BRP A;  2NND A;  1SY3 A;  5AEO A;  1IKJ A;  1VWL B;  1BWY A;  2PI3 O;  4N7C A;  1MX8 A;  3FMZ A;  1GX8 A;  1A18 A;  4ORW A;  4U8U N;  2A13 A;  2F01 A;  4LZV A;  3KZA A;  3N91 A;  3APW A;  4IAW A;  4GK9 A;  4CSB A;  4AZR A;  3AKN A;  1RBP A;  1SLG B;  3RDX A;  5H9A A;  4M6S A;  4TKH A;  1QFV A;  1HQP A;  2QCB A;  3AKM A;  4AW8 A;  3ZW2 A;  4I95 A;  4CPI A;  3D96 A;  2OFR X;  1SWN A;  3ZWE A;  1CJ5 A;  2C1Q A;  2OYB O;  1I9H A;  3RDU A;  3LHN A;  3LV4 A;  2Q9S A;  1HY2 A;  2KT4 B;  1SWC A;  4YBU A;  1DZP A;  3UEU A;  4LQZ A;  1GT1 A;  1PMP A;  2A2U A;  2Z4H A;  2AL0 X;  2RTB B;  2RTR B;  1MDC A;  3OBL A;  5JD2 A;  1SLF B;  1YWA A;  3U0D A;  1IJ8 A;  3F9D A;  3JS1 A;  1LDO A;  2CAM A;  3P02 A;  3PK2 A;  2JMB A;  3WJD A;  3T1D A;  1FTP A;  1U17 A;  2A0A A;  4ZHD A;  3U9P C;  3B2K A;  4KH8 A;  2X56 A;  1ACD A;  1NP4 A;  5LJC A;  2GTL M;  2WEX A;  4QNI A;  1ICM A;  4O3W A;  1KT5 A;  2FT9 A;  1GGL A;  1Y52 X;  3EW2 A;  1KT7 A;  1NC9 A;  1E00 A;  2OFA A;  2FR2 A;  3STK A;  4O4U A;  4U8U M;  1MUP A;  3CR6 A;  2OVS A;  3CQR A;  5B11 O;  1LNM A;  2JU7 A;  5F1E A;  5IRA A;  3STN A;  4QGV A;  1A57 A;  2IZC B;  1NBX A;  2JN3 A;  3PP6 A;  4PJ2 A;  3UAQ A;  2L5P A;  3BLG A;  5FQ8 E;  4ALB A;  4YGH A;  4ZJ0 A;  1BSO A;  1DZK A;  1X89 A;  1VWG B;  3DTQ A;  4AZO A;  3VG4 A;  4QQ1 A;  5FQ7 E;  4YBP A;  2XST A;  1UYO X;  4TKB A;  1AEL A;  2LB6 A;  4ZGF A;  1LCW A;  3BDR A;  1JZU A;  1SLE B;  3D4R A;  2RQ0 A;  1CBQ A;  2IZE B;  1K3B A;  4GKC A;  3HOE A;  4R0B A;  1HN2 A;  1NDJ A;  3EM0 A;  2OVD A;  4Z27 A;  1NQM A;  4LKT A;  1VWD B;  3TZS A;  4HPB A;  1AVE A;  4RUU A;  2JU8 A;  3X00 A;  1BM5 A;  1Y0G A;  3SZH A;  2OL7 A;  1DF3 A;  3FA8 A;  4AZQ A;  1SWR A;  1G85 A;  4ORY A;  1EI5 A;  1O1V A;  1DZM A;  2OFB A;  2YG2 A;  2DJF A;  3HK1 A;  4FGI B;  5IRU A;  1VYG A;  4TNN A;  3B2I A;  4I3C A;  1FEL A;  3APV A;  4YKO A;  3WVM A;  4O4S A;  2Q4N A;  3T6L A;  3LTW A;  1GT4 A;  3B2J A;  1EAL A;  1FEN A;  1GM6 A;  2UZ2 A;  2WPU A;  4UU3 A;  1LKE A;  2HNX A;  1SA8 A;  2MO5 A;  5B5F A;  1SLD B;  5IO7 A;  2AH7 X;  4ALO A;  3TGB A;  2POA A;  3I0A A;  2PY1 A;  2FR3 A;  5EDB A;  4EKV A;  3I17 A;  2G7B A;  3UEV A;  1T8V A;  1TXL A;  1EUO A;  3RY2 A;  1Z24 A;  4Y0P A;  4NLI A;  3NR3 A;  4D6A A;  3WYQ A;  3CMP A;  2N93 A;  3PPT A;  3WZO A;  2OY1 O;  5B27 A;  1HMR A;  1NQN A;  1GT3 A;  1MVG A;  2R74 A;  4MVI A;  2WQA E;  3UEX A;  3TGC A;  1P6P A;  5HAE A;  1VWQ B;  1SWS A;  3ZW0 B;  1ALB A;  1EPB A;  5BVS A;  1EW3 A;  2WUT A;  4KCA A;  3RE6 A;  3O2Y A;  2OF9 A;  1YWB A;  2RTD B;  1EXS A;  2K62 A;  2DJG A;  4JO6 A;  4YFR A;  3F6Z B;  2UYW A;  1LEL A;  3PDF A;  5HCC C;  2QOM A;  3VG2 A;  1OEE A;  1YP6 A;  1ERX A;  4GJS A;  2KTS A;  2AT6 X;  2MM3 A;  2OY8 A;  2C4I A;  3NQK A;  3WXQ A;  2IZK A;  1G7N A;  1VWH B;  1Y53 X;  4GU8 A;  2RTL A;  3FA7 A;  1TOU A;  3BU9 A;  4Y59 A;  4HFO A;  1X8U A;  5IRW A;  5AQ6 A;  3EW1 A;  4IB9 A;  2M4L A;  2P8G A;  1SWD A;  1KOI A;  1RXK A;  2CM4 A;  2WR6 A;  4ZCB A;  3MBT A;  3RKG A;  3ZW1 B;  1VWI B;  5FQ6 E;  3RDM A;  3S26 A;  3VHH A;  3H3I A;  4ZHH A;  1CBS A;  4AZP A;  4ZH6 A;  2K23 A;  4OEM A;  5HZ8 A;  1LDQ A;  2X32 A;  3AEH A;  2IZL B;  5D8J A;  5D4A A;  4GRJ A;  4INN A;  2OY7 A;  2RCT A;  2OFM X;  1EIO A;  1PTS A;  4CV7 A;  2CBR A;  2BC3 A;  2BS5 A;  1D2U A;  1Y9L A;  4CDE A;  5L3Y A;  3B2H A;  1QWD A;  4GDZ A;  5IO5 A;  1VWB B;  2MJI A;  3Q6L A;  3FW4 A;  3WYP A;  1KZW A;  4IMN A;  2I5V O;  1HMS A;  3IFB A;  2OF8 A;  2X8S A;  3NX2 A;  1KZX A;  1STR B;  1VWO B;  2AMM X;  1CRB A;  5AJC A;  4ZR2 A;  5D45 A;  5HCD C;  2WQ9 A;  4Y0Q A;  3WZN A;  3VHM A;  3SOT A;  5D47 A;  3SLO A;  3S5X A;  3OE3 A;  2BSZ A;  4U9C A;  2MWH A;  2QO4 A;  5LJG A;  4BX6 B;  4I60 A;  5BYP A;  1S44 A;  1I04 A;  3TF6 A;  2G79 A;  3NPO A;  4QGW A;  3P6C A;  2GTF X;  1O8V A;  4N7D A;  5F6B A;  3S60 A;  3ZUI A;  2CZT A;  1RAV A;  2QMI A;  1S7D A;  3P6D A;  5H9K A;  1IKE A;  4IAX A;  2E4J A;  5B29 A;  2FTB A;  2JOZ A;  4TLJ A;  5F58 A;  1RXH A;  4A1Y A;  4DQ3 A;  5C0N A;  2FLJ A;  5H9N A;  3NQ9 A;  5LKF A;  4FBO A;  3O22 A;  3HWE A;  4ON1 A;  2VFC A;  1SXW A;  2L9C A;  2GH7 A;  1STS B;  2FHL A;  2RTA A;  1OEK A;  2LBV A;  3VU1 A;  4MIR A;  3FDC A;  3FW5 A;  4KT5 A;  1URE A;  3DSZ A;  4BBO A;  3HTY A;  1SRE A;  1N9M A;  2W2B A;  1GX3 A;  3F8A A;  1LID A;  4XMF A;  3HWG A;  1I78 A;  1GT5 A;  4DQ4 A;  3FA6 A;  1JMX A;  1Y9T A;  2JU3 A;  4OS0 A;  1JQP A;  1SY2 A;  2IZF B;  4ZHF A;  1SWA A;  1X8O A;  3PQU A;  4TKJ A;  2ZAI A;  3WJB A;  1HXZ A;  4LZU A;  4ML7 B;  2IFB A;  4NP1 A;  2FGS A;  4COT A;  5HZ5 A;  3ZUO A;  4HWM A;  1H91 A;  2MF6 A;  2LFO A;  1SXU A;  4BJ8 A;  5LJB A;  1KL4 A;  2FS7 A;  3JQO A;  1VWN B;  2LKK A;  4ZHC A;  4M7M A;  3GE2 A;  3ZQ3 A;  3MM0 A;  4BX5 B;  2HKD A;  2OL8 O;  1MOY A;  2WEW A;  2G8C O;  5F6Z A;  1MEP A;  2DM5 A;  2LA7 A;  4C5P A;  1JMZ A;  3T6F A;  1HBP A;  4GJV A;  4YDB A;  4ODD A;  5L8O A;  1RLB E;  1RXJ A;  2JW1 A;  2L67 A;  5CYB A;  3WZQ A;  1W6F A;  1X8P A;  5HTD A;  1BBP A;  2NP1 A;  4CDD A;  4OS3 A;  3Q34 A;  1LCV A;  2HYS A;  1LIB A;  1RST B;  3P6G A;  4GNY A;  3SZJ A;  4EDE A;  2R73 A;  1A2D A;  2X8F A;  3FEK A;  3WJG A;  4ZFX A;  5HBS A;  5CHK A;  2QO6 A;  5K67 A;  1PBY A;  1B0O A;  4BGF A;  2GTL O;  5B5G A;  4CK4 A;  4Z28 A;  5HWZ A;  5LJE A;  1DF8 A;  4YDA A;  1I4U A;  4GGT A;  1LF7 A;  4BX5 A;  1ZNG A;  1SRJ A;  1B56 A;  4O49 A;  4YCE A;  1SWK A;  1NGL A;  1BJ7 A;  2RTH B;  1LIF A;  1SRF A;  5HZQ A;  4Z2O A;  1LCZ A;  4XMD A;  4U8U O;  1NP1 A;  1ERB A;  1AVD A;  3KFH A;  4XMG A;  3V8U A;  5BVT A;  1DV9 A;  4YKM A;  1SWT A;  5LKE A;  3PQS A;  3BX8 A;  5LJH A;  5IXG A;  4IB7 A;  2A2G A;  4CPE A;  5LJD A;  1AQB A;  2OY5 O;  4NW4 A;  1ZNE A;  5EDC A;  3VE1 A;  3OD9 A;  2WWP A;  2R56 A;  5LJK A;  1R0U A;  1PM1 X;  2RTC B;  3AUM O;  2JGS A;  1BLR A;  1SWB A;  3KFI A;  1EQD A;  5CSE A;  4K19 A;  5EPQ A;  4O4O A;  2AKQ A;  2ALL X;  1SMP I;  1E2T A;  1W4T A;  4MVK A;  3STM X;  1G74 A;  1HQQ A;  1N7Y A;  5EZ2 A;  1KT6 A;  1FEM A;  5IO6 A;  1SRI A;  1IW2 A;  3KQ0 A;  2RTO B;  1ML7 A;  3CWK A;  2VFB A;  1L6M A;  3BX7 A;  3E3C A;  4UU2 A;  2F09 A;  1KXO A;  2OVE A;  1BRQ A;  1JIW I;  2RTK A;  3VG7 A;  1VWF B;  3SAO A;  4WFU A;  1VWC B;  4OS8 A;  3NP1 A;  4ES7 A;  4U3Q A;  1UYN X;  2KTD A;  1AB0 A;  3HWF A;  2X45 A;  2AVI A;  4IAB A;  2X46 A;  2QO5 A;  1BSQ A;  4YMY A;  1KL3 A;  4JHQ A;  3RY1 A;  4Z6J A;  1T68 X;  2RTP B;  4KC7 A;  4BOE A;  4ORS A;  4OEL A;  4OMW A;  4BCS A;  3CKF A;  2IZG B;  4NLJ A;  1RSU B;  3NBX X;  3FIQ A;  1T0V A;  1B8E A;  5H9L A;  4B55 A;  1E02 A;  3JSQ A; 
#chains in the Genus database with same CATH homology
 1GX9 A;  3ZW0 A;  2CZU A;  5DG4 A;  1OPA A;  1D3S A;  2YMS A;  3HOL A;  3FR4 A;  4I3B A;  1OBU A;  3P6H A;  1OEJ A;  4GET A;  4EXZ A;  1BEB A;  2AT8 X;  1SY0 A;  1YWD A;  1DC9 A;  1JYJ A;  2W2A A;  1X8Q A;  4YFQ A;  5HTE A;  3FR5 A;  2X8T A;  1LPJ A;  1ADL A;  1QY1 A;  1S2P A;  3FLL A;  4O9S A;  1B4M A;  2NNE A;  1VPR A;  4ORR A;  5F7G A;  4XMC A;  4O4X A;  1G5W A;  1FE3 A;  2RD7 C;  4YCH A;  5HZ9 A;  1X8N A;  4GH7 A;  2L68 A;  3VG5 A;  3ZW1 A;  4ORU A;  1LFO A;  1QY0 A;  3VG6 A;  2RA6 A;  1E06 A;  1OPB A;  3BU1 A;  4ID2 A;  4Y0S A;  1ZNK A;  3IA8 A;  4IB6 A;  1ICN A;  3G7X A;  1ZNL A;  3UEW A;  1BM5 A;  2G78 A;  4FBR A;  1JBH A;  4AYH A;  4Y0R A;  4WHI A;  4O3X B;  5FFH A;  4I9R A;  4NNS A;  3BSZ E;  5FEN A;  3RWX A;  4QYP A;  3C77 X;  1I06 A;  1YWC A;  2LBA A;  5HZ6 A;  3U03 A;  4YFP A;  5D48 A;  3FEN A;  4TJZ A;  4MVE A;  1ZRY A;  3WBG A;  1XCA A;  4IMO A;  3MVF A;  2Z4I A;  5AJB A;  4BQU A;  3APX A;  4D6B A;  3EMM A;  1OBQ A;  1CBR A;  4XMH A;  1X71 A;  4YH0 A;  1VYF A;  1PBO A;  2QOS C;  2ZAG A;  4FBV A;  4QAE A;  3BS2 A;  1TOW A;  2MHD A;  4O3Y A;  4O3Z A;  5EED A;  4A1Y A;  3GAQ A;  3PEC A;  1PEE A;  1A3Y A;  1EPA A;  1KT4 A;  1MX7 A;  2ACP X;  2AT3 X;  2W2F A;  3WJF A;  5KHP A;  2ANS A;  5KIC A;  2Q39 A;  3CBS A;  3BRN A;  2BLG A;  3PED A;  4IB8 A;  1HBQ A;  1AVG I;  4QGX A;  1JJX A;  2BT9 A;  1SY1 A;  2XKL A;  3EBW A;  3EYC A;  3MX7 A;  5HA1 A;  4AZN A;  4BVM A;  3OJY C;  3ELZ A;  3O19 A;  2HMB A;  3KFG A;  4ZHG A;  3KFF A;  1E5P A;  4NYR A;  5CE4 A;  2OZQ A;  1U0X A;  1CBI A;  1FDQ A;  1OBP A;  1QFT A;  3BY0 A;  4I6S A;  2ACO A;  4A60 A;  4ZH9 A;  2CM9 A;  4OMX A;  2KD2 A;  4ARH A;  5HA0 A;  1DFV A;  1IFC A;  3EBK A;  2AT5 X;  1EII A;  1IFB A;  1JYD A;  4I9S A;  4MIS A;  3P6E A;  1GXA A;  2HLV A;  3NAD A;  3WJC A;  2OVA A;  1BSY A;  2AT0 X;  1U18 A;  3D97 A;  2QM9 A;  2FS6 A;  4ORX A;  4KC8 A;  1QY2 A;  3FEP A;  1XKI A;  5KID A;  3RZY A;  3VE2 A;  4L1N A;  3QKG A;  4ZGU A;  3NX1 A;  2F73 A;  3C78 X;  2BS6 A;  3C76 X;  2Q2P A;  4YGZ A;  4GZV A;  1I05 A;  4NYQ A;  2KW1 A;  1KT3 A;  4GE1 A;  4EEJ A;  4WFV A;  1HMT A;  4HPC A;  4XME A;  5BVQ A;  3RBY A;  4LKP A;  4IBA A;  3D95 A;  3L4R A;  4I3D A;  5F1E A;  1YP7 A;  1LIE A;  2EU7 X;  3HWD A;  3P24 A;  3PH6 A;  1GKA B;  2CBS A;  1KQX A;  2FWV A;  3PH5 A;  1QQS A;  2ASN X;  5L8N A;  2HZR A;  3WOV A;  3S5V A;  3CQN A;  1ZNH A;  2GJ5 A;  4A8Z A;  4AZM A;  1YIV A;  2RCQ A;  3NQ3 A;  5HCE C;  4TQ2 A;  4YGG A;  3RSW A;  3ELX A;  1O1U A;  4NNT A;  4QZT A;  3ZZV A;  4HPD A;  1YUP A;  3VPJ E;  1ZND A;  2FRS A;  3FYF A;  1LIC A;  5L8I A;  3CBC A;  1SXX A;  4KII A;  2NNQ A;  2WSJ A;  2RN4 A;  1GKA A;  5K06 A;  3FA9 A;  4FQB B;  3WJE A;  2GC9 A;  4QYN A;  3ZI8 A;  3APU A;  3P6F A;  4L3R A;  5FAZ A;  1JV4 A;  3K3L A;  3FR2 A;  4JGL A;  4QRL A;  1QAB E;  1KQW A;  5JR8 A;  1TVQ A;  1QG5 A;  3FEL A;  1KGL A;  4WBK A;  4HPA A;  5DPQ A;  3VG3 A;  5H8T A;  3TGA A;  1IIU A;  2A3F X;  3B2L A;  4RUN A;  4PSQ A;  1DZJ A;  5EEE A;  1N0S A;  1SXY A;  1TW4 A;  1JJJ A;  4MVL A;  2HZQ A;  2Q2M A;  1UZ2 X;  4EQA C;  2BHV A;  4GNW A;  4EFG A;  2GTL N;  4QZU A;  1BRP A;  2NND A;  1SY3 A;  5AEO A;  1IKJ A;  1BWY A;  4N7C A;  1MX8 A;  3FMZ A;  1GX8 A;  1A18 A;  4ORW A;  4U8U N;  2A13 A;  4LZV A;  3KZA A;  3N91 A;  3APW A;  4IAW A;  4GK9 A;  4CSB A;  4AZR A;  3AKN A;  1RBP A;  5H9A A;  4M6S A;  4TKH A;  1QFV A;  1HQP A;  3AKM A;  4AW8 A;  3ZW2 A;  4I95 A;  3D96 A;  2OFR X;  3ZWE A;  1CJ5 A;  3LHN A;  3LV4 A;  2Q9S A;  2KT4 B;  4YBU A;  1DZP A;  3UEU A;  4LQZ A;  1GT1 A;  1PMP A;  2A2U A;  2Z4H A;  2AL0 X;  1MDC A;  3OBL A;  3U0D A;  1YWA A;  3F9D A;  3JS1 A;  3P02 A;  2JMB A;  3WJD A;  3T1D A;  1FTP A;  1U17 A;  2A0A A;  4ZHD A;  3U9P C;  3B2K A;  4KH8 A;  1ACD A;  1NP4 A;  5LJC A;  2GTL M;  2WEX A;  4QNI A;  1ICM A;  4O3W A;  1KT5 A;  2FT9 A;  1GGL A;  1KT7 A;  1E00 A;  2FR2 A;  3STK A;  4O4U A;  4U8U M;  1MUP A;  3CR6 A;  2OVS A;  3CQR A;  3STN A;  1LNM A;  2JU7 A;  1A57 A;  4QGV A;  3PP6 A;  2JN3 A;  4PJ2 A;  3UAQ A;  2L5P A;  3BLG A;  5FQ8 E;  4ALB A;  4YGH A;  4ZJ0 A;  1BSO A;  1DZK A;  1X89 A;  3DTQ A;  4AZO A;  3VG4 A;  4QQ1 A;  5FQ7 E;  4YBP A;  2XST A;  4TKB A;  1AEL A;  2LB6 A;  4ZGF A;  3BDR A;  1JZU A;  3D4R A;  2RQ0 A;  1CBQ A;  4GKC A;  3HOE A;  1HN2 A;  3EM0 A;  2OVD A;  4LKT A;  3TZS A;  4HPB A;  4RUU A;  2JU8 A;  1DF3 A;  3FA8 A;  4AZQ A;  1G85 A;  4ORY A;  1EI5 A;  1O1V A;  1DZM A;  2YG2 A;  4FGI B;  3HK1 A;  4TNN A;  3WVM A;  3B2I A;  4I3C A;  1FEL A;  3APV A;  4YKO A;  4A1H A;  4O4S A;  2Q4N A;  1EAL A;  1GT4 A;  3B2J A;  1FEN A;  1GM6 A;  4UU3 A;  1LKE A;  2HNX A;  1SA8 A;  2MO5 A;  5IO7 A;  2AH7 X;  4ALO A;  3TGB A;  2POA A;  3I0A A;  2PY1 A;  2FR3 A;  5EDB A;  3I17 A;  2G7B A;  3UEV A;  1T8V A;  1TXL A;  1EUO A;  1Z24 A;  4Y0P A;  4NLI A;  3NR3 A;  4D6A A;  3CMP A;  2N93 A;  3PPT A;  5B27 A;  1HMR A;  3UEX A;  1GT3 A;  1MVG A;  2R74 A;  4MVI A;  2WQA E;  3TGC A;  1P6P A;  5HAE A;  3ZW0 B;  1ALB A;  1EPB A;  5BVS A;  1EW3 A;  2WUT A;  4KCA A;  3O2Y A;  1YWB A;  1EXS A;  2K62 A;  4YFR A;  3F6Z B;  5HCC C;  3VG2 A;  1OEE A;  1YP6 A;  1ERX A;  2KTS A;  2AT6 X;  2MM3 A;  3NQK A;  3WXQ A;  1G7N A;  4GU8 A;  3FA7 A;  1TOU A;  3BU9 A;  4HFO A;  1X8U A;  5AQ6 A;  4IB9 A;  2M4L A;  2P8G A;  3RKG A;  1KOI A;  2CM4 A;  4ZCB A;  2WR6 A;  3MBT A;  3ZW1 B;  5FQ6 E;  3S26 A;  3H3I A;  4ZHH A;  1CBS A;  4AZP A;  4ZH6 A;  2K23 A;  5HZ8 A;  5D8J A;  5D4A A;  4GRJ A;  4INN A;  2RCT A;  2OFM X;  1EIO A;  4CV7 A;  2CBR A;  2BS5 A;  1D2U A;  1Y9L A;  3B2H A;  1QWD A;  4GDZ A;  5IO5 A;  3Q6L A;  2MJI A;  3FW4 A;  1KZW A;  4IMN A;  1HMS A;  3IFB A;  2X8S A;  3NX2 A;  1KZX A;  5AJC A;  2AMM X;  1CRB A;  4ZR2 A;  5HCD C;  5D45 A;  2WQ9 A;  4Y0Q A;  3SOT A;  5D47 A;  3S5X A;  3OE3 A;  5LJG A;  4U9C A;  2MWH A;  2QO4 A;  5BYP A;  1S44 A;  1I04 A;  3TF6 A;  2G79 A;  3NPO A;  4QGW A;  3P6C A;  2GTF X;  1O8V A;  4N7D A;  5F6B A;  3S60 A;  3ZUI A;  2CZT A;  2QMI A;  1S7D A;  3P6D A;  5H9K A;  1IKE A;  4IAX A;  2E4J A;  5B29 A;  2FTB A;  2JOZ A;  4TLJ A;  5F58 A;  4DQ3 A;  5C0N A;  2FLJ A;  5H9N A;  3NQ9 A;  5LKF A;  4FBO A;  3O22 A;  3HWE A;  4ON1 A;  1SXW A;  2L9C A;  1OEK A;  2LBV A;  3VU1 A;  4MIR A;  3FW5 A;  4KT5 A;  1URE A;  3DSZ A;  3HTY A;  2W2B A;  3F8A A;  1LID A;  4XMF A;  3HWG A;  1T0V A;  1GT5 A;  4DQ4 A;  3FA6 A;  2JU3 A;  1Y9T A;  4OS0 A;  1SY2 A;  4ZHF A;  1X8O A;  3PQU A;  4TKJ A;  2ZAI A;  3WJB A;  4LZU A;  4ML7 B;  4NP1 A;  2IFB A;  4COT A;  5HZ5 A;  3ZUO A;  4HWM A;  1H91 A;  2LFO A;  1SXU A;  5LJB A;  2FS7 A;  3JQO A;  2LKK A;  4ZHC A;  4M7M A;  3GE2 A;  3ZQ3 A;  2WEW A;  5F6Z A;  2DM5 A;  2LA7 A;  1HBP A;  4YDB A;  4ODD A;  5L8O A;  1RLB E;  2JW1 A;  2L67 A;  5CYB A;  1X8P A;  5HTD A;  1BBP A;  2NP1 A;  4OS3 A;  2HYS A;  1LIB A;  3P6G A;  4GNY A;  4EDE A;  2R73 A;  1A2D A;  2X8F A;  3FEK A;  3WJG A;  4ZFX A;  5HBS A;  2QO6 A;  1B0O A;  2GTL O;  4CK4 A;  5HWZ A;  5LJE A;  4YDA A;  1I4U A;  1LF7 A;  1ZNG A;  4O49 A;  1B56 A;  4YCE A;  1NGL A;  1BJ7 A;  5HZQ A;  1LIF A;  4XMD A;  4XMG A;  4U8U O;  1NP1 A;  1ERB A;  3V8U A;  3KFH A;  5BVT A;  1DV9 A;  4YKM A;  5LKE A;  3PQS A;  3BX8 A;  5LJH A;  4IB7 A;  2A2G A;  5LJD A;  1AQB A;  4NW4 A;  1ZNE A;  5EDC A;  3VE1 A;  3OD9 A;  2WWP A;  2R56 A;  5LJK A;  1R0U A;  1PM1 X;  1BLR A;  3KFI A;  1EQD A;  1E02 A;  4K19 A;  5EPQ A;  4O4O A;  2AKQ A;  2ALL X;  1SMP I;  4MVK A;  3STM X;  1G74 A;  5EZ2 A;  5IO6 A;  1KT6 A;  1FEM A;  1IW2 A;  3KQ0 A;  1ML7 A;  3CWK A;  3E3C A;  1L6M A;  3BX7 A;  4UU2 A;  2F09 A;  2OVE A;  1KXO A;  1BRQ A;  1JIW I;  3VG7 A;  3SAO A;  4WFU A;  4OS8 A;  3NP1 A;  4ES7 A;  4U3Q A;  2KTD A;  3HWF A;  1AB0 A;  4IAB A;  2X45 A;  4R0B A;  4YMY A;  2X46 A;  2QO5 A;  1BSQ A;  1T68 X;  4KC7 A;  4BOE A;  4ORS A;  4OMW A;  4NLJ A;  3NBX X;  3FIQ A;  1VYG A;  1B8E A;  5H9L A;  2O62 A;  3JSQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...