3BXXA

Binding of two substrate analogue molecules to dihydroflavonol 4-reductase alters the functional geometry of the catalytic site
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
324
structure length
324
Chain Sequence
ETVCVTGASGFIGSWLVMRLLERGYTVRATVRDPTNVKKVKHLLDLPKAETHLTLWKADLADEGSFDEAIKGCTGVFHVATPMDFESKDPENEVIKPTIEGMLGIMKSCAAAKTVRRLVFTSSAGTVNIQEHQLPVYDESCWSDMEFCRAKKMTAWMYFVSKTLAEQAAWKYAKENNIDFITIIPTLVVGPFIMSSMPPSLITALSPITGNEAHYSIIRQGQFVHLDDLCNAHIYLFENPKAEGRYICSSHDCIILDLAKMLREKYPEYNIPTEFKGVDENLKSVCFSSKKLTDLGFEFKYSLEDMFTGAVDTCRAKGLLPPSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dihydroflavonol 4-reductase
publication title Structural evidence for the inhibition of grape dihydroflavonol 4-reductase by flavonols
pubmed doi rcsb
source organism Vitis vinifera
molecule tags Oxidoreductase
total genus 100
structure length 324
sequence length 324
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.1.1.219: Dihydroflavanol 4-reductase.
pdb deposition date 2008-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3bxxA00
1U2DA 1K5HA 4HADA 1MXHA 1ZCJA 4BB6A 5CG2A 3AWDA 4B79A 3IDSA 5CDTA 4E2WA 4B8WA 1V0JA 4CQMA 1E92A 4PLFA 1B8VA 1ZIDA 4U6QA 4QFDA 4EJ0A 4IZHA 2AG8A 3S55A 4BMSA 5IN4A 4WASA 2P4QA 3WGOA 1CETA 2FR8A 1P1IA 1LSJA 3FTNA 4XD2A 4A73A 4CMIA 3QWBA 1B15A 5K6AC 3TZCA 3OSUA 2ZQYA 4KWHA 3AW9A 2UYYA 5IAAA 3G49A 5CDGA 4NBTA 3IJRA 3WGYA 1PGQA 4TRMA 1PZEA 4AJ2A 2NSDA 3F5QA 3Q1LA 4FOOA 4R4JA 4YRDA 5IDYA 1LDNA 4GX1A 1C0IA 3UCFA 3S2FA 3DTTA 4GSKA 4IS3A 3A06A 5ER6A 2X5JO 4AJNA 2D5CA 4R16A 4U0JA 3GAFA 2QG4A 1M75A 5JDIC 1YWGO 4XQCA 3TSCA 2ZJ0A 1ZH8A 4LSMA 3K5PA 3WB9A 1ONPA 2DTDA 3I3OA 5C7LO 2RHCA 5I7VA 4TVBA 1D1SA 5JYEA 3DZKA 3TOZA 1OAAA 1W8DA 3EYWA 5AXAA 1UXGA 2Q4BA 1L7DA 4DC0A 3GFGA 4WNIA 1GV0A 3WS7A 1EVZA 1GQ2A 1H94A 1HDRA 3GA0A 3U4IA 5JBIA 4A10A 3QA9A 1CF2O 4RQUA 4NI5A 1HE2A 3D5QA 1HRDA 4Q3CA 3N58A 1ZSVA 3ROPA 2PNFA 2GN9A 4L9RA 4CLRB 3FPLA 4CLEA 1TT7A 2O3UA 3VHRA 1NQAO 4ND1A 1NVMB 3PPIA 4AJLA 1J49A 2G76A 4Z0HO 2EJVA 2VYVD 3MTGA 4D3DA 4ONEA 1XQ1A 2ZKLA 3ITDA 4CQLB 4E4YA 5C5IA 2GGSA 1G0OA 4Y8VA 2JKVA 4YEDA 5JC8A 3DZIA 3V2UA 3JQ9C 2G5CA 4BO7A 4MVJG 4RF2A 2W2LA 4U0KA 5DOZA 3HZZA 1LRKA 5KKAA 3S8MA 4CODB 3BYZA 3RJ9A 3WBFA 2DUUA 2OP0A 4IIUA 4OL9A 2C59A 3I83A 3NGXA 2HLPA 3H9GA 5JO0A 2W2KB 4CLRA 1V35A 4J6FA 1PQPA 3KBOA 4YJDA 5BQFA 1ZXBA 3DAGA 1PZHA 4XQ9A 4E5PA 4YQYA 4E33A 4S3MA 1I2BA 4CQLA 1QYWA 3ASUA 5THQA 1PJLA 5JAIA 3LDHA 3RJ5A 2Q99A 3PHJA 4EW6A 1XSEA 3RBVA 4CL3A 5BNIA 4HY3A 2PA3A 4K6FA 4WLEA 3JD1A 4J43A 4BNFA 2NU9A 4PFJA 1I36A 3PZBA 3L4BA 2QX7A 5EL0A 4NG5A 3RUEA 3DZGA 4HFNA 3I52A 1WDMA 4J4TA 2W2KA 1SCUA 1X13A 4HWKA 2ZATA 4JP3A 5FEUA 4D0SA 3OJOA 2GNAA 1ISGA 4N54A 4EGFA 1YXMA 5TGDA 2E4AA 2C5AA 3ZNQA 1ZXLA 4OH1A 1I10A 3GG9A 4LCEA 4RPKA 1V3UA 4BNXA 5G0VA 4ND2A 5FWNA 1P1JA 1XEAA 3EHEA 4Z6KA 1ULSA 3DBLB 1JA9A 4NU5A 3GZ4A 3MTJA 1CQIA 3GN1A 3OHSX 4J49A 1JKJA 2FSVA 3VDQA 2D3TA 3BMOB 5LCXA 3RC1A 4Z3DA 1PJ3A 5AOVA 1IE3A 2E37A 3HDYA 1ZJYA 3ORFA 4HFRA 9LDBA 4CMGA 1FJHA 3QJ5A 3GUYA 1ZK3A 5AXDA 5ITVA 1H6CA 1HF3A 3I1JA 5TJ9A 5K0ZA 1YQGA 3W4JA 3UVEA 2O50A 4LN1A 3U09A 4IZIA 3U9LA 4CMKA 1JDJA 1LJ8A 1X7HA 3G3EA 4JN6B 5LDGA 3PYLA 1GU7A 4AL4A 1P1RA 1D7OA 5J23A 4LW8A 5F5NA 1LDYA 3M1LA 4CUKA 3DBLA 1WXDA 5A05A 3FRJA 3KO8A 3NAQA 4YJFB 4JQCA 3BTOA 4INAA 1Z73A 2O3QA 4CL8A 1C3VA 3BMOA 4HBGA 3SLKA 4J7CA 4IJWA 3WMWA 2H6EA 4A7PA 2OORA 5EQDA 1PJ2A 3AOEC 1V9LA 1YJ8A 3WLEA 4XQGA 3KB6A 3LC2O 5JDCC 3RUHA 2QHXA 5F21A 3QE3A 1M6HA 2I6TA 2VT3A 3ZH2A 3BTUA 3GDGA 5DCWA 5JO9A 2ZYGA 4RVHA 1N8KA 2EJWA 4FFRA 3KYBA 3ZU2A 4E5NA 2LDBA 2VQ3A 5U9CA 1SZJG 1LC0A 2YQ5A 3VPGA 4ZRNA 5L51A 1Z75A 1GEGA 5F1KA 4K1LA 2B83A 3LVFO 4YJFA 2YYYA 1GPDG 2WM3A 4DPLA 3GEMA 4KP7A 5LC1A 1I0ZA 4E32A 1P33A 1R12A 2Y1CA 3E9MA 2YFHA 4TKLA 2NVUB 1EBFA 1I3KA 2FPPA 2VZ8A 4BKOA 1HT0A 1NAIA 1PL6A 2YQ4A 3FNEA 3JYOA 4TKMA 4I1IA 1LQUA 1SEVA 1TEHA 2GR9A 4J2HA 4R9SA 2DT5A 2XOXA 1ISJA 2Q4EA 3S1LA 3AM5A 5HA5A 5L4SA 3PVZA 3TL2A 4E13A 4LVUA 4GLOA 1EE2A 3RU7A 3VC7A 3DAPA 4XB1A 4BNZA 4DREA 3V5NA 2I67A 1DXYA 1U3VA 1GFSA 1HXHA 2UUPA 3OJEA 4GGPA 4E6PA 5CHEA 2NVUA 1OFGA 4S1VA 5IN5A 5I9NA 1WMAA 3KRTA 4R01A 2PTGA 1B14A 1XCBA 4J9UE 4HKTA 4Y6SA 2NADA 3PHLA 4Q3EA 1ARZA 4BNTA 3OIFA 1ENPA 4BKPA 1I3LA 3EVNA 4IM7A 1QYXA 2FR1A 4R5HA 1A71A 1NXQA 3RCBA 4ALNA 1NVGA 1PS9A 3E82A 3PJGA 3RUCA 5DBIA 1NPYA 4NJMB 4UEOA 2I5PO 2O3TA 1VSUA 3H9EO 1Y5MA 1T2AA 2H5LA 2PKQP 4Z9XA 2O4CA 4BNVA 3TWOA 1IYZA 4Q3BA 3NDRA 3QW2A 4PRKA 4WLOA 4E0BA 1C0LA 2DLDA 2BFMA 3PLNA 2EP7A 2OFPA 4KQXA 4E2XA 1IB6A 1G0NA 1FMCA 2YFQA 4YT5A 4WPGA 3VH2A 4RDIA 3VDRA 2PV7A 2HKIA 4M1QA 1J6UA 5JAMA 1BXZA 1RM4A 3DZBA 2WWRA 4Q3DA 3JQGB 4FS3A 4XYEA 1ENZA 3KOUA 4L8VA 1PJTA 4W7HA 4TWRA 1YJQA 1P45A 4NJMA 4UVDA 4ZQGA 5T8KA 2ZQZA 3IOYA 4WK6A 3MJSA 3NJ8A 3L6OO 1HDZA 4YPOA 5CG1A 1IULA 2X86A 4R54A 4OHUA 3QWAA 2CSUA 2C54A 5AXBA 5JMPA 4L74A 3NV9A 2EHDA 3A14A 3W6UA 3ZU5A 4EUEA 1UZNA 3VZPA 3E6AA 3STHA 2NTNA 1F0YA 3WNVA 3JQGA 2DBQA 2YUTA 3BHMA 3GEDA 1N1EA 1T1SA 2X9GA 1YQXA 4NK5A 5C7OO 5KCZA 3PYXA 4IGFA 4DQUA 2PK3A 1DC4A 4BNGA 4RL6A 1F06A 3LF1A 3GHHA 4HUJA 1ZMOA 4HFJA 4EYEA 4RJTA 2PZMA 5KVSA 4CMCA 4NU6A 2OO5A 3HN7A 2AE2A 2Q50A 3JYNA 4DYVA 3F6YA 5FFFA 3AFMA 1BDBA 4TZTA 2IZ1A 4PZDA 4TRJA 3TJRA 4XEHA 1LQTA 1WLYA 3PI7A 3AUSA 1Y81A 1ISMA 5JCXA 3GK3A 3ZWNA 2Q1SA 2VYNA 3L9WA 3QRWA 1O0SA 4K9DA 1N7HA 5DOVA 3AI1A 3JYLA 1I2CA 3EGOA 3TZKA 2IEBA 3MZ0A 1ADGA 4PVCA 3IC5A 2VTEA 3A1NA 3ZV4A 1DIAA 1XWFA 4CUJA 5A9TA 4URFA 5G2OA 1ONNA 1JKFA 3UHAA 4AJ1A 4MP8A 4BGEA 4CLXA 1ZUD1 4M55A 4O1MA 4E30A 2FRDA 2J3JA 1Q1NA 1EQ2A 1RM3A 2RH4A 1QSGA 3C7DB 3QP9A 2HMSA 4RPHA 2PKRA 4GH5A 5CAEA 2BI7A 3E1KA 5EN4A 2SCUA 3NTRA 3PZRA 2X7HA 3GNQA 4RO0A 1PS8A 3U5TA 4LRSB 2XAAA 3TOXA 2Y0EA 2BHLA 5JE8A 4BNJA 2Q1TA 1M76A 5EERA 3GVPA 3RQSA 1CRWG 2GYYA 1ZVMA 4N5NA 5B1YA 1XIVA 3RC7A 4ND4A 3RKRA 5COBA 1EQUA 3WIEA 2C7VA 4A2CA 3U4DA 1DSSG 2DU8A 2JFGA 1EBUA 5AYVA 2Y05A 5DDIP 4CLDA 3KSDO 3LT1A 4ZQHA 1E5LA 2WEKA 3I9JA 1P1HA 3KEOA 1M6WA 3R0IA 4KUEA 4BO0A 1UP7A 3CSDA 5BNFA 7MDHA 4W99A 2ZB4A 2VRCA 3PHIA 3BTVA 3JQAD 5DP2A 1E6WA 1TT5B 4YAKA 1I01A 3KSUA 2E48A 3K31A 2BFAA 4UVEA 3PQDA 3SJ7A 3FBTA 4O0LA 4YACA 1DEHA 1QORA 5L7YA 4XQEA 4NQZA 3GAZA 3IQDB 4E5YA 4KWIA 2AHRA 3RFXA 1LTHR 3BZUA 4A26A 3BHJA 4L4RA 1PJBA 4R9RA 8LDHA 2Q45A 3I23A 2ZYDA 3MOIA 3QQPA 1A7KA 4HX5A 4PLPA 4E2YA 5GZ1A 3W1VA 2PZJA 1B7GO 1KY4A 3ST7A 2X9VA 1FXSA 1D8AA 4JNKA 3WR5A 1TT5A 1YDWA 5A5EA 3WICA 1DPGA 3D3WB 3IUSA 2X4GA 4MVJD 4BNYA 4ILKA 1FDVA 1PGOA 4M87A 2Y99A 2YV3A 1XU9A 4FJ1A 2X0JA 4BMVA 1GDHA 1Z82A 1QYDA 2C5EA 4GL4A 4YR9A 3CEAA 4DWVA 1X1TA 1GTMA 1LLDA 2VNAA 4TRRA 3VH1A 4EEZA 3VZSA 4UVIA 2RBEA 4IDGA 5GY7A 1ENYA 4AJOA 4L0QA 1PGNA 3FD8A 1VI2A 4YT2A 1WNTA 4JCOA 1IPFA 3PTZA 2O23A 4NBVA 4UVGA 4PLVA 5ITWA 5JPIA 2BELA 1V3TA 1YB1A 4BGVA 4ZQEA 3D3WA 3WQQA 3P7MA 5KWEA 3CIFA 1DIHA 4JIGA 1GL3A 3L07A 4FGWA 3ZGYA 3F9IA 3RVDA 1PGJA 1RPNA 4R1NA 1HYGA 2TMGA 1XU7A 1HEUA 2GZ2A 1KVSA 5IDWA 2NWQA 2BGMA 3AY7A 2I3GA 1P1FA 1BSVA 1K2WA 1ZFNA 2BD0A 4U8GA 1W4ZA 4WECA 4BKQA 3PYMA 3GRKA 1ISHA 3JCZA 3DBRB 3HE3A 2NU8A 3KZVA 4BO3A 3HDQA 3S2GA 4BV9A 1UP4A 4HP8A 1ZBQA 3LZ6A 3L6EA 2HRBA 4FPXA 1XDWA 2EIHA 3ANMA 5CPBA 1B16A 1U7HA 1JWBB 3K6JA 3EMKA 3K30A 4J1NA 1H0KA 4U7WA 3U4CA 2HMVA 2FZWA 1DIGA 5KJ6A 1O9BA 4R1TA 5KJEA 1YDEA 4B7UA 1KIFA 1R4MB 3OA2A 2DTEA 4FW8A 1GZ4A 1K89A 3OA0A 2B4TO 4J1TA 2GN8A 5T8KC 1NWCA 5ENVA 4E31A 3UF0A 3DOJA 1UXHA 3DBRA 1VPDA 3E9NA 4KZPA 3ONEA 3C1AA 1PQWA 4JXKA 5TS3A 1O94A 2CZCA 1SAYA 4PVDA 1DIRA 1NFFA 1AN9A 1E7SA 2IRWA 2JD1A 4IGEA 2J8ZA 4XYBA 1J0XO 2QIOA 1UDAA 4E3ZA 2Y67A 3RWBA 4LISA 3S2IA 3PJFA 1T26A 5KVVA 1KVUA 1NHGA 4MIEA 3PXXA 4BO5A 4II2A 1R4MA 4J1SA 3U4HA 4OOFA 5TQVA 4PCVA 4XX0A 4EJ6A 3RU9A 3DHYA 4EDFA 5C37A 2DFDA 4BIIA 1E3EA 3D7LA 4F6CA 1K0UA 5KVQA 1OMOA 1HE5A 3HB5X 4DTIA 1AUPA 1BXGB 4GMFA 1YQDA 3IAHA 2JHGA 3ZWPA 1NWHA 2QRJA 2WJPA 5A9SB 4IINA 3JD3A 4MIYA 4J0EA 3VPHA 2VN8A 8ADHA 2R2GA 2FPIA 3ZWVA 2XXBA 4FFMA 2GF2A 4L4XA 3HSKA 3FWNA 2WD7B 4LMPA 5JY1A 1U3WA 4NMHA 1T1RA 3H5NA 3DZHA 3OF2A 3GQVA 5DN9A 3WNQA 4X54A 1RKXA 2Q3EA 5G0WA 2DC1A 2B69A 3OECA 5I7SA 3LLVA 3ZWCA 3OQ6A 3SVTA 4I9HA 3WYBA 5G0SA 2PGJA 1BXGA 2HMWA 4AJIA 4CJXA 3OJFA 1V3VA 5IF3A 3OJLA 1L7EA 2B36A 1HDXA 5IJZA 5A9SA 2P91A 4BKUA 5A06A 3E5RA 1FDSA 2X8LA 3JQFA 3LK7A 3NT5A 1UUFA 1E6EA 2VWQA 3RUFA 3BMCB 3PHHA 4DIBA 4MO2A 2WD7A 1GR0A 2D59A 2V6FA 2TMDA 1ZW1A 2QW8A 1I30A 1DBVO 1AGNA 1QG6A 4DIOA 4UAGA 1KOLA 2IODA 3ZHYA 3B1KA 3GGOA 1FF9A 2AQ8A 4XGNA 3RC2A 5COAA 2Y68A 2I99A 4JROA 5FF9A 4F45A 5B4VA 3H2ZA 1LX6A 4YJGB 5JS6A 3WWZA 5CDYA 3KEQA 3HHPA 3H9QA 5T67A 1KEWA 3BMNB 1XGKA 1MFPA 3BMCA 3QVXA 1DJNA 2V65A 1B0AA 3BMQB 4IJUA 3ADPA 4MVJP 4XR4A 5A03A 5EIOA 4PZEA 4L75A 2Q1WA 3HN2A 1WZEA 3B1JA 4QO7A 3PEFA 4DLAA 1IHYA 3E03A 1RYDA 1U3TA 5TJHA 4G81A 4AJPA 1JKIA 1Q0HA 2VZ0A 1I2ZA 4JLWA 1DDOA 3CH6A 5CPFA 3IMFA 2AEFA 1O89A 4PLGA 1PL7A 1JN0A 1PJCA 4KDFA 2YDYA 1H5QA 4YJGA 3TNLA 4XWYA 5B37A 3ZHZA 1SB9A 4OKIA 1Q7CA 1LI4A 3PLRA 2NVWA 1K6JA 2XXJA 1DAPA 3BMNA 4YDRA 4CMHA 4KOAA 3OBBA 1E3LA 1E3WB 2EKLA 1ORRA 3BMQA 3KLMX 4J7UA 4IMRA 4PG5A 2X0NA 1T2FA 1E1MA 3TRIA 2J5KA 4YA6A 2RH8A 5MDHA 2UUOA 4YAIA 1E77A 4H15A 1CEQA 4B4OA 2UAGA 1HLDA 1C14A 2NLOA 4QQRA 5KKCA 3DO5A 2BH9A 3HFGA 3WFJA 1QKIA 1E3SA 1NVTA 4ALIA 2FN7A 1AE1A 4K28A 4TRNA 1EK5A 1VJTA 3PDJA 4N18A 3C1TA 3KTDA 1NPDA 4DL9A 3A28A 5FI3A 1HDYA 2C2YA 2RIRA 4Z0PA 3GG2A 2Y1EA 2ZB8A 2ZB7A 3KYCB 1E3WA 1D4FA 1A4UA 1MC4A 4B4VA 1IY8A 1UJMA 2BFOA 5IXYA 1YS4A 3AM4A 1LDMA 5I8WA 1YH3A 3K92A 5I7EA 5IDQA 3VVCA 4QSMA 4H3VA 1TI7A 5H83A 4PG4A 4LMRA 3WGQA 3EZLA 3DHEA 1NQOA 3TQHA 4D79A 3P5SA 4UEKA 4CM9D 1HE4A 2CUKA 3X2EA 5EMHA 2JHFA 3AY6A 3L6DA 1RM0A 3AI2A 1GZ3A 2Q46A 1ISFA 1EVIA 3RIHA 2JFHA 5JFOA 1N2SA 4I5FA 2HK9A 1YONA 1MB4A 2DVMA 3KYCA 2BKAA 2BF7A 9LDTA 5JW6A 3W4KA 5THKA 3OQ1A 4P4NA 5KOIA 4XDZA 1KVRA 2HJRA 3ENKA 3ADOA 4ALMA 5JCJD 2O3RA 1XHLA 3JQBA 3E48A 4NR0A 3NUGA 2ZCUA 3F4BA 5I8ZA 5A3VA 5TT0A 3I9LA 3DMTA 2CFCA 2VCYA 5TF4A 5TLSA 3WTBA 3UW3A 1RJWA 3DBHB 5I9MA 4KUGA 4J4BA 1E1KA 1RYEA 3OJ0A 4FCCA 3TDKA 4CM8B 1KBZA 4OYRA 1EDOA 4PG7A 2QZZA 1T4DA 1TVEA 4XRGA 2IDZA 5BSFA 3PFWO 1ZK4A 4AJKA 3VTFA 1U4SA 4D41A 2D1YA 4MVJF 1UDCA 2A4KA 1E0DA 4R3WA 3H2SA 1Q7GA 1OC2A 4XKJA 3P19A 4MVJI 4Y6RA 1SOWA 3SLGA 4MOWA 1LSOA 2G0TA 3GPDG 1VM6A 3H5RA 4M8SA 4DXHA 2VWGA 2G1UA 3KV3O 3N74A 1HYEA 1PS0A 3UFXA 1P31A 1O5IA 2OHXA 3DBHA 5HM8A 5HS4A 2QZ9A 2FY8A 2X23A 4AJHA 3AY3A 4FJ0A 1XLTA 4CM8A 4J9VA 1DFHA 2JFFA 1OI7A 1C0KA 3LYLA 1F12A 5DZSA 4EBFA 1AHHA 2VHZA 4IDCA 4Z9YA 3H6KA 5CEJA 1JAYA 6LDHA 4Q3AA 1LSUA 3GR6A 4OM8A 2D8AA 4MJLA 4QT0A 5EQFA 1WAMA 4GWKA 5DF1A 1UZLA 4JBIA 3INGA 3UH1A 3VH4A 3I9KA 4JBGA 1LU9A 1VKNA 4DC1A 4P38A 3C85A 3FF4A 3ZV6A 4IJKA 3V8BA 1Z74A 1ZEMA 1W6UA 4RVSA 4DA9A 3U0BA 5A3JA 3DXFA 4NDNE 4OXNA 1ZSNA 1U1IA 4BNHA 1E7QA 2CD9A 5ICMA 2VUUA 1BG6A 2O7SA 3ON5A 4AJJA 1O8CA 4UEJA 5JYDA 3EDMA 1E3IA 4J90A 4YXFA 3Q2KA 4NHEA 4FSHA 2IZZA 1C0PA 2DTXA 3ASVA 1GQYA 1V8BA 2A94A 4FDAA 4DMMA 1F14A 3RUDA 1BWSA 4IQGA 1PR3A 4KTVE 4MKXA 2FMUA 4I9NA 1PGPA 2FHSA 1YBMA 2HCTA 4BS9A 4ZRMA 5DBFA 2O2SA 1F8FA 1Y9EA 2P68A 3KXDA 4R41A 4LGVA 1GPJA 1GYRA 4FC7A 3T4XA 4EUFA 4RQTA 4XB2A 1JU9A 3CE6A 2ZTUA 4CR6A 4ZHSA 1HYHA 3QVWA 4BO1A 2ZTMA 3ZU4A 3WGHA 2W2LD 3B70A 1DJQA 3CUKA 3BA1A 3K96A 1CWUA 2OBNA 4NIMA 2I76A 5I9LA 3QVSA 3D4NA 5L40A 3LC1O 1MXFA 3R3JA 2E6UX 3UGKA 1HDOA 5AVOA 4O63O 4UREA 5T5QA 4IXWA 3K9QO 2A35A 1WWKA 4ND3A 3PJDA 3GLQA 4XA8A 4BO8A 1OZAA 1WPQA 3Q11A 4MDHA 2GRAA 1BVUA 3AOGA 3IL2A 4ZD6A 1DIBA 3RBXA 4E2ZA 1P74A 1PJQA 1ADFA 2J5QA 1BTOA 4WJZA 2VNSA 5IXSA 5JY6A 1X1EA 2GDZA 1EVYA 3PP8A 5EJ2A 3JD4A 2Y0DA 4RGBA 4I5GA 4E12A 2P4HX 4YRAA 3INTA 2D0IA 4XDYA 1YL6A 2P9CA 3GDOA 3GPIA 1ISIA 4WEOA 2PGLA 2B35A 3IUPA 4JJGA 3EC7A 1Q7BA 1SMKA 1LA2A 4IS2A 4I08A 3JQEA 1E1NA 1MP0A 1VJ1A 2J3KA 4N5LA 4RV9A 3VPSA 4BGIA 1UR5A 5HRUA 2OXIA 2J3HA 2F00A 1HSZA 3TN7A 3IP1A 1JWAB 3COSA 3GZNB 1QYCA 3OP4A 4XIYA 1MG0A 1MX3A 5A1TA 5BSEA 3M2PA 4RVDA 3AM3A 4XGKA 3GVHA 1NQ5A 3B20A 4CR8A 2GASA 2Y1FA 3ZI0A 4B4WA 1A7AA 1HKUA 1I5RA 4KMSA 1H9BA 3MJ4A 3ZW9A 1H93A 1IUKA 4ITUA 4OAQA 5KNLA 2X5KO 3QWIA 2AQKA 3G0OA 4ZN6A 2Q2WA 3D4PA 4LVCA 3GVIA 1P3DA 2DBRA 3S2EA 3F4LA 3ROKA 2DQ4A 4GLLA 5B12A 3HDJA 2C07A 3NDJA 4C7KA 4D3SA 3VKUA 3FR7A 1S7CA 2R6JA 3LF2A 3GZNA 2F1KA 1ZZEA 3L4BC 1T2CA 1JLLA 1GD1O 2DAPA 4GX2A 2E82A 3GOHA 4IQ0A 4NJOA 4TROA 4HNHA 3WQRA 3Q0EA 5IFLA 1B8UA 1DFGA 2O7QA 5JNLA 3WQSB 1VC2A 1XA0A 1M67A 3Q2IA 4E5MA 3ETEA 1BRMA 1LDEA 2NUAA 2Y93A 1LLQA 4Q39A 2CF5A 3WTCA 3GEGA 3DOCA 1L1FA 3JV7A 1Y6JA 4QFCA 2HMUA 4FBGA 3ZWWA 4IDDA 3H5AA 4NK4A 1LC3A 4RCVA 3I9OA 4RZHA 4XR9A 3HUDA 2PGDA 4YJHB 3BXXA 1HETA 5L7TA 1SB8A 1WDLA 2I66A 2GUGA 3OIGA 1XYGA 2EGGA 1DO8A 3PDUA 4YCAA 4RZIA 5KTKA 1P9LA 3VH3A 3TFOA 5L53A 1SO8A 1QLJA 3FNHA 1PWXA 5TNXA 2CDBA 5EESA 1LNQA 4QO8A 5HS6A 2YW9A 1MFZA 4G5HA 5BNTA 5CP8A 2IZ0A 1JAXA 4F3YA 1LXCA 3TFQA 1P44A 1XELA 2O4UX 5A04A 5DBGA 2WTBA 1SPXA 1GQQA 1Y9AA 2GSDA 1XG5A 2Y1OA 4YJHA 3ZHBA 1ZSYA 5TRTA 2OZPA 5DT9A 5AXCA 2DBVO 2W90A 1Y5RA 2ZJ1A 4BNKA 4C7JA 4D43A 1H6AA 1ML3A 5JMWA 4PZCA 3PWSA 3LQFA 2EF1A 4BV8A 3ZWAA 1OOEA 3JQ6A 5A9RA 4PN3A 2VT2A 1VKOA 3FNFA 3GVCA 4KTTE 4MVJE 4OXKA 1E5QA 2FOIA 3KYDB 3BTSA 2JAHA 1I33A 1F17A 3I9MA 4ND5A 3QSGA 4FD3A 1QYVA 4ZA2A 1NHWA 4CV1A 1QP8A 3MWEB 1A9ZA 4FN4A 3WJ7A 2WMDA 2Q49A 3AUUA 3OMLA 1K6XA 1Z7EA 4DLLA 4N5MA 4A27A 3V1YA 2Q1UA 3JYPA 4GVXA 4HNGA 1GYQA 4W7IA 2GN4A 4TZKA 1T2EA 2FWMX 2IXAA 5FI5A 3AU9A 1A27A 3F1KA 4B8ZA 4XRRA 2GO1A 4B4UA 1U28A 3L9XA 3NRCA 1Y1PA 2GPTA 1KEVA 2WDZA 4RF4A 4XIJA 4CM4B 4M54A 2WE7A 2DM6A 3KYDA 4CUZA 4R68A 5ILOA 3HG7A 2HK7A 2JCXA 1I24A 3K2BA 1UAYA 2X22A 1HE3A 1GY8A 4GQAA 4N7RA 2YY7A 2D5AA 1LBEA 3QVOA 4QTZA 3GRPA 3WDSA 4OSOA 4PIVA 3ZWBA 2X1HA 2W4QA 4WCDA 1ULUA 1HDGO 2NNLD 3EAGA 3AFNA 2C82A 3QWHA 2NQ8A 1CYDA 5HBRA 3ONFA 4CM4A 2WYVA 2PH5A 4ZVVA 3FSRA 7ADHA 2A92A 3TZ6A 4PLTA 4WNCA 5GZ6A 3GGGA 5H82A 2VHWA 2QQ5A 1CQJA 4A5OA 1R0LA 4WLFA 4MKRA 1SBYA 3JQCA 4CLOB 1J4AA 3ULKA 4PLHA 3RAJA 1X15A 1EZ4A 3E9QA 3PQFA 2VYVA 1S6YA 2WSBA 4GI2A 3OQBA 1Q2XA 4XJTA 3ZZNA 1RWBA 5AQ1A 3IKTA 4ZICA 1PSDA 4W4TA 1G1AA 1KC3A 2GCGA 2P9GA 3DL2A 3DTYA 4TMFA 3AUAA 5IZCA 5ENDA 1P77A 2OL4A 5TX7A 2ZB3A 4NNJA 2IYPA 1PWZA 3WSVA 4GPD1 4YTEA 3WJAA 3DB2A 1IPEA 1IL0A 1F8GA 1NQTA 4FR5A 4CMJA 2P5UA 4RF3A 4CLOA 1E3JA 6ADHA 4IDAA 4KQWA 4UUOA 2CVOA 4YWJA 1X0XA 1YBVA 3NTQA 1P1KA 4A03A 1YOVB 3ZNNA 4CM3A 4EITA 2VYND 3D0OA 1R15A 1YVEI 3OEYA 3GMSA 1U7TA 3ZNOA 1PU2A 4EEXA 4WLNA 3OM9A 1U5AA 4MINA 2O3SA 3WOHA 4ZQFA 3FTPA 4BVAA 4RORA 2C0CA 3O9ZA 1HDCA 2D2IA 2PH3A 1SOVA 1GUYA 3RSHA 1W0CA 4UUMA 3INRA 2EW2A 4BL5A 2VUSA 2R00A 3EUWA 1VL6A 4II3A 3DC2A 5G0TA 4AJEA 4Z0TA 2UVDA 3DFUA 1NYTA 2I9PA 1ENOA 3CPSA 3GF4A 1YOVA 2CVZA 1OBFO 4BNIA 1EE9A 3Q6IA 4B3IA 4RPJA 4FIZA 4L73A 3ROQA 4NZ9A 5MGBA 4EJMA 1K6IA 1PR9A 1NASA 5IG2A 3QVTA 4Y98A 5JSFA 4WUVA 1LLCA 1WW8A 2NTJA 1JVBA 2FSSA 2H63A 1YE3A 1DC3A 2AXQA 4G2NA 5H81A 1VJ0A 1Y8RB 1A5ZA 4OSPA 2CNBA 1LEHA 1UXJA 3EK2A 4MIOA 3PQEA 3ZHXA 1R37A 3QHAA 5DP1A 3I4CA 2I65A 4OKNA 3PRJA 4WKGA 5KJFA 2AEJA 2PZLA 3KETA 2BMAA 3OEWA 3BIOA 3CXRA 2VRCD 3JQDA 4IUYA 3UICA 4ALLA 2VOJA 3HNPA 2B37A 4GAEA 3FCOA 3AU8A 4MKZA 3DDNA 2Y1DA 4IMPA 5A5FA 3ABIA 1T4BA 1W73A 2NQTA 1GAEO 2WYWA 2J3IA 3G79A 4YAGA 1H2BA 5B4UA 3RASA 1Y8RA 3D5TA 1J5PA 5DCYA 2GZ3A 3JTMA 1HLPA 3C8MA 4Z3KA 3ZW8A 3GH3A 2CF6A 3H7AA 3N7UA 3SC4A 4B3JA 3GNTA 4DLBA 3U3XA 2HQ1A 2DFVA 5BT9A 3W8FA 5A02A 1U8XX 4RPLA 4RDHA 4WCFB 1X0VA 2P9EA 3KUXA 3W4IA 4DPKA 2QYSA 2EV9A 1I3MA 3SJUA 3ETGA 1JTVA 2IXBA 4BHTA 5HWSA 3DMYA 3K2EA 1ADCA 1CJCA 2UDPA 4CMAA 3MWDB 2B4QA 4TVOA 3V1UA 2HO5A 1NR7A 3OETA 4R1UA 4UUNA 3ZWMA 2E49A 3O38A 3H65A 3NDIA 2PD4A 3ROMA 2PWZA 3M6IA 3HJAA 3T7EA 2LDXA 4QX6A 3VZQA 3HWRA 4R1SA 3ZWOA 3B6ZA 1IZ0A 5C7IO 1DHRA 1DRWA 1E7WA 2B5VA 3VZRA 3WX0A 3DWFA 4DBVO 2YJZA 1H6DA 2DKNA 3H3FA 3WG9A 4WCFA 2G82A 1EVJA 3MOGA 4Y6PA 2POQX 1I8TA 3GY0A 3SC6A 1QV6A 2AQIA 1TB4A 3CTMA 2X0RA 2VHYA 3A9WA 3PFFA 4UUPA 4ID9A 2X5OA 3A4VA 3C1OA 1A4IA 3K8ZA 4IY1A 4NPCA 4P22A 4QECA 2IEDA 4R5MA 4W9NA 2G17A 5ICSA 1KC1A 4NFYA 3FR8A 3G17A 2HJSA 4I5DA 1IOLA 4JK3A 1KY5A 2X6TA 1H6BA 3O03A 1N92A 4O59O 3WIDA 3JYQA 2OBYA 3KLPX 4P4GA 3IS3A 3LC7O 4MPDA 4YT4A 3HDHA 2OP1A 2NM0A 3NTOA 3QLJA 3TZHA 2HDHA 5C3MA 1X7DA 5ES3A 3UOGA 4BO9A 1UAGA 4JBHA 2OMEA 2Y66A 3I6QA 4GKVA 2VZ9A 1UH5A 3RFTA 4GSLA 4DPMA 1VE9A 2JD2A 4PLCA 2GLXA 5EPOA 3BAZA 2PD3A 1YL5A 3AJRA 1ZKMA 5CFZA 1KETA 1UP6A 3IKVA 4AFNA 4D3FA 1B2LA 1GV1A 2IE0A 4YB8A 3CINA 2Q2QA 2WYUA 2V7PA 2AG5A 3T7CA 3ZV3A 1MUUA 4BNNA 3WYCA 2Z1MA 4WLVA 4BNWA 2YV1A 3RD5A 3FPCA 4ALKA 4BO2A 4M49A 4IDFA 4PLYA 2IYOA 5L7WA 1NNUA 5TSDA 4YT8A 1EUCA 1JW9B 5IZCC 5TIIA 5T57A 2EG9A 2VHXA 4K26A 4NH4A 2ZCVA 1M66A 4AICA 4UVHA 2C20A 2O3JA 1BVRA 2B0JA 4BOYA 3K73O 1T25A 2PKQO 4BGUA 4FFOA 4FFPA 3CZRA 1B8PA 1Y8QB 1EUZA 4WEQA 3ZU3A 4GKBA 3BHIA 4BQPA 1HSOA 2PLAA 4H16A 2VTDA 5KJ1A 1X14A 4NFSA 1ONOA 3GVXA 4BO6A 2BRUA 3D3EA 3RUAA 3ICPA 1QR6A 2V6BA 2VOEA 4DYDA 4CQMD 4XCVA 1WP4A 1ZK1A 4CPDA 1TXGA 2RHRA 4CV2A 5JXWA 1MC5A 1DRUA 1DHTA 5L9AA 3W8EA 4BKRA 3U49A 4Q9NA 3DONA 3JQ7B 2R00C 3D1LA 4RLHA 1P0FA 1Y8QA 4PG8A 1Z6ZA 4Y67A 4CM6A 5K9ZA 1TA4A 5CEFA 2GERA 1PJSA 1EK6A 3CMCO 1HL3A 1RM5A 5G0UA 5T64A 3I6IA 3WXBA 4W6ZA 3ZNPA 4FGSA 4JGBA 4CMEA 2ZK7A 4DVJA 4WOKA 3UCEA 4OQZA 5JAQA 5JAZA 4B7CA 1R0KA 4E5KA 3DOOA 2YHUA 2YHIB 4MP6A 1NR1A 4J1QA 4DQXA 2Q2VA 1I3NA 4CR7A 3DHNA 4K6CA 1JVSA 3JQ7A 1DLJA 1HWYA 1R0SA 4PRLA 2NV6A 1VRWA 4WGGA 4ZGWA 2C2XA 3IIEA 1V6AA 3OICA 3P2OA 3JQAB 2HU2A 3H4VA 5A4DA 1N9GB 4PG6A 3OIDA 4Q3NA 3W8DA 2ZYAA 4IPTA 2EGHA 1UXIA 2VWPA 3WLFA 1JQBA 3JQFC 1PX0A 1OC4A 1YO6A 4OO3A 4HXYA 4XYMA 1NBOA 2YHIA 4MVJM 1U5CA 2OGUA 2PD6A 4W82A 3SX2A 3EVTA 3V1TC 1GYPA 3R1IA 1KYQA 1Y7TA 4J16A 4XZ3A 4DMLA 3PHGA 4EI2A 1NTOA 1YGYA 3MJTA 4UULA 3VOSA 3ZWXA 4BB5A 2AE1A 4JX8A 4C4OA 5BSHA 1VSVA 2CDAA 2UV8A 2BGKA 4HV4A 3H9JA 3JQAA 1YRLA 2JAPA 3RC9A 1KEPA 1N9GA 1R16A 4GX0A 2X9NA 1EMDA 4H7PA 1IHXA 3E8XA 4KDEA 2BI8A 4FFNA 5L4NA 5TT1A 1LRJA 4FC6A 4CM1A 1YB5A 1EDZA 3F3SA 2GD1O 3ANLA 1R6DA 4GMGA 5G4LA 3F5SA 2VWHA 2VUTA 2DPGA 1M2WA 4YRBA 3WGIA 1FDWA 3C7AA 4WLUA 3NT2A 3LT2A 2FZEA 3R6DA 3LSYA 3DAFA 1U9JA 1CDOA 3RBZA 1LUAA 1SEPA 3E18A 4P8RA 2I3AA 4E21A 3WSWA 3SBOA 5DULA 1ADBA 1ZJZA 2HAEA 4FFLA 3KHUA 4MVJA 5BSGA 3VVBA 3GC6A 4WCFC 3C24A 3PGJA 2AMFA 4ESOA 1LLUA 3TL3A 4WE3A 4WOJA 3L4SO 4XJSA 1D3AA 2RAFA 1XR3A 4J3FA 2C7GA 3WGTA 3UKOA 4OIMA 1U8FO 1E7MA 1LDBA 1GUZA 1ZK0A 1YKFA 4FQ8A 1MA0A 3PWZA 4W9NC 1VL8A 4F6LA 1NP3A 1EUDA 1CIVA 2VRBA 1E7RA 1FDTA 1K3TA 3WFIA 2HRZA 3O4RA 1NFRA 3UN1A 1G6KA 3UXYA 3GN2A 3MJCA 4M86A 2XPCA 4OGWA 4BNMA 1NAHA 3WMXA 5F3RA 3OFSA 2WD8A 4JJFA 2FP4A 2O48X 1GCOA 3CKYA 5L95A 4JJIA 1I32A 2Y0CA 2OUIA 4I9UA 1PQUA 3SEFA 5F5LA 1ID1A 4IDEA 5EINA 1ZK2A 5IZ4A 2J6IA 2BFPA 3U62A 4GBJA 4OJNA 2ET6A 1DC6A 1O95A 5L3ZA 3QIVA 4PLWA 3F46A 3I5MA 1XKQA 2QYTA 2EP5A 4DQVA 3MJVA 2NACA 4IDBA 3UCXA 1PJ4A 1QLHA 4ZJUA 2Y1GA 3DR3A 4FOSA 4QEDA 3KSZO 3WYEA 4BMNA 1BMDA 4YAEA 2DBZA 4RPGA 1X7GA 4OXYA 2CMDA 4XGIA 1DLIA 4A0SA 4FB5A 1PL8A 3EY4A 2D4AA 4CM7A 3O8QB 3GDFA 4RLSA 2EKPA 4D45A 2PFGA 2JL1A 2ZIZA 3C7CB 3PGXA 5F1PA 2JD0A 4R51A 3H3JA 2JCYA 3Q3CA 1GUFA 1ZO8A 2JCVA 4BNUA 2AEMA 1VL0A 1WMBA 3AI3A 1HZZA 4NBUA 4XYGA 2H9IA 3JQBC 4EZBA 3ICCA 3ITKA 4OMUA 2CVQA 3I4FA 3OH8A 4BUCA 1QXSA 2EWMA 2NVBA 2A9FA 3KVOA 2V6MA 4MVJH 1CERA 3DMTC 4GWGA 3TPCA 1DAOA 3Q9UA 2W8ZA 1UZMA 3R3SA 2DPHA 5DNAA 4DBZA 2JJYA 2CDCA 2HK8A 5U1PA 3O8QA 3RUIA 1ZMTA 3F47A 4IJVA 1D1TA 5L45A 1C1XB 1BDMA 3VPFA 3FN4A 3ZV5A 4CMBA 5K6AA 1KS9A 1Q0LA 3TZQA 4IBOA 1NPTO 4HFMA 3IP3A 1R4NB 1KVTA 1T24A 3ETDA 4D46A 1A9YA 1DRVA 4YYZA 5CDUA 3JSAA 4D42A 1WZIA 1U4OA 4P4LA 5HTOA 3FWZA 4AJ4A 2ILTA 3DZJA 2WE8A 4NBRA 3E5MA 1YL7A 3WGGA 4IQ8A 1N5DA 1C1DB 1B3RA 3VKVA 4RF5A 1H2HA 3LLSA 5CEEA 4QUKA 2HMTA 2GZ1A 5JDIA 3G1TA 4D44A 4CMEC 3TF5A 1C1XA 3LU1A 3FHLA 1U2GA 5ILGA 4F46A 4CLHA 1SNYA 1MLDA 2X58A 1XQ6A 3GHYA 1R4NA 3GMDA 1T2DA 2YV2A 4TSKA 1IZ9A 1EFLA 5COQA 3ENNA 4B7XA 3GNSA 5KJCA 3LT4A 2NU7A 3VPXA 3MCVA 4J2OA 4BO4A 5KIAA 2QRKA 2EXXA 1C1DA 3MJEA 4GX5A 3JD0A 4J4HA 1WDKA 3DEYX 3RI3A 3T4EA 4AG3A 3PK0A 1GEEA 3PJEA 4O6VA 1KEUA 3Q9NA 3UAGA 1TLTA 1H9AA 2Z5LA 2Z1NA 4MP3A 5GZ3A 1DFIA 4I8XA 4YBZA 4OOEA 2XF8A 2P5YA 1KVQA 1E7YA 1BW9B 1GCUA 2ZTVA 1BGVA 5B4TA 5T6BA 3KM0A 4J0FA 4EUHA 2BGLA 3EZYA 4U6SA 5IDXA 3EW7A 3NT4A 4L4SA 1QRRA 4QXMA 1DOHA 3ZDFA 1NX6A 4RVUA 3QY9A 2HUNA 3PIDA 4JP2A 1O6ZA 2GN6A 4LCJA 3X2FA 3HQ4O 4YQZA 3JQ9A 2FPGA 3F1LA 4L76A 2EERA 1DB3A 1N7GA 4BQRA 3G1UA 4OQYA 4LSWA 1AXGA 2B4RO 1P0CA 3GUCA 4ROSA 2ZTLA 3NJ4A 1MG5A 4FJ2A 4LRTB 4PLZA 4TQGA 3AUTA 4KUHA 1NM5A 1ZEJA 4J91A 1PEDA 3ANNA 4ZU3A 4LK3A 2H1SA 2AA3A 1PTJA 2EW8A 3ZWYA 1BW9A 4CV0A 5BR7A 1Q0QA 4Z9FA 3VAZA 3CMMA 5L4LA 4GGOA 2FR0A 2P2SA 3QWFA 3V2GA 5CDSA 1EEHA 3D64A 4R69A 5FYDA 3FBGA 3DFZA 3AK4A 4IXTA 5KVCA 3WBBA 1UXKA 1YB4A 4RVGA 3DBVO 4YVFA 3CZMA 3DZFA 3HADA 4RVFA 3HFSA 4M89A 2X0IA 1EFKA 3LT0A 4B3HA 3O26A 3WGZA 1N1GA 4GVLA 3RKUA 5TC4A 4O5OA 1R66A 3M1AA 2J5RA 4AVYA 1QMGA 4CM5A 2YZ7A 1BXKA 4R3NA 3W6ZA 3WWYA 1AXEA 2B5WA 5DCUA 1VLLA 1QV7A 1UDBA 1B3BA 1E6UA 1B26A 5ER9A 4XYLA 5F1OA 3P2YA 3DQPA 1MV8A 3L0DA 1GADO 3UUWA 2W98A 3HB4X 3NKLA 2QRLA 2EEZA 2PY6A 2DUWA 3GGPA 5JC1A 3VTZA 1SC6A 2PZKA 5G4KB 1A72A 2NU6A 1Z45A 3C3XA 3PIIA 3RROA 4G65A 1PZFA 1PIWA 2HSDA 3NGLA 3V2HA 2AW5A 4ALJA 5JLAA 3L77A 3GFBA 2EKQA 2CY0A 3NYWA 1LSSA 3PWKA 4BNLA 1FDUA 3ZCXA 3RFVA 1Z7BA 3QV1A 3FI9A 4PGFA 2BLLA 4DUPA 3NEPX 1U3UA 4ZQBA 1MGOA 3MEQA 3FNGA 2V6GA 4CM9A 2OOSA 4NFHA 2Z95A 3GT0A 5GMOA 3ZN2A 3JQ8B 4YAJA 5LDHA 3NX4A 2C29D 4IIVA 3B1FA 4U5QA 1KERA 2VHVA 3IJPA 5G4KA 4DRYA 1AHIA 2RCYA 4Y9DA 1PZGA 3JD2A 4DGSA 5ADHA 4D7AA 3AOEA 2PR2A 1E1LA 3H9UA 4CQMB 5I7FA 5JCJA 5JDCA 4J7XA 1HTBA 1WVGA 4CV3A 2YDXA 1ZNQO 1GZ6A 2AQHA 3D4OA 3M2TA 1LDGA 4I5EA 1YBAA 2NTVA 3H8VA 4CMIB 1NFQA 1FK8A 1DC5A 3I9NA 3SXPA 4NBWA 3JQ8A 1HZJA 5U4QA 2O2YA 4DIFA 4D0RA 1LRLA 3ONDA 1BHSA
chains in the Genus database with same CATH superfamily
4R1QA 3VI4B 1HT2E 2QF7A 5ALUA 1MXHA 4BB6A 3WJ1A 2ZYUX 3TPFA 1GZUA 3TZLA 3IDSA 1OFTA 3PTAA 3GIWA 4XCQA 5B36A 4IFBA 1WUYA 4ZDJA 4KACA 2ZSIA 4KKXB 3G68A 4KRXA 1RIIA 1QFYA 2PKEA 1PYGA 4D4IA 2HV8A 2I2XB 3M6VA 4CG1A 1PW7A 5IN4A 2PLWA 4MQ6A 2WNSA 2XQGA 3OZXA 5ALPA 4MR8A 1YJ5A 4NICA 1CETA 1P1IA 1LSJA 1P2SA 4RXMA 4XD2A 4CMIA 2ATIA 5KDDA 1YQWA 2P2DA 3AL2A 1KZ1A 1MO4A 3OSUA 2B1QA 3AW9A 4DR6B 1GRCA 1QOZA 5IAAA 1L7OA 2N0SA 4K7JA 2QLBA 5JZVA 4GT1A 2QMQA 4US2R 1Z0IA 4P36A 3W34A 1PZEA 1ST2A 4AJ2A 1GKUB 1WSBA 2RBGA 3Q1LA 1X7WA 1V41E 1KAOA 1YDGA 3T38A 4CKWB 1C2YA 3I73A 4CTJA 4GSKA 1WVIA 2XQFA 4I4TB 5HE9A 1ZC4A 4IOLA 3A06A 3FOAA 1NUSA 2D5CA 3G7UA 3RVLA 4D4MA 4R16A 2BUBA 4E4RA 1IEWA 1ZD3A 4YXWA 2QG4A 3MCAA 3QOWA 4QUJA 3V8VA 1IHUA 4DS3A 5BR8B 4DR1B 2RHWA 1XD9A 3L7YA 4XQCA 4UARA 3TSCA 4HSEA 3AHEA 1XAGA 1ZU5A 1BFDA 1ZH8A 4G0YA 5HCIA 4LG1A 1YDHA 3K5PA 4LS3A 2J30A 5DGXA 2MOKA 5CW1A 2XUOA 1ONPA 3WB9A 5C7LO 4HNSA 1HA3A 1PR4A 4FFSA 1R5OA 3M5DA 2OOKA 5DM0A 1Y37A 3PUHA 3TOZA 1W5AA 2B9EA 3RG8A 4HNVA 1OAAA 1CFJA 1W8DA 2VQ6A 3EYWA 5AXAA 3TQRA 2GYUA 4M0UA 1GAQA 1QC5A 3C3AA 3WV4A 5J58A 5K4GA 1M8PA 2VQDA 1CUYA 1TAGA 3KKMA 3EUEA 3VJKA 3WS7A 3FCUB 3D1JA 1HDRA 2JBWA 3IX7A 5JBIA 2J9YB 1Z4KA 3PPYA 3QLVC 4JT4A 1HE2A 3D5QA 1HRDA 5DLPA 3LQQA 3JATB 3ZDBA 1U28C 2GN9A 4PQGA 4CLRB 2ZIWB 1GT6A 5HFJA 1TT7A 1W0KA 1IOZA 5HCUA 1ZGZA 2TMKA 4LF5B 3SJZA 1RZ3A 4D3DA 2WU4A 2CCKA 2D7JA 2YR0A 3RWMB 4D25A 3ITDA 2C4VA 4CQLB 1LPMA 3N0XA 4CNQA 1G0OA 5C5IA 5HZGA 5ULLA 4JYMA 2X8JB 1XKTA 3KT3A 5AKYA 4YV7A 1ZPDA 1OXUA 5TS2A 2FMXA 3MGAA 2D3WA 3UG7A 2J0UB 2VF2A 2W2LA 5ITSA 3C14C 5SICE 3BYZA 2NU9B 3BXPA 4RGYA 1GPWB 5A3RA 4ZQIA 3RJ9A 3WBFA 2FX3A 4CNBA 3AHDA 1ZLXA 3ECCA 1CB7A 4LBZA 4RBNA 3NGXA 4U2CA 3U13A 4DJEC 1SCUB 2EFJA 3V46A 1KJZA 1V35A 4J6FA 1PQPA 1VIVA 1EUQA 3OKPA 1ZXBA 2BM1A 2G5PA 3G89A 3C6KA 3LMKA 4Q7MB 1T29A 2ZJ8A 4TWJA 1PTJC 4XQ9A 3TTXA 3LX5A 4PSKA 4YQYA 4E33A 2C5FA 4S3MA 4H6PA 2C2OA 1I2BA 3AIIA 5GONF 1R9MA 2F8MA 3LDHA 1WXWA 3HU1A 3V3TA 2GCIA 1JX6A 4Q00A 5AM3A 3K70C 2QUAA 3FPSA 4HY3A 2ZT6A 3NHKA 2YWCA 1FVFA 4EL5A 1VGVA 5JCZA 2E6KA 1P4GA 4BNFA 1T1JA 2ARKA 1I1OA 4KR6A 2V7TA 1I36A 3PZBA 4MW5A 5EL0A 1W9HA 1NYLA 1T0PA 2YXNA 1SZDA 1JKJB 5JCPA 1ZM7A 2RGGA 1YQEA 1EFVB 3I52A 4EWLA 5AI0A 3GAMA 4PY2A 4TTJA 4N5IX 4YAWA 5FEUA 4N6OA 4D0SA 3F7MA 3N0RA 3O2SB 2GNAA 2V9CA 1LH0A 4MB2A 5EUQB 3F5DA 4I1PA 5AK3A 2VJQA 2WJVA 4MH0R 5TGDA 2N9UA 2E4AA 2X6QA 3ZNQA 4W5JA 1W8IA 4HWTA 4OYYA 3H0KA 3DUWA 2J9FB 4CIXA 4HQ6A 1KQ3A 2M6RA 1ZXLA 1PG2A 5AWFC 4OH1A 1UKVY 2ZRIA 4H18A 2P4EA 2E7ZA 4LCEA 3IOEA 4KPFC 3VOBA 1V3UA 4PQRA 4B6RA 3THYB 2RHLA 3O0TA 5ALKA 2C0QA 4ND2A 1P1JA 4AQDA 2P6UA 2Y4OA 3HPRA 3EHEA 3OQPA 4LOAA 4HB0A 2PT5A 4NU5A 3GZ4A 3R7WA 4MNTA 1CQIA 3QVGA 2PYZA 1F8XA 3LH5A 2XA9A 1RHUA 1L8LA 5C1DA 3BMOB 5AHXA 4C0JA 1L4LA 1IRXA 1OPRA 3EZGA 4Q4JA 4OM7A 1PJ3A 3FYTA 1WLSA 5ISMA 3BKXA 4DCPA 2B8EA 4MO9A 5AW6A 4XWWA 4ER0A 4RUKA 1ST3A 4HFRA 2CL6X 3QJ5A 2PSDA 5ITVA 2RHGB 4KX5A 4UU1A 3A9SA 2GRJA 4JP1A 2AFVA 1OASA 4DB2A 3WLAA 1RRPA 4LN1A 3GLSA 1OHHA 1M2OB 3U09A 2Q6OA 2EX0A 3WP1B 5LDGA 4Q4LA 1GNPA 3GLGB 5FBHA 1P1RA 1D7OA 4RTOA 1ACJA 3PV0A 3DBLA 4M9CA 4GQIA 5A05A 3SQOA 4V1CB 5K0JA 1SG0A 4YJFB 2QEQA 4INAA 5HQTA 2WWIA 4CL8A 5HRAA 2NTYC 2OZLA 3NVAA 4HBGA 4HXGA 4IJWA 3WMWA 2H6EA 2PXHA 1XYYA 2I54A 2OORA 3KR2A 5KREA 4Q7QA 1YJ8A 3L8GA 4MRRA 4DEYA 5LQJA 2PL9A 2ZIGA 2GEUA 3NDPA 2QAGA 2QHXA 2Y2VA 5BWBA 5I9IA 4FX5A 1BU8A 2ZRKA 1LVGA 1PFKA 2FZKA 4EMTA 4KR2A 1OE0A 2YIDA 2BF4A 2ZUVA 2W6QA 4KR9A 3ZH2A 3BTUA 3GDGA 3AF5A 2DWPA 4X95A 5DCWA 2VJNA 3OQJA 3LHSA 4MI1A 2BMVA 4QREA 2LDBA 3AEYA 3QYFA 3LM8A 4E5NA 3ET4A 5L51A 1Z75A 4HUQA 1JAZA 2IV2X 3F5FA 5F1KA 4JI8B 2C4TA 1XTKA 1ZH0A 4MYDA 5ALNA 3EXG1 4ER7A 1FYWA 3A6HA 4NCKA 2YYYA 3UK1A 3FWKA 4DPLA 1GFIA 5B3AA 2YCBA 2JLXA 3ICWA 4D3XA 4D8VA 2OAEA 3LP8A 1P33A 4FU0A 2Y1CA 1QRSA 1OKKA 2HL6A 4Y18A 2NVUB 4O3MA 4X6XA 1TZBA 4BKOA 1XNQB 2QRQA 3UUFA 1RNLA 3PT9A 4TKMA 3FNEA 3VNAA 4BZPA 1SEVA 1O6GA 4J2HA 2Q5EA 2ZE7A 3T3OA 3QOXA 1XPJA 2XOXA 4WI1A 3U3MA 2WHYA 3AM5A 5L4SA 3GRYA 1UFQA 1EFRD 4QTYA 5CXSA 2FG6C 3OCYA 4E13A 2CNWD 3D6FA 2O2HA 3OFND 4B2LA 4UTZA 2QL7A 3DFIA 3EFOB 3RU7A 1JIQA 4FMBB 3VC7A 5U4XA 4BNZA 4NE2A 1FTQA 1U2ZA 4Q19A 4ER3A 2I03A 5HMLA 3OQIB 3A04A 3V5NA 3JVVA 4GYYA 5FP0A 1DXYA 4RKFA 1U3VA 2IDKA 4TTQA 1L4NA 5E7IA 5IBQA 5JBNA 3UPTA 3F71A 4LHZA 3GRRA 5AW7A 2NO5A 1OFGA 4JUBA 3EDYA 5KTYA 3F7NA 3B53X 3KRTA 4R01A 1Z68A 1IQRA 4COOA 4HKTA 4XVUA 2FPWA 4Y6SA 2ISCA 3UJDA 2NADA 3NYQA 3IMKA 3USCS 1WABA 4UXHA 5DI9A 5CU7A 3GJXC 4BNTA 3LCMA 3V4PB 4Q0MA 1SVNA 2AZDA 2BEKA 3PA8A 4B6PA 2HLDD 1K2VN 4R5HA 2WJ6A 1JVNA 3PC8A 1E1RD 1AZWA 1NVGA 4MQEA 4FBLA 3RUCA 1NPYA 4NJMB 3G7NA 1BU5A 3L8FA 1F9AA 1OW3B 1DU4A 1GU0A 2JGKA 2PKQP 2O4CA 3O2NA 3OZGA 4IZ6A 4F9FA 2JFNA 2BJVA 4Q3BA 2LWIA 3BRWD 4J94A 3L02A 3P20A 1HTTA 4Z4HA 3H5WA 3PLNA 3HA7A 1SELA 2EP7A 3LOUA 3MD0A 3JZDA 2AG6A 1PJAA 1T6XA 3TG2A 3MC1A 2YFQA 1Y6QA 3K7EA 4MS4A 4WPGA 3E2IA 2ZSKA 5DGHA 4ZI2A 1V16B 2BPOA 3OF5A 3VDRA 2ZUTA 4JBXA 2HKIA 3HDTA 1NXSA 2DJIA 3H86A 4AS1A 1VOTA 4Q3DA 3V4RA 2PSSA 3SBDA 3VZBA 4L8VA 4LJ7A 1RLTA 1LK0A 1WBJB 3WHLA 3AF4A 4EW1A 2ZJFA 5AKGA 4X7MA 5I7WA 1FJGB 2PMCA 5T8KA 3VR6H 3OPXA 1H8HA 2GM4A 2PT7A 5A6SA 1GUBA 2QTFA 4LDNA 3LS2A 3OOWA 4NENB 4YPOA 4YH1A 4CCYA 1M7GA 1K66A 1J39A 1QWSA 4FLMA 2H5JA 2O07A 1Q22A 4L22A 3OTIA 3U3OA 4DCSA 1YZQA 3NV9A 1ZIPA 3A14A 4FQ7A 3CF2A 4L74A 3I76A 1WY7A 4KO3S 1SXHA 2BKVA 3DHVA 1E5XA 5BXQC 1W581 2C3YA 3STHA 5AW8A 4CFSA 3TVTA 4LRYA 3DMFA 3I3SR 3JQGA 2DBQA 3KB2A 4NK5A 1RQPA 1T1SA 3MWFA 1YQXA 1XL0A 1K4KA 2QR2A 4MKFA 4A91A 4DNPA 4DQUA 4ASUA 3TVDA 3KQUA 2PK3A 1DC4A 4N82A 5FPKA 3BA6A 5A7GA 5JZSA 5JYEA 1F06A 4R7TA 5CCXA 4WL0A 1MQ8B 5JZMA 2W6JD 2JAWA 4N76A 3B9RA 1S8OA 3NETA 1YZLA 4NU6A 2OO5A 2EEPA 5TQ0A 2AE2A 2A14A 5JV5A 2Q50A 3OU7A 2VBCA 4DYVA 4E08A 4D2IA 1WIWA 3QITA 5JNWA 5CTAA 4AW9A 4DARA 3AFMA 3DVLA 3H6GA 1I4TD 1YZFA 2AJTA 4HDSA 4AUNA 1P2GA 1BDBA 2A0WA 1TUBA 1GPYA 1QQTA 3C8UA 4B73A 1BX3A 3B36A 4C5AA 4JI4B 3TJRA 3P9XA 1FFSA 3I0MA 1R5JA 1MD9A 4TN5A 4C0BA 5CAEB 5JD5A 2BCEA 3GK3A 2ODBA 1CY7A 2H06A 2Q1SA 2VYNA 2XF2A 4MV7A 4AZ0B 5K2OA 3QRWA 2VDLB 2CHUA 2UZ3A 5DMHA 5C9ZA 4K9DA 1I6KA 2C4KA 3FPAA 1RHKA 4OXRA 2OHFA 1O9HA 5KWVA 3E22B 1RHRA 4JUCA 2ECOA 3U80A 3U4QB 2QTTA 3EGOA 4JLBA 5EVJA 2WIFA 4BP3A 4PVCA 4OJTA 1F0KA 1DIAA 5GM1A 1Y5LA 2YWFA 1SD2A 4N3NA 5A9TA 4URFA 3DTVD 1SQSA 3EAFA 5H3CA 2L42A 4KAXA 1JKFA 3EZ6A 1ZUD1 4O1MA 3E58A 2IYLD 2ATCA 4PYIA 1EQ2A 2FSVC 1HBJA 1XNRB 2RH4A 3OAAA 2BRUC 2RKOA 2O8BB 4TYQA 2ZQ5A 3CH4B 1ZINA 3BFPA 5EN4A 5KYWA 2R5WA 3QI2A 5EHNA 5IYZA 3WYGA 4N48A 2IF2A 1OILA 4OFBA 5K1ZA 3LDAA 2BHSA 3MAAC 3KOYA 1OX5A 2GXSA 3ZHVA 2JKYA 2Q1TA 4BC0A 5IT9A 2A5YB 3KWFA 3ZK8A 4ERXA 4G26A 5LOVB 2WSSA 1DCTA 3VR6D 3A6ZA 1Q95A 2GYYA 1Q0SA 1CBUA 4D6YA 5B1YA 1XNHA 4S1NA 5EPEA 2A9RA 4ND4A 5M3BA 3R9IA 4D8XA 5FI0B 4BUJA 2GVZC 1ZCFA 2ZSDA 3F5MA 3BD8A 3WIEA 3IO5A 2C4WA 2GJ4A 1ZN8A 2W00A 2BZ0A 4FGUA 2JFGA 1C9MA 1G5PA 2Y05A 2X15A 4TVKA 5DDIP 4OUDB 1F2UA 2C03A 2M1XA 3KSDO 2R5NA 4JVOA 4UAJA 1E5LA 4DDWA 3I9JA 4IDOA 1M6WA 2V55B 3R0IA 1T10A 4V0KA 4AWXA 4BVFA 2AYYA 2P40A 5EP2A 5BNFA 7MDHA 1I51A 1A5TA 4C43A 4NYJR 2ZB4A 1QX4A 5DP2A 1OGYA 4FSDA 4RMGA 5B58T 3UJ6A 4EENA 5CTJA 2CKDA 2ANBA 1CXZA 4L27A 5DISB 3T9CA 1LTKA 2FXVA 2IY9A 3ZWKA 4DAOA 3KSUA 3A0UA 3MELA 2BFAA 1WBDA 4RIHA 3MJDA 5FFMA 3ZZMA 1PW5A 4FEYA 3FBTA 3HC7A 4QDUA 3SJ7A 1P39A 1QORA 4L8LA 1KZ6A 4NQZA 3FFBA 3ZE7A 1G6Q1 3BZUA 4A26A 3EY9A 4R2WA 1PJBA 5J5AA 2GPNA 4TZ0A 4BATA 4G9EA 2FEPA 5J40A 3R8FA 1XMJA 5HIKA 1QJ4A 1XDUA 1NI5A 3B5IA 2ZYDA 1ZNXA 4XVQA 3RFCA 4EHIA 1NTRA 1JQDA 3TSOA 3W1VA 1OD6A 5GZ1A 4F4JA 1ZA1A 2PZJA 4I5IA 5IM5A 4YJ2A 1GNRA 2FSGA 1TTTA 1S3GA 2DULA 4ZI5A 3AVXA 2B61A 3NH6A 1EFCA 2IP4A 4R9NA 3QI7A 2ZM6B 2MR6A 2FSPA 3OZUA 5DBOA 1OGJA 3WR5A 5JMOA 1X1QA 3N0TA 4PO1A 1FYEA 1GG9A 1SM4A 1JEOA 1BO6A 3S6JA 1II0A 1DPGA 1XN1A 1CNMA 4HB4A 4EARA 2VZEA 4YCJA 1G16A 4OQXA 4BNYA 5HQ3B 1GGFA 4ILKA 2Q5LA 3UWKA 3USZA 2O5CA 2FE1A 3L8ZA 4MCIA 4QWWA 4G0UA 1YC5A 3VJMA 1QOQB 4N8DA 3QUAA 4BMVA 4U7JA 4JDUA 5A2GA 4KE7A 2C5EA 4YRJA 3VMMA 3GEPA 4D9EA 2VSQA 4YR9A 4DNFA 5KTMA 1JQLB 4DWVA 1TVKB 3VUEA 4EEZA 1C9JA 3GGCA 4NATA 4P7FA 3VH1A 3PQ7A 3PXCX 3DCJA 3HY3A 3VZSA 4ARSA 4URVR 1IUNA 1PGNA 4L0QA 2IZ7A 1KK2A 5TMDA 4IVQA 1YS6A 5KDLA 1R0XA 1CY6A 2I7CA 1UEIA 4LJSA 4PLVA 5ITWA 2WHPA 1TZ2A 4ZCRA 1E79A 2BELA 2O54A 4ZQEA 3D3WA 3VR2D 3P7MA 4MUNA 5KWEA 2X13A 4ZHQB 1ODTC 2ZI7A 3L07A 4FGWA 4N47A 5BT8A 2AZXA 2V9PA 2C2ZA 2DX7A 3QK7A 1MEJA 4A9AA 4M1EA 1F1BA 1T43A 3L6UA 2V96A 4G5YA 2VTBB 2HF2A 2GZ2A 1KVSA 3W7AA 5IDWA 4FMPA 3H11A 3WGKA 2NWQA 4EAAA 1RWMA 3U1TA 2OKGA 1YR8A 2D1RA 1W29A 2WU0A 1BSVA 1K2WA 4DY4A 4EJSA 4ARCA 3BCUA 2H8GA 4BKQA 2O19A 1ISHA 2XUPA 2MU1A 1EGHA 4WZBE 1N8NA 1XTTA 4RX1A 1HI9A 2QMUA 2NU8A 3HDQA 3VSDA 5BRJA 5FX2A 1EIWA 4WN3A 2G9UA 1UP4A 2G6TA 3EG5A 1X92A 1AK2A 2HRBA 3NCHA 4FPXA 3S3TA 4AKTA 1B8OA 2XKAA 3E9DA 4AIIA 2LKCA 1B16A 1Q84A 4IIJA 1FEZA 2H7YA 3A3NA 5L3SA 5I9BA 2UZ1B 2VQFB 1XKXA 2FWIA 3IDAA 3TLXA 1AQYA 4Y0NA 1SC3A 4UM7A 2XUKA 2F17A 4P81A 5GOZA 4DKXA 1YDEA 5BSWA 1LBSA 4MQ4A 1EWTA 3GJ4A 2BKXA 1UMDB 4PANA 4PBTA 4GPTA 4D9GA 1U5BA 2LD4A 3HVHA 4KLAA 1GNVA 2C83A 5AP9A 4BQOA 2QX6A 2QRMA 3AUKA 3MUOA 4EB6B 3EZFA 3DOJA 4DQKA 1KFCB 3D2BA 1VPDA 3H75A 3E9NA 1X19A 3PXBA 5AIAA 3HCWA 4DLUA 3C1AA 1I4OA 1PQWA 3ILXA 1E5DA 3QXJA 4Q1VA 3PC4A 1VLVA 5TS3A 4KWTA 1WB4A 3A1TA 2H2FA 3R3ZA 1NFFA 2OYSA 3PF9A 1BS1A 1QVVA 4G67A 3IBTA 2B25A 1J0XO 5E2AA 2AH5A 1UDAA 1Z2CA 3C8DA 1C9NA 1O95C 1AQ6A 1SURA 2Y67A 1N2JA 4LISA 5E1OA 1V45E 1CJBA 4I3HA 1RCTE 3RT7A 2IXTA 4DLSA 1UFOA 1G3UA 2O0HA 2OG2A 1J9ZA 1S3SA 1KVUA 1NHGA 2WU8A 3L01A 5DNEA 4RFSA 3AJ9A 4Z7OB 4II2A 1JG2A 1PZNA 1U9IC 4N49A 1FXWF 1YKSA 2OCBA 1ATIA 2B6NA 3FKSA 4XX0A 2PUEA 1N2XA 4EDFA 4H6WA 4CKCA 2Z6QA 1R4ZA 2IV7A 2ZZNA 3T1TA 1EM8B 3D7LA 4BN0A 1K0UA 2VHUA 3DMNA 1DKLA 2VBIA 3KQYA 1OMOA 3NFRA 4MJ7A 4WOPA 1KI8A 2EYQA 5KVQA 1L4FA 1Q16A 3OEEA 1YQDA 4B4KA 1EVEA 4QVKA 3KZNA 2JHGA 1XK7A 1NWHA 3P9IA 1KMIY 2VDVE 4YJ3F 4ZEOA 2FDCA 3EG9B 4LZAA 4IINA 3AHIA 1E0SA 4EABA 4KXXA 3REFA 3OOEA 3FYHA 3EIEA 1E8MA 3PI6A 3ZWVA 2XXBA 3G0CA 4XPIA 1GNSA 3TGWA 5JEEA 4L4XA 1T0JB 4Y1EA 3WNZA 1DJMA 3LYAA 2CFRA 4DAEA 4F04A 1U3WA 2TYSB 1A9QA 2XD9A 2G7ZA 3RSLA 4KFUA 3RV3A 4XQ0A 1Q1GA 3GQVA 4BYGA 5E9WA 4F12A 3EXIB 4L3WA 2Q3EA 5FADA 3VBEA 4BQFA 4NXMB 1JLSA 3LLVA 3ZWCA 3G2PA 3AC0A 4OB6A 3MMSA 3MN1A 4OLFA 4AJIA 4CFYA 4CJXA 4F5DA 4MV8A 5CCBA 1SVIA 2FRDC 2V9ZA 2VNHA 5BRAA 2R11A 5F76A 5F7JA 2BHRA 2VP6A 2B36A 1E61A 2IOFK 4BKUA 4X0EA 2MTBA 1KZ4A 2W6ZA 3UA3A 1FMLA 3JQFA 3OO1A 4K8RB 2CZGA 1M5RA 2TECE 1JEYB 1CVIA 2VWQA 3OZCA 4RULA 1GHTA 3JY6A 4ZREA 3BMCB 3PHHA 2KBFA 4K8OA 2NSYA 2QI9C 4MO2A 4DIBA 2RC5A 4U7PB 1NT2A 1GR0A 2D59A 2Y77A 3DWEX 3L7OA 4K9RA 4BCCA 3EQ9A 3MS2A 4R7GA 2QW8A 3KVVA 1NW7A 2LTAA 3IHLA 1AGNA 1U1DA 3C5HA 1WPGA 1O08A 4DIOA 5AVYA 4LOJA 1CUAA 1IVYA 1R50A 2L2QA 2ZBGA 4MGEA 1P9OA 2H59A 2W37A 1S2NA 1TFUA 2WG2A 1NC1A 5FFNA 4UM9B 1W5TA 3AEUB 1AJEA 2G9QA 5DO9A 3TOCA 4QD3A 2Y68A 3ZD7A 3IPCA 3HEBA 5IC4A 2RHOA 5ALGA 2W83A 2AK3A 3DKPA 3L82B 4XUGB 4UBKA 4OFWA 4TXLA 3KEQA 1T5LA 2W2NA 3LUJA 2P90A 2GO7A 3QVXA 3WVNA 1GCGA 1SBNE 3BMQB 3C1UA 4XR4A 5A03A 1D07A 1U11A 1UT6A 1XRLA 5EIOA 4PZEA 3PLAE 3FJYA 2CT8A 4EG4A 3B1JA 4X8MA 3O1LA 1ILWA 2PUWA 2HR1A 4IH9A 3E03A 1X7XB 1CQZA 2OC4A 1HOXA 4IWXA 1U3TA 2IPNA 5K8CA 1FUYB 5TJHA 2OGSA 2A30A 3M33A 4LZOA 3UB3A 1I2ZA 5C8YB 3CH6A 4I46A 3GLIB 3AR5A 1O89A 4QYTA 3ZHCA 4IIXA 1H5QA 1UK7A 2MINB 2Q9BA 3DBOB 5IULC 1Z22A 4G0WA 2XSZA 5B37A 3NXSA 1AKQA 1SBTA 4OKIA 1QQAA 3QKIA 5TV2A 2ZANA 3PLRA 1K6JA 2J3MA 1HRKA 2UZIR 2YV4A 3FMPB 1EAMA 4C4AA 4KOAA 3EODA 1E3LA 3KLMX 2IKQA 4IMRA 1T2FA 3N7TA 2A8YA 3HJBA 1AZTA 2J5KA 4CTMA 2EJUA 4Q24A 5CYFA 3U7HB 1ES9A 4IEFB 2OXEA 4IOJA 4WKOA 4YHHB 5HBGA 3ED5A 1TADA 1FRZA 3HYSA 4QHTA 3B3GA 1DC8A 1HLDA 2MHCA 1VA4A 2NLOA 1WUIS 4UUQA 5E3IA 5KKCA 4DUYB 2BH9A 3WNDA 3HFGA 5AKKA 1PUXA 4K28A 3UYKA 4TRNA 3W06A 4HDRA 2OV6A 1EK5A 1UMKA 3IBGA 1XDBA 2L17A 1V7PC 3EGVA 3VO1A 5B57C 3WWPA 2AOUA 1NPDA 2AS0A 2D7CA 3PIRA 4JJKA 3TNDA 3JAKB 1VBKA 1ZIYA 1VBNA 2CGEA 4OFXA 1NI4A 1AUVA 2O2IA 3NHZA 4FSXA 4GZMA 3MWGA 5DT2A 1E3WA 1D4FA 1MKYA 3O3OB 4W5WA 1MC4A 2OGZA 1NJ8A 4B4VA 2EJCA 1I7SB 5EUCA 1QTNA 2PKCA 1YS4A 3HGMA 3D9QX 1XZLA 4V0QA 4JI5B 4CI0B 1LDMA 1X6VA 4GPIB 5I8WA 3K92A 4EPTA 1KMNA 1OI3A 3UB4A 3HR4A 2XB4A 1AB5A 1HDIA 1TYZA 4H3VA 4PG4A 5H83A 3MOSA 4F4HA 2MMGA 4JV5B 3VDMA 2WLSA 2H11A 3TQHA 4D79A 2F59A 1PQ4A 5EMHA 2JHFA 3AY6A 3L6DA 1B8NA 2J0VA 4NU8X 4CT4B 2F2TA 2COKA 4WY2A 3HABA 4PO9A 1GZ3A 2VP0A 3SZRA 2Q46A 3QEKA 4BWFB 3AGQA 1QAQA 3QU7A 1EVIA 3ZIDA 2JFHA 2AJCA 4OBEA 1J0CA 1DEXA 1E6KA 2GQ0A 5TQ2A 3MAGA 4FE7A 1MB4A 4J0KA 1P1BA 2AKEA 5DB4A 1N3YA 2H52A 3AF2A 3DOIA 4YP9A 4ZCLA 2PIAA 5JVDB 2WPNA 3U3ZA 3W4KA 5THKA 3WK8A 4AKSA 4AWBA 3UHPA 2HJRA 1L8XA 1W47A 3EIUA 3ENKA 4N9QA 3LRXA 4WBNB 5LXTB 5HR5A 1UIMA 2D4HA 2G9RA 2QLFA 5DM2A 3SXJA 1XHLA 3R0QA 2VSYA 4HN9A 3O6VA 3E48A 3ELWA 3NUGA 3QLUC 1IWPB 2VR1A 1CQXA 2ZCUA 3DV0B 3F4BA 3Q7IA 3TIGA 1YQQA 5A3VA 5TT0A 3WLPA 4A8JB 4DILA 2ZAMA 1K68A 3IR6A 3KT0A 4K6KA 4O8ZA 2IHNA 1QP4A 4AY3A 4NWIA 1XRJA 4BRWA 3SLRA 1OJ7A 3WTBA 3WDKA 5FBZA 3DBHB 5I9MA 4WY5A 1LQ2A 4KUGA 1ZBDA 5IARA 2ZLBA 1E1KA 2GJ9A 3NTUA 4CM8B 2CUZA 3DCNA 1IG3A 1VIMA 1Y6ZA 4N7MA 3OUTA 3OC6A 4GUAA 1T4DA 1HKHA 3C6MA 2IDZA 4I55A 5DLDA 5ALIA 3PFWO 4PC2A 4ZYWA 1RTKA 1Y98A 3J80A 3K05A 3WK5A 1U4SA 4LYEA 5IBPA 2ZDHA 2AKYA 3C97A 2HA5A 4XKJA 1S2IA 3G02A 3K1JA 5B64A 4YP1A 3HU5A 4E88A 2FYTA 3MCZA 4HDOB 1YZUA 3DNFA 3PFHA 3C4VA 1FVHA 3TQSA 4DXHA 5IUKC 2PG3A 3N74A 3KV3O 3QXSA 4V38A 1PS0A 3GJ6A 3B12A 1Y4AE 2W58A 1O5IA 4FI3F 1Z2DA 2X23A 3R75A 4AJHA 2VJMB 2QGFA 2GD6A 4IIDA 1CUGA 1DFHA 2JFFA 3WFZA 1V5WA 1C0KA 1V4BA 3LYLA 1H2ZA 4RESA 1F12A 4KOEC 8AT1A 2VAVA 1OR8A 1ZHHA 4Z9YA 3LHDA 1ND6A 2AN3A 1NOJA 4LYYA 2C77A 1E2NA 2X77A 3BM5A 4O4JB 4KIFA 4YXWD 2EZTA 2Z30A 1THTA 4DA6A 1WAMA 2PX4A 4GWKA 5FO1A 4ZVOA 3FM9A 3RSOA 3VH4A 4PHTA 3I9KA 1LB1B 4JVNA 1Y3BE 5D5PA 2XNHA 4L4ZA 4UOQA 1GM5A 3C85A 3ZV6A 2F6RA 1NATA 5F7XA 3KSRA 2CVFA 4X7PA 3IEXA 4NDNE 3DC7A 3ND9A 4GM1A 4MUJA 3W5HA 1L5KA 2VUUA 5ICMA 2XAUA 1TA0A 2WVGA 2H08A 3TK1A 3E81A 3N6VA 4UEJA 3HCEA 3OSZA 2PU7A 2QD3A 3EDMA 1COWA 3VU3A 1P0MA 2XOEA 3HXQA 3O8LA 3ASVA 4FDAA 3X1DA 4C6TB 3GQBB 2P3LA 1ZXXA 1C0EA 2AHOA 2CXXA 3RUDA 1BWSA 1PAUA 3MS7A 2QP4A 3HKBA 5H16A 4MHTA 4KTVE 4MKXA 3MMNA 3EOBI 4GUDA 1YBMA 1PO7A 1CJKC 1BCSB 1YNOA 4BS9A 5KOJA 3DKVA 5DBFA 5EJEA 2O2SA 4FYPA 5FB3A 4B5LA 1W0KD 4Q9AA 3X1ZA 3AB7A 4UU7A 4LRQA 4OAPA 2ZUSA 4PGGA 4PFQA 2B82A 3T4XA 1MQ9A 4JI3B 5ALEA 5EJ9A 2V7VA 1CUSA 1QHHB 1TKAA 2IVFA 4RQTA 1JU9A 1A2OA 3EB9A 2ZTUA 5G1OA 1U81A 1SG6A 2HHLA 2ZIXB 5K03A 4L07A 4HZGA 3JR3A 1N7JA 3WRXA 1HG1A 3WGHA 1K8QA 2BR5A 1PBNA 2ERYA 1P9WA 2W2LD 4YC7A 7REQA 4YRIA 3B70A 5FLXA 2B98A 1E4EB 4ARIA 3EXHC 3TM5A 1JBEA 9MHTA 1C5KA 2WUVA 3FPKA 5K8UA 2ZJ5A 3LL4A 4PIMA 3QVSA 4NE7A 2Z2IA 1P4AA 1FYVA 2NYRA 1HLFA 2NYVA 3RM3A 1N32B 2Z2KA 4UREA 2D2EA 5SZJA 4YRRA 1WZCA 1XLVA 1P7CA 1WWKA 5LR6A 3CCCA 1STOA 4ND3A 4ZT7A 4JDPA 1OZAA 1WPQA 2C5BA 5EI5A 1RXVA 4W9MC 4C1NA 2AXEA 3WJ2A 3IL2A 1DIBA 2XDWA 1ADFA 1L1QA 2QU8A 3QVVA 2VNSA 3TW8A 5IVHA 1X1EA 2GDZA 4KLRA 4N9WA 5KYXB 3QOFA 5EWLB 3RC3A 4RGBA 2A9QA 1JJFA 1EB8A 1R0ZA 4Z0NA 3TQOA 3SFZA 4YRAA 4G5FA 3KKQA 4J0IA 1MRNA 5KWIA 1G63A 221PA 1PK9A 4DM7A 3UXMA 3LVRE 3ZG6A 3CCFA 4NBSA 4UJ5A 1N6PA 3SR4A 3URKA 3VU1A 1KGSA 1S4QA 1BS2A 2DHCA 3D8NA 3FYUA 1Q7BA 1SMKA 4IS2A 2P69A 4DMRA 4I08A 3JQEA 1E1NA 5EKXA 1VJ1A 5AW5A 3MGKA 1UR5A 1X80A 2XITA 3HFRA 2F00A 2XGSA 4IIFA 1XJWA 3ACBA 3GARA 3IP1A 3OP4A 4Z1OA 3FYDA 4NEHB 3EZ2A 3GT7A 3HM9A 1OV6A 4XGKA 3GVHA 4B3DA 3LV8A 3A1VA 3BK1A 2ZVPX 1W19A 1LZKA 3TRDA 3U44B 3ZW9A 2CUTA 2ZTSA 3BL8A 2VJLA 2BYTA 3TXYA 5KNLA 3ND5A 4YASA 2JJ8A 5HKOA 2IHZA 3QE0A 4P83A 2KW5A 2Q2WA 1TO2E 3D4PA 2XQJA 4WZAE 4ZI7A 2DOKA 4ZAXA 1AS0A 4RPCA 3ROKA 4MI9A 4HBZA 1JDPA 1WR8A 2LUOA 1NU6A 3EBLA 4C7KA 1JG7A 2PCLA 3AP3A 3VKUA 1H1LB 3B2EA 3FR7A 4WZBB 3GZNA 1JDVA 1ZJ6A 2J07A 2O5VA 5CH5A 1H0RA 2BI4A 1H3FA 1QR2A 3GOHA 1Z56C 4IQ0A 1L6RA 3Q7RA 4O4HF 4TROA 1ZNWA 4HNHA 4YRLA 1V25A 5LPNA 2I8AA 3CC8A 3HO6A 1OHHD 2H7VA 4QPNA 3TUZC 3PUIA 2O7QA 4ZTZB 4OHYA 2EIXA 2BEWB 3UAWA 1LV7A 5JNLA 1M1YE 1SK9A 2AC2A 2VJOA 3NHYA 4JEHA 4CKXA 1M67A 1JHUA 1U8YA 4UKDA 4X1IA 3CG4A 3ETEA 4MHSA 5AHKA 4E5MA 2BBOA 2IQ5A 3A05A 2WFLA 1C2TA 4JEIA 4GFDA 2V8OA 4DSAA 1KPGA 4ITVA 4F8JA 5LNK6 2CF5A 2Z8YA 3PEUA 4PX9A 3WTCA 2WUEA 3CPHA 3G13A 4DJTA 4E4TA 1E9CA 1LF0A 1L1FA 2C9MA 3OE1A 4QFCA 2SKEA 3T3PB 4DA4A 2PS1A 3DT8A 4FBGA 2XZPA 2H2DA 4JI7B 4DSTA 3K16A 4RCVA 3I9OA 5DIFA 3C7TA 4XR9A 3E70C 4AZSA 2FEKA 4HQOA 4YJHB 4OJYA 1PKXA 3B1ZA 1FU8A 2QD1A 3BXXA 3JZMA 1HETA 4H08A 3WDLA 2Q4RA 4KGVA 4ZYZA 3PDUA 1DO8A 4Z99A 3CUSA 3ECSA 3OQNA 3WQHA 1W76A 2XIQA 3VH3A 4BTEA 3OFKA 4G1UC 1CUXA 4ENQA 1KI1A 2A88A 5IDVA 2R8RA 4JH0A 1P8AA 5EESA 4QO8A 3T1VA 2OV2A 4CETA 4RQBA 3HI6A 1MZPA 1JAXA 3BERA 1I2AA 1XELA 2O4UX 2GILA 5A04A 1YZNA 1OKKD 1SPXA 1J8YF 4LXQA 4M37A 5GV8A 4HDMB 1L5HB 3B6IA 3ZX4A 4DDUA 3QKWA 1C8VB 4E09A 5AKHA 3RARA 1XG5A 5DK6A 1U2QA 2XUFA 3B7WA 3M9WA 4O3FA 1RTTA 4ARVA 3T7JA 5BN5A 3SMQA 2IITA 3A6EA 1H6AA 3I09A 5G02A 1FX0B 5HTKA 2HA2A 1VBFA 5JCOA 3LQFA 6PFKA 3G5TA 3LYUA 1MB3A 1P5RA 2QNBA 4M9ZA 1EVQA 4FXPA 5AJZA 4C2AA 4EZIA 5BN4A 1CE8A 5FOVA 5E9AA 1KAQA 1P9NA 5AT1A 5JASA 1MX1A 3EVDA 4P5DA 1V71A 4RTPA 1E5QA 4NMWA 4R71A 2IK8A 3KYDB 4HTFA 1G6HA 2YWXA 4RABA 2NO7A 2VBFA 2E5LB 4ND5A 4ZK2A 4Q18A 3U4CA 1XTPA 1XCGB 2ZDGA 1QP8A 5H1YA 1E69A 4EL0A 2ODPA 3HMKA 4FN4A 2VXCA 3L4EA 4KKVA 1ZESA 2R87A 3AUUA 2C58A 3I6ZA 3V1YA 3JYPA 2BGGA 1KA9H 2R6AA 5CCEA 1PFWA 2QA5A 1A27A 1TU4A 1L7AA 4LX0A 3ITNA 4K9SA 3R7AA 3DOEA 2PKWA 3GEBA 4TLMB 4PZLA 3NBKA 3NRCA 5EZSA 1Y0BA 1IAQA 4RF4A 4XIJA 1N2CE 4PGMA 4CM4B 5K0GA 1DAGA 3U9SA 4CUZA 2IEGA 4V39A 4R68A 4WXRA 3OUZA 2JCXA 4G63A 1Y6GA 2B7BA 2IQIA 3K2BA 4M88A 2X22A 3ETJA 3MWEA 2Q5CA 4GQAA 1KP2A 3HACA 3ZDRA 1LBEA 5DLEA 2BZSA 2P0YA 4QTZA 2CYAA 1RZVA 2J6HA 3GRPA 3IQFA 3LXXA 4X71A 5K3FB 5UKDA 1PLKA 1ZD1A 3B1VA 1UANA 3ZWBA 4CL2A 5DTJA 3RFUA 1BXRA 5IJWA 4EO9A 2NGRA 1EPUA 4WCDA 2F3TA 2R5FA 2Y71A 2GWHA 1BX0A 1C3JA 2NNLD 1A76A 2I55A 2ZOSA 3EAGA 1N9KA 3PXUA 4HS4A 3ROTA 3RYFB 2IBSA 4ZVPA 2VH2A 4OK6A 1ESEA 2JLRA 2O7VA 1P19A 5A5GA 1GDTA 1E4OA 2O14A 1SXJC 3PRYA 1XCPA 1XZDA 1H8HD 2WYVA 2PH5A 1S9DA 3L7NA 2I1VB 2WIBA 4ZVVA 4Z1MA 4GL2A 3E7DA 2PQ6A 2ZPUA 1LZLA 3ELBA 1OXKB 1CQJA 1LK5A 1IZ7A 4KHPB 4Z7QB 1D2RA 1FMJA 1HUQA 1SBYA 1SUEA 4IHJF 4CLOB 1VKHA 3TEJA 4PLHA 3PFNA 1JBQA 3NC0C 2RGUA 4BECA 5IVDA 1FLDA 1POXA 3A7DA 5JJCA 2D5BA 5K2MA 1YRBA 3DF7A 4O5AA 1QPBA 1JXMA 1VFNA 1F4LA 1RWBA 3W2EA 5BMVB 4HNRA 2PRIA 5F33A 2ZSAA 4ZICA 3IKTA 1G1AA 3D8HA 2JZCA 1YD7A 2C4NA 4TMFA 2HX1A 3AUAA 4ASUD 5IZCA 1NP6A 1P77A 4IX9A 3GJ3A 1V9SA 3L1KA 4X85A 3AESA 3CNLA 5I7HA 5TX7A 2ACVA 2F3QA 2ZB3A 1Z15A 2IYPA 3W5DA 1CY8A 1JJVA 4OGKA 3H2HA 2ZI5A 2GFIA 1QO0A 3PICA 5DTRA 1DKUA 1ZMBA 3DB2A 1UWVA 1NQTA 1ZN7A 4LPSA 4RF3A 1E3JA 3LBHA 1UPAA 4J6EA 3VDNB 4UUOA 2EYUA 3RTEA 3L46A 4YWJA 5HILA 2WFZA 2H3HA 2ZIAA 4LYHA 5LZ8A 2VYND 4CEIB 1D9XA 3GMSA 1U7TA 4D80A 3ZNOA 4EEXA 3S1AA 4WLNA 4AMGA 1GA4A 2DFTA 3KPWA 2PBZA 3KWMA 4AMVA 2BFFA 1JFSA 2PBRA 3FOEC 3BORA 1Q3KA 5IC6A 2A1IA 1XVVA 3VJLA 1GUYA