3BXXA

Binding of two substrate analogue molecules to dihydroflavonol 4-reductase alters the functional geometry of the catalytic site
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
324
structure length
324
Chain Sequence
b'ETVCVTGASGFIGSWLVMRLLERGYTVRATVRDPTNVKKVKHLLDLPKAETHLTLWKADLADEGSFDEAIKGCTGVFHVATPMDFESKDPENEVIKPTIEGMLGIMKSCAAAKTVRRLVFTSSAGTVNIQEHQLPVYDESCWSDMEFCRAKKMTAWMYFVSKTLAEQAAWKYAKENNIDFITIIPTLVVGPFIMSSMPPSLITALSPITGNEAHYSIIRQGQFVHLDDLCNAHIYLFENPKAEGRYICSSHDCIILDLAKMLREKYPEYNIPTEFKGVDENLKSVCFSSKKLTDLGFEFKYSLEDMFTGAVDTCRAKGLLPPSH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dihydroflavonol 4-reductase
publication title Structural evidence for the inhibition of grape dihydroflavonol 4-reductase by flavonols
pubmed doi rcsb
source organism Vitis vinifera
molecule tags Oxidoreductase
total genus 100
structure length 324
sequence length 324
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.1.1.219: Dihydroflavanol 4-reductase.
pdb deposition date 2008-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3bxxA00
1YBAA 2B5WA 2CF6A 1P0CA 1P1HA 1A9ZA 4LK3A 4B4WA 3G79A 1D7OA 4R5MA 1HXHA 2A92A 5G4KA 3PJFA 1H9BA 2QRJA 3JQ9A 3X2EA 4DBZA 4DIFA 5JS6A 2X9GA 3PYLA 4Y98A 1FDUA 1T1RA 3LZ6A 3E18A 3NAQA 2Y0CA 3L4BC 4ILKA 5JLAA 3BHMA 4JNKA 1KC1A 4B7CA 3V2HA 4WKGA 1PS9A 3ROMA 1BXZA 4DQVA 3AOEC 1MUUA 3EYWA 1X1TA 1DB3A 4CMBA 2H5LA 4Z3KA 2PGJA 4BKPA 4JP2A 1F0YA 4JQCA 1T1SA 4J1QA 4RDHA 4DWVA 1QYCA 4YAIA 2WD8A 3HFGA 4RVFA 2Q1SA 3JQ6A 7MDHA 2FSVA 2XF8A 1E3WB 1C0LA 4RVGA 2AXQA 3KEOA 2HSDA 1CQIA 1Y9AA 1ZK1A 2P2SA 4BNGA 5A04A 5AXCA 5GZ6A 4J43A 1JWBB 1VPDA 1AE1A 2I3GA 2VWPA 3KM0A 2NV6A 3Q9UA 4GBJA 4MVJM 4OHUA 5I7SA 1GYRA 1NR7A 3CKYA 4XQ9A 1IB6A 3ROKA 2YFQA 3K92A 4FD3A 3BMQA 4XRRA 3ZWXA 3KYCA 2NQTA 1YONA 3E82A 2EHDA 4CMGA 1W8DA 5L7TA 4E2ZA 2HRZA 2D59A 5LC1A 4CM8A 2RIRA 3O03A 1UP6A 4OXNA 4RCVA 4GPD1 1DIGA 2C82A 5U4QA 1V8BA 3RKRA 4YT2A 4AICA 2HMSA 4XQEA 4D3SA 5FYDA 2QRKA 4ALJA 2HUNA 3KEQA 1ZZEA 2W2LD 4AG3A 1D3AA 1EE2A 4J90A 5KKAA 3IKTA 1BXGA 1BVRA 4H3VA 1PJQA 3GAZA 2VNSA 1Y8QB 2AW5A 1KBZA 3GEMA 3RC1A 4DRYA 3L9WA 4O5OA 4GQAA 3AI3A 3RUCA 3DZIA 1WAMA 4BQPA 1QG6A 3CXRA 2VWQA 1I36A 4IQGA 5TIIA 1PIWA 4DMLA 3BZUA 3PJDA 3HFSA 4ND3A 4RF2A 3WJAA 1IZ9A 4KTVE 2HJSA 3RFXA 3H5AA 4BGEA 1E7YA 1LLDA 4DLBA 3GEDA 4O0LA 4I8XA 4BL5A 1R6DA 4QTZA 3RROA 1YQDA 4A7PA 4DC1A 2FWMX 3ZU5A 1F06A 1KIFA 4AFNA 1JVSA 1ISIA 2PR2A 2WE7A 2AG8A 3FPCA 3PIDA 5I7EA 1PJ4A 3RU7A 1ADFA 3H9QA 4D3DA 3WLEA 1DC5A 1JTVA 3QVSA 1EK6A 3H9UA 3HB5X 4PIVA 3VH2A 1NFQA 2EW2A 4XIYA 5CAEA 3D4OA 4O59O 3DWFA 1QYWA 3GG9A 4E21A 5DT9A 3FHLA 4YJHB 2HK7A 2R2GA 2Z1NA 4MVJA 1SOVA 1WLYA 3TZ6A 3ZV5A 4JJGA 2RHRA 4U6QA 4R3NA 2O4UX 2HK9A 4UVEA 3BTSA 4JP3A 5AYVA 2BGLA 2E49A 1E6WA 1DEHA 2HK8A 1YXMA 1H0KA 1YL5A 4LSMA 3GNSA 2HCTA 1HZJA 3WQRA 6ADHA 3RASA 1V3TA 3WGZA 2DKNA 2H1SA 3AI2A 4EGFA 3WSWA 1RJWA 4PN3A 4GKBA 4M1QA 3IUSA 4YJFB 1OFGA 5A06A 4DUPA 5JDCA 4BO8A 3RCBA 4CUZA 2B37A 1JKFA 3GLQA 1N1GA 4B4VA 5GZ3A 4E12A 4Y6SA 3BIOA 1PGPA 5JAIA 3INTA 3Q3CA 1I3LA 4INAA 2AQKA 4J49A 5L95A 3ZWVA 2P5YA 4DVJA 4P4GA 1KOLA 2GASA 4IDEA 3TF5A 1YQGA 1BDBA 4I9NA 4OSOA 1HWYA 4PVDA 1NM5A 2OMEA 3WG9A 4E5KA 4F45A 3LLVA 3WGHA 3IMFA 4GWKA 4NJMA 4J2HA 3IIEA 3K73O 4XWYA 3I6QA 4R01A 3LT4A 4CQMD 1O5IA 4YJDA 2EGHA 3QWIA 4MIOA 1ZW1A 3NEPX 4ESOA 4CLHA 4TRNA 3DB2A 1VL0A 1X0XA 1PGNA 3IOYA 5L3ZA 5B1YA 1YL6A 1P1RA 4ND1A 4RF4A 4ALKA 1U3VA 3BMCB 2VWHA 2VUSA 2EERA 1PU2A 3U62A 1H93A 1VL6A 1XLTA 3D4NA 3T4EA 4R1SA 1Q2XA 2DVMA 4IDGA 3UVEA 1ZXLA 3ZCXA 4A73A 3ZHBA 1PJCA 4CM7A 2ZQZA 1C1DB 1LA2A 1YS4A 2VOEA 3EW7A 5DCYA 3OJFA 3FNEA 3IAHA 1R4MA 4GAEA 2GSDA 3FPLA 4H16A 1SPXA 1LI4A 3D3EA 1EFKA 1N7HA 3IS3A 1PS0A 1DRWA 4IIUA 4BO1A 3RUDA 1LDEA 2I66A 4NK5A 5G2OA 5L4LA 3BA1A 4NG5A 5KVCA 1GU7A 3BHIA 3EVNA 4EW6A 2DBRA 3V1YA 4YAEA 4AJEA 5ENDA 4CL3A 5DN9A 3EMKA 5EN4A 2VTEA 5L9AA 1Z73A 1HYEA 3GDFA 1EBUA 3N58A 1SEVA 3V8BA 2FP4A 2VWGA 4NNJA 4ROSA 3EHEA 2EXXA 1GFSA 4D0SA 2NVWA 4QO8A 5CDSA 3WJ7A 3WNQA 5H83A 3NGXA 4YQYA 4M49A 2HKIA 3ANLA 4XJSA 3LSYA 4AJ4A 2BFMA 2YY7A 4R9RA 3ADPA 1IULA 1R4NA 1KY5A 1Z75A 4NFHA 5C7OO 2YZ7A 1I0ZA 3BXXA 3K2BA 3PDUA 4L4RA 4ALNA 1HYGA 3PWZA 4NK4A 3QWHA 4CM1A 4A27A 3BMOA 4ALIA 4LMRA 1O0SA 2D1YA 4OO3A 5K6AA 4K1LA 3KETA 1PL8A 2IXAA 1N9GB 4DPMA 1WDMA 4O6VA 1FMCA 1H6AA 1DBVO 2D2IA 3OF2A 4CUJA 4FBGA 3UW3A 1X15A 3M1LA 3JD4A 4DIOA 2TMGA 1J5PA 2GR9A 3OJEA 1P1IA 2QYSA 2Y93A 1ZEJA 3AY6A 5TX7A 5KJ1A 3QVXA 3I52A 3HJAA 5G4LA 2J5QA 3EZYA 4QFCA 1G1AA 1PQUA 4R41A 1HDYA 1QLJA 3HE3A 1HEUA 4UAGA 3DL2A 4IDCA 1A7KA 5F1PA 3FRJA 4E5PA 2NACA 3GPDG 1TT5B 3HHPA 5ENVA 3SJUA 3JCZA 3DZJA 3QLJA 4LCJA 2X5KO 1QXSA 2JD1A 3WGIA 1AHIA 1VLLA 1A7AA 3M2PA 4BB6A 2UAGA 1YBMA 5B4TA 3KBOA 3NTRA 4WLOA 4E13A 1KVQA 4Y67A 4M55A 4BO4A 4NMHA 5L7WA 3P2YA 2Y0DA 2PA3A 1C0PA 1HDOA 4MPDA 4CMAA 4U7WA 5TT1A 4GI2A 5U9CA 2ZTVA 3PLNA 3ABIA 1P77A 4Q3DA 4XYEA 4R51A 2V6GA 3PWKA 1HKUA 2G82A 3QA9A 4NPCA 2WM3A 2VT3A 3GFBA 1GQQA 4KQXA 2CY0A 5ITVA 3KZVA 1WMBA 3MCVA 1LEHA 2Y0EA 4J91A 4LVUA 1SC6A 5CEFA 4XA8A 4RL6A 5TGDA 2YV3A 3MZ0A 4TROA 3L0DA 2BI7A 4K9DA 4RPJA 5TF4A 1ZSYA 4R1TA 3R3SA 3U5TA 1Y5RA 4ZQBA 2HRBA 3EAGA 3ZWPA 4IXWA 3BTVA 1ISHA 4FJ1A 4WLFA 4D0RA 3H9EO 3SX2A 5L51A 4A03A 3U4CA 4J4HA 1V9LA 2W4QA 1EUZA 3AY7A 4QSMA 3DC2A 3I83A 2NQ8A 2GCGA 3HWRA 1ZJZA 1QV6A 1RPNA 2IE0A 1O89A 1JQBA 1EVJA 1LLUA 5IAAA 1GEGA 1SBYA 2D5AA 3DBHA 1J6UA 2G0TA 4UULA 3JQ9C 4FOOA 5JW6A 2BD0A 2V65A 5DZSA 3EC7A 3K96A 4R1UA 1NYTA 2OHXA 4L8VA 2D5CA 1WMAA 2G76A 3HG7A 2PKQP 1O94A 4EUFA 1U8FO 2QX7A 1BMDA 3DAGA 5IDYA 2WJPA 2O3QA 3JQAB 5A9SA 1BSVA 5EMHA 3JQEA 2YQ5A 5L53A 4KDFA 3FR7A 3QQPA 3F6YA 1BG6A 3OMLA 3OEWA 3PFFA 5CFZA 4CPDA 4YTEA 1MC4A 4IIVA 3KYDB 2FZWA 2C0CA 5JCJA 1NTOA 1WDKA 3DZBA 1NFRA 1PR9A 1A9YA 4FQ8A 1CWUA 3G0OA 1XHLA 4MVJG 1KEWA 2ZATA 4FJ0A 1SAYA 4UUNA 1XYGA 1EVZA 1ZNQO 4MP3A 5HBRA 1C1XB 2FRDA 3JQ8B 2UUOA 3F1LA 5F21A 5T8KA 3ITDA 1K89A 2PFGA 3KYBA 1W4ZA 3RVDA 3OETA 4OXKA 3L6OO 3NV9A 1MA0A 4Y8VA 3VZPA 4BNIA 1PZGA 1VC2A 1MFZA 3FSRA 3NTOA 4WECA 3GRPA 3ZNNA 1TB4A 4CLEA 4CODB 1B3RA 2R00C 1E5QA 2WTBA 3RFTA 4D7AA 3DQPA 3LC2O 1LNQA 3FNFA 3SBOA 3PQDA 3F1KA 2RBEA 1HE4A 4BUCA 1JW9B 2NVUB 4RPKA 3G49A 1SOWA 4PLTA 2V6BA 3OEYA 1YKFA 4FR5A 2Q46A 4P4NA 4Y9DA 2DLDA 4QQRA 3E03A 3D4PA 1YJ8A 4XX0A 4FDAA 5C37A 2GN4A 1RM3A 1HF3A 4ZD6A 3T7CA 5DNAA 2VYVD 3FCOA 5KOIA 1GDHA 1J49A 1MFPA 1U7TA 4WCFA 3LT2A 2ZQYA 2VN8A 4RLHA 3K9QO 4EEXA 1K6IA 3TSCA 3GUYA 4RJTA 3AUTA 2BLLA 1PEDA 1GUZA 4TRMA 1C0IA 4DQXA 1U3TA 3GEGA 1I01A 5B37A 4J3FA 2I65A 2VTDA 4NZ9A 3RBVA 4K6FA 1E3IA 3JQFA 4MVJP 3DDNA 3VTZA 5IJZA 2IYPA 1NVTA 3PI7A 4UEOA 5DBFA 1T4BA 1BTOA 1JDJA 1ZCJA 4G2NA 5G0WA 3OFSA 4R68A 4GH5A 3SJ7A 2EKPA 4J4BA 2Y1FA 1QV7A 3O8QA 4WLVA 4LISA 4L76A 1ZK2A 3GGGA 3OIDA 3EDMA 2W2LA 3AFNA 3I9MA 3LF2A 2CUKA 3VC7A 1GAEO 2OBYA 2Y68A 1CRWG 1Y7TA 1S7CA 2EWMA 3KVOA 3U4DA 3IQDB 2WYVA 4FFNA 4MIEA 2GRAA 4JJFA 4HBGA 5L4SA 1VJTA 3VKVA 3WR5A 3B6ZA 2XAAA 3WNVA 2DU8A 3O26A 2X1HA 3GK3A 1I24A 3W4IA 4BGVA 5A03A 1IHXA 4EEZA 3FBGA 4IDFA 2E4AA 4MJLA 4ZA2A 4FIZA 2V7PA 3PGJA 1P3DA 5G0VA 1NWHA 2FR8A 3F9IA 1B16A 4J4TA 3S2EA 4W9NA 1LX6A 2D3TA 2JCXA 4DGSA 1XGKA 2TMDA 5F5LA 3P7MA 4D3FA 4NIMA 2W2KA 4M54A 4NH4A 3DBRB 4EBFA 4PLFA 3DBLB 3NDJA 3JYNA 1PWXA 4S3MA 1Y6JA 2P91A 2AE2A 3C24A 4F6LA 4FB5A 5KJFA 1UXGA 1E3EA 4B4UA 1EK5A 1NHWA 2EP7A 1I30A 1AHHA 1IUKA 3MJSA 3PXXA 5ILOA 5IDQA 1TI7A 4WPGA 3V5NA 1HDGO 2NM0A 3TWOA 5I8ZA 4CLOA 3GGOA 3U9LA 1NR1A 4YQZA 4Z0PA 5ILGA 2P9EA 1M2WA 2X4GA 4FFPA 1FF9A 5DF1A 3E5RA 1DFHA 5DOVA 5F1KA 1O95A 4BNMA 1VE9A 1EQ2A 3H3FA 1AXGA 1LSUA 1K0UA 2Y1GA 4RV9A 4XCVA 4CM9A 2ZYDA 4CL8A 1B8UA 4NJOA 3SXPA 2ZB4A 1XDWA 3ASUA 1VSUA 1BVUA 1SMKA 1Z74A 4LRSB 2SCUA 2I5PO 2C5AA 3CPSA 4FPXA 2Y1CA 3PZRA 3FI9A 1E1NA 4I1IA 5KVQA 3ZV6A 5JDIC 2DUUA 1ISFA 4NDNE 4YJGB 4IZHA 5B4UA 2VYND 1LJ8A 3VPSA 3OJ0A 5AQ1A 1ZK0A 3PRJA 5EQFA 5B12A 5L40A 2X5JO 1T2FA 4HWKA 1YBVA 3EZLA 4OKNA 3TOZA 3TZCA 1HSOA 2ZTLA 3C85A 1ZVMA 3A1NA 4GGOA 2EGGA 3QV1A 4LRTB 3N7UA 2X0JA 4L73A 5IDXA 4EITA 2EW8A 2PGLA 4CQMA 4MINA 3NT4A 2OGUA 4BNFA 3GMSA 4RO0A 1U3UA 4EZBA 5BNTA 2VZ0A 3UICA 1WXDA 4HXYA 3DMTC 4CUKA 2DAPA 4BGIA 3U4HA 1Y81A 4B4OA 3GUCA 1YOVB 3DBVO 1OMOA 2A35A 4R16A 4BO3A 2G5CA 5LDGA 3AY3A 2OBNA 5K6AC 4RGBA 1I2CA 1U4SA 1Y1PA 4CM4A 1UP7A 2WYWA 1UH5A 2DBVO 3JQBA 1ADGA 4PLVA 2AQIA 4M87A 2P68A 3RI3A 3ETGA 2AE1A 1HDRA 1LRJA 1R0KA 2HQ1A 3NTQA 3PVZA 4BO2A 1E1KA 1HTBA 2DT5A 2NLOA 3W8EA 2WEKA 4XD2A 3TFQA 3JYQA 4J0EA 4DQUA 2HMWA 4AJLA 3RKUA 2CVZA 3FNHA 5TJ9A 2FMUA 5COAA 1E3LA 5DOZA 3UAGA 3PHJA 1MXFA 3JSAA 3E1KA 4PZCA 5KKCA 1WP4A 3RBXA 1IHYA 2D8AA 4GGPA 1XIVA 3Q0EA 5BT9A 5IN5A 2RH8A 3V2GA 4J1NA 4K26A 4AVYA 1DRVA 1O9BA 4KOAA 3OQ6A 4Q3NA 4UUOA 4XGIA 2EEZA 5JMPA 2E6UX 3GFGA 3WFIA 4P4LA 1NWCA 2A9FA 2QW8A 3K31A 4CLDA 3QIVA 1P1KA 1Y5MA 1T2CA 1NQAO 4XYBA 3OIFA 2IEDA 3R0IA 3HZZA 4ZICA 4IS3A 2NU6A 2GNAA 5IDWA 1XQ6A 3H9GA 1T2AA 1U28A 1IOLA 4NBWA 4L74A 4Q3AA 1HYHA 2X7HA 4ITUA 5JE8A 2A4KA 1M66A 4HADA 3TL2A 4HNHA 3T7EA 3WOHA 3WWZA 1RWBA 3OICA 3CMMA 3NUGA 1NQ5A 3W8FA 1P31A 4TZTA 4W82A 4D46A 1OBFO 2PD4A 2Y66A 3C1OA 4PLYA 3WXBA 3GDOA 5FFFA 3WX0A 3IJRA 2YJZA 3DXFA 5DULA 3H2SA 3C7CB 1YJQA 2BFAA 3CTMA 3C8MA 4U8GA 3SC4A 1BW9A 3NJ8A 1EQUA 4E6PA 1MXHA 3P5SA 2BGMA 2Q99A 3A4VA 3M6IA 1F12A 1ZEMA 3ZNOA 4BKQA 1KEVA 1H2BA 4TKLA 4BV9A 4YT8A 3P2OA 2NNLD 4JBHA 5TSDA 4KZPA 3ZHXA 1PJLA 3K6JA 4PCVA 4BNLA 2VNAA 1QR6A 3I5MA 1V3VA 5THQA 3KXDA 2VHXA 5DP2A 4PGFA 4YWJA 3AWDA 2GDZA 5DBGA 1RKXA 2Y1OA 3A28A 3E8XA 3G17A 4MIYA 3UXYA 3H6KA 3DMYA 5TT0A 3FTPA 3E9QA 3NJ4A 4D42A 2JD2A 4OMUA 1T2DA 2RH4A 1ZK3A 2EJVA 3ZHYA 2O2YA 3QWFA 3VOSA 4WEOA 1UXIA 2JKVA 2NUAA 3UUWA 4BNWA 3DHNA 5C3MA 5EPOA 2BHLA 2H9IA 4OJNA 4IJWA 2DBZA 4CV3A 4E4YA 1PJSA 3BAZA 5CG1A 5EJ2A 2JHFA 4PG4A 1ISMA 3C7AA 4CM6A 1PJ3A 8LDHA 1X0VA 2PY6A 3GG2A 3W1VA 5ES3A 1EDOA 2NTNA 1MG0A 3ICPA 3DTYA 3KSZO 3VZRA 2O3SA 3GOHA 3SLGA 4CLRB 3GNQA 1N8KA 3I4FA 3JQGB 3JV7A 4HFMA 5COBA 3RU9A 3C7DB 4NQZA 4E0BA 4GVLA 3ZNPA 3DAFA 2Z1MA 1YH3A 2IDZA 1A71A 3ZWBA 1NVGA 2YDXA 4W7IA 4ZGWA 1QP8A 2Q2QA 1JVBA 5BNFA 4YRDA 3H3JA 1GTMA 2ILTA 3WIDA 3ZWYA 2LDXA 1KYQA 1NNUA 3PEFA 1DSSG 2FPIA 3I4CA 4ZRMA 3ZDFA 4RDIA 4BNXA 2EP5A 4YBZA 3VDRA 3O4RA 3B1JA 5DDIP 1GQ2A 4LMPA 3DZKA 1MC5A 1DC3A 4R1NA 4Z3DA 3WSVA 5BSEA 4H7PA 4PZEA 4KUGA 2XOXA 2BI8A 4EUEA 2I6TA 3U49A 2Q1WA 4ND4A 3ULKA 3ZWOA 4CQLB 4RF3A 1RYDA 1NBOA 3PJGA 1E92A 3F47A 1ML3A 3NT5A 4Q3CA 1CF2O 4FC7A 1X7HA 1XU7A 4XB1A 3W4KA 5A02A 1A4UA 5H82A 5TS3A 3S55A 5JY6A 1RM5A 2IODA 1GYQA 2NVBA 4YVFA 4B8ZA 3CMCO 3JQCA 4URFA 1RYEA 4XB2A 2Y99A 4CLXA 1XEAA 1FJHA 3WYBA 2PZJA 3TZHA 3ZWMA 3AK4A 3NX4A 5ADHA 1G6KA 1HE3A 1L7DA 1MLDA 4FFMA 1T25A 3AW9A 3VPHA 4R5HA 1X1EA 5G4KB 3JQ7A 3GDGA 3RUEA 3BMNA 1L1FA 2QG4A 3IC5A 2ZB7A 5CPFA 2HMTA 1D1TA 1DIRA 4WCFC 1K6JA 1LDBA 4GWGA 1WWKA 2FR0A 1R12A 4XZ3A 3TL3A 1FDVA 4XDZA 3I9JA 3R1IA 4G65A 3LC1O 2HMVA 4HFRA 2PV7A 1I3MA 1E6UA 1H94A 3TN7A 4R54A 3WYCA 1ZSNA 4OIMA 3GR6A 2NU9A 4XQCA 3PIIA 1BGVA 3H5RA 3WIEA 4NBTA 2GN6A 3GGPA 4WLUA 2X86A 2O7SA 1H2HA 5AXDA 2CD9A 3CSDA 3HNPA 4J1TA 1ZFNA 4NU6A 4S1VA 3PP8A 4B79A 3D1LA 2XXJA 1VKOA 2OP0A 4CMEC 1WVGA 3B20A 4IINA 1IE3A 4QT0A 3BMQB 4E32A 5EIOA 2BGKA 4DREA 2OORA 3KYCB 2LDBA 1OAAA 4KWIA 3ZWCA 3IP3A 1MV8A 3F3SA 1YRLA 3LLSA 2E82A 3UFXA 1B14A 2HDHA 4CM8B 4PLWA 2F00A 3LT1A 3ZW8A 1W0CA 2GLXA 5KIAA 5KVVA 3HSKA 2OOSA 3AJRA 4XYGA 3WICA 4WOJA 1PL7A 5AXAA 5CDTA 4PG6A 3I6IA 2AEJA 2VHYA 1OOEA 5FEUA 3UF0A 4DYVA 1U2GA 3VZQA 4J2OA 4MVJE 5CPBA 2XXBA 3HDYA 3IUPA 2Z5LA 1BXGB 3F4LA 4YEDA 1ONOA 1NXQA 4P8RA 4BO0A 1GD1O 4IM7A 1P45A 1DLJA 2VYVA 3GF4A 1GZ3A 4J7CA 1HLDA 1ONPA 4XQGA 1E3SA 3ZWAA 3L4BA 3NDRA 4PLZA 4WUVA 4M89A 3S2IA 3HQ4O 1ISJA 4WCDA 2GN9A 4RVDA 3D3WB 4D45A 4FFLA 3AOEA 1DC4A 3M1AA 5F3RA 4IDBA 1Z7EA 4AJ1A 3D0OA 3GN2A 2QIOA 3GA0A 3UKOA 3WBFA 2EJWA 3LDHA 2QZZA 3JD2A 1WNTA 3QWAA 2CFCA 3ASVA 1ULUA 1FDWA 2JAPA 3D7LA 2W90A 3F4BA 4MO2A 1IL0A 4YCAA 5EESA 4I5FA 3CIFA 1UXJA 4LW8A 2RAFA 1XWFA 2WMDA 2J3HA 4NI5A 1KY4A 1C0KA 1UDBA 3ZH2A 3PLRA 5C7LO 5JYDA 3Q6IA 5L7YA 3ZI0A 3KOUA 3ROPA 2ZB8A 3GZNA 1JN0A 2FOIA 3GN1A 3LU1A 4RQUA 4YR9A 5EINA 1F8GA 2CSUA 1H5QA 2CDAA 2VZ8A 4KP7A 4FOSA 2HAEA 1UXHA 4HUJA 1SZJG 5C7IO 1NFFA 3QRWA 1Q1NA 1DPGA 3RAJA 3GZ4A 3RUFA 3L4SO 5K9ZA 1R0LA 3CZMA 3OQ1A 3U4IA 4BNNA 1DC6A 4XIJA 3QVTA 4OL9A 1B26A 4YA6A 4ZQHA 2X9NA 3HDHA 2GZ1A 3GQVA 5CDUA 1B15A 3FR8A 4D41A 3DONA 3ONEA 4R69A 2JFGA 1KC3A 1PTJA 4CMIA 3ZWWA 3F46A 3KUXA 5A3VA 5HM8A 4HP8A 4E5NA 3JD3A 5TLSA 3QSGA 3UCEA 2PK3A 1P33A 2C59A 1IPEA 4W6ZA 4LCEA 3LF1A 1ZO8A 3MJVA 5GY7A 1HLPA 3HUDA 4R9SA 4DC0A 4IMRA 1DRUA 4AJIA 3DBRA 5F1OA 1NAIA 4I5DA 4NJMB 4BMSA 2PLAA 3OSUA 4ONEA 4UVDA 1ENYA 2XPCA 4BNTA 4UVGA 5A05A 5J23A 3C1TA 4WJZA 4BIIA 4HV4A 1JWAB 1ZMOA 4W7HA 5EERA 2JFHA 4AJPA 3GVHA 4C7JA 3VH4A 2WWRA 2POQX 4A2CA 4EI2A 1OI7A 2BF7A 1ZMTA 4DTIA 4YXFA 3JQAD 3EGOA 1K6XA 3W6UA 2FHSA 3DEYX 2UUPA 3ZU2A 1U2DA 3WGYA 3PQEA 5I7FA 1DLIA 3QW2A 2B4RO 3B1KA 4FGSA 4QFDA 3UH1A 4CR6A 1Y8RB 2WD7A 5GZ1A 2YHIA 4B3JA 3FWNA 5IZ4A 1YO6A 3UHAA 3I9NA 1HDZA 1GZ6A 2YYYA 2VYNA 3BTOA 3FWZA 4IGFA 3DZHA 1SO8A 3OH8A 1H6BA 4PLCA 1E1LA 1CIVA 1LQUA 1KVSA 1YB1A 2J3KA 1XELA 2O48X 1X13A 2Q49A 3C1AA 2UVDA 4RORA 3DR3A 5A9TA 1LC0A 4O1MA 4CV1A 4PLGA 3AFMA 4DA9A 2OXIA 3LQFA 2H6EA 4FC6A 3DOOA 1UAYA 5T67A 1P44A 3COSA 3H5NA 2B36A 3OA0A 1SB8A 2B4TO 1NPTO 2C20A 1LDGA 2Q1UA 4UVIA 2P4HX 1R66A 3LYLA 4CMHA 3I3OA 4ID9A 4Y6PA 2DTDA 2Q3EA 4ALLA 2X0IA 4BNYA 1WDLA 4GX2A 1R4NB 2JJYA 4QX6A 2AHRA 1JLLA 3OQBA 3H65A 3CH6A 2C2YA 1LC3A 4OQYA 5DCWA 1KERA 4ZQGA 3OBBA 3BMOB 1D4FA 4PLHA 1E7MA 1P9LA 3WQQA 3PZBA 3PYMA 5ICMA 2FZEA 1CJCA 1E3WA 3E6AA 1E77A 3KSDO 1ISGA 3DOJA 2GN8A 3HADA 2WE8A 3DAPA 3LK7A 1MG5A 3GRKA 4IJKA 1GV1A 1I5RA 2NTVA 3ONDA 3PHIA 4PZDA 3V1TC 4GX0A 5JNLA 2QZ9A 2CNBA 4MDHA 3CINA 3PQFA 4PG8A 2FPGA 4PG5A 3MTGA 3WLFA 3PPIA 3ETDA 9LDBA 2VRCD 5A5EA 3H9JA 4G81A 2O2SA 4E31A 2AEFA 3TDKA 1GY8A 4HNGA 2P5UA 1GPDG 4AJNA 4LVCA 1DFGA 2PZLA 3B1FA 4WEQA 1Z45A 2X8LA 3GY0A 2VHWA 1E7RA 5FWNA 3DFUA 4B3HA 4BV8A 1NPDA 5MDHA 5JC8A 4AJJA 2E48A 1I10A 2PNFA 5B4VA 2F1KA 2EIHA 2CVQA 3MJTA 1Q7CA 5JDCC 3TNLA 1DIAA 5TNXA 4EDFA 3WS7A 1Y8QA 3ZU3A 2UV8A 4RLSA 3SVTA 2C7VA 2VRBA 4EUHA 4JN6B 2G17A 1S6YA 3PTZA 5CEEA 4MVJH 2W98A 1DOHA 1HZZA 2C29D 1J4AA 2X23A 3UOGA 4WE3A 4II3A 1MX3A 1XG5A 2CVOA 2PKQO 3QWBA 2BRUA 1K3TA 1UAGA 1YVEI 5CHEA 2OZPA 3PFWO 4BKUA 3ANNA 3GMDA 5BSHA 2C54A 4J9VA 1R16A 2VCYA 3OIGA 4GMGA 3NRCA 1KVTA 3HDJA 1E0DA 1KEUA 1UP4A 3VPFA 3VPXA 1WPQA 2Q2VA 4J9UE 5K0ZA 4XJTA 2B83A 4YJHA 4XGNA 4GSLA 4TQGA 3I9OA 4DPKA 1PX0A 1P1JA 4I08A 4PFJA 3MJ4A 1RM4A 2I67A 2YFHA 3DBHB 1B8VA 4B7UA 3DTTA 1SNYA 4KUHA 1DIBA 5U1PA 3ZN2A 1HSZA 1OZAA 3OA2A 1DIHA 4RPHA 4ZJUA 3H8VA 1HRDA 3JD1A 4I9HA 3WFJA 1CDOA 3IKVA 1AUPA 1ADCA 4IZIA 5IXYA 1XCBA 2PZKA 3L07A 1GV0A 4JK3A 4IBOA 1G0NA 4CLRA 3A06A 5BNIA 3RUIA 4DLAA 1AGNA 4YJFA 2Y1DA 1BWSA 2B35A 3KLPX 2OP1A 5A9SB 1N7GA 3EVTA 3S2GA 1ZUD1 4DXHA 4QO7A 1DXYA 3Q11A 4IXTA 1H6CA 2I9PA 5JBIA 1B8PA 2FR1A 3B70A 4NFYA 1VI2A 1QYVA 4A26A 1PL6A 4D44A 4TZKA 2YW9A 1P1FA 4RVHA 4ZU3A 2GZ3A 1AXEA 4I5GA 4BMNA 2ZTMA 1FDTA 3UN1A 4TVBA 5KWEA 1U8XX 1XKQA 2RHCA 1Q0HA 2AG5A 2Q2WA 1PGQA 1VM6A 3AM3A 4UEJA 1ENZA 2B4QA 1EFLA 3ST7A 4FCCA 3SC6A 2D0IA 2JAHA 5CDYA 1EBFA 1P74A 3LVFO 1GYPA 4N18A 1O8CA 3SLKA 4RPGA 1LSOA 1CYDA 2FPPA 4RVSA 4WNIA 2UYYA 3BMCA 1DJQA 2E37A 3N74A 5JAMA 1GCOA 1Q7BA 4MKRA 5HWSA 1W6UA 4DPLA 3WGTA 4Q3EA 1EMDA 4AL4A 4JX8A 1C1DA 3PDJA 3E48A 2JHGA 4I9UA 1DHRA 1JAYA 4JCOA 2ZCVA 1M76A 1JKJA 4JXKA 1GUFA 4Y6RA 3WGGA 1B2LA 2ZYGA 5DP1A 4CMJA 4YAGA 3A14A 2DTEA 3LC7O 4PVCA 4BB5A 3H4VA 3RC7A 3WMXA 4NFSA 3D64A 4OOEA 3WGOA 1HL3A 1YGYA 4PRKA 2GO1A 2O3JA 4XR4A 2V6FA 1XR3A 2BKAA 1Z7BA 3WB9A 4WCFB 4H15A 1NP3A 5FI5A 5HTOA 4OYRA 3QY9A 4JGBA 2HO5A 3INGA 3OJLA 4II2A 4JIGA 4NR0A 5KJ6A 1T24A 2B5VA 1NAHA 3I1JA 1R0SA 3IDSA 1LRKA 1H9AA 1E7SA 2AMFA 2OFPA 4G5HA 4ALMA 3GC6A 2PD6A 2CMDA 5T6BA 4ZRNA 5JC1A 3JD0A 4FS3A 5GMOA 1EZ4A 1OC2A 1HDCA 3VKUA 2G1UA 1U9JA 4Q3BA 5CDGA 1I2ZA 3GAFA 2DFVA 1R15A 4NHEA 2I99A 5JYEA 4Z0TA 1EVIA 1DO8A 2OL4A 1LDMA 2BFPA 3RJ5A 3DFZA 4PG7A 1G0OA 1MGOA 3O8QB 5A3JA 4WLNA 1Q0LA 3AM5A 4HY3A 1YL7A 3T4XA 1IY8A 1N9GA 5FF9A 3KB6A 2J3JA 3HN7A 2DFDA 4IJVA 4XGKA 4UUMA 3D5QA 2R00A 1Q0QA 1U4OA 3TZKA 4RPLA 1FXSA 5KVSA 1NASA 4E2WA 4W99A 3AI1A 3TFOA 1LXCA 4TVOA 2I3AA 1M6HA 2C5EA 1SEPA 4KMSA 2NTJA 2O7QA 3VDQA 4CMCA 3D3WA 1ZSVA 1ZH8A 4DIBA 5L4NA 1LDNA 2GD1O 5I7VA 3PHHA 3E9MA 1PS8A 3RD5A 2OUIA 3KTDA 3MOIA 1TT5A 3RSHA 5IZCA 2O3UA 4LGVA 1F17A 3O9ZA 3L6DA 1B3BA 4BO7A 4JJIA 3TOXA 1N92A 4PRLA 2W2KB 2BELA 1A72A 4CR8A 3GVCA 2X0NA 3RIHA 4UREA 3VTFA 4J7XA 1ZXBA 3OJOA 4E2YA 1NQOA 1F8FA 3L6EA 4J1SA 4E5MA 5JMWA 4XKJA 5KJEA 1HE2A 4WOKA 2NU7A 1YB5A 1LLCA 3RWBA 3QHAA 4CLOB 2C7GA 2YUTA 3INRA 2CZCA 1I2BA 4J7UA 3UCFA 4BNZA 2JCYA 2VQ3A 1Z82A 5G0UA 4HX5A 4UVHA 3Q2KA 1UXKA 1YDWA 5T8KC 4N54A 1T4DA 4CM9D 4RZIA 3WYEA 5ICSA 1N1EA 4ZQEA 3M2TA 4Q9NA 2HLPA 1C14A 1PJ2A 4YT5A 2PZMA 1GUYA 3PHLA 2DBQA 3A9WA 2DPGA 4RZHA 3PGXA 2NADA 3R3JA 3F5QA 2Q45A 2GERA 2VUTA 2VUUA 3U3XA 1P0FA 4YDRA 2YQ4A 3G3EA 2AQ8A 3MEQA 3VH1A 4FW8A 4OM8A 4CQMB 1HETA 2D4AA 3S1LA 5IXSA 2JCVA 4F46A 2X0RA 3AUAA 4UEKA 4N5MA 2JFFA 3VH3A 1XA0A 3AM4A 2WDZA 5ITWA 1GADO 4Z6KA 3KLMX 4U0KA 4RVUA 3JQAA 2C07A 5JY1A 5BSFA 5BQFA 4CM4B 1NQTA 9LDTA 4N7RA 3E9NA 5BR7A 1YQXA 4FGWA 2O23A 1PZFA 4IQ0A 1I3NA 2GGSA 2O4CA 1EVYA 5FI3A 2PTGA 4CM5A 3KYDA 1NVMB 3Q9NA 3AOGA 2PWZA 2VZ9A 2VT2A 1LQTA 1E1MA 4CR7A 1Y8RA 4RQTA 4E2XA 4CM3A 3RBZA 3DO5A 1ORRA 3EUWA 4P38A 1JA9A 5TRTA 2FSSA 3JQFC 5ER6A 1EE9A 1C1XA 2IXBA 3KO8A 4BKOA 1K5HA 3JQ8A 2YV1A 4CJXA 4Q39A 4WASA 3DOCA 1BDMA 2UDPA 3QE3A 4MVJF 3PYXA 4GLOA 2QHXA 5JDIA 5EL0A 4YACA 5COQA 3JYLA 3CEAA 4R4JA 3ONFA 2AQHA 3S2FA 4BQRA 4GSKA 1QRRA 2X22A 3EK2A 2ZJ0A 4UUPA 4J6FA 2WSBA 3DZFA 3ZHZA 3HB4X 3X2FA 5LCXA 3CUKA 4ND2A 2Q1TA 2QQ5A 4IJUA 4IDAA 4BO6A 1LRLA 4A10A 4TMFA 3W6ZA 2DQ4A 2NVUA 1DAOA 1VL8A 1DJNA 1IYZA 3IP1A 3ZNQA 5JSFA 3S8MA 2X9VA 2GYYA 4O63O 5I9MA 3DMTA 4LSWA 3KHUA 2J3IA 2ZB3A 1UZLA 3OHSX 4KDEA 3HDQA 3KRTA 2P9CA 3G1UA 3SEFA 1OC4A 5G0TA 1PR3A 2IYOA 2Q4BA 3FF4A 4W9NC 5JO9A 4CV2A 1UDAA 1KVUA 4YAJA 4EYEA 1BW9B 2IZZA 3KV3O 3WTBA 4U0JA 4XYLA 1DAPA 1IZ0A 1R37A 3TJRA 5DBIA 3ZWNA 4KTTE 4IUYA 2RCYA 3RFVA 1Z6ZA 4J0FA 2Q4EA 2VOJA 4JBIA 4JROA 4KWHA 3JTMA 3FNGA 3RC9A 2VRCA 4MKZA 3GVPA 4OKIA 1UR5A 1M67A 5TC4A 4BNJA 5A1TA 1I33A 1N2SA 1IPFA 4EJ6A 4KUEA 1U1IA 1M6WA 2EKQA 4I5EA 4NBRA 3L9XA 5ER9A 4QUKA 3D5TA 2JL1A 4FSHA 1LSSA 4GX5A 4YB8A 2Y05A 3H7AA 1ZJYA 4C7KA 3OECA 5IN4A 1PJBA 5TQVA 1ZIDA 3UCXA 4Z9FA 5A5FA 1PWZA 1B7GO 2VHVA 4BGUA 4YYZA 1KS9A 2X58A 3JYOA 4MVJD 1KEPA 1E6EA 1L7EA 4GL4A 5IG2A 3ORFA 2B0JA 4Z9XA 4AJKA 3FBTA 2BFOA 3JYPA 1ADBA 2R6JA 3PJEA 4TKMA 2OO5A 2J5RA 3DHEA 3MJCA 3F5SA 4GLLA 4B7XA 1DFIA 2BMAA 3GT0A 3RQSA 3OP4A 1BXKA 2ZIZA 1EUDA 1ZBQA 1VJ0A 2I76A 4E3ZA 1SB9A 4YRAA 3K5PA 4IMPA 1BHSA 4NBVA 4PLPA 1VKNA 1UUFA 1N5DA 4IDDA 4FFRA 2X6TA 1VJ1A 3C3XA 3NGLA 8ADHA 7ADHA 1SCUA 1WZEA 3BHJA 3ANMA 4C4OA 1PZHA 2GUGA 3VPGA 2O3TA 5CP8A 4XDYA 3FD8A 4QEDA 4FN4A 2DPHA 1QSGA 3RUHA 2IZ1A 3DBLA 1D8AA 4IY1A 4ZVVA 2NWQA 1F14A 1LU9A 1CEQA 1PJTA 3JQBC 4CV0A 1UZNA 3VVBA 1E3JA 4DYDA 5JO0A 1LSJA 1LLQA 1TEHA 2ET6A 3ADOA 1LBEA 3EY4A 4OAQA 1ID1A 1I8TA 1NX6A 1VRWA 4RF5A 3ZGYA 4YT4A 1PQPA 4FFOA 4HFNA 3TPCA 2GZ2A 3DHYA 1PQWA 2EG9A 2J6IA 3ENNA 1RM0A 3STHA 1TLTA 4MVJI 5I9NA 3ROQA 3I23A 5IFLA 1EUCA 1FDSA 2C2XA 4CMKA 1B0AA 4U6SA 3WTCA 4GMFA 4EJMA 5JAQA 1R4MB 1YE3A 3NKLA 4OH1A 4XEHA 3JQ7B 3VZSA 4BS9A 4E30A 4P22A 4BHTA 1GZ4A 3BMNB 2ZCUA 4DBVO 1TA4A 2IEBA 5CEJA 2P9GA 2ZTUA 1V3UA 4OOFA 4YJGA 1YB4A 1LDYA 3VVCA 5T64A 3O38A 3WMWA 1JKIA 1XU9A 3PHGA 3UGKA 1XQ1A 5KTKA 2DTXA 3ZW9A 3ITKA 4JLWA 5TJHA 5HS4A 5F5NA 2EKLA 2GF2A 4MP6A 3QVOA 2YHUA 1PGOA 3DZGA 3U0BA 3I9KA 3MTJA 1TT7A 4TWRA 4IS2A 1KETA 3QVWA 4BNUA 2HMUA 3FTNA 1TXGA 4AJOA 1K2WA 1U3WA 3IL2A 4GKVA 1E5LA 2B69A 1PSDA 4QECA 4L4XA 1DDOA 1YOVA 1C3VA 1D1SA 1A5ZA 3WBBA 2IZ0A 3TRIA 3GVIA 3GVXA 1QKIA 4WGGA 3NT2A 6LDHA 3BYZA 3QJ5A 3ZV4A 4OQZA 4OGWA 5BSGA 4BKRA 4WK6A 1NHGA 2PD3A 1JAXA 3MWEB 3H2ZA 3JQDA 4Z0HO 4L0QA 4BVAA 1V35A 1CETA 3VAZA 2GPTA 4NBUA 2J5KA 5JPIA 4D43A 1X14A 1W73A 2FY8A 3MOGA 2PH5A 2J8ZA 3W4JA 4ZQFA 3ICCA 4TRRA 5JFOA 1GPJA 5DCUA 5AVOA 3WWYA 3MWDB 3HN2A 3NYWA 4A0SA 3CE6A 2AEMA 3BTUA 3IJPA 3K30A 1ARZA 2CF5A 1QYDA 2A94A 4B8WA 1X7DA 4HKTA 5IZCC 2Y1EA 3WDSA 4XRGA 4DL9A 1A27A 3TZQA 4K28A 5HRUA 4GX1A 4W4TA 4IGEA 5I9LA 2Z95A 1PZEA 4YPOA 2O50A 4D79A 2CDBA 3AU8A 4BOYA 2HJRA 1ENPA 3ENKA 3WGQA 4XYMA 1CQJA 4DMMA 1UDCA 1XSEA 4Z9YA 1T26A 3WQSB 4X54A 4YRBA 4NU5A 2V6MA 4M8SA 1O6ZA 1I32A 2CDCA 4K6CA 1FK8A 1DHTA 1V0JA 2ZJ1A 4DLLA 3U09A 2YV2A 2JD0A 2NU8A 2ZK7A 4JBGA 4AJ2A 4MP8A 2Q50A 3V2UA 4CMEA 1ENOA 4GVXA 3GHHA 3CZRA 4MOWA 3GZNB 3GH3A 1E7QA 1JU9A 3K8ZA 1QORA 1Q7GA 4ZHSA 4WNCA 4N5LA 4E33A 3OM9A 4BO9A 1U7HA 4U5QA 4ND5A 1CERA 3R6DA 5T5QA 2DUWA 2QYTA 3L77A 5IF3A 3E5MA 1LUAA 2W8ZA 2EF1A 1GL3A 5JXWA 3VHRA 4KQWA 4ZN6A 4MKXA 1A4IA 1E7WA 4BNHA 4OXYA 5A9RA 5I8WA 2Y67A 4IPTA 1Y9EA 3Q1LA 4CMIB 3GNTA 3ZU4A 3I9LA 1YWGO 3KSUA 1QMGA 1GEEA 3RJ9A 4N5NA 3G1TA 1ZKMA 5KJCA 3ZV3A 1ONNA 5T57A 1EDZA 3PK0A 1MP0A 4OSPA 4R3WA 4E5YA 3ETEA 5HS6A 2VHZA 1GQYA 3PWSA 1PGJA 5G0SA 3K2EA 3W8DA 1GCUA 4BMVA 2HU2A 3AUSA 4L75A 1U5CA 5CG2A 1I3KA 1GR0A 3NDIA 2BH9A 3Q2IA 1HDXA 1YDEA 4A5OA 2ZYAA 2H63A 5THKA 2FN7A 2DC1A 4BNKA 3JQGA 1HE5A 1KVRA 3ON5A 1HT0A 3RC2A 4M86A 1U5AA 4B3IA 1WW8A 3AUUA 1J0XO 1V6AA 1ULSA 2NSDA 4WLEA 4FJ2A 1M75A 4L9RA 4F6CA 4TSKA 5JCXA 3LT0A 5L45A 2AA3A 4HFJA 3V1UA 1LTHR 1H6DA 1NPYA 2PH3A 2QRLA 4XR9A 4BO5A 1BRMA 2PKRA 2PGDA 1UJMA 2EV9A 2WD7B 5LDHA 1T2EA 2YHIB 2ZKLA 3QP9A 5EQDA 5JAZA 5JCJD 4IQ8A 4LN1A 3ZZNA 1QYXA 5MGBA 5AXBA 2O3RA 1TVEA 3MJEA 4CQLA 1AN9A 1UZMA 4TRJA 1EEHA 1X7GA 5AOVA 4J16A 5KNLA 3RUAA 5C5IA 1QLHA 3P19A 2P4QA 4BNVA 4F3YA 5KCZA 1MB4A 1VSVA 2YDYA 3AU9A 3FN4A 2IRWA 3GHYA 4L4SA 4QXMA 1WZIA 4YAKA 4AJHA 3GPIA 4EJ0A 3TQHA 2X5OA 5H81A 5HA5A 1ZK4A 5A4DA 2WYUA 2DM6A
chains in the Genus database with same CATH superfamily
1YBAA 3M83A 4R98A 4REQA 4MS1B 1MJ5A 3G68A 1UKCA 1KMIY 4QUBA 2G4LA 1Z4QA 1DCKA 1K7FB 4MA0A 2A92A 1WZNA 1QDEA 1EFPA 4JHLA 4JIMA 2QRJA 2UUBB 4MTLA 3JQ9A 5ALYA 4DBZA 2MYPA 1XZDA 3LZ6A 4U2FA 2ONKA 4PCLA 3IYLW 4KXQA 3GFQA 1X6VA 2G1KA 2Y0CA 5E6SB 4ER7A 2NO1A 4WOBA 4ILKA 3BHMA 3EJWA 4A0FA 3K6SA 3I01A 1XK7A 3FTCA 2VPPA 3FGNA 4B7CA 2YS7A 4WKGA 4CKYA 1PS9A 4YCNA 3KD2A 1JQ3A 5MGNA 3AOEC 1I3CA 1MUUA 2WJAA 4MQMA 1W35A 1X1TA 2FEAA 2PGJA 4INZA 4JP2A 4EHLA 1F0YA 4JQCA 1N32B 2I4LA 5FBZA 7MDHA 1CFJA 3E1SA 4RHUA 4RLQA 4B3GA 2W8BB 3O6VA 3RE1A 4RAQA 5IF9A 3GUZA 1P2GA 4K9QA 2JLBA 4GMXA 4O4LA 3GRRA 3DE3X 2AXQA 4RVGA 2HSDA 2QSUA 2TS1A 2A9KA 3H5OA 1ZK1A 4E5UA 4BNGA 2HK6A 3LT5A 3N9IA 1RNLA 1IJEA 1TKRA 1GUAA 3AT1A 5GZ6A 4P3NA 2E7ZA 4K6MA 4MVJM 2I3GA 3ZXUB 4CEHA 1UKEA 3Q9UA 2FKAA 5IC6A 1GYRA 1J0AA 1NUSA 2OV4A 4OGLA 1LWNA 3CKYA 4XQ9A 5CA1B 1IB6A 3KQTA 2FPGB 2QT1A 4I36A 2C0QA 2YFQA 3DWEX 3J81k 2AXEA 1G2IA 1RXEA 3ZCVA 3CO0S 4KQJA 3KYCA 2QTNA 2NQTA 1YONA 2D7JA 2JIRA 1QK5A 5BWCA 1U2SA 4KQCA 1E63A 3RWMB 1W8DA 1COWA 1GL9B 2ZAMA 1JR3A 4MUAA 4RC9A 3GNLA 1DELA 5JJ5A 2VAWA 2JIDA 5LC1A 2RIRA 3F5MA 3K9BA 3O03A 2V59A 2X8WA 3HXTA 3DJYA 4C4XA 2X5XA 1V8BA 2X1VA 4KVAA 2VNHA 5AW8A 4JH0A 1PEAA 3BD9A 3EG9A 4AICA 1NZJA 1IU9A 1W2WB 3N87A 1GZHB 4YRLA 1RXUA 2YXDA 5G3ZA 1UJCA 5F73A 2EQ5A 3LXMA 4ALJA 3U7GA 1RAFA 1AHPA 3KEQA 4DY6A 1AN0A 2RGNC 5KKAA 1A2OA 4UEQA 4G5QA 4TMZA 1RAAA 4EVQA 2V4MA 2VNSA 1KAQA 2XCSB 2CLDX 4ZT3A 1MRZA 2C94A 1F4VA 1SCBA 2WMYA 5K5EA 1KJZA 1NW8A 4C4PA 1H2YA 2F3TA 4GQAA 4Z8XA 1ZCFA 2LD4A 3S7ZA 1FQKA 1WAMA 2QM7A 1QG6A 2GO7A 2CLFB 3CXRA 4K9NA 4LI3X 5CK4A 3SBXA 5CCEA 5DN6D 4IDNA 5ALUA 1ML4A 1U2TA 5I9BA 1GKIA 1XD9A 3QFTA 3QUAA 3RFXA 3H5AA 4BGEA 1GSAA 5DK4A 4JLDA 4DLBA 4EPXA 2GM4A 4O0LA 3WIVA 1LPPA 1R6DA 1NBME 2V97A 2PDAA 3EA4A 2QMHA 3R3HA 3S28A 3BA6A 4A7PA 2AN1A 3KZNA 3SJAA 1F06A 3EGIA 4RTSA 4PBSA 4FOTA 2Q1XA 4KQ1A 1NRJB 2XT0A 2EP8A 2AG8A 2FX5A 1PJ4A 4DUZB 1TL7C 3DH0A 4K7JA 1Z34A 4OF4A 5C4MA 2HXGA 1DC5A 3II6X 3I30X 1RHKA 3QUCA 5HJ2A 1YCFA 5EHNA 1SCNE 3KQVA 2ID7A 3KALA 3TSAA 3VR2A 5LMZA 1NFQA 1FFAA 3CLRC 4DNQA 2G1PA 1EWTA 3D4OA 4YX9A 3ZJYA 3B89A 3GG9A 3V42A 4UHEA 4XVRA 1HMPA 4PANA 3MUOA 1ZD9A 3Q8MA 3GWZA 2ZIVB 2Z1NA 1MC8A 4DDTA 4J76A 2EQAA 4LJSA 1T4CA 1GCAA 1WLYA 3K0HA 3LD9A 1FX0B 4NLLA 3ZV5A 2O7RA 1O08A 2A5GA 4DSNA 2O4UX 2XZLA 5JWHA 5IAJA 1QGDA 3BTSA 3PRHA 4CU2A 3FLEA 1TF7A 1E6WA 1JEJA 1TF5A 1FTNA 2E49A 5GM1A 4LXUA 5BPFA 4DCOA 4RL4A 4B6JA 1YL5A 4LYHA 4D8WA 4Z4QA 2JRLA 2IEZA 2Q5HA 3WQRA 3I42A 5LQJA 1FW6A 1JEOA 1EK0A 1RWMA 2H1SA 3AI2A 3WSWA 5K4HA 1J42A 1Y37A 3EXFA 2BPOA 3HI4A 3NHLA 5TQJA 3FZQA 4YJFB 5KTRA 1WKVA 3UHOA 4DUPA 2B1GA 1EXNA 1F20A 2GVNA 4G01B 3RCBA 3SDZA 4MW4A 1JKFA 2JFOA 2JJ2D 4IGIA 4KJZA 3R5JA 4H3HB 4L8WB 4MZXA 3OBIA 4RJ2A 5GJVC 1NUQA 1KJJA 3MXTA 3ZE7A 1N0UA 4J49A 4HR7A 2P5YA 4LXYA 4FI3F 5TF0A 2CNWA 2CL5A 5BN3B 4NXNB 4P4GA 1OSNA 3JZMA 1N34B 4IDEA 4KQMA 2P0AA 3B51X 4I9NA 3H19A 4UPDA 5E6RB 1DWPA 3PKJA 4E70A 4F45A 2QUZA 3A2MA 4NJMA 4O3FA 1YOBA 3OT1B 3U4GA 4BASA 2Z8XA 3E3LA 5M7EA 2I8CA 3D7KA 4OB7A 3LT4A 3GDWA 1IOVA 4FE3A 4JITA 4ZO8A 5LXTA 2EGHA 2VXCA 4MIOA 3A9RA 1ZW1A 5AHWA 1EH5A 4RJLA 3T7SA 1C3JA 2PFSA 3JPWA 3TX2A 4HAUA 1YZQA 1CP3A 4WTOA 3CO5A 3IAFA 4RBNA 1X0XA 5L3ZA 3UGJA 2CNNA 3EQ8A 4MUXA 3IPXA 2HF2A 1U3VA 2VWHA 4KEAA 2EERA 4JSTA 5H9VA 4V03A 5EJ7A 1H93A 1VL6A 3C5EA 3TQTA 3DJFA 1EGQA 3BGSA 4MS3B 5BQOA 5L3RA 1AZTA 1TVKA 3ENVA 4R1SA 1PLLA 3T4EA 1ZISA 5I7WA 1ZXLA 3NTXA 2JCSA 3DEHA 3OX4A 1PJCA 3QQ5A 4ZI7B 3EW7A 4IXDA 4X95A 3B7WA 3TKLA 1RI5A 2J3LA 1GPLA 1IEVA 3CLTC 1Q74A 4FMPA 4D4HA 3QTBA 3FPLA 1S1CA 1SURA 1SULA 3ICVA 3D3EA 5FORA 3SQWA 4U39A 3KOYA 2AF4C 3KWMA 3RLIA 1PS0A 5EJ4A 5HTKA 1CY2A 2Z6VA 3AUFA 2WJIA 1D6JA 3BDIA 3EWAA 3KR0A 2ASVA 2I66A 3GBVA 2FW0A 2GARA 3HU1A 1Y82A 2VNKA 4EQ6A 1I94B 2NP6A 5BYAA 1TJNA 4Q4JB 3BA1A 4P93A 2W0MA 4BWYA 3SYNA 5KVCA 3NIDB 1QPZA 3EVNA 4CTKA 4EW6A 4YAEA 5ENDA 5IT4A 5DN9A 5AR1A 1S2MA 2P3LA 5L9AA 4WN9A 3C6QA 5ALOA 1KJQA 1PJRA 1USIA 1KK1A 3D54D 2FP4A 4RPCA 1RFLA 2O8BB 2OEPA 3EHEA 4R8SA 4O2AF 4CTJA 4D0SA 3S1AA 1NVEA 2NVWA 3V1NA 1K2VN 2WWHA 3WL3A 3WNQA 1JJBA 1QC5B 3NGXA 1X7XB 2H7YA 5J4YA 4I9GA 5CDFA 3BWMA 5JISA 5ALVA 2WMNB 1V5IA 4IGKA 4M49A 5AIAA 3AVTA 2EZUA 4OY3A 1G66A 3LSYA 4H6PA 4HS4A 2CVPA 3W2EA 2R8BA 2YY7A 1EVLA 3W05A 4AJ4A 2LKDA 4KXFB 3K4PA 1X74A 2NZWA 1Q3HA 1XNGA 2VTBB 1N8TA 1QU3A 1HYGA 2VXOA 3PWZA 4X1OA 2Z57A 5EZYF 1Z68A 4BFTA 1NBAA 2R1ZA 2XGOA 2HIMA 3F71A 2PJUA 4RZQA 1SUBA 2RE8A 3T3IA 5ALXA 2XQKA 5C81A 1O0SA 2D1YA 1GAJA 2GD6A 4YRJA 1CE8B 4QXRA 1W0JD 2G09A 2YWJA 2CL0X 2AMJA 3KPVA 4K1LA 3WGNA 2Q27A 4K0KB 4BATA 4J0GA 1DUIA 1N9GB 3LDFA 4OHVA 4DPMA 3EZ9A 2ZEJA 4NPHA 1BS1A 4JBXA 1X15A 5DV9A 1TGYA 1XVAA 4WXYB 1L3IA 3X1DA 3AKYA 3FXAA 3B82A 3QEOA 4AM8A 2AS0A 4GI5A 3W3ZB 4JYBA 1AOXA 3B2EA 5D1NA 1I4WA 2G4CA 2WM8A 3IEPA 4GHWA 5HK9A 4N5DA 4F1WA 3VPBA 3GGDA 4QREA 2XGMA 3VMMA 5DMXA 3SZOA 5KJ1A 1T5DX 1NLZA 1ZM9A 2RK3A 2IZOA 2BMFA 4P3OA 2QNRA 3A1TA 2QJWA 4G1UC 5DSXA 1HDYA 3RIYA 1KDPA 2TECE 3DL2A 2HWXA 1X3LA 2IU3A 5JS1A 5C18A 4E5PA 1H85A 5KWVA 2NACA 2I3DA 2PMFA 3HHPA 2UZ1B 4QYWA 3JCZA 2WC1A 3DZJA 4O2BA 2O1WA 3PF9A 4NARA 4JLSA 4Q18A 3AVUA 3ZKWA 4PXSA 5CYOA 1CS4C 1VLLA 1E9BA 1E2KA 3CRVA 2UAGA 4GPBA 1YBMA 1QO0A 2JKYA 2FF5A 1KJWA 4FXPA 3KBOA 5FBWB 4ESHA 2QNBA 2X1LA 3PC8C 4G41A 3K9HA 4G4IA 4M55A 1CZLA 1P8JA 2OKCA 2SBTA 1HDOA 4MPDA 4D4JA 3WNZA 4CMAA 4JJKA 5TT1A 3PQ2A 5U9CA 1BWRA 1XZGA 1XJQA 3WL6A 3MIZA 5JQGA 5TQ2A 1P60A 3ABIA 1BFDA 1P77A 2J5BA 2VP3A 3UC9A 1PAUA 3LUAA 4XYEA 3U7QB 1TVCA 2V6GA 4ZDKA 3ZK9A 1U6KA 2GEDA 1Z0DA 2OD7A 2WAAA 4D0LB 4AUNA 5KINB 4IQFA 1TLFA 1LJLA 3WIBA 1NVAA 1QGYA 4AJ9A 3IOCA 3ELYA 2HEGA 3PDIA 4KKVA 1LEHA 2R25B 1E1QA 4J91A 1PLJA 4U7PB 1NQXA 1M33A 3EDYA 3F67A 4KU4A 2PBLA 3L0DA 1T9KA 5FFMA 1A4RA 4JJ8A 2BI7A 3L5OA 1FTQA 2GA9A 1SXGA 1Y5RA 4R40A 1EFHA 4F04A 3EAGA 1BOOA 3ZWPA 4RTKA 1ISHA 3LIPA 2PV0A 1T5TA 3SX2A 1UPFA 1GPWB 3DLIA 4H7HA 4QSMA 1EUZA 5C8DA 3P2MA 1Z4IA 4LQDA 3DMDA 4BQIA 5HYVA 2I6UA 2VDWB 3KOWA 1G16A 2P6UA 4B6EA 2Q5QA 4F06A 1QV6A 2IE0A 1Y33E 4EG1A 2QENA 2PWBA 2PG3A 4FNOA 5F78A 2PRSA 1GEGA 2D5AA 1P72A 1J6UA 2G0TA 1Y9DA 2QR3A 3MPOA 3WKEA 1FFXB 2VYFA 2FVXA 1XB2A 1K06A 1Z62A 5C1OA 1W75A 2CHVA 3N75A 1FP6A 4Y2TA 1CP2A 4R1UA 4C7MA 1NYTA 1TYBE 2GRJA 1BCSB 2GCIA 3QX7A 5CM9C 1L0BA 1SKQA 3BXGA 4I4IA 2WSLA 3OJXA 3SSOA 3O4VA 1J1UA 4G5FA 4DLTA 2XKAA 2FN3A 1QUEA 2XRYA 4Q1BA 1EJ0A 2Z2YA 3TH5A 4ZOAA 2RBKA 2O2DA 3L4EA 3RR2A 3M6MD 1XQYA 3MHTA 3BSWA 4QBHA 1YA8A 2X77A 3NBXX 2WJJA 4OM7A 2WJPA 5ALGA 2O3QA 1JX6A 1PP4A 3VC3A 1BSVA 1IC6A 2Z2XA 3PEYA 2Q4DA 2XVZA 3DOFA 3DT6A 4KDFA 1VRCA 1AY0A 3E7WA 1RT9A 1AS2A 4QRDA 2XD9A 4IIVA 4YTEA 4CCWA 5ITZA 4NICA 1IZYA 2C0CA 2FZWA 3LBNA 3AIOA 5EXDA 5JCJA 1D4OA 1NTOA 1GNLA 2ZT7A 3R5TA 3QW4B 3G0OA 4KHPB 1KPHA 2J6BA 2P9YA 2ODTX 1QGUA 1JDPA 1NVDA 1X9GA 2WHPA 2QN7A 1SAYA 2VXBA 1PF7E 1EGHA 2VEOA 4FGJA 4X1IB 3I8SA 3OU2A 3S68A 3LPCA 2JARA 1C1XB 4DN6A 3K70B 1ZGBA 4K87A 1E1RA 4MV0A 3UXHA 2DF8A 1Z6YA 2UUOA 2EW1A 5F21A 5CFLA 2WTXA 3AR7A 3JZFA 3IFSA 3EWSA 2ADFA 2EFGA 3BF7A 2HJ9A 2FPSA 2SECE 3DUWA 4UC0A 4BTVA 2NP7A 4F3NA 1UMDB 1WULS 2XXAA 1XEXA 4DRYA 3IDAA 3NV9A 1JTFA 5C0OE 1MA0A 1PZGA 1JG1A 3H84A 2BEJA 1VC2A 3FSRA 1DQRA 1V25A 4H0NA 3GRPA 1TB4A 1PJAA 4RSHA 1NUHA 3CH5A 2CLMB 1Q77A 2WIAA 4JL6A 4LYJA 1LNQA 2IIQA 1KYTA 5A5FA 3ERCA 2X2OA 3FY4A 1MRSA 4ZAWA 3ZIAD 1RRPA 3VI4B 2JCBA 1N2CA 4Y2JA 1X77A 1JW9B 3JALB 2QTWB 1W30A 4X84A 2NVUB 3IV9A 1SQSA 1T3HA 1VKHA 3O3CA 2LBPA 3DW3X 1YKFA 1IIRA 4FR5A 3ZHSA 2B5OA 2GLUA 3ORSA 2J0QA 2A14A 4FDAA 4ZAGA 5DRYA 3FTEA 4JUBA 4P98A 2BGRA 2P2GA 1HF3A 2FNAA 3A4YA 3T7CA 3EXG2 2PWPA 3FCOA 2SKEA 3K20A 2OCLA 4NAVA 1DPFA 4TXLA 4WCFA 1R6VA 3QENA 3R76A 2ZQYA 3B5IA 3SWWA 2C9BA 2O57A 2VN8A 1FP7A 2Y4OA 3PUKA 3PSHA 4P7BA 1BZYA 3ZR4B 2OC4A 1RLUA 3GUYA 1BMTA 1CVIA 1SCQA 4I8DA 3GP8A 3NU1A 3LLMA 4JVLA 1PEDA 2B99A 3RWOA 4ZK6A 1N77A 3H3XA 4N0DA 4TRMA 5A3SA 1GLNA 1U3TA 5IULC 1N3IA 1AHNA 1ZD1A 4DV1B 1WJGA 2I65A 1QP7A 4KGXA 4LC1A 3LH5A 4G1MB 3RBVA 3LY5A 1NJ5A 1MHTA 3OKPA 3WJ1A 4BQFA 4U7GA 2HHJA 3TFWA 1NVTA 4IVNA 4B8YA 4UEOA 3A6FA 3UQZA 3G6WA 5DBFA 1PQYA 1I1QB 5CJJA 1FNCA 1ZCJA 3CONA 2P78A 1UFVA 2MU1A 4XI9A 4B45A 3T3GA 3CM0A 1KYXA 2VF2A 4OHKA 4U2CA 1QV7A 3ZCQA 4LISA 1EWYA 1ZK2A 2ASEA 3U5ZB 4HX9A 1RQGA 3EFBA 5AW5A 3EDMA 2I6FA 1YC5A 1AKNA 2O8NA 3AFNA 3I9MA 3IJ5A 2WUFA 4X93A 3SX4A 2CJXA 3PB3A 2CUKA 1HV8A 3G5LA 3G7UA 4IJ5A 2XWBF 4RE5A 2WB2A 2IOFA 1RRKA 2IBMA 4QM7A 3D6JA 2HT6A 2VDLB 1BKDR 4P3KA 1X3SA 1CRWG 1ICIA 1VCMA 4TZ0A 4NV0A 2BEVB 1SKBA 3FNRA 1W4LA 2PMDA 3PENA 3IQDB 2WYVA 4MIEA 2G1JA 1YUNA 1JSXA 3N3AC 4HBGA 2HSEA 5D00A 3PUJA 3WNVA 3R9XA 1NRXA 3O26A 2B1IA 1C4XA 1XOIA 2JS7A 3ROFA 4BQSA 1E4YA 1GRRA 5IM4F 3O2JA 4QBIA 4BGVA 2CNLA 3SQMA 3GI1A 4UM8B 5A03A 4F1KA 1X1BA 1QF9A 3A58B 3FBGA 1K7SN 1VCIA 4KO3S 4D9NA 4ZA2A 4DUGD 4YRQA 1HQCA 1MO6A 4ZAVA 1M0EA 2VTVA 2FR8A 4P83A 1B16A 3AKCA 3WP0A 3ZLBA 1Z25A 2JCXA 2D3TA 3NTVA 4BDTA 4JUFA 1L8LA 5FDFA 2NMVA 5I48A 3SHFA 2ZUSA 3P7MA 1Z5VA 1E6CA 1J8QA 1Z3IX 2FK8A 5MFPA 2N9UA 3JYNA 4S3MA 3HNRA 4I3GA 1NX9A 5IW8A 1WV0A 2AL7A 4M9SA 2IFTA 3CF0A 2QGZA 1XVUA 3H16A 1IWOA 4JBWA 1FS6A 4FB5A 1KR2A 4HB4A 2WVGA 3TLKA 4H7IA 4I46A 4DDMA 3QKSB 4B4UA 2CB0A 4Q12A 3N6XA 2I6SA 3CNBA 4MQLA 1NHWA 3UAOA 1BE0A 1W1UA 3VDNB 1JZTA 1RYHA 2ZTSA 4C3UA 1TI7A 2EDCA 4D8TA 4Y3UA 1IVNA 1M8KA 3VU1A 5I8ZA 4CF3A 1XMIA 3GGOA 4L8GA 5KYWB 4Z0PA 5ILGA 1HTTA 4U7FA 1CHDA 4FFPA 1OXUA 1QBGA 2R48A 5IHPA 2R8YA 5F1KA 3K70C 5EE0A 4DV5B 2J7PD 2QI9C 1YRYE 1J90A 1VJ5A 4HDRA 1VPTA 1FFCA 3HMKA 1DI0A 1YR6A 5I5EA 5GOTA 4L9SA 3OOYA 1IIBA 4CL8A 5IHXA 2FJ0A 1QFXA 1G63A 4J0HA 3ZY5A 2ZB4A 2XUGA 3JPYA 1ZNXA 4AB1A 2WFZA 4ZU6X 5E2BA 5AKYA 4I1IA 3I73A 4PW0A 2JJ2A 3C15C 3E70C 1S5PA 1YFKA 1E1NA 2ZRKA 4QUAA 3ZV6A 1M83A 2DUUA 3A2LA 3R5FA 1WRBA 4NDNE 5I5GA 3MBOA 4DKJA 1KI8A 1E5TA 1S2LA 4YV7A 1Z2EA 3BFPA 4GGOA 3PC7A 2ZITA 4QSHA 1ORHA 4MTCA 1DO2A 3QV1A 1K97A 2X0JA 1UBJS 4FSDA 4IIEA 4R6XA 1UBLS 2IIPA 2QLBA 1L5LA 3GZJA 5IWAB 1F0PA 1O1YA 2AUNA 3DM5A 3CT6A 5BQ5A 2TSYB 3N86A 3NDPA 2HYIC 1LW7A 3NT4A 2OGUA 5AH0A 1FFHA 2IIBA 2JIMA 3GMSA 4FX5A 4RO0A 4D74A 2VZ0A 3UICA 1WXDA 3U9SA 3T1YB 3FB4A 3EA0A 3I04M 1RXVA 2DAPA 3AP1A 4BGIA 1DCMA 4D3YA 1Y81A 4B4OA 2CJWB 1YOVB 2D13A 2ID8A 2AUTA 3LXRA 1T5HX 3O82A 3PFHA 4HH4A 4O2LA 1OMOA 4DY4A 5GJBA 2ZBUA 3T06B 3DMNA 3VHLB 4ZZ0A 3AY3A 1KF0A 4CM4A 1I2CA 1U4SA 1J9ZA 2VQ6A 3GXBA 1UP7A 1NRIA 1O87A 2KWIA 2V55B 1EM8B 2WYWA 1P80A 5CJPA 1G64A 3SI7A 2XMSA 1U9CA 4OFBA 3BS4A 4OQPA 3RIXA 4EDHA 1EINA 3PFCA 4FE4A 3FJYA 3PVZA 2BTOA 4B74A 1DG3A 3KDPA 4TL6A 4ZI7A 1HTBA 3ZVKA 1D6SA 3W8EA 1V47A 1II9A 1KU0A 2X9QA 4TTQA 5CXQA 2ZUVA 4EAAA 4E5VA 2CVZA 3FNHA 1G7CA 2PZAA 2CHFA 3DFIA 3MRTA 2QY6A 3NKFA 1NA5A 3NWPA 4HTFB 4WHMA 1HGXA 3ORRA 5FCDA 2V9PA 3UAGA 2QTVA 1U99A 2KM1A 1HEYA 5DGCA 3RBXA 2PR7A 2WG0A 1SUIA 2V7EA 1IHYA 3PNLA 3EE6A 1R5OA 1U3CA 4H1TA 1EAYA 1MT0A 2K6GA 3DE1X 3U3DA 1XIVA 3Q0EA 5BT9A 5T3YA 5SZKB 2RH8A 4DVGA 1Z4LA 3CNOA 4Q3NA 4KOAA 4PGAA 4ZCPA 4TZ6A 4RETA 5LDDC 2BTQB 2GT1A 3IEXA 2XBUA 3PFBA 1EM6A 3WFIA 3GL9A 3E05A 4LOKA 4CLDA 3LO5A 3A9SA 3WADA 4AMVA 4QTTB 3OLYA 4JBYA 4DCUA 4L02A 4XYBA 2DETA 2JFWA 2QVGA 2X40A 5ALJA 5KYUB 1NF8A 2VSYA 3DMHA 3R0IA 4DG8A 2OO5C 4KPUA 3HZZA 3VU9A 4IQ4A 4XLLA 2NU6A 3BRQA 3H42B 1U2QA 5IDWA 2F67A 5F7OA 1CQJB 3BWDD 4D9BA 5M34A 4B3BA 1N2XA 1R8QA 4GR5A 4NEHB 1M2OB 3LPDA 2R6AA 3DE7X 1M66A 3CV3A 2ZSDA 3CF2A 3RSZA 3T7EA 3TL2A 1R6XA 1D09A 4YP1A 1RW4A 3KTFA 4WADA 1Q21A 1A8UA 1FXWF 1GGNA 1SXHA 1JG6A 1KWKA 1NYQA 4YCJA 3AESB 5IH3A 1QMPA 1DP4A 3PGVA 1OAKA 1CR4A 1W0JA 2CHGA 2KHZA 2Y76A 2Y66A 3ONNA 1CQPA 4PC3A 4PLYA 4PV7A 5EWJB 3WXBA 5FFFA 2BC9A 4G1FA 2BH2A 1JA1A 3R20A 4LXIA 1A77A 3TGLA 1SBHA 3DXFA 2CYCA 5DULA 2QRHA 2BFAA 5IJ9A 3C8MA 2W0SA 4O4HB 4W1QA 1SG9A 2BGMA 3RTEA 3V3KA 5HZMA 1NLMA 5F52A 1PR5A 1YAHA 3M6IA 3OZGA 1HH4A 1LF0A 1ZEMA 2RBGA 3ZNOA 4ZARA 1KEVA 1KI7A 4YV1A 4CYMA 4YT8A 2IV7A 5A2QA 1Z08A 2NNLD 4JBHA 5TSDA 4EMUA 4Q34A 2ZRNA 4MS4A 4RA9A 4YV2A 3K6JA 3CRNA 3NHBA 4XSHA 5TDHA 3P0IA 4MCJA 4QPJC 4RH1A 4ZI3A 1Z7YA 4BNLA 3NS7A 1QR6A 1OLUB 3SVLA 3OQPA 4ETMA 4ZYTA 2VHXA 4GOLD 4OHMA 2XWJI 1QGAA 4YWJA 2CJFA 3HJGA 1CZKA 2GDZA 2HA5A 4Y6GB 3IIJA 3PEEA 5CNIA 4CG3A 2NPFA 1Y48E 5HIMA 2WAOA 3A28A 3E8XA 3G17A 4MIYA 2ZI3A 4M53A 5TT0A 3NJ4A 2ZE7A 3AMVA 4JB3A 4OMUA 3W6OA 2PXCA 3DNPA 3ZHYA 2EJVA 3VI3B 4F6RB 1YMUA 3VOSA 4DCCA 4C0AC 1OX4B 2JKVA 2UZ1A 3UUWA 4R6WA 1XPJA 5KSPA 4QVKA 3DHNA 5C3MA 1RTTA 2BHLA 2W42A 3Q98A 1JJIA 3FJOA 1G38A 4UMEA 2GEUA 1UFQA 4CV3A 4EJ2A 5K6TA 1ETHA 1PJSA 1XF1A 2WYIA 2I80A 4E4YA 4I1PA 1XRRA 2DPLA 1MW9X 2XCQA 1C2YA 2PN1A 2XRMA 2FTKE 1A88A 1K5GA 4LZZA 1V26A 1XXLA 4K9OA 1JQ5A 2PY6A 3FUCA 1E2MA 4IIYA 5TGTA 4B09A 3F98A 5KUTA 1EDOA 5CIQA 2W6QA 3DTYA 5AOCA 4ZOLF 4CLRB 4MKGA 1N8KA 3WYGA 2XDAA 3IULA 1Z5PA 1B0UA 2Q7OE 1DOZA 5HNKA 1IHUA 4HFMA 3D0KA 5LKRA 4NQZA 2AN5A 4E0BA 1VLMA 2D7DA 1OH7A 2C4TA 1CW2B 1I3OA 1LBIA 1NKVA 3X3HA 2BEUA 3DE5X 2NT4A 3GD7A 4W7IA 2OK7A 1QP8A 2Q2QA 3R5KA 1RQ2A 1GNSA 4G0XA 1GTMA 3WIDA 4EHIA 1VE5A 4MUEA 4V39A 1DSSG 2FPIA 4ZRMA 3RS0A 3PU6A 2EP5A 4YBZA 3VDRA 4B17A 1S3IA 5C8YB 1CPYA 1GQ2A 4HVCA 1RVDA 2VCEA 1MC5A 4R1NA 2QMOA 2OGWA 2WLSA 3LCMA 2PT7A 4H7PA 1RRCA 1J8MF 4URXR 2IKSA 2L18A 3G2PA 1G8FA 1WCXA 2J4CA 3CURA 4QD3A 4DKXA 2Q1WA 1UL1X 2DKOA 1JALA 2IYQA 1Q1EA 3EF3A 2AJ8A 3PA6A 3U37A 4LFAB 1ZU4A 1RYDA 3H13A 1J1IA 4Q3CA 5LIPA 5ISMA 1NKSA 1EGVB 2ZRIA 2NXCA 2PBZA 1CJVC 5KYTA 2F59A 2H1OA 3I05A 3U48A 4E2FA 5H82A 1KEZA 2ERCA 1RM5A 1QONA 1PFQA 4JLOA 3RTAA 3L8CA 3E9RA 3TI9A 2YN4A 5HQ3B 5B6PA 1ZM4A 2O7NA 1JP7A 2VLBA 3FYUB 3CUTA 3PKZA 1ULHA 4TXMA 2IXEA 1OW3B 3CMCO 4H60A 4UMFA 1E9DA 4ENTA 3UOWA 1XEAA 1FJHA 3M33A 2PZJA 5REQB 3TZHA 4ZO7A 1A4XA 5J2TA 1MLDA 4FFMA 2ZRPA 5LMNB 4YC7A 5KNCH 4AQYB 3MS4A 5G4KB 4C4ZA 4DIDA 4H3SA 1G42A 2BE9A 2V98A 2VP6A 3DE0X 1T3ZA 4IV5A 1D2AA 3IC5A 1R6AA 3KTOA 4MR8A 2PS1A 2VHTA 5THXA 3WGUA 3GBSA 3HKEB 3P0RA 4L6CA 4M7RA 1EFVB 1CDDA 1K6JA 5AVJA 5ADWA 1YBFA 4WFKA 1OPXA 1XCJA 1LGYA 4HZIA 3MT9A 3E3AA 5C1IA 3LC1O 2HMVA 1Z38A 3G9UA 2Z4TA 4U5XA 1Y8CA 3CVOA 3GLKA 3TN7A 2FUEA 2NZYA 1JG3A 2I03A 1I4TD 3ZDYB 4OJMX 2W83A 3V7YA 3EOZA 2P7IA 3DZDA 4XQCA 3DTVD 4HLUA 1BGVA 3PGA1 1P9RA 1PSWA 3H5RA 4O4IB 2GN6A 3RS8A 2EBWA 4KE8A 3JZIA 1V7CA 2H2AA 1V5EA 2X86A 3STVA 1PCXA 3G9TA 3HDTA 4L22A 3I58A 1FUYB 5FAXA 2JJ8A 2XB9A 3EF1A 4C7BA 4EUKA 1RCUA 3GEPA 4B79A 2ZZNA 1VKOA 1LI5A 5IABA 1E2IA 1ECFA 4JELA 2I7TA 1GUDA 2W9XA 1FNSA 3GCGA 3K3PA 1PG2A 4IINA 1IE3A 4OH7A 5JU6A 1OIWA 2XEDA 2BGKA 3ASYA 4L5JA 4DREA 1GQOA 1ZH4A 3HHEA 1NMEA 1SUFA 1WMSA 3FDZB 4MJ7A 1MOZA 3DVRX 4HYQA 3UB3A 3KB2A 4ZHQF 3WL7A 3R3XA 2Y0BA 2D5BA 4IZ6A 5CVEA 1V7PC 1UBTS 3ZIAA 1B14A 4W5TA 3IO5A 1ESEA 4HDKA 3KNZA 1A8PA 5AM2A 5KIAA 1VRVA 4KL8S 3HSKA 2C5GA 4XYGA 3WICA 3ZQJA 3IIKA 1GGKA 1PL7A 2JAWA 3KCQA 4DJ5X 5CDTA 1DKPA 2VHYA 2HFKA 2A5JA 4RV5A 1NVBA 3SMQA 1WHSB 3VAAA 1G41A 4KWTA 1QE5A 5HX7A 2AFIE 3K0EA 5CPBA 2OG2A 5BRAA 1KTVA 4JB8A 1SA0A 4C5CA 4QXQA 2ZBQA 3TRDA 3F4LA 2FGJA 4TMXA 1NXQA 4U6NA 1TRKA 4E1VA 2I4TA 1AU9A 1DLJA 1GZ3A 2W4IA 1ONPA 1VE7A 4G07A 4J0JA 4PCUA 3KZKA 3THWA 4ZVQA 2G8LA 3KEMA 5GPBA 1E3SA 3DGEC 1U5BA 4EW2A 3UJ7A 4YRZA 4X00A 1M7HA 3UK1A 5I01A 2WYOA 5HDBB 3L4BA 2APJA 1BU8A 3PNYA 4OFZA 3V6MA 3HQ4O 1DXQA 3CKLA 3EZGA 2XSZA 4WCDA 3VZCA 1KZ7B 2BWJA 3G0BA 2PKXA 2W2OA 1NI3A 3M1AA 2XNCA 4OEHA 1Z7EA 4Z0NA 2MJLA 4OYYA 2XTJA 3N8GA 3UKOA 3I61A 2QZZA 4TTJA 5E7QA 3DYIA 1WNTA 2CE7A 3NBMA 3DP7A 5KTPA 5ICGA 4BX3A 1R9GA 4BLWA 2JAPA 4RWEA 3UK7A 5IYZB 1WXWA 1E6MA 2W90A 4IVRA 5FOVA 3DKKA 3I2IA 3FTQA 2A30A 4U2GA 4YCAA 3NYQA 2BZ0A 1UXJA 1CLUA 1ZGAA 4I5FA 4M0PA 4NPAA 5KQPA 2BDTA 1F2VA 2PVCA 5CAEB 2FJPA 1YIDA 4MPRA 3OWXA 3JY6A 4UUQA 3VISA 3DDHA 3PLRA 4ZT7A 5B6JA 3T3EA 3O8DA 2VBGA 3O8RA 3ZI0A 1U65A 2AFIB 5A62A 3I1FA 4RQUA 3LU1A 1Y9ZA 2CSUA 1H5QA 3R09A 3A37A 1E1CA 2VZ8A 4KP7A 2OAP1 1XTIA 1G7RA 4F5WA 3QBDA 4GMDA 5DNYB 3C8DA 3HUEA 1IZZA 1O9GA 3QVGB 2C2BA 2UYCA 1SZJG 1Q91A 2XTZA 1UZAA 4RKWA 5C7IO 2H9YA 2ZS9A 4Q1CA 3QRWA 3L18A 4QE3A 1JHYA 3WZMA 5CB0A 1VQ1A 1YQEA 5E1OA 5K9ZA 4J16C 1E2EA 3QBVA 1DKQA 3ZKAA 4Q7JB 1V1MA 1JG7A 3QVTA 4Q4CA 4OL9A 1B26A 3QPVA 4O1IA 1E61A 3IHTA 1VKJA 1Z2CA 2X9NA 1EXVA 2GZ1A 3DBIA 1NQUA 1Q44A 3GQVA 4BE4A 2BP7B 1XCMA 3FR8A 1E3TA 4IL5A 2XVAA 2JFGA 4R69A 2QPOA 2JGNA 2CSXA 3F46A 1FA9A 5F4ZA 5CEEA 3MWGA 3MRXA 4AZ3B 2E9SA 5DHAA 2JHPA 3I1IA 3JD3A 4YMIA 5LB4A 3OTHA 3UCEA 2HNBA 5FLEX 2Z8YA 4RSGA 4UBJA 2WSYB 1F0NA 3N07A 2OWEA 3LF1A 4LCEA 5FL3A 1M6EX 5B5SA 4I55B 3KC2A 4R9SA 3HUDA 1DRUA 1EXDA 1XD2B 2HIGA 1J20A 2HPHA 1WW3A 2W43A 4FEGA 2BAGA 2IHUA 3L1HA 1XN1A 5IAEA 1VXRA 3DCYA 4I5DA 1J9GA 3C98A 4EI9A 3QTLA 2FMFA 2ZVDA 3EODA 1IWPB 3A4LA 3HWWA 4ND7A 4H1HA 2R1VB 2R0QC 2H51A 4L5AA 4LIPD 2OC9A 4BFLA 5JUWA 4IVQA 4WJZA 5JBQA 4BIIA 4KRFA 2R8XA 5CGZA 1EIWA 3ZYCA 3DO6A 3FYTA 1QIHA 3GVHA 5J5VA 2C3PA 2ZE8A 3RRJA 3VH4A 1OI7A 2J30A 3L0ZA 4A2PA 1J33A 4I4TB 4DTIA 4RJIA 3HSSA 3KEGA 5BUSA 3CRRA 2HJWA 3JQAD 1CG6A 4TXJA 2J7PA 3IHKA 1R8YA 3EGOA 1K6XA 2ZXFA 3JAWB 4GLBA 3DEYX 4NKRA 5TARA 3W6UA 3ZU2A 5B7GA 3DEIA 4JEMA 5J2UA 2GVDC 4RWZA 1QHIA 2PGIA 3WGYA 3U6KA 2LGJA 1VLHA 3PQEA 5K0BA 3AJDA 1OJLA 3OLZA 4WACA 5LLDA 3B1KA 3RSOA 1L5ZA 4FGSA 4LQCA 1NVWQ 4BX0A 2FMIA 5HUHA 5E3IA 3RRFA 4CR6A 3HPQA 3OCJA 1IFXA 1KS2A 3FWNA 4MEBA 2E89A 4PYJA 2WABA 3PE4A 3T41A 1GG5A 2VNIA 3FNBA 3A4MA 3L8GA 3MT8A 5IUKC 1QGED 2J41A 3ESRA 5ADUS 1Z26A 2C0PA 2DLNA 4MGKR 4AQDA 4CFSA 4GOJA 4U2EA 3OH8A 4NE9A 4F3CA 1NXPA 1V7ZA 3CFYA 4GL2A 1E1LA 1YB1A 4MAFA 2J3KA 5AI6A 4EENA 1XELA 2O48X 1X13A 2Q49A 5IC4A 5AUPB 4EA9A 4GW3A 4V0KA 4JUDX 5TV2A 4ECAA 4CV1A 4XVQA 2JHCA 2O8FB 4QXOA 4A2QA 1QRUA 3ZXXA 3KUCA 1M8PA 1F6DA 1JF8A 4RM3A 3LQFA 3QTTA 1M2EA 3W5IA 3U1TA 3K53A 3VHXA 5JXHA 1P44A 2RH9B 4IG4A 2B36A 3FHCB 3OA0A 1FOEB 1NPTO 3U9TA 1A5SB 2GYWA 1EWKA 2CJWA 3FOBA 3WMEA 4HXFB 1R66A 1U8YA 1E60A 1OV4A 3SIWA 2W5UA 3R0XA 4CMHA 4Y6PA 4O3MA 3JQRA 1IY1A 3C6ZA 4KZKA 2E4WA 4N1AA 4L72A 1CJKC 1V71A 2REBA 2QORA 1FQOA 3OZ7A 2XCOA 3JARB 3H65A 1CUIA 3A32A 3TW8B 1N5RA 2QV7A 4RTMA 3G2NA 1YHNA 3W5JA 1MX9A 3HMQA 2FLWA 3OBBA 4XWAA 3BMOB 4IOKA 1E2PA 3SAJA 4EPTA 3KSBC 4G97A 3ZCPA 2OHIA 2DHQA 3NBUA 1JH8A 2F43B 2G28A 3ZWKA 2R84A 2FZEA 1Z0IA 5LJLA 4DSAA 4KGZA 4ZTUB 2J33A 4IKPA 3VZBA 2YV5A 4W63A 1GGMA 5T41A 2PRIA 2GN8A 2G3YA 3DNMA 1JEYB 1Q84A 1T5BA 5FWAA 3R2JA 4PQRA 1X70A 3ILYA 1NY6A 3IOEA 3ONDA 4ACAA 3SOPA 4FEEA 1GPAA 1H3NA 1OXVA 4PZDA 5AIBA 3ND8A 1YZTA 4P32A 3IURA 4MDHA 2C95A 1ADYA 4PG8A 3H5WA 4LYYA 2PNJA 3X2SA 3BBLA 3ORHA 2BTQA 3JATB 1OWLA 3QI2A 1SU4A 4G81A 3QE9Y 2O2SA 3LQRA 3CBGA 4K9KA 2CV1A 4KR3A 1T43A 3AHDA 3UJHA 2P5UA 3CKMA 3ETHA 4XSVA 4CW7A 4DMFA 4EH1A 3KU4A 2ORVA 3LWZA 4NONA 4WEQA 2N46A 3KTAA 4BPRA 4DEXA 1XPRA 2J4DA 2RAUA 3AL2A 4MROA 3DFUA 5MDHA 1NPDA 3M9XA 2F9FA 1XNRB 5K3DA 1Z4NA 3KQLA 1A9XA 2B4AA 3CU5A 1Y3AA 1DS6A 2F1KA 2VH1A 4PPYA 3CPHA 1Q7CA 2HBRA 2JIPA 5FOSA 3W8NA 1X7YB 4ZMRA 4EDFA 3WS7A 2FWPA 3Q8KA 5FUMA 2QNIA 3IBYA 1QVRA 1NN0A 3HU5A 4BBZA 1X39A 5KTYA 5JSZA 2JJ1D 2WTNA 3Q9SA 4ED9A 1Q5PA 1PQ4A 4HD8A 4JN6B 1T3TA 2G17A 3EDCA 3GCXA 4K1XA 4U7TB 2RD2A 1KPIA 1D2RA 4MVJH 3WHPA 2IEYA 2P30A 4QUDA 1HZZA 3AEQA 2GTHA 1J4AA 2QJOA 1EFCA 2DHRA 5I7AA 4R84A 1P1CA 2G9ZA 2GDJA 4UMDA 4ICIA 3ZJ5A 2RGYA 2D5IA 3UYKA 2B4KA 3S27A 2XMDA 3PFWO 5KQRA 2C7RA 4NABA 4H1UA