3BY1A

Unliganded norvalk virus p domain
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
287
structure length
280
Chain Sequence
PFTLPNLPLSSLSNSRAPLPISSMGISPDNVQSVQFQNGRCTLDGRLVGTTPVSLSHVAKIRGTSNGTVINLTELDGTPFHPFEGPAPIGFPDLGGCDWHINMTQFGHSQTQYDVDTTPDTFVPHLGSIQANGIGSGNYVGVLSWISPPSHPSGSQVDLWKIPNYGSTEATHLAPSVYPPGFGEVLVFFMSKMPGPGAYNLPCLLPQEYISHLASEQAPGEAALLHYVDPDTGRNLGEFKAYPDGFLTCVPNGAGPQQLPINGVFVFVSWVSRFYQLKPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 58 kd capsid protein
publication title Structural basis for the receptor binding specificity of Norwalk virus.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Viral protein
total genus 57
structure length 280
sequence length 287
ec nomenclature
pdb deposition date 2008-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08435 Calici_coat_C Calicivirus coat protein C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 3by1A02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 3by1A01
4X0CA 4RM0A 4OOXA 4X06A 4OPOA 3SKBA 3ONUA 3D26A 4Z4RA 5IYPA 4OOSA 4X7DA 4P25A 4Z4WA 3LQ6A 2ZL7A 4P3IA 5BSXA 5F4OA 4RPDA 4X07A 1IHMA 4Z4UA 4RPBA 5F4JA 4WZLA 3ASTA 4QUZA 4Z4VA 4X7CA 5F4MA 3BQJA 4QVJA 4Z4SA 2ZL5A 4X7FA 4OPVA 3ASQA 4RDLA 4P26A 3Q38A 2OBRA 4P1VA 3PA1A 3RY8A 5HZAA 3PA2A 4RDKA 5BSYA 5J3OA 5KW9A 4Z4YA 4X05A 4OPSA 3SLDA 3Q6QA 4OOVA 3ONYA 4P12A 3Q6RA 5IYWA 4RDJA 3PUNA 3ASPA 3BY1A 3Q3AA 3PUMA 3R6KA 4Z4ZA 3ASSA 4ROXA 5IYRA 4WZKA 3SJPA 2OBSA 4WZEA 2ZL6A 5HZBA 4WZTA 4Z4TA 5IYNA 5J35A 3R6JA 4X7EA 3ASRA 3Q39A 4OP7A 4RLZA 3LQEA 3SEJA 3PVDA 3V7AA 5IYQA 3SLNA 2OBTA 4P2NA 4QVAA 3BY2A 4QV2A 5E6TA
chains in the Genus database with same CATH superfamily
4X0CA 1ZM3A 3BH4A 4TMVA 3QFTA 3CCMB 2M5SA 4XN3A 1CNEA 2ZXHA 1NB0A 4OOXA 2FVGA 4X06A 5A8AA 4L8JA 4OPOA 5L46A 3SKBA 3ZZ0A 3BCFA 4ACAA 3FPKA 1WSVA 2ZZEA 1VQ8B 4II3A 4B3GA 4OOSA 2V4DA 4DNTB 3A8JA 4Z4WA 2X0KA 2XNDA 4P22A 3OP1A 1EXMA 1ELOA 1Y0RA 4XNFA 5F4OA 4X07A 3ZUGA 1N08A 4Z4UA 1MRZA 1FNCA 3BC9A 4RPBA 1YITB 1W2BB 2V7QA 3ASTA 4BPRA 2C5HA 3OAAA 1GO2A 2W6JA 1V0FA 4TMXA 1VQOB 5F4MA 4G1BA 2I1LA 1NRKA 1WORA 2GQFA 4YELA 4ZGNB 5DSZA 1BQEA 4UAJA 1SKYB 4PC2A 2NPFA 3W2FA 4XQFA 1E1QA 1U2RA 4JMQA 1VQMB 1ZUNB 1QFYA 1VQKB 3WYAA 1E3XA 1WU8A 1D8TA 3VO1A 1P4MA 4RD3A 3J81k 2ZITA 1GAWA 3GVJA 2ZTGA 1EP2B 1E64A 1N06A 4ZCMA 1W34A 4M1KA 2GK6A 4HIZA 5BSYA 1YJ9B 4YAOA 4RD1A 4ASUA 1T5EA 4N3GA 4H9GA 1I18A 3AGQA 4QFMA 2WJVA 3AVUA 1QX4A 4UZEA 1WSRA 2V7VA 3ASPA 4M2LA 2XZOA 2F1MA 3ASSA 4IW3B 1AMOA 4M4SA 2VNKA 2OYNA 2QMUA 1XE1A 2OBSA 3WY9A 1FRQA 4LBVA 2ZL6A 3A8KA 1G7CA 4PGOA 2QDXA 1QUFA 2Q6IA 2HLDA 3CC2B 3AGPA 2VBVA 3CP8A 1UD4A 2V31A 1W0KA 4XORA 5TV2A 3A3BA 4PC7A 1EP1B 1BJKA 3ZC3A 5GV8A 2VNHA 2CF4A 3CCQB 2BPOA 3WBKA 4YEJA 5KNLA 1Q9SA 2GJKA 4HE5A 3DDYA 4MYTA 1PKVA 1W0JA 1UD6A 1W9XA 2V7TA 3KEWA 5CDFA 3JQPA 3QFRA 2DERA 3V7AA 2VNJA 1TTTA 2OBTA 3E1YE 1BLIA 1AIPA 2OTLB 1BPLA 3FPPA 3CB4A 4P2NA 4XM3A 4XOTA 3GVKA 2BSAA 3W5UA 1YJWB 1IJEA 5H59A 1PJ7A 1K28D 2OK8A 5E6TA 1FRNA 1QG0A 1EFUA 2DYIA 2C78A 2GREA 1NJID 4Y7CA 3ONUA 4XOPA 3D26A 1BX0A 3GIRA 3SJZA 5IYPA 1QFZA 2JJ1A 1CNFA 1TVCA 1M1KD 3OZUA 2DCUA 3B8HA 2DOGA 4DQLA 5FO0A 5FIUA 3WXMA 2ZL7A 4P3IA 1WDTA 5DS0A 1VJSA 4C0SA 3CPXA 5GV7A 2QEXB 1E63A 2DEUA 3VR6A 2X6WA 3CCSB 1QGAA 1VQPB 4QUZA 4Y9UA 1QH0A 4P9SA 4X7CA 1V0EA 1WPCA 3BQJA 3P26A 2ZZGA 1BMFA 2E1BA 3CCVB 4Z4SA 1OB0A 4B48A 4XKWA 2QTZA 2BN4A 3ZPNA 1RQRA 3U2QA 4RDLA 2Z6BD 4P26A 2LZJA 2GJRA 2OTJB 4AC9A 1EWYA 2WPDA 1KC8D 2VZLA 3PA1A 4NBSA 1ZM9A 2BMWA 3RY8A 5HZAA 1GAQA 1W35A 4KKTA 4ZCLA 1KJZA 1S4MA 4RDKA 4G1VA 5J3OA 1F20A 1E79A 2YWGA 4OPSA 4Z4YA 1YJNB 3QFSA 4XLFA 3P27A 1N0UA 2JN9A 5TR9A 1N07A 3Q6RA 2DIEA 4FN5A 2JIZA 4XD7A 5IYWA 2GJPA 4X8IA 2R6HA 1JB9A 3BY1A 3ZZUA 4B3FX 1VQ9B 3R6KA 1COWA 4Z4ZA 2QGGA 1VHEA 4ROXA 1T6ZA 2WYRA 3T56B 1G7RA 1E1RA 2QN6A 1JNYA 2C2WA 3WBJA 1NDHA 2C4UA 3SJPA 1Q7YD 2D3LA 3G4SB 3AVVA 4MYUA 5HZBA 5EMNA 2CW5A 3OZVA 4RD2A 4ACBA 2J7KA 3VNVA 4PC1A 1SM4A 1WOSA 4TMZA 2Q6LA 3QFCA 1NB9A 2VBTA 1QVFB 3R6JA 4TSFA 4N3NA 5J35A 3V76A 1R5OA 1KZLA 4U9UA 1EP3B 2C4TA 1B2RA 3ASRA 2VJIA 5FA6A 4YXWA 4OP7A 2D9RA 4RJLA 1DDGA 5HXBA 4WQMA 4NNJA 3CMEB 1YLOA 4KKUA 3CCUB 2GPJA 4PC3A 2XGJA 4B44A 2B5OA 4FK8A 3PVDA 4KKSA 1KK2A 4R71A 3GVLA 2DY1A 3A8IA 1FX0A 1OGJA 5FL7A 1VQ4B 1R5BA 3PENA 2BV3A 4TMTA 2AHOA 4QVAA 1T6YA 1VLOA 2V7WA 2XNJA 3BNWA 3HAGA 2BGIA 3OEHA 2QA4B 5KSWB 2RC5A 4LBYA 3CMAB 5A88A 4EH1A 1FNDA 4XR6A 2BF4A 1FNMA 1Q82D 4PC6A 4X7DA 1ZM4A 4P25A 2FX3A 1I7PA 3W2HA 3G71B 3LQ6A 1DARA 3OKXA 1EFCA 2VYQA 1YI2B 4P6VF 1KMHA 4G6IA 4ZGQB 1BX1A 1IJFA 2JJ2A 1VHOA 2HDNB 3OZWA 1XQBA 2ZBVA 2WSSA 4RD4A 3ISXA 5TY0A 4YAWA 3OOCA 1G7SA 4XMYA 1R5NA 3BCDA 3W2EA 1QFJA 2ZBUA 4QVJA 1S0UA 4AVZA 2X3UA 2ZL5A 1GR1A 4X7FA 3WNDA 2QTLA 4DQKA 3JQQA 4II2A 3ASQA 2D74A 4G7XA 3LO8A 1E3ZA 3G6EB 3AVYA 2OBRA 3B78A 5FO1A 1EFTA 1QGYA 3W5VA 3ZBTA 1YHQB 4ZV4A 4P1VA 3QE2A 3B82A 3E20A 1PJ6A 3A35A 1I8DA 2NV4A 3LVBA 3I55B 1VLYA 4B47A 3WNCA 3CTAA 1FDRA 2CK3A 1RQPA 3W5HA 4X05A 3OJWA 3CD6B 3Q6QA 5B6IA 1PJ5A 1TUIA 4OOVA 4P12A 2X53S 4B43A 2BM1A 1UD8A 2ZZQA 3T53B 1NBMA 4TMWA 2CC2A 3PUMA 3GQBA 1JJ2B 1OB2A 4FWTA 5IYRA 1KQSB 2F43A 1HVXA 4WZKA 1VQNB 2HCJB 4WZEA 4WWVA 1DG1G 4YAFA 5AN9A 2Q6OA 1KK3A 3MMPA 5FNZA 3W2IA 4Z4TA 3CP2A 5IYNA 3WQZA 1B23P 2ZXIA 4XLEA 1E43A 2PMDA 3G05A 3FJOA 2PE3A 3Q39A 1WTHD 1UMKA 2YWFA 1VF7A 1XB2A 2P3MA 3I56B 1CQXA 3ES9A 3OW2B 4RD0A 3ZBUA 3T51B 1DDIA 4GQNA 4XLHA 3SEJA 5IYQA 1J9ZA 4LBWA 5LMZA 1N8RD 2ZZFA 5THXA 2DETA 1H8EA 3SLNA 4FXUA 1Y0YA 2R9VA 4M53A 1WOOA 4NCNA 2B7CA 4DK0A 3CXCB 2VBSA 4M0LA 5DN6A 4Z1MA 4TKOB 3BY2A 1D2EA 1A8PA 4QV2A 2X85A 1MABA 4YHBA 2CNDA 4RM0A 2CRVA 1QVGB 2BM0A 4LC0A 2D3NA 1T6XA 2XNCA 3CW2A 3OEEA 3VNUA 2PIAA 3JU4A 2YWHA 4Z4RA 3A1PA 1YX2A 3CCRB 1HZEA 1N0VC 3U6BA 2EFGA 3AVXA 1VQ6B 2E1RA 3MHPA 3OFNA 3OW7A 5BSXA 3H9NA 3NE5B 4RPDA 1IHMA 1M90D 5F4JA 1D1NA 4WZLA 1H85A 1Q86D 4AF6A 3CCJB 4LBZA 4Z4VA 2XOKA 1KRHA 2QE7A 4TT3A 4TN1A 2VJJA 1TLLA 4XKVA 4ZCIA 3OJXA 2Q6KA 4DNRB 2HMAA 1K9MD 2V7XA 3MCAA 4RCZA 5TRDA 4XN0A 4OPVA 3OE7A 3AVTA 1FNBA 3CESA 4HE6A 2WJYA 1H42A 1UD2A 1S72B 4G7WA 4RCYA 1JA0A 3GSIA 3CRZA 1QGZA 3Q38A 3LNNA 3ZZTA 3I1FA 1UD5A 1VQ5B 1UD3A 3U6KA 4B3XA 4XL9A 5H5JA 1XFOA 2RC6A 1HA3A 1F60A 4XONA 4PAAA 2F4NA 1ZM2A 3PA2A 2XZLA 3A3GA 1KD1D 3CMMA 5KW9A 1KTVA 3SLDA 1KK1A 4B4DA 4C43A 3ONYA 1OHHA 2B7BA 2YWEA 4P6YA 4RDJA 1H8HA 1OB5A 3PUNA 3Q3AA 1VQ7B 2KVOA 2WZNA 1K73D 3JQRA 1GJRA 4XLAA 3WNBA 1Q81D 2C5BA 4YALA 4K1XA 4PABA 2VNIA 4YAUA 1VQLB 1YIJB 2PLFA 1QUEA 2X6XA 2XZPA 3CCLB 4WZTA 1GVHA 1WOPA 2ZTNA 4E0FA 4X7EA 5A89A 2V7UA 5HKKA 2WR8A 2GK7A 3ZIAA 3QSYA 4RD6A 2BGJA 4J0QA 4UZUA 2F1LA 3VO2A 4F7DA 3CC7B 1KK0A 4RLZA 2JDIA 2VBUA 4CQJA 2XEXA 1E62A 1N05A 2C77A 3W2GA 4DK1A 2OK7A 2X6YA 3CPWB 3AVWA 3OPOA 2CBXA 3LQEA 3FKSA 2X8KA 4QHYA 4UZFA 3CCEB 1SKQA 1WP6A 1G7TA 4G5GA 2EIXA 1IB0A 4AF7A 2W6IA 3VMFA 2BVNA 4Q7JB 1EFRA 3KL9A 2WZPP 1JA1A 1V5VA 1OGIA 4P3YA 1K8AD 3CC4B 1W87A 4Y9RA 5JBQA 3H94A 4XLCA 5IK2A
chains in the Genus database with same CATH topology
4X0CA 4RM0A 4OOXA 4X06A 4OPOA 3SKBA 3ONUA 3D26A 4Z4RA 5IYPA 4OOSA 4X7DA 4P25A 4Z4WA 3LQ6A 2ZL7A 4P3IA 5BSXA 5F4OA 4RPDA 4X07A 1IHMA 4Z4UA 4RPBA 5F4JA 4WZLA 3ASTA 4QUZA 4Z4VA 4X7CA 5F4MA 3BQJA 4QVJA 4Z4SA 2ZL5A 4X7FA 4OPVA 3ASQA 4RDLA 4P26A 3Q38A 2OBRA 4P1VA 3PA1A 3RY8A 5HZAA 3PA2A 4RDKA 5BSYA 5J3OA 5KW9A 4Z4YA 4X05A 4OPSA 3SLDA 3Q6QA 4OOVA 3ONYA 4P12A 3Q6RA 5IYWA 4RDJA 3PUNA 3ASPA 3BY1A 3Q3AA 3PUMA 3R6KA 4Z4ZA 3ASSA 4ROXA 5IYRA 4WZKA 3SJPA 2OBSA 4WZEA 2ZL6A 5HZBA 4WZTA 4Z4TA 5IYNA 5J35A 3R6JA 4X7EA 3ASRA 3Q39A 4OP7A 4RLZA 3LQEA 3SEJA 3PVDA 3V7AA 5IYQA 3SLNA 2OBTA 4P2NA 4QVAA 3BY2A 4QV2A 5E6TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X0C A;  4RM0 A;  4OOX A;  4X06 A;  4OPO A;  3SKB A;  3ONU A;  3D26 A;  4Z4R A;  5IYP A;  4OOS A;  4X7D A;  4P25 A;  4Z4W A;  3LQ6 A;  2ZL7 A;  4P3I A;  5BSX A;  5F4O A;  4RPD A;  4X07 A;  1IHM A;  4Z4U A;  4RPB A;  5F4J A;  4WZL A;  3AST A;  4QUZ A;  4Z4V A;  4X7C A;  5F4M A;  3BQJ A;  4QVJ A;  4Z4S A;  2ZL5 A;  4X7F A;  4OPV A;  3ASQ A;  4RDL A;  4P26 A;  3Q38 A;  2OBR A;  4P1V A;  3PA1 A;  3RY8 A;  5HZA A;  3PA2 A;  4RDK A;  5BSY A;  5J3O A;  5KW9 A;  4Z4Y A;  4X05 A;  4OPS A;  3SLD A;  3Q6Q A;  4OOV A;  3ONY A;  4P12 A;  3Q6R A;  5IYW A;  4RDJ A;  3PUN A;  3ASP A;  3BY1 A;  3Q3A A;  3PUM A;  3R6K A;  4Z4Z A;  3ASS A;  4ROX A;  5IYR A;  4WZK A;  3SJP A;  2OBS A;  4WZE A;  2ZL6 A;  5HZB A;  4WZT A;  4Z4T A;  5IYN A;  5J35 A;  3R6J A;  4X7E A;  3ASR A;  3Q39 A;  4OP7 A;  4RLZ A;  3LQE A;  3SEJ A;  3PVD A;  3V7A A;  5IYQ A;  3SLN A;  2OBT A;  4P2N A;  4QVA A;  3BY2 A;  4QV2 A;  5E6T A; 
#chains in the Genus database with same CATH topology
 4X0C A;  1ZM3 A;  3BH4 A;  4TMV A;  3QFT A;  3CCM B;  2M5S A;  4XN3 A;  1CNE A;  2ZXH A;  1NB0 A;  4OOX A;  2FVG A;  4X06 A;  5A8A A;  4L8J A;  4OPO A;  5L46 A;  3SKB A;  3ZZ0 A;  3BCF A;  4ACA A;  3FPK A;  1WSV A;  2ZZE A;  1VQ8 B;  4II3 A;  4B3G A;  4OOS A;  2V4D A;  4DNT B;  3A8J A;  4Z4W A;  2X0K A;  2XND A;  4P22 A;  3OP1 A;  1EXM A;  1ELO A;  1Y0R A;  4XNF A;  5F4O A;  4X07 A;  3ZUG A;  1N08 A;  4Z4U A;  1MRZ A;  1FNC A;  3BC9 A;  4RPB A;  1YIT B;  1W2B B;  2V7Q A;  3AST A;  4BPR A;  2C5H A;  3OAA A;  1GO2 A;  2W6J A;  1V0F A;  4TMX A;  1VQO B;  5F4M A;  4G1B A;  2I1L A;  1NRK A;  1WOR A;  2GQF A;  4YEL A;  4ZGN B;  5DSZ A;  1BQE A;  4UAJ A;  1SKY B;  4PC2 A;  2NPF A;  3W2F A;  4XQF A;  1E1Q A;  1U2R A;  4JMQ A;  1VQM B;  1ZUN B;  1QFY A;  1VQK B;  3WYA A;  1E3X A;  1WU8 A;  1D8T A;  3VO1 A;  1P4M A;  4RD3 A;  3J81 k;  2ZIT A;  1GAW A;  3GVJ A;  2ZTG A;  1EP2 B;  1E64 A;  1N06 A;  4ZCM A;  1W34 A;  4M1K A;  2GK6 A;  4HIZ A;  5BSY A;  1YJ9 B;  4YAO A;  4RD1 A;  4ASU A;  1T5E A;  4N3G A;  4H9G A;  1I18 A;  3AGQ A;  4QFM A;  2WJV A;  3AVU A;  1QX4 A;  4UZE A;  1WSR A;  2V7V A;  3ASP A;  4M2L A;  2XZO A;  2F1M A;  3ASS A;  4IW3 B;  1AMO A;  4M4S A;  2VNK A;  2OYN A;  2QMU A;  1XE1 A;  2OBS A;  3WY9 A;  1FRQ A;  4LBV A;  2ZL6 A;  3A8K A;  1G7C A;  4PGO A;  2QDX A;  1QUF A;  2Q6I A;  2HLD A;  3CC2 B;  3AGP A;  2VBV A;  3CP8 A;  1UD4 A;  2V31 A;  1W0K A;  4XOR A;  5TV2 A;  3A3B A;  4PC7 A;  1EP1 B;  1BJK A;  3ZC3 A;  5GV8 A;  2VNH A;  2CF4 A;  3CCQ B;  2BPO A;  3WBK A;  4YEJ A;  5KNL A;  1Q9S A;  2GJK A;  4HE5 A;  3DDY A;  4MYT A;  1PKV A;  1W0J A;  1UD6 A;  1W9X A;  2V7T A;  3KEW A;  5CDF A;  3JQP A;  3QFR A;  2DER A;  3V7A A;  2VNJ A;  1TTT A;  2OBT A;  3E1Y E;  1BLI A;  1AIP A;  2OTL B;  1BPL A;  3FPP A;  3CB4 A;  4P2N A;  4XM3 A;  4XOT A;  3GVK A;  2BSA A;  3W5U A;  1YJW B;  1IJE A;  5H59 A;  1PJ7 A;  1K28 D;  2OK8 A;  5E6T A;  1FRN A;  1QG0 A;  1EFU A;  2DYI A;  2C78 A;  2GRE A;  1NJI D;  4Y7C A;  3ONU A;  4XOP A;  3D26 A;  1BX0 A;  3GIR A;  3SJZ A;  5IYP A;  1QFZ A;  2JJ1 A;  1CNF A;  1TVC A;  1M1K D;  3OZU A;  2DCU A;  3B8H A;  2DOG A;  4DQL A;  5FO0 A;  5FIU A;  3WXM A;  2ZL7 A;  4P3I A;  1WDT A;  5DS0 A;  1VJS A;  4C0S A;  3CPX A;  5GV7 A;  2QEX B;  1E63 A;  2DEU A;  3VR6 A;  2X6W A;  3CCS B;  1QGA A;  1VQP B;  4QUZ A;  4Y9U A;  1QH0 A;  4P9S A;  4X7C A;  1V0E A;  1WPC A;  3BQJ A;  3P26 A;  2ZZG A;  1BMF A;  2E1B A;  3CCV B;  4Z4S A;  1OB0 A;  4B48 A;  4XKW A;  2QTZ A;  2BN4 A;  3ZPN A;  1RQR A;  3U2Q A;  4RDL A;  2Z6B D;  4P26 A;  2LZJ A;  2GJR A;  2OTJ B;  4AC9 A;  1EWY A;  2WPD A;  1KC8 D;  2VZL A;  3PA1 A;  4NBS A;  1ZM9 A;  2BMW A;  3RY8 A;  5HZA A;  1GAQ A;  1W35 A;  4KKT A;  4ZCL A;  1KJZ A;  1S4M A;  4RDK A;  4G1V A;  5J3O A;  1F20 A;  1E79 A;  2YWG A;  4OPS A;  4Z4Y A;  1YJN B;  3QFS A;  4XLF A;  3P27 A;  1N0U A;  2JN9 A;  5TR9 A;  1N07 A;  3Q6R A;  2DIE A;  4FN5 A;  2JIZ A;  4XD7 A;  5IYW A;  2GJP A;  4X8I A;  2R6H A;  1JB9 A;  3BY1 A;  3ZZU A;  4B3F X;  1VQ9 B;  3R6K A;  1COW A;  4Z4Z A;  2QGG A;  1VHE A;  4ROX A;  1T6Z A;  2WYR A;  3T56 B;  1G7R A;  1E1R A;  2QN6 A;  1JNY A;  2C2W A;  3WBJ A;  1NDH A;  2C4U A;  3SJP A;  1Q7Y D;  2D3L A;  3G4S B;  3AVV A;  4MYU A;  5HZB A;  5EMN A;  2CW5 A;  3OZV A;  4RD2 A;  4ACB A;  2J7K A;  3VNV A;  4PC1 A;  1SM4 A;  1WOS A;  4TMZ A;  2Q6L A;  3QFC A;  1NB9 A;  2VBT A;  1QVF B;  3R6J A;  4TSF A;  4N3N A;  5J35 A;  3V76 A;  1R5O A;  1KZL A;  4U9U A;  1EP3 B;  2C4T A;  1B2R A;  3ASR A;  2VJI A;  5FA6 A;  4YXW A;  4OP7 A;  2D9R A;  4RJL A;  1DDG A;  5HXB A;  4WQM A;  4NNJ A;  3CME B;  1YLO A;  4KKU A;  3CCU B;  2GPJ A;  4PC3 A;  2XGJ A;  4B44 A;  2B5O A;  4FK8 A;  3PVD A;  4KKS A;  1KK2 A;  4R71 A;  3GVL A;  2DY1 A;  3A8I A;  1FX0 A;  1OGJ A;  5FL7 A;  1VQ4 B;  1R5B A;  3PEN A;  2BV3 A;  4TMT A;  2AHO A;  4QVA A;  1T6Y A;  1VLO A;  2V7W A;  2XNJ A;  3BNW A;  3HAG A;  2BGI A;  3OEH A;  2QA4 B;  5KSW B;  2RC5 A;  4LBY A;  3CMA B;  5A88 A;  4EH1 A;  1FND A;  4XR6 A;  2BF4 A;  1FNM A;  1Q82 D;  4PC6 A;  4X7D A;  1ZM4 A;  4P25 A;  2FX3 A;  1I7P A;  3W2H A;  3G71 B;  3LQ6 A;  1DAR A;  3OKX A;  1EFC A;  2VYQ A;  1YI2 B;  4P6V F;  1KMH A;  4G6I A;  4ZGQ B;  1BX1 A;  1IJF A;  2JJ2 A;  1VHO A;  2HDN B;  3OZW A;  1XQB A;  2ZBV A;  2WSS A;  4RD4 A;  3ISX A;  5TY0 A;  4YAW A;  3OOC A;  1G7S A;  4XMY A;  1R5N A;  3BCD A;  3W2E A;  1QFJ A;  2ZBU A;  4QVJ A;  1S0U A;  4AVZ A;  2X3U A;  2ZL5 A;  1GR1 A;  4X7F A;  3WND A;  2QTL A;  4DQK A;  3JQQ A;  4II2 A;  3ASQ A;  2D74 A;  4G7X A;  3LO8 A;  1E3Z A;  3G6E B;  3AVY A;  2OBR A;  3B78 A;  5FO1 A;  1EFT A;  1QGY A;  3W5V A;  3ZBT A;  1YHQ B;  4ZV4 A;  4P1V A;  3QE2 A;  3B82 A;  3E20 A;  1PJ6 A;  3A35 A;  1I8D A;  2NV4 A;  3LVB A;  3I55 B;  1VLY A;  4B47 A;  3WNC A;  3CTA A;  1FDR A;  2CK3 A;  1RQP A;  3W5H A;  4X05 A;  3OJW A;  3CD6 B;  3Q6Q A;  5B6I A;  1PJ5 A;  1TUI A;  4OOV A;  4P12 A;  2X53 S;  4B43 A;  2BM1 A;  1UD8 A;  2ZZQ A;  3T53 B;  1NBM A;  4TMW A;  2CC2 A;  3PUM A;  3GQB A;  1JJ2 B;  1OB2 A;  4FWT A;  5IYR A;  1KQS B;  2F43 A;  1HVX A;  4WZK A;  1VQN B;  2HCJ B;  4WZE A;  4WWV A;  1DG1 G;  4YAF A;  5AN9 A;  2Q6O A;  1KK3 A;  3MMP A;  5FNZ A;  3W2I A;  4Z4T A;  3CP2 A;  5IYN A;  3WQZ A;  1B23 P;  2ZXI A;  4XLE A;  1E43 A;  2PMD A;  3G05 A;  3FJO A;  2PE3 A;  3Q39 A;  1WTH D;  1UMK A;  2YWF A;  1VF7 A;  1XB2 A;  2P3M A;  3I56 B;  1CQX A;  3ES9 A;  3OW2 B;  4RD0 A;  3ZBU A;  3T51 B;  1DDI A;  4GQN A;  4XLH A;  3SEJ A;  5IYQ A;  1J9Z A;  4LBW A;  5LMZ A;  1N8R D;  2ZZF A;  5THX A;  2DET A;  1H8E A;  3SLN A;  4FXU A;  1Y0Y A;  2R9V A;  4M53 A;  1WOO A;  4NCN A;  2B7C A;  4DK0 A;  3CXC B;  2VBS A;  4M0L A;  5DN6 A;  4Z1M A;  4TKO B;  3BY2 A;  1D2E A;  1A8P A;  4QV2 A;  2X85 A;  1MAB A;  4YHB A;  2CND A;  4RM0 A;  2CRV A;  1QVG B;  2BM0 A;  4LC0 A;  2D3N A;  1T6X A;  2XNC A;  3CW2 A;  3OEE A;  3VNU A;  2PIA A;  3JU4 A;  2YWH A;  4Z4R A;  3A1P A;  1YX2 A;  3CCR B;  1HZE A;  1N0V C;  3U6B A;  2EFG A;  3AVX A;  1VQ6 B;  2E1R A;  3MHP A;  3OFN A;  3OW7 A;  5BSX A;  3H9N A;  3NE5 B;  4RPD A;  1IHM A;  1M90 D;  5F4J A;  1D1N A;  4WZL A;  1H85 A;  1Q86 D;  4AF6 A;  3CCJ B;  4LBZ A;  4Z4V A;  2XOK A;  1KRH A;  2QE7 A;  4TT3 A;  4TN1 A;  2VJJ A;  1TLL A;  4XKV A;  4ZCI A;  3OJX A;  2Q6K A;  4DNR B;  2HMA A;  1K9M D;  2V7X A;  3MCA A;  4RCZ A;  5TRD A;  4XN0 A;  4OPV A;  3OE7 A;  3AVT A;  1FNB A;  3CES A;  4HE6 A;  2WJY A;  1H42 A;  1UD2 A;  1S72 B;  4G7W A;  4RCY A;  1JA0 A;  3GSI A;  3CRZ A;  1QGZ A;  3Q38 A;  3LNN A;  3ZZT A;  3I1F A;  1UD5 A;  1VQ5 B;  1UD3 A;  3U6K A;  4B3X A;  4XL9 A;  5H5J A;  1XFO A;  2RC6 A;  1HA3 A;  1F60 A;  4XON A;  4PAA A;  2F4N A;  1ZM2 A;  3PA2 A;  2XZL A;  3A3G A;  1KD1 D;  3CMM A;  5KW9 A;  1KTV A;  3SLD A;  1KK1 A;  4B4D A;  4C43 A;  3ONY A;  1OHH A;  2B7B A;  2YWE A;  4P6Y A;  4RDJ A;  1H8H A;  1OB5 A;  3PUN A;  3Q3A A;  1VQ7 B;  2KVO A;  2WZN A;  1K73 D;  3JQR A;  1GJR A;  4XLA A;  3WNB A;  1Q81 D;  2C5B A;  4YAL A;  4K1X A;  4PAB A;  2VNI A;  4YAU A;  1VQL B;  1YIJ B;  2PLF A;  1QUE A;  2X6X A;  2XZP A;  3CCL B;  4WZT A;  1GVH A;  1WOP A;  2ZTN A;  4E0F A;  4X7E A;  5A89 A;  2V7U A;  5HKK A;  2WR8 A;  2GK7 A;  3ZIA A;  3QSY A;  4RD6 A;  2BGJ A;  4J0Q A;  4UZU A;  2F1L A;  3VO2 A;  4F7D A;  3CC7 B;  1KK0 A;  4RLZ A;  2JDI A;  2VBU A;  4CQJ A;  2XEX A;  1E62 A;  1N05 A;  2C77 A;  3W2G A;  4DK1 A;  2OK7 A;  2X6Y A;  3CPW B;  3AVW A;  3OPO A;  2CBX A;  3LQE A;  3FKS A;  2X8K A;  4QHY A;  4UZF A;  3CCE B;  1SKQ A;  1WP6 A;  1G7T A;  4G5G A;  2EIX A;  1IB0 A;  4AF7 A;  2W6I A;  3VMF A;  2BVN A;  4Q7J B;  1EFR A;  3KL9 A;  2WZP P;  1JA1 A;  1V5V A;  1OGI A;  4P3Y A;  1K8A D;  3CC4 B;  1W87 A;  4Y9R A;  5JBQ A;  3H94 A;  4XLC A;  5IK2 A; 
#chains in the Genus database with same CATH homology
 4X0C A;  4RM0 A;  4OOX A;  4X06 A;  4OPO A;  3SKB A;  3ONU A;  3D26 A;  4Z4R A;  5IYP A;  4OOS A;  4X7D A;  4P25 A;  4Z4W A;  3LQ6 A;  2ZL7 A;  4P3I A;  5BSX A;  5F4O A;  4RPD A;  4X07 A;  1IHM A;  4Z4U A;  4RPB A;  5F4J A;  4WZL A;  3AST A;  4QUZ A;  4Z4V A;  4X7C A;  5F4M A;  3BQJ A;  4QVJ A;  4Z4S A;  2ZL5 A;  4X7F A;  4OPV A;  3ASQ A;  4RDL A;  4P26 A;  3Q38 A;  2OBR A;  4P1V A;  3PA1 A;  3RY8 A;  5HZA A;  3PA2 A;  4RDK A;  5BSY A;  5J3O A;  5KW9 A;  4Z4Y A;  4X05 A;  4OPS A;  3SLD A;  3Q6Q A;  4OOV A;  3ONY A;  4P12 A;  3Q6R A;  5IYW A;  4RDJ A;  3PUN A;  3ASP A;  3BY1 A;  3Q3A A;  3PUM A;  3R6K A;  4Z4Z A;  3ASS A;  4ROX A;  5IYR A;  4WZK A;  3SJP A;  2OBS A;  4WZE A;  2ZL6 A;  5HZB A;  4WZT A;  4Z4T A;  5IYN A;  5J35 A;  3R6J A;  4X7E A;  3ASR A;  3Q39 A;  4OP7 A;  4RLZ A;  3LQE A;  3SEJ A;  3PVD A;  3V7A A;  5IYQ A;  3SLN A;  2OBT A;  4P2N A;  4QVA A;  3BY2 A;  4QV2 A;  5E6T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...