3BY1A

Unliganded norvalk virus p domain
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
287
structure length
280
Chain Sequence
b'PFTLPNLPLSSLSNSRAPLPISSMGISPDNVQSVQFQNGRCTLDGRLVGTTPVSLSHVAKIRGTSNGTVINLTELDGTPFHPFEGPAPIGFPDLGGCDWHINMTQFGHSQTQYDVDTTPDTFVPHLGSIQANGIGSGNYVGVLSWISPPSHPSGSQVDLWKIPNYGSTEATHLAPSVYPPGFGEVLVFFMSKMPGPGAYNLPCLLPQEYISHLASEQAPGEAALLHYVDPDTGRNLGEFKAYPDGFLTCVPNGAGPQQLPINGVFVFVSWVSRFYQLKPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 58 kd capsid protein
publication title Structural basis for the receptor binding specificity of Norwalk virus.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Viral protein
total genus 57
structure length 280
sequence length 287
ec nomenclature
pdb deposition date 2008-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08435 Calici_coat_C Calicivirus coat protein C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 3by1A02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 3by1A01
4P26A 3SLNA 3Q6RA 3V7AA 3R6KA 3ASQA 3Q38A 4RDLA 3ASSA 5F4JA 4ROXA 4OPOA 4Z4VA 3SEJA 4Z4UA 4Z4ZA 4P25A 3ONYA 3PA1A 4P3IA 3R6JA 3Q3AA 3ASRA 4RLZA 5HZBA 3SKBA 4P12A 2ZL5A 4QUZA 4Z4RA 3D26A 3PUMA 5IYQA 5KW9A 3LQEA 3Q6QA 5J3OA 2OBSA 3RY8A 3BQJA 3Q39A 3ASPA 4RPBA 4RDKA 4WZTA 3LQ6A 3BY2A 5BSYA 4OOXA 1IHMA 5IYNA 4Z4WA 3SJPA 3BY1A 4X7EA 4OOVA 2ZL7A 4X7CA 4Z4TA 4OP7A 3PUNA 4X06A 3ONUA 4P1VA 3PVDA 4X0CA 3ASTA 4WZKA 4OPVA 4RM0A 3PA2A 4WZEA 2ZL6A 4P2NA 4OPSA 5F4OA 4Z4YA 2OBRA 4OOSA 5E6TA 5J35A 4QV2A 4Z4SA 5IYWA 5BSXA 4X7DA 5IYPA 5HZAA 5F4MA 4QVAA 3SLDA 4RPDA 2OBTA 4WZLA 4X05A 4X7FA 5IYRA 4X07A 4RDJA 4QVJA
chains in the Genus database with same CATH superfamily
2OK8A 2V7QA 3Q6RA 4RD4A 3W2HA 3CCSB 4G5GA 2DERA 4R71A 1VQNB 1CNEA 1K9MD 4RDLA 4IW3B 4ROXA 1VF7A 3B78A 5TRDA 4XLEA 3CB4A 4PC2A 4XKVA 1BMFA 2XOKA 2V7VA 3HAGA 3PA1A 3A3GA 1OHHA 4B3GA 3ASRA 3T56B 2V4DA 4RLZA 5HKKA 2P3MA 3CCUB 1XB2A 3W5UA 3FKSA 4UZFA 5TR9A 1VQPB 5HXBA 1S72B 3AGQA 2Q6IA 1H8EA 4XMYA 3B8HA 1YJWB 1TVCA 1UD4A 2XNJA 1EP1B 2HLDA 1JJ2B 1T6XA 3LQEA 1YHQB 3V76A 4Z1MA 2X0KA 3VMFA 1UD6A 2OBSA 1BQEA 3W2GA 4ZCMA 1QUEA 4EH1A 4F7DA 2F1LA 1QGYA 2KVOA 3OKXA 4XNFA 2BN4A 1GAQA 4DK1A 1VQ6B 1NRKA 4B44A 1BJKA 1T6YA 2ZXIA 3OJWA 2E1BA 4N3GA 2GJRA 3CW2A 1XQBA 1KJZA 1N08A 4K1XA 3WNBA 2AHOA 2YWHA 4B48A 3BY1A 4DK0A 1YJNB 2PLFA 4X7CA 4Z4TA 3WNCA 2QEXB 4DQKA 3J81k 4M4SA 2X8KA 2VYQA 4OPVA 1VLOA 2ZL6A 1KK1A 4XLAA 5EMNA 3OFNA 2R6HA 3VO1A 2ZZQA 3CRZA 4ZV4A 2X85A 1N05A 5THXA 5F4OA 1PJ5A 4Z4YA 2WZPP 4XN3A 1H8HA 4TKOB 2X3UA 5AN9A 3I55B 2JJ1A 3GQBA 2VBSA 2XEXA 2WYRA 3P26A 1E79A 5BSXA 5FL7A 1MABA 3BCFA 4LC0A 5F4MA 2OYNA 1UD2A 2X6XA 4P22A 4XORA 1ZM4A 1GAWA 1FRQA 4RD1A 1DDIA 2Q6KA 3ZC3A 3ZZTA 2OTJB 4QVAA 3SLDA 1D2EA 2OBTA 1H42A 1PKVA 1FRNA 1KTVA 2VNIA 3E20A 2F1MA 1FNDA 3H9NA 2BVNA 1CQXA 1UD5A 2C78A 1TTTA 3CMMA 2I1LA 5IYRA 1M1KD 1WDTA 5GV8A 1FDRA 2X53S 4RDJA 2DETA 3AVTA 4II3A 1EWYA 4QVJA 2YWGA 2QTZA 1DDGA 2DCUA 3G4SB 3CCQB 3ZBUA 2V7TA 4UZEA 2PE3A 4FWTA 3GSIA 1ZM3A 4BPRA 1EFCA 5F4JA 1WOPA 1GVHA 3GIRA 3LO8A 1W34A 1W0JA 3U2QA 2GJPA 1UMKA 3R6JA 1OGIA 3G6EB 4XLFA 5HZBA 2QDXA 4P3YA 3ZUGA 3MHPA 4AC9A 3SKBA 1JA0A 1EP3B 2VNHA 4P12A 2ZL5A 3A35A 3ZPNA 4XQFA 4HE5A 1KMHA 3CCMB 4H9GA 1EFTA 4XM3A 3T51B 3PUMA 3OE7A 2QMUA 4NCNA 4ZCIA 5KW9A 1VHOA 1PJ6A 1ZM2A 2BM1A 1YIJB 2XNCA 3NE5B 1W0KA 1W35A 2WSSA 3E1YE 5J3OA 4XOTA 4LBZA 3BQJA 4M2LA 3U6KA 4LBWA 4XONA 2QGGA 4AF7A 1VHEA 4YAOA 4RCZA 4P6YA 1E63A 2D3NA 1G7SA 4Y7CA 2B7CA 4WZTA 1IJFA 3BY2A 1R5OA 2QE7A 1KZLA 2VZLA 3OW7A 5BSYA 3OEHA 1Q82D 2XZOA 4Z4WA 1G7RA 1W2BB 3CCVB 3W2FA 3A3BA 2YWEA 1I18A 1NJID 4X7EA 4XLHA 3CCRB 4OOVA 1VQMB 1TLLA 4KKTA 4OP7A 1WORA 3PUNA 2B5OA 3JQRA 4NNJA 4X0CA 1GR1A 3ASTA 2BMWA 3ISXA 4YELA 1BX0A 2RC5A 4YAFA 4AF6A 1VQ8B 1GO2A 1G7CA 5FA6A 4E0FA 3W2IA 1S0UA 1JA1A 2HMAA 4LBVA 5GV7A 2FVGA 3OW2B 4OPSA 5IK2A 4KKSA 1IJEA 3OZVA 1WOOA 1B2RA 4ACBA 4OOSA 2CK3A 2GK6A 4G1BA 4PC6A 1CNFA 1VQKB 2GREA 2X6YA 2ZTNA 3PENA 1NBMA 3VNUA 4WQMA 1NB0A 3JU4A 4X7DA 2C5BA 5KSWB 1I8DA 5A8AA 1UD3A 1DARA 4UAJA 3QFCA 3GVJA 4FN5A 4HE6A 4JMQA 1KQSB 1J9ZA 2ZZFA 5LMZA 1KC8D 1VQLB 2GQFA 2R9VA 4WZLA 2ZXHA 1Q86D 3CXCB 2DYIA 4FK8A 1JB9A 2DY1A 2FX3A 3CCJB 4TT3A 4Y9RA 2BM0A 4C0SA 3LVBA 2E1RA 2GJKA 1VQ9B 4RD3A 4B4DA 3CD6B 4II2A 1B23P 1A8PA 1SM4A 1RQRA 1QVGB 1W9XA 4P26A 3SLNA 3AVYA 3V7AA 4XD7A 2BGIA 5H59A 1FNMA 4TN1A 2XZLA 4PABA 3ASQA 1M90D 4OPOA 1YITB 2NV4A 4YHBA 2NPFA 4L8JA 4Z4ZA 2CW5A 1EFRA 2D9RA 4TMTA 3Q3AA 1OB0A 2W6JA 1ELOA 1F20A 1K73D 4B3XA 1V0EA 1F60A 4PC1A 4YALA 2WJYA 3D26A 1HVXA 3CCEB 5KNLA 3WQZA 5CDFA 2WR8A 3OZWA 4FXUA 1VLYA 3KEWA 3RY8A 3CC2B 4TMXA 2HDNB 3Q39A 3AVWA 3ASPA 3A8IA 4RPBA 4RDKA 1I7PA 3FJOA 4MYUA 3CMAB 4X8IA 1JNYA 1FNBA 1ZM9A 3LQ6A 2VBTA 2JDIA 3CP2A 1KK3A 4P9SA 3VR6A 3WNDA 1PJ7A 1H85A 4OOXA 1N06A 1N07A 3QFRA 1KK0A 2VBVA 3VO2A 1WP6A 4G7WA 1KK2A 2YWFA 4XL9A 2BPOA 4M1KA 4Y9UA 2PIAA 3SJPA 1YI2B 2BF4A 2RC6A 1K28D 3OP1A 3DDYA 3OOCA 2BSAA 4DNRB 1QH0A 2BV3A 5DSZA 2J7KA 1DG1G 3B82A 4YXWA 1HA3A 4YEJA 4WZKA 2ZITA 3OEEA 4RM0A 3PA2A 4WZEA 5A89A 5FIUA 5FO1A 2VNJA 3A8JA 3OAAA 2WZNA 4P2NA 4PC3A 4PAAA 2QA4B 4RD2A 4Q7JB 3ZZ0A 3ZBTA 3CTAA 2VBUA 2Q6OA 2ZZGA 3WY9A 4DNTB 1E3ZA 1E1QA 4QHYA 1T6ZA 1R5BA 3CP8A 3GVKA 2C5HA 1E43A 2CRVA 4UZUA 4QV2A 4WWVA 1U2RA 1P4MA 1V0FA 3WBJA 1WSRA 1QFJA 2V31A 2WJVA 1BLIA 1EFUA 2C4UA 5HZAA 5IYPA 4NBSA 5JBQA 3CPWB 4B43A 2EFGA 1OB2A 4RPDA 3LNNA 2JJ2A 2HCJB 1QFZA 3G71B 1WTHD 3FPPA 2OK7A 3W2EA 3CESA 4TMWA 3CMEB 4XR6A 1V5VA 1NDHA 3P27A 5FNZA 2DEUA 1QVFB 4XN0A 1RQPA 2XNDA 2D74A 3A1PA 4RD0A 3A8KA 3OZUA 2CBXA 4XOPA 4XLCA 3JQQA 3CC4B 1FNCA 1SKQA 4AVZA 3I56B 3SJZA 1N0VC 3I1FA 3R6KA 3Q38A 2QTLA 4J0QA 3ASSA 1UD8A 3MCAA 2W6IA 4P6VF 1HZEA 3QSYA 2JN9A 5A88A 2GPJA 2ZBVA 4Z4VA 2DIEA 3SEJA 4Z4UA 3CCLB 1WSVA 4TMVA 4P25A 3OJXA 3ONYA 1OGJA 4ASUA 4P3IA 3CC7B 1MRZA 1D8TA 2D3LA 5DS0A 1XE1A 4G7XA 2X6WA 1YLOA 2LZJA 1NB9A 1QG0A 2C2WA 3BNWA 1BPLA 1QGAA 1D1NA 4QUZA 4Z4RA 1G7TA 4MYTA 1Y0YA 3U6BA 2Z6BD 5IYQA 1YX2A 5DN6A 4KKUA 1E62A 1VQOB 4HIZA 4TSFA 3Q6QA 3H94A 1N0UA 4PGOA 2V7UA 2VJJA 1QUFA 1WOSA 4DQLA 3CPXA 1SKYB 3WBKA 1Q81D 1WPCA 1KRHA 2B7BA 1T5EA 2CC2A 4RD6A 5H5JA 3VNVA 2CNDA 3QE2A 1YJ9B 4U9UA 4CQJA 3ES9A 2WPDA 1ZUNB 1GJRA 2F4NA 1W87A 4TMZA 1IHMA 1AIPA 4C43A 5L46A 5IYNA 3AVVA 3G05A 2V7XA 1IB0A 1E1RA 2JIZA 2PMDA 5FO0A 4B3FX 4PC7A 1E64A 2ZL7A 3T53B 4X06A 3WYAA 3ONUA 4P1VA 1VQ7B 4M0LA 3PVDA 2CF4A 3BCDA 4ZCLA 3ZZUA 4ZGNB 1VQ5B 1TUIA 2C77A 2DOGA 2Q6LA 2C4TA 3AGPA 3JQPA 4G6IA 3MMPA 4M53A 5TY0A 5B6IA 1EXMA 1K8AD 4YAUA 1EP2B 1OB5A 4XKWA 2V7WA 3OPOA 3QFSA 2OBRA 2GK7A 3ZIAA 2OTLB 5E6TA 1VQ4B 5J35A 2BGJA 4Z4SA 2VNKA 2M5SA 2QN6A 2ZTGA 5IYWA 1Q9SA 4QFMA 1FX0A 2ZZEA 1AMOA 1E3XA 3W5HA 1QX4A 1XFOA 1R5NA 3KL9A 3FPKA 4B47A 3AVXA 1Y0RA 1QFYA 1VJSA 4G1VA 2ZBUA 4RJLA 3W5VA 1QGZA 1WU8A 2EIXA 1S4MA 1BX1A 2VJIA 1COWA 2XZPA 4ZGQB 3WXMA 1Q7YD 1N8RD 4X05A 2F43A 4ACAA 3QFTA 3AVUA 1KD1D 4RCYA 4X7FA 5TV2A 4LBYA 4GQNA 2XGJA 3BH4A 4X07A 4N3NA 3GVLA 3BC9A 4YAWA
chains in the Genus database with same CATH topology
4P26A 3SLNA 3Q6RA 3V7AA 3R6KA 3ASQA 3Q38A 4RDLA 3ASSA 5F4JA 4ROXA 4OPOA 4Z4VA 3SEJA 4Z4UA 4Z4ZA 4P25A 3ONYA 3PA1A 4P3IA 3R6JA 3Q3AA 3ASRA 4RLZA 5HZBA 3SKBA 4P12A 2ZL5A 4QUZA 4Z4RA 3D26A 3PUMA 5IYQA 5KW9A 3LQEA 3Q6QA 5J3OA 2OBSA 3RY8A 3BQJA 3Q39A 3ASPA 4RPBA 4RDKA 4WZTA 3LQ6A 3BY2A 5BSYA 4OOXA 1IHMA 5IYNA 4Z4WA 3SJPA 3BY1A 4X7EA 4OOVA 2ZL7A 4X7CA 4Z4TA 4OP7A 3PUNA 4X06A 3ONUA 4P1VA 3PVDA 4X0CA 3ASTA 4WZKA 4OPVA 4RM0A 3PA2A 4WZEA 2ZL6A 4P2NA 4OPSA 5F4OA 4Z4YA 2OBRA 4OOSA 5E6TA 5J35A 4QV2A 4Z4SA 5IYWA 5BSXA 4X7DA 5IYPA 5HZAA 5F4MA 4QVAA 3SLDA 4RPDA 2OBTA 4WZLA 4X05A 4X7FA 5IYRA 4X07A 4RDJA 4QVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P26 A;  3SLN A;  3Q6R A;  3V7A A;  3R6K A;  3ASQ A;  3Q38 A;  4RDL A;  3ASS A;  5F4J A;  4ROX A;  4OPO A;  4Z4V A;  3SEJ A;  4Z4U A;  4Z4Z A;  4P25 A;  3ONY A;  3PA1 A;  4P3I A;  3R6J A;  3Q3A A;  3ASR A;  4RLZ A;  5HZB A;  3SKB A;  4P12 A;  2ZL5 A;  4QUZ A;  4Z4R A;  3D26 A;  3PUM A;  5IYQ A;  5KW9 A;  3LQE A;  3Q6Q A;  5J3O A;  2OBS A;  3RY8 A;  3BQJ A;  3Q39 A;  3ASP A;  4RPB A;  4RDK A;  4WZT A;  3LQ6 A;  3BY2 A;  5BSY A;  4OOX A;  1IHM A;  5IYN A;  4Z4W A;  3SJP A;  3BY1 A;  4X7E A;  4OOV A;  2ZL7 A;  4X7C A;  4Z4T A;  4OP7 A;  3PUN A;  4X06 A;  3ONU A;  4P1V A;  3PVD A;  4X0C A;  3AST A;  4WZK A;  4OPV A;  4RM0 A;  3PA2 A;  4WZE A;  2ZL6 A;  4P2N A;  4OPS A;  5F4O A;  4Z4Y A;  2OBR A;  4OOS A;  5E6T A;  5J35 A;  4QV2 A;  4Z4S A;  5IYW A;  5BSX A;  4X7D A;  5IYP A;  5HZA A;  5F4M A;  4QVA A;  3SLD A;  4RPD A;  2OBT A;  4WZL A;  4X05 A;  4X7F A;  5IYR A;  4X07 A;  4RDJ A;  4QVJ A; 
#chains in the Genus database with same CATH topology
 2OK8 A;  2V7Q A;  3Q6R A;  4RD4 A;  3W2H A;  3CCS B;  4G5G A;  2DER A;  4R71 A;  1VQN B;  1CNE A;  1K9M D;  4RDL A;  4IW3 B;  4ROX A;  1VF7 A;  3B78 A;  5TRD A;  4XLE A;  3CB4 A;  4PC2 A;  4XKV A;  1BMF A;  2XOK A;  2V7V A;  3HAG A;  3PA1 A;  3A3G A;  1OHH A;  4B3G A;  3ASR A;  3T56 B;  2V4D A;  4RLZ A;  5HKK A;  2P3M A;  3CCU B;  1XB2 A;  3W5U A;  3FKS A;  4UZF A;  5TR9 A;  1VQP B;  5HXB A;  1S72 B;  3AGQ A;  2Q6I A;  1H8E A;  4XMY A;  3B8H A;  1YJW B;  1TVC A;  1UD4 A;  2XNJ A;  1EP1 B;  2HLD A;  1JJ2 B;  1T6X A;  3LQE A;  1YHQ B;  3V76 A;  4Z1M A;  2X0K A;  3VMF A;  1UD6 A;  2OBS A;  1BQE A;  3W2G A;  4ZCM A;  1QUE A;  4EH1 A;  4F7D A;  2F1L A;  1QGY A;  2KVO A;  3OKX A;  4XNF A;  2BN4 A;  1GAQ A;  4DK1 A;  1VQ6 B;  1NRK A;  4B44 A;  1BJK A;  1T6Y A;  2ZXI A;  3OJW A;  2E1B A;  4N3G A;  2GJR A;  3CW2 A;  1XQB A;  1KJZ A;  1N08 A;  4K1X A;  3WNB A;  2AHO A;  2YWH A;  4B48 A;  3BY1 A;  4DK0 A;  1YJN B;  2PLF A;  4X7C A;  4Z4T A;  3WNC A;  2QEX B;  4DQK A;  3J81 k;  4M4S A;  2X8K A;  2VYQ A;  4OPV A;  1VLO A;  2ZL6 A;  1KK1 A;  4XLA A;  5EMN A;  3OFN A;  2R6H A;  3VO1 A;  2ZZQ A;  3CRZ A;  4ZV4 A;  2X85 A;  1N05 A;  5THX A;  5F4O A;  1PJ5 A;  4Z4Y A;  2WZP P;  4XN3 A;  1H8H A;  4TKO B;  2X3U A;  5AN9 A;  3I55 B;  2JJ1 A;  3GQB A;  2VBS A;  2XEX A;  2WYR A;  3P26 A;  1E79 A;  5BSX A;  5FL7 A;  1MAB A;  3BCF A;  4LC0 A;  5F4M A;  2OYN A;  1UD2 A;  2X6X A;  4P22 A;  4XOR A;  1ZM4 A;  1GAW A;  1FRQ A;  4RD1 A;  1DDI A;  2Q6K A;  3ZC3 A;  3ZZT A;  2OTJ B;  4QVA A;  3SLD A;  1D2E A;  2OBT A;  1H42 A;  1PKV A;  1FRN A;  1KTV A;  2VNI A;  3E20 A;  2F1M A;  1FND A;  3H9N A;  2BVN A;  1CQX A;  1UD5 A;  2C78 A;  1TTT A;  3CMM A;  2I1L A;  5IYR A;  1M1K D;  1WDT A;  5GV8 A;  1FDR A;  2X53 S;  4RDJ A;  2DET A;  3AVT A;  4II3 A;  1EWY A;  4QVJ A;  2YWG A;  2QTZ A;  1DDG A;  2DCU A;  3G4S B;  3CCQ B;  3ZBU A;  2V7T A;  4UZE A;  2PE3 A;  4FWT A;  3GSI A;  1ZM3 A;  4BPR A;  1EFC A;  5F4J A;  1WOP A;  1GVH A;  3GIR A;  3LO8 A;  1W34 A;  1W0J A;  3U2Q A;  2GJP A;  1UMK A;  3R6J A;  1OGI A;  3G6E B;  4XLF A;  5HZB A;  2QDX A;  4P3Y A;  3ZUG A;  3MHP A;  4AC9 A;  3SKB A;  1JA0 A;  1EP3 B;  2VNH A;  4P12 A;  2ZL5 A;  3A35 A;  3ZPN A;  4XQF A;  4HE5 A;  1KMH A;  3CCM B;  4H9G A;  1EFT A;  4XM3 A;  3T51 B;  3PUM A;  3OE7 A;  2QMU A;  4NCN A;  4ZCI A;  5KW9 A;  1VHO A;  1PJ6 A;  1ZM2 A;  2BM1 A;  1YIJ B;  2XNC A;  3NE5 B;  1W0K A;  1W35 A;  2WSS A;  3E1Y E;  5J3O A;  4XOT A;  4LBZ A;  3BQJ A;  4M2L A;  3U6K A;  4LBW A;  4XON A;  2QGG A;  4AF7 A;  1VHE A;  4YAO A;  4RCZ A;  4P6Y A;  1E63 A;  2D3N A;  1G7S A;  4Y7C A;  2B7C A;  4WZT A;  1IJF A;  3BY2 A;  1R5O A;  2QE7 A;  1KZL A;  2VZL A;  3OW7 A;  5BSY A;  3OEH A;  1Q82 D;  2XZO A;  4Z4W A;  1G7R A;  1W2B B;  3CCV B;  3W2F A;  3A3B A;  2YWE A;  1I18 A;  1NJI D;  4X7E A;  4XLH A;  3CCR B;  4OOV A;  1VQM B;  1TLL A;  4KKT A;  4OP7 A;  1WOR A;  3PUN A;  2B5O A;  3JQR A;  4NNJ A;  4X0C A;  1GR1 A;  3AST A;  2BMW A;  3ISX A;  4YEL A;  1BX0 A;  2RC5 A;  4YAF A;  4AF6 A;  1VQ8 B;  1GO2 A;  1G7C A;  5FA6 A;  4E0F A;  3W2I A;  1S0U A;  1JA1 A;  2HMA A;  4LBV A;  5GV7 A;  2FVG A;  3OW2 B;  4OPS A;  5IK2 A;  4KKS A;  1IJE A;  3OZV A;  1WOO A;  1B2R A;  4ACB A;  4OOS A;  2CK3 A;  2GK6 A;  4G1B A;  4PC6 A;  1CNF A;  1VQK B;  2GRE A;  2X6Y A;  2ZTN A;  3PEN A;  1NBM A;  3VNU A;  4WQM A;  1NB0 A;  3JU4 A;  4X7D A;  2C5B A;  5KSW B;  1I8D A;  5A8A A;  1UD3 A;  1DAR A;  4UAJ A;  3QFC A;  3GVJ A;  4FN5 A;  4HE6 A;  4JMQ A;  1KQS B;  1J9Z A;  2ZZF A;  5LMZ A;  1KC8 D;  1VQL B;  2GQF A;  2R9V A;  4WZL A;  2ZXH A;  1Q86 D;  3CXC B;  2DYI A;  4FK8 A;  1JB9 A;  2DY1 A;  2FX3 A;  3CCJ B;  4TT3 A;  4Y9R A;  2BM0 A;  4C0S A;  3LVB A;  2E1R A;  2GJK A;  1VQ9 B;  4RD3 A;  4B4D A;  3CD6 B;  4II2 A;  1B23 P;  1A8P A;  1SM4 A;  1RQR A;  1QVG B;  1W9X A;  4P26 A;  3SLN A;  3AVY A;  3V7A A;  4XD7 A;  2BGI A;  5H59 A;  1FNM A;  4TN1 A;  2XZL A;  4PAB A;  3ASQ A;  1M90 D;  4OPO A;  1YIT B;  2NV4 A;  4YHB A;  2NPF A;  4L8J A;  4Z4Z A;  2CW5 A;  1EFR A;  2D9R A;  4TMT A;  3Q3A A;  1OB0 A;  2W6J A;  1ELO A;  1F20 A;  1K73 D;  4B3X A;  1V0E A;  1F60 A;  4PC1 A;  4YAL A;  2WJY A;  3D26 A;  1HVX A;  3CCE B;  5KNL A;  3WQZ A;  5CDF A;  2WR8 A;  3OZW A;  4FXU A;  1VLY A;  3KEW A;  3RY8 A;  3CC2 B;  4TMX A;  2HDN B;  3Q39 A;  3AVW A;  3ASP A;  3A8I A;  4RPB A;  4RDK A;  1I7P A;  3FJO A;  4MYU A;  3CMA B;  4X8I A;  1JNY A;  1FNB A;  1ZM9 A;  3LQ6 A;  2VBT A;  2JDI A;  3CP2 A;  1KK3 A;  4P9S A;  3VR6 A;  3WND A;  1PJ7 A;  1H85 A;  4OOX A;  1N06 A;  1N07 A;  3QFR A;  1KK0 A;  2VBV A;  3VO2 A;  1WP6 A;  4G7W A;  1KK2 A;  2YWF A;  4XL9 A;  2BPO A;  4M1K A;  4Y9U A;  2PIA A;  3SJP A;  1YI2 B;  2BF4 A;  2RC6 A;  1K28 D;  3OP1 A;  3DDY A;  3OOC A;  2BSA A;  4DNR B;  1QH0 A;  2BV3 A;  5DSZ A;  2J7K A;  1DG1 G;  3B82 A;  4YXW A;  1HA3 A;  4YEJ A;  4WZK A;  2ZIT A;  3OEE A;  4RM0 A;  3PA2 A;  4WZE A;  5A89 A;  5FIU A;  5FO1 A;  2VNJ A;  3A8J A;  3OAA A;  2WZN A;  4P2N A;  4PC3 A;  4PAA A;  2QA4 B;  4RD2 A;  4Q7J B;  3ZZ0 A;  3ZBT A;  3CTA A;  2VBU A;  2Q6O A;  2ZZG A;  3WY9 A;  4DNT B;  1E3Z A;  1E1Q A;  4QHY A;  1T6Z A;  1R5B A;  3CP8 A;  3GVK A;  2C5H A;  1E43 A;  2CRV A;  4UZU A;  4QV2 A;  4WWV A;  1U2R A;  1P4M A;  1V0F A;  3WBJ A;  1WSR A;  1QFJ A;  2V31 A;  2WJV A;  1BLI A;  1EFU A;  2C4U A;  5HZA A;  5IYP A;  4NBS A;  5JBQ A;  3CPW B;  4B43 A;  2EFG A;  1OB2 A;  4RPD A;  3LNN A;  2JJ2 A;  2HCJ B;  1QFZ A;  3G71 B;  1WTH D;  3FPP A;  2OK7 A;  3W2E A;  3CES A;  4TMW A;  3CME B;  4XR6 A;  1V5V A;  1NDH A;  3P27 A;  5FNZ A;  2DEU A;  1QVF B;  4XN0 A;  1RQP A;  2XND A;  2D74 A;  3A1P A;  4RD0 A;  3A8K A;  3OZU A;  2CBX A;  4XOP A;  4XLC A;  3JQQ A;  3CC4 B;  1FNC A;  1SKQ A;  4AVZ A;  3I56 B;  3SJZ A;  1N0V C;  3I1F A;  3R6K A;  3Q38 A;  2QTL A;  4J0Q A;  3ASS A;  1UD8 A;  3MCA A;  2W6I A;  4P6V F;  1HZE A;  3QSY A;  2JN9 A;  5A88 A;  2GPJ A;  2ZBV A;  4Z4V A;  2DIE A;  3SEJ A;  4Z4U A;  3CCL B;  1WSV A;  4TMV A;  4P25 A;  3OJX A;  3ONY A;  1OGJ A;  4ASU A;  4P3I A;  3CC7 B;  1MRZ A;  1D8T A;  2D3L A;  5DS0 A;  1XE1 A;  4G7X A;  2X6W A;  1YLO A;  2LZJ A;  1NB9 A;  1QG0 A;  2C2W A;  3BNW A;  1BPL A;  1QGA A;  1D1N A;  4QUZ A;  4Z4R A;  1G7T A;  4MYT A;  1Y0Y A;  3U6B A;  2Z6B D;  5IYQ A;  1YX2 A;  5DN6 A;  4KKU A;  1E62 A;  1VQO B;  4HIZ A;  4TSF A;  3Q6Q A;  3H94 A;  1N0U A;  4PGO A;  2V7U A;  2VJJ A;  1QUF A;  1WOS A;  4DQL A;  3CPX A;  1SKY B;  3WBK A;  1Q81 D;  1WPC A;  1KRH A;  2B7B A;  1T5E A;  2CC2 A;  4RD6 A;  5H5J A;  3VNV A;  2CND A;  3QE2 A;  1YJ9 B;  4U9U A;  4CQJ A;  3ES9 A;  2WPD A;  1ZUN B;  1GJR A;  2F4N A;  1W87 A;  4TMZ A;  1IHM A;  1AIP A;  4C43 A;  5L46 A;  5IYN A;  3AVV A;  3G05 A;  2V7X A;  1IB0 A;  1E1R A;  2JIZ A;  2PMD A;  5FO0 A;  4B3F X;  4PC7 A;  1E64 A;  2ZL7 A;  3T53 B;  4X06 A;  3WYA A;  3ONU A;  4P1V A;  1VQ7 B;  4M0L A;  3PVD A;  2CF4 A;  3BCD A;  4ZCL A;  3ZZU A;  4ZGN B;  1VQ5 B;  1TUI A;  2C77 A;  2DOG A;  2Q6L A;  2C4T A;  3AGP A;  3JQP A;  4G6I A;  3MMP A;  4M53 A;  5TY0 A;  5B6I A;  1EXM A;  1K8A D;  4YAU A;  1EP2 B;  1OB5 A;  4XKW A;  2V7W A;  3OPO A;  3QFS A;  2OBR A;  2GK7 A;  3ZIA A;  2OTL B;  5E6T A;  1VQ4 B;  5J35 A;  2BGJ A;  4Z4S A;  2VNK A;  2M5S A;  2QN6 A;  2ZTG A;  5IYW A;  1Q9S A;  4QFM A;  1FX0 A;  2ZZE A;  1AMO A;  1E3X A;  3W5H A;  1QX4 A;  1XFO A;  1R5N A;  3KL9 A;  3FPK A;  4B47 A;  3AVX A;  1Y0R A;  1QFY A;  1VJS A;  4G1V A;  2ZBU A;  4RJL A;  3W5V A;  1QGZ A;  1WU8 A;  2EIX A;  1S4M A;  1BX1 A;  2VJI A;  1COW A;  2XZP A;  4ZGQ B;  3WXM A;  1Q7Y D;  1N8R D;  4X05 A;  2F43 A;  4ACA A;  3QFT A;  3AVU A;  1KD1 D;  4RCY A;  4X7F A;  5TV2 A;  4LBY A;  4GQN A;  2XGJ A;  3BH4 A;  4X07 A;  4N3N A;  3GVL A;  3BC9 A;  4YAW A; 
#chains in the Genus database with same CATH homology
 4P26 A;  3SLN A;  3Q6R A;  3V7A A;  3R6K A;  3ASQ A;  3Q38 A;  4RDL A;  3ASS A;  5F4J A;  4ROX A;  4OPO A;  4Z4V A;  3SEJ A;  4Z4U A;  4Z4Z A;  4P25 A;  3ONY A;  3PA1 A;  4P3I A;  3R6J A;  3Q3A A;  3ASR A;  4RLZ A;  5HZB A;  3SKB A;  4P12 A;  2ZL5 A;  4QUZ A;  4Z4R A;  3D26 A;  3PUM A;  5IYQ A;  5KW9 A;  3LQE A;  3Q6Q A;  5J3O A;  2OBS A;  3RY8 A;  3BQJ A;  3Q39 A;  3ASP A;  4RPB A;  4RDK A;  4WZT A;  3LQ6 A;  3BY2 A;  5BSY A;  4OOX A;  1IHM A;  5IYN A;  4Z4W A;  3SJP A;  3BY1 A;  4X7E A;  4OOV A;  2ZL7 A;  4X7C A;  4Z4T A;  4OP7 A;  3PUN A;  4X06 A;  3ONU A;  4P1V A;  3PVD A;  4X0C A;  3AST A;  4WZK A;  4OPV A;  4RM0 A;  3PA2 A;  4WZE A;  2ZL6 A;  4P2N A;  4OPS A;  5F4O A;  4Z4Y A;  2OBR A;  4OOS A;  5E6T A;  5J35 A;  4QV2 A;  4Z4S A;  5IYW A;  5BSX A;  4X7D A;  5IYP A;  5HZA A;  5F4M A;  4QVA A;  3SLD A;  4RPD A;  2OBT A;  4WZL A;  4X05 A;  4X7F A;  5IYR A;  4X07 A;  4RDJ A;  4QVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...