3BY2A

Norwalk p polypeptide (228-523)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
287
structure length
280
Chain Sequence
PFTLPNLPLSSLSNSRAPLPISSMGISPDNVQSVQFQNGRCTLDGRLVGTTPVSLSHVAKIRGTSNGTVINLTELDGTPFHPFEGPAPIGFPDLGGCDWHINMTQFGHSQTQYDVDTTPDTFVPHLGSIQANGIGSGNYVGVLSWISPPSHPSGSQVDLWKIPNYGSTEATHLAPSVYPPGFGEVLVFFMSKMPGPGAYNLPCLLPQEYISHLASEQAPGEAALLHYVDPDTGRNLGEFKAYPDGFLTCVPNGAGPQQLPINGVFVFVSWVSRFYQLKPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 58 kd capsid protein
publication title Structural basis for the receptor binding specificity of Norwalk virus.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Viral protein
total genus 58
structure length 280
sequence length 287
ec nomenclature
pdb deposition date 2008-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 3by2A02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 3by2A01
4Z4SA 2ZL6A 5BSXA 3V7AA 5F4JA 4P3IA 4P1VA 4OP7A 4OOVA 5BSYA 4X05A 3PVDA 3ASQA 4X07A 4QVAA 2OBSA 3ONYA 3SLDA 4RM0A 3LQ6A 5J35A 4WZKA 4X7DA 3LQEA 3SJPA 4QUZA 4WZLA 5IYPA 5IYNA 4RDJA 4X7EA 2ZL5A 3BY1A 4Z4RA 5KW9A 4OOSA 4P12A 5IYQA 4OPSA 5F4OA 4Z4YA 3PA1A 4WZEA 5HZAA 3ASPA 3ASSA 3BQJA 3Q6RA 5IYRA 3SKBA 4QV2A 5IYWA 3PA2A 4OPOA 4RPDA 5F4MA 4Z4WA 3R6JA 4P26A 4QVJA 4Z4ZA 3Q6QA 4OPVA 3SLNA 4Z4VA 4RLZA 3ASTA 3ASRA 4RDKA 5HZBA 4X7CA 4WZTA 4Z4TA 4OOXA 4RDLA 5J3OA 5E6TA 4RPBA 3Q39A 4ROXA 3SEJA 2OBTA 2ZL7A 4X0CA 3D26A 3PUMA 3ONUA 2OBRA 4X7FA 3Q38A 4Z4UA 3BY2A 3Q3AA 3RY8A 3PUNA 4P2NA 1IHMA 3R6KA 4X06A 4P25A
chains in the Genus database with same CATH superfamily
1BLIA 1VQ9B 3CMEB 1MABA 3MCAA 1WSVA 1N08A 1SM4A 1A8PA 4P1VA 2XNJA 3OKXA 4AVZA 4P22A 4OOVA 2GK6A 5BSYA 5THXA 3CD6B 2W6JA 3OEEA 2QDXA 2DEUA 3CRZA 1B23P 3W2HA 1QX4A 1WTHD 1B2RA 1JB9A 3CTAA 5FO1A 4DNTB 1KK0A 4UZFA 1Q82D 2RC5A 3ISXA 4PAAA 2R6HA 3A8IA 1Q81D 2J7KA 4FN5A 1ZM4A 4RM0A 5KNLA 4MYUA 4XORA 1CQXA 2V7XA 5J35A 4DQKA 3OJXA 4X7DA 3CXCB 2ZXHA 3CCUB 1YJNB 2VBSA 4UZUA 4B44A 1W87A 2PMDA 4N3GA 4DNRB 1NB0A 1E3XA 1FNCA 3BY1A 1NJID 1F20A 3CPWB 3NE5B 3OE7A 3G4SB 2BGJA 3WNBA 3CCSB 4XOPA 4OOSA 5GV7A 4B3GA 2GK7A 5IYQA 1ZM2A 1UD2A 2XOKA 1KQSB 4KKTA 3QSYA 3J81k 2WR8A 4WZEA 2X6WA 3ASPA 1IJFA 2B7CA 3V76A 3ASSA 1G7TA 3BQJA 2JN9A 1XQBA 1DG1G 5IYRA 2BGIA 2JJ2A 4ZGNB 3LO8A 1IJEA 4H9GA 2C4TA 3MHPA 4P3YA 1T6ZA 1T5EA 4PC7A 3R6JA 2BM1A 4QFMA 3ZBTA 3CMAB 4P26A 2ZTNA 1YITB 1E62A 1FNMA 1PJ6A 3A1PA 3Q6QA 4B47A 3SLNA 3KL9A 4LBYA 2F4NA 1M90D 4RDKA 3OAAA 4YALA 4U9UA 2ZBVA 1UMKA 2RC6A 1VQOB 2ZZFA 2AHOA 1WOOA 4Y9RA 5J3OA 1T6YA 2D3NA 3W5VA 1G7CA 1J9ZA 1N8RD 1EXMA 2V7QA 3JQRA 1H42A 2HCJB 3PUMA 5GV8A 2OBRA 4M53A 5KSWB 1W0KA 1JNYA 4PGOA 1PJ5A 3BY2A 4LBWA 4YELA 2WPDA 2XZOA 1U2RA 2VNJA 3PUNA 4P2NA 1QGZA 4QHYA 1VQLB 1R5BA 3W2IA 2Q6LA 2YWGA 4TMVA 3R6KA 1OHHA 1EP2B 4YXWA 1ZM9A 1PKVA 1KZLA 2X6YA 1EP1B 4MYTA 2BF4A 4Z4SA 2VJIA 1CNEA 2VNHA 4RD6A 2ZL6A 2CNDA 1UD3A 4G1VA 5BSXA 3GSIA 1YLOA 2Q6IA 3V7AA 5A88A 4P3IA 3FKSA 4YAFA 1AIPA 2DOGA 4F7DA 1WOSA 1KC8D 3GVJA 1S72B 4C0SA 1EFRA 2WJVA 4X05A 1VQNB 1YIJB 4Y9UA 4DK1A 2X0KA 3FJOA 2GJKA 3H9NA 1AMOA 3ES9A 3QFCA 3SLDA 2OK8A 3OZVA 2DCUA 4XN0A 3VO1A 5TR9A 2ZBUA 3LQ6A 4EH1A 2BVNA 4M4SA 1K8AD 3OFNA 4UZEA 1UD4A 2VBUA 4QUZA 1COWA 4WZLA 4JMQA 3SJZA 3I56B 1I8DA 2LZJA 2GREA 2I1LA 1I7PA 4B43A 5B6IA 1EWYA 2ZTGA 4XLFA 1V0FA 3P27A 5CDFA 4M1KA 3B78A 1BMFA 2XGJA 1KMHA 2ZZEA 4R71A 3JQQA 4OPSA 1JA1A 5DSZA 1R5NA 5F4OA 3ZZ0A 4Z4YA 3PA1A 1D8TA 1NRKA 2V7UA 2E1BA 1QH0A 1FDRA 5FL7A 4M2LA 1YI2B 2BPOA 4RCYA 1HVXA 2W6IA 3OW7A 3A3GA 2BMWA 4XLCA 1P4MA 2CRVA 1VJSA 1WDTA 1UD5A 2NV4A 4QV2A 3AVUA 1UD6A 4XQFA 2DERA 3A35A 2XNCA 3ZPNA 4ACBA 2VYQA 4YEJA 1VQ5B 3U2QA 1K73D 3AVVA 3JU4A 4XLHA 2DY1A 1QFZA 2X3UA 5F4MA 2FVGA 4Z4WA 1WU8A 3AVTA 1OB2A 2Q6OA 4TMWA 2C2WA 1QFJA 4XONA 1VQPB 4QVJA 2VBTA 5A8AA 1FNBA 2YWHA 4XLEA 2GJRA 2NPFA 1GO2A 4RLZA 3W5HA 3ASTA 3G71B 3CCLB 4E0FA 5HZBA 4TKOB 3ZBUA 4AF7A 2F1MA 4X8IA 1QFYA 4XL9A 2HMAA 1RQRA 3QFRA 4OOXA 4Z4TA 4XR6A 3WBKA 3ZIAA 3AVWA 3CC4B 4RDLA 5DS0A 1BX0A 1DDGA 1Q86D 3A3BA 2OK7A 5TV2A 3Q39A 3SEJA 4J0QA 2ZL7A 4XLAA 2OTLB 1N07A 1GVHA 1UD8A 2EFGA 5H5JA 1V5VA 2DIEA 3GVLA 4Z4UA 1JA0A 2GPJA 3Q3AA 1G7RA 1KK2A 3AVYA 2EIXA 2E1RA 1E1RA 1H8EA 1VHOA 4FXUA 2XNDA 2ZITA 3DDYA 2QN6A 1E43A 4YAUA 4ASUA 2Q6KA 2X53S 4K1XA 1QG0A 1BJKA 3OPOA 5F4JA 3CCEB 2QGGA 3AGQA 4BPRA 2WZPP 2BN4A 2BSAA 2CBXA 4PC6A 2GQFA 3WBJA 1F60A 2D74A 1XE1A 4TT3A 4X07A 2F1LA 3VR6A 4QVAA 4XN3A 3OZWA 3CCRB 1W35A 3CC7B 5JBQA 2QA4B 3ZZUA 2OYNA 3QFSA 2V7TA 3VO2A 3MMPA 1WORA 1MRZA 2X8KA 3ZZTA 4B4DA 1S4MA 1W2BB 1HZEA 4RDJA 4TSFA 2XEXA 4X7EA 3I1FA 1NBMA 2C5HA 2WZNA 3OEHA 1EFCA 4XKWA 4Z4RA 4XM3A 4LC0A 4P12A 4RD0A 4UAJA 1VQ7B 5DN6A 2M5SA 1G7SA 1EFUA 4HE6A 1TTTA 1E63A 2DETA 1VQMB 4TMZA 2CW5A 2WYRA 1V0EA 3T51B 4P6YA 1W34A 1W9XA 3OP1A 4XD7A 1ZUNB 5AN9A 2JIZA 5HKKA 1WSRA 1HA3A 4KKSA 2QEXB 3Q6RA 1OB5A 4PABA 4G5GA 2PE3A 4AC9A 2VJJA 4RCZA 4CQJA 1Y0YA 3FPKA 3W5UA 1EP3B 1FRNA 4OPOA 1FRQA 3E20A 4RPDA 4ZGQB 1WOPA 1SKYB 1N0VC 1H85A 2Z6BD 1DARA 3QE2A 4II3A 2QMUA 3AVXA 4Z4ZA 4NCNA 4RJLA 4OPVA 3G05A 4Z4VA 1YX2A 4GQNA 3BNWA 1VQKB 4XKVA 5HXBA 4PC1A 3ASRA 1KRHA 2CK3A 2YWEA 1QGAA 4X7CA 3KEWA 1TVCA 2V4DA 3OOCA 4WZTA 2ZZQA 1EFTA 2OTJB 2JJ1A 1D1NA 1IB0A 1Q9SA 4ZCLA 3WYAA 2CF4A 1QGYA 4PC3A 1YJ9B 3CESA 1S0UA 4RPBA 4ZCIA 4ROXA 1FX0A 2HDNB 1E64A 4G6IA 4PC2A 3CCVB 1YJWB 3T53B 4ZV4A 1T6XA 3A8KA 3D26A 2B5OA 2WSSA 5IK2A 1VQ4B 3Q38A 4RD2A 5H59A 2VNKA 4NNJA 4P9SA 1GR1A 1OB0A 2JDIA 2C77A 5FIUA 3B82A 4NBSA 1E1QA 3W2GA 4P6VF 1FNDA 1DDIA 1VQ6B 1E3ZA 4P25A 4KKUA 2ZXIA 2B7BA 4RD4A 1CNFA 5TY0A 4XOTA 2BV3A 1OGIA 2R9VA 1WPCA 1E79A 2C4UA 2X6XA 4WWVA 3GIRA 3U6KA 3CPXA 2P3MA 4OP7A 1QVFB 3W2FA 4LBVA 4HIZA 4G7XA 3PVDA 4WQMA 3ASQA 4RD1A 1VLYA 4B48A 1RQPA 1QUEA 2QTZA 2D3LA 2OBSA 1XB2A 4TMXA 4YAOA 3ZC3A 3G6EB 2D9RA 1M1KD 3ONYA 3BCFA 1R5OA 1H8HA 4B3XA 2WJYA 4XNFA 2C5BA 4WZKA 3LQEA 4M0LA 2KVOA 3SJPA 3CB4A 5IYPA 5IYNA 1QUFA 1W0JA 4IW3B 4RD3A 1K28D 5FA6A 3PENA 4TMTA 3CP2A 2C78A 4AF6A 3CCJB 2PLFA 3WNDA 3H94A 2QTLA 2ZL5A 1PJ7A 5A89A 2XZLA 5KW9A 1GJRA 1ZM3A 1D2EA 5TRDA 3JQPA 1N05A 2V7VA 1KK3A 3E1YE 1WP6A 2V7WA 3GVKA 4FWTA 5L46A 1KD1D 4ACAA 1XFOA 3VMFA 5HZAA 3WXMA 3A8JA 3CCMB 2V31A 1Q7YD 3VNVA 2VNIA 4HE5A 4LBZA 1BQEA 2VBVA 1BX1A 2F43A 3SKBA 2QE7A 1KTVA 2HLDA 1YHQB 5IYWA 3U6BA 3CCQB 3PA2A 1VQ8B 3T56B 4YAWA 1N06A 3BC9A 3GQBA 2BM0A 1OGJA 4G1BA 4B3FX 1VHEA 3WY9A 3LVBA 1N0UA 2ZZGA 3W2EA 2YWFA 2DYIA 3OZUA 3I55B 2X85A 3LNNA 1KJZA 3CC2B 1K9MD 3CP8A 2VZLA 4ZCMA 3QFTA 1KK1A 3OJWA 4TN1A 4L8JA 3ZUGA 2FX3A 1I18A 1ELOA 1NDHA 2XZPA 2CC2A 3BH4A 1TUIA 4II2A 1NB9A 4XMYA 5FNZA 3CMMA 4Y7CA 5LMZA 3FPPA 5E6TA 4Z1MA 4C43A 3CW2A 1VLOA 4FK8A 2OBTA 4N3NA 4X0CA 1GAQA 1BPLA 3BCDA 3P26A 3WNCA 2GJPA 3ONUA 1SKQA 3HAGA 4X7FA 1QVGB 4DK0A 1Y0RA 4YHBA 1VF7A 4Q7JB 3RY8A 5FO0A 3B8HA 3OW2B 3AGPA 3VNUA 2PIAA 1IHMA 1TLLA 1JJ2B 4X06A 1GAWA 4G7WA 5EMNA 3WQZA 4DQLA
chains in the Genus database with same CATH topology
4Z4SA 2ZL6A 5BSXA 3V7AA 5F4JA 4P3IA 4P1VA 4OP7A 4OOVA 5BSYA 4X05A 3PVDA 3ASQA 4X07A 4QVAA 2OBSA 3ONYA 3SLDA 4RM0A 3LQ6A 5J35A 4WZKA 4X7DA 3LQEA 3SJPA 4QUZA 4WZLA 5IYPA 5IYNA 4RDJA 4X7EA 2ZL5A 3BY1A 4Z4RA 5KW9A 4OOSA 4P12A 5IYQA 4OPSA 5F4OA 4Z4YA 3PA1A 4WZEA 5HZAA 3ASPA 3ASSA 3BQJA 3Q6RA 5IYRA 3SKBA 4QV2A 5IYWA 3PA2A 4OPOA 4RPDA 5F4MA 4Z4WA 3R6JA 4P26A 4QVJA 4Z4ZA 3Q6QA 4OPVA 3SLNA 4Z4VA 4RLZA 3ASTA 3ASRA 4RDKA 5HZBA 4X7CA 4WZTA 4Z4TA 4OOXA 4RDLA 5J3OA 5E6TA 4RPBA 3Q39A 4ROXA 3SEJA 2OBTA 2ZL7A 4X0CA 3D26A 3PUMA 3ONUA 2OBRA 4X7FA 3Q38A 4Z4UA 3BY2A 3Q3AA 3RY8A 3PUNA 4P2NA 1IHMA 3R6KA 4X06A 4P25A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z4S A;  2ZL6 A;  5BSX A;  3V7A A;  5F4J A;  4P3I A;  4P1V A;  4OP7 A;  4OOV A;  5BSY A;  4X05 A;  3PVD A;  3ASQ A;  4X07 A;  4QVA A;  2OBS A;  3ONY A;  3SLD A;  4RM0 A;  3LQ6 A;  5J35 A;  4WZK A;  4X7D A;  3LQE A;  3SJP A;  4QUZ A;  4WZL A;  5IYP A;  5IYN A;  4RDJ A;  4X7E A;  2ZL5 A;  3BY1 A;  4Z4R A;  5KW9 A;  4OOS A;  4P12 A;  5IYQ A;  4OPS A;  5F4O A;  4Z4Y A;  3PA1 A;  4WZE A;  5HZA A;  3ASP A;  3ASS A;  3BQJ A;  3Q6R A;  5IYR A;  3SKB A;  4QV2 A;  5IYW A;  3PA2 A;  4OPO A;  4RPD A;  5F4M A;  4Z4W A;  3R6J A;  4P26 A;  4QVJ A;  4Z4Z A;  3Q6Q A;  4OPV A;  3SLN A;  4Z4V A;  4RLZ A;  3AST A;  3ASR A;  4RDK A;  5HZB A;  4X7C A;  4WZT A;  4Z4T A;  4OOX A;  4RDL A;  5J3O A;  5E6T A;  4RPB A;  3Q39 A;  4ROX A;  3SEJ A;  2OBT A;  2ZL7 A;  4X0C A;  3D26 A;  3PUM A;  3ONU A;  2OBR A;  4X7F A;  3Q38 A;  4Z4U A;  3BY2 A;  3Q3A A;  3RY8 A;  3PUN A;  4P2N A;  1IHM A;  3R6K A;  4X06 A;  4P25 A; 
#chains in the Genus database with same CATH topology
 1BLI A;  1VQ9 B;  3CME B;  1MAB A;  3MCA A;  1WSV A;  1N08 A;  1SM4 A;  1A8P A;  4P1V A;  2XNJ A;  3OKX A;  4AVZ A;  4P22 A;  4OOV A;  2GK6 A;  5BSY A;  5THX A;  3CD6 B;  2W6J A;  3OEE A;  2QDX A;  2DEU A;  3CRZ A;  1B23 P;  3W2H A;  1QX4 A;  1WTH D;  1B2R A;  1JB9 A;  3CTA A;  5FO1 A;  4DNT B;  1KK0 A;  4UZF A;  1Q82 D;  2RC5 A;  3ISX A;  4PAA A;  2R6H A;  3A8I A;  1Q81 D;  2J7K A;  4FN5 A;  1ZM4 A;  4RM0 A;  5KNL A;  4MYU A;  4XOR A;  1CQX A;  2V7X A;  5J35 A;  4DQK A;  3OJX A;  4X7D A;  3CXC B;  2ZXH A;  3CCU B;  1YJN B;  2VBS A;  4UZU A;  4B44 A;  1W87 A;  2PMD A;  4N3G A;  4DNR B;  1NB0 A;  1E3X A;  1FNC A;  3BY1 A;  1NJI D;  1F20 A;  3CPW B;  3NE5 B;  3OE7 A;  3G4S B;  2BGJ A;  3WNB A;  3CCS B;  4XOP A;  4OOS A;  5GV7 A;  4B3G A;  2GK7 A;  5IYQ A;  1ZM2 A;  1UD2 A;  2XOK A;  1KQS B;  4KKT A;  3QSY A;  3J81 k;  2WR8 A;  4WZE A;  2X6W A;  3ASP A;  1IJF A;  2B7C A;  3V76 A;  3ASS A;  1G7T A;  3BQJ A;  2JN9 A;  1XQB A;  1DG1 G;  5IYR A;  2BGI A;  2JJ2 A;  4ZGN B;  3LO8 A;  1IJE A;  4H9G A;  2C4T A;  3MHP A;  4P3Y A;  1T6Z A;  1T5E A;  4PC7 A;  3R6J A;  2BM1 A;  4QFM A;  3ZBT A;  3CMA B;  4P26 A;  2ZTN A;  1YIT B;  1E62 A;  1FNM A;  1PJ6 A;  3A1P A;  3Q6Q A;  4B47 A;  3SLN A;  3KL9 A;  4LBY A;  2F4N A;  1M90 D;  4RDK A;  3OAA A;  4YAL A;  4U9U A;  2ZBV A;  1UMK A;  2RC6 A;  1VQO B;  2ZZF A;  2AHO A;  1WOO A;  4Y9R A;  5J3O A;  1T6Y A;  2D3N A;  3W5V A;  1G7C A;  1J9Z A;  1N8R D;  1EXM A;  2V7Q A;  3JQR A;  1H42 A;  2HCJ B;  3PUM A;  5GV8 A;  2OBR A;  4M53 A;  5KSW B;  1W0K A;  1JNY A;  4PGO A;  1PJ5 A;  3BY2 A;  4LBW A;  4YEL A;  2WPD A;  2XZO A;  1U2R A;  2VNJ A;  3PUN A;  4P2N A;  1QGZ A;  4QHY A;  1VQL B;  1R5B A;  3W2I A;  2Q6L A;  2YWG A;  4TMV A;  3R6K A;  1OHH A;  1EP2 B;  4YXW A;  1ZM9 A;  1PKV A;  1KZL A;  2X6Y A;  1EP1 B;  4MYT A;  2BF4 A;  4Z4S A;  2VJI A;  1CNE A;  2VNH A;  4RD6 A;  2ZL6 A;  2CND A;  1UD3 A;  4G1V A;  5BSX A;  3GSI A;  1YLO A;  2Q6I A;  3V7A A;  5A88 A;  4P3I A;  3FKS A;  4YAF A;  1AIP A;  2DOG A;  4F7D A;  1WOS A;  1KC8 D;  3GVJ A;  1S72 B;  4C0S A;  1EFR A;  2WJV A;  4X05 A;  1VQN B;  1YIJ B;  4Y9U A;  4DK1 A;  2X0K A;  3FJO A;  2GJK A;  3H9N A;  1AMO A;  3ES9 A;  3QFC A;  3SLD A;  2OK8 A;  3OZV A;  2DCU A;  4XN0 A;  3VO1 A;  5TR9 A;  2ZBU A;  3LQ6 A;  4EH1 A;  2BVN A;  4M4S A;  1K8A D;  3OFN A;  4UZE A;  1UD4 A;  2VBU A;  4QUZ A;  1COW A;  4WZL A;  4JMQ A;  3SJZ A;  3I56 B;  1I8D A;  2LZJ A;  2GRE A;  2I1L A;  1I7P A;  4B43 A;  5B6I A;  1EWY A;  2ZTG A;  4XLF A;  1V0F A;  3P27 A;  5CDF A;  4M1K A;  3B78 A;  1BMF A;  2XGJ A;  1KMH A;  2ZZE A;  4R71 A;  3JQQ A;  4OPS A;  1JA1 A;  5DSZ A;  1R5N A;  5F4O A;  3ZZ0 A;  4Z4Y A;  3PA1 A;  1D8T A;  1NRK A;  2V7U A;  2E1B A;  1QH0 A;  1FDR A;  5FL7 A;  4M2L A;  1YI2 B;  2BPO A;  4RCY A;  1HVX A;  2W6I A;  3OW7 A;  3A3G A;  2BMW A;  4XLC A;  1P4M A;  2CRV A;  1VJS A;  1WDT A;  1UD5 A;  2NV4 A;  4QV2 A;  3AVU A;  1UD6 A;  4XQF A;  2DER A;  3A35 A;  2XNC A;  3ZPN A;  4ACB A;  2VYQ A;  4YEJ A;  1VQ5 B;  3U2Q A;  1K73 D;  3AVV A;  3JU4 A;  4XLH A;  2DY1 A;  1QFZ A;  2X3U A;  5F4M A;  2FVG A;  4Z4W A;  1WU8 A;  3AVT A;  1OB2 A;  2Q6O A;  4TMW A;  2C2W A;  1QFJ A;  4XON A;  1VQP B;  4QVJ A;  2VBT A;  5A8A A;  1FNB A;  2YWH A;  4XLE A;  2GJR A;  2NPF A;  1GO2 A;  4RLZ A;  3W5H A;  3AST A;  3G71 B;  3CCL B;  4E0F A;  5HZB A;  4TKO B;  3ZBU A;  4AF7 A;  2F1M A;  4X8I A;  1QFY A;  4XL9 A;  2HMA A;  1RQR A;  3QFR A;  4OOX A;  4Z4T A;  4XR6 A;  3WBK A;  3ZIA A;  3AVW A;  3CC4 B;  4RDL A;  5DS0 A;  1BX0 A;  1DDG A;  1Q86 D;  3A3B A;  2OK7 A;  5TV2 A;  3Q39 A;  3SEJ A;  4J0Q A;  2ZL7 A;  4XLA A;  2OTL B;  1N07 A;  1GVH A;  1UD8 A;  2EFG A;  5H5J A;  1V5V A;  2DIE A;  3GVL A;  4Z4U A;  1JA0 A;  2GPJ A;  3Q3A A;  1G7R A;  1KK2 A;  3AVY A;  2EIX A;  2E1R A;  1E1R A;  1H8E A;  1VHO A;  4FXU A;  2XND A;  2ZIT A;  3DDY A;  2QN6 A;  1E43 A;  4YAU A;  4ASU A;  2Q6K A;  2X53 S;  4K1X A;  1QG0 A;  1BJK A;  3OPO A;  5F4J A;  3CCE B;  2QGG A;  3AGQ A;  4BPR A;  2WZP P;  2BN4 A;  2BSA A;  2CBX A;  4PC6 A;  2GQF A;  3WBJ A;  1F60 A;  2D74 A;  1XE1 A;  4TT3 A;  4X07 A;  2F1L A;  3VR6 A;  4QVA A;  4XN3 A;  3OZW A;  3CCR B;  1W35 A;  3CC7 B;  5JBQ A;  2QA4 B;  3ZZU A;  2OYN A;  3QFS A;  2V7T A;  3VO2 A;  3MMP A;  1WOR A;  1MRZ A;  2X8K A;  3ZZT A;  4B4D A;  1S4M A;  1W2B B;  1HZE A;  4RDJ A;  4TSF A;  2XEX A;  4X7E A;  3I1F A;  1NBM A;  2C5H A;  2WZN A;  3OEH A;  1EFC A;  4XKW A;  4Z4R A;  4XM3 A;  4LC0 A;  4P12 A;  4RD0 A;  4UAJ A;  1VQ7 B;  5DN6 A;  2M5S A;  1G7S A;  1EFU A;  4HE6 A;  1TTT A;  1E63 A;  2DET A;  1VQM B;  4TMZ A;  2CW5 A;  2WYR A;  1V0E A;  3T51 B;  4P6Y A;  1W34 A;  1W9X A;  3OP1 A;  4XD7 A;  1ZUN B;  5AN9 A;  2JIZ A;  5HKK A;  1WSR A;  1HA3 A;  4KKS A;  2QEX B;  3Q6R A;  1OB5 A;  4PAB A;  4G5G A;  2PE3 A;  4AC9 A;  2VJJ A;  4RCZ A;  4CQJ A;  1Y0Y A;  3FPK A;  3W5U A;  1EP3 B;  1FRN A;  4OPO A;  1FRQ A;  3E20 A;  4RPD A;  4ZGQ B;  1WOP A;  1SKY B;  1N0V C;  1H85 A;  2Z6B D;  1DAR A;  3QE2 A;  4II3 A;  2QMU A;  3AVX A;  4Z4Z A;  4NCN A;  4RJL A;  4OPV A;  3G05 A;  4Z4V A;  1YX2 A;  4GQN A;  3BNW A;  1VQK B;  4XKV A;  5HXB A;  4PC1 A;  3ASR A;  1KRH A;  2CK3 A;  2YWE A;  1QGA A;  4X7C A;  3KEW A;  1TVC A;  2V4D A;  3OOC A;  4WZT A;  2ZZQ A;  1EFT A;  2OTJ B;  2JJ1 A;  1D1N A;  1IB0 A;  1Q9S A;  4ZCL A;  3WYA A;  2CF4 A;  1QGY A;  4PC3 A;  1YJ9 B;  3CES A;  1S0U A;  4RPB A;  4ZCI A;  4ROX A;  1FX0 A;  2HDN B;  1E64 A;  4G6I A;  4PC2 A;  3CCV B;  1YJW B;  3T53 B;  4ZV4 A;  1T6X A;  3A8K A;  3D26 A;  2B5O A;  2WSS A;  5IK2 A;  1VQ4 B;  3Q38 A;  4RD2 A;  5H59 A;  2VNK A;  4NNJ A;  4P9S A;  1GR1 A;  1OB0 A;  2JDI A;  2C77 A;  5FIU A;  3B82 A;  4NBS A;  1E1Q A;  3W2G A;  4P6V F;  1FND A;  1DDI A;  1VQ6 B;  1E3Z A;  4P25 A;  4KKU A;  2ZXI A;  2B7B A;  4RD4 A;  1CNF A;  5TY0 A;  4XOT A;  2BV3 A;  1OGI A;  2R9V A;  1WPC A;  1E79 A;  2C4U A;  2X6X A;  4WWV A;  3GIR A;  3U6K A;  3CPX A;  2P3M A;  4OP7 A;  1QVF B;  3W2F A;  4LBV A;  4HIZ A;  4G7X A;  3PVD A;  4WQM A;  3ASQ A;  4RD1 A;  1VLY A;  4B48 A;  1RQP A;  1QUE A;  2QTZ A;  2D3L A;  2OBS A;  1XB2 A;  4TMX A;  4YAO A;  3ZC3 A;  3G6E B;  2D9R A;  1M1K D;  3ONY A;  3BCF A;  1R5O A;  1H8H A;  4B3X A;  2WJY A;  4XNF A;  2C5B A;  4WZK A;  3LQE A;  4M0L A;  2KVO A;  3SJP A;  3CB4 A;  5IYP A;  5IYN A;  1QUF A;  1W0J A;  4IW3 B;  4RD3 A;  1K28 D;  5FA6 A;  3PEN A;  4TMT A;  3CP2 A;  2C78 A;  4AF6 A;  3CCJ B;  2PLF A;  3WND A;  3H94 A;  2QTL A;  2ZL5 A;  1PJ7 A;  5A89 A;  2XZL A;  5KW9 A;  1GJR A;  1ZM3 A;  1D2E A;  5TRD A;  3JQP A;  1N05 A;  2V7V A;  1KK3 A;  3E1Y E;  1WP6 A;  2V7W A;  3GVK A;  4FWT A;  5L46 A;  1KD1 D;  4ACA A;  1XFO A;  3VMF A;  5HZA A;  3WXM A;  3A8J A;  3CCM B;  2V31 A;  1Q7Y D;  3VNV A;  2VNI A;  4HE5 A;  4LBZ A;  1BQE A;  2VBV A;  1BX1 A;  2F43 A;  3SKB A;  2QE7 A;  1KTV A;  2HLD A;  1YHQ B;  5IYW A;  3U6B A;  3CCQ B;  3PA2 A;  1VQ8 B;  3T56 B;  4YAW A;  1N06 A;  3BC9 A;  3GQB A;  2BM0 A;  1OGJ A;  4G1B A;  4B3F X;  1VHE A;  3WY9 A;  3LVB A;  1N0U A;  2ZZG A;  3W2E A;  2YWF A;  2DYI A;  3OZU A;  3I55 B;  2X85 A;  3LNN A;  1KJZ A;  3CC2 B;  1K9M D;  3CP8 A;  2VZL A;  4ZCM A;  3QFT A;  1KK1 A;  3OJW A;  4TN1 A;  4L8J A;  3ZUG A;  2FX3 A;  1I18 A;  1ELO A;  1NDH A;  2XZP A;  2CC2 A;  3BH4 A;  1TUI A;  4II2 A;  1NB9 A;  4XMY A;  5FNZ A;  3CMM A;  4Y7C A;  5LMZ A;  3FPP A;  5E6T A;  4Z1M A;  4C43 A;  3CW2 A;  1VLO A;  4FK8 A;  2OBT A;  4N3N A;  4X0C A;  1GAQ A;  1BPL A;  3BCD A;  3P26 A;  3WNC A;  2GJP A;  3ONU A;  1SKQ A;  3HAG A;  4X7F A;  1QVG B;  4DK0 A;  1Y0R A;  4YHB A;  1VF7 A;  4Q7J B;  3RY8 A;  5FO0 A;  3B8H A;  3OW2 B;  3AGP A;  3VNU A;  2PIA A;  1IHM A;  1TLL A;  1JJ2 B;  4X06 A;  1GAW A;  4G7W A;  5EMN A;  3WQZ A;  4DQL A; 
#chains in the Genus database with same CATH homology
 4Z4S A;  2ZL6 A;  5BSX A;  3V7A A;  5F4J A;  4P3I A;  4P1V A;  4OP7 A;  4OOV A;  5BSY A;  4X05 A;  3PVD A;  3ASQ A;  4X07 A;  4QVA A;  2OBS A;  3ONY A;  3SLD A;  4RM0 A;  3LQ6 A;  5J35 A;  4WZK A;  4X7D A;  3LQE A;  3SJP A;  4QUZ A;  4WZL A;  5IYP A;  5IYN A;  4RDJ A;  4X7E A;  2ZL5 A;  3BY1 A;  4Z4R A;  5KW9 A;  4OOS A;  4P12 A;  5IYQ A;  4OPS A;  5F4O A;  4Z4Y A;  3PA1 A;  4WZE A;  5HZA A;  3ASP A;  3ASS A;  3BQJ A;  3Q6R A;  5IYR A;  3SKB A;  4QV2 A;  5IYW A;  3PA2 A;  4OPO A;  4RPD A;  5F4M A;  4Z4W A;  3R6J A;  4P26 A;  4QVJ A;  4Z4Z A;  3Q6Q A;  4OPV A;  3SLN A;  4Z4V A;  4RLZ A;  3AST A;  3ASR A;  4RDK A;  5HZB A;  4X7C A;  4WZT A;  4Z4T A;  4OOX A;  4RDL A;  5J3O A;  5E6T A;  4RPB A;  3Q39 A;  4ROX A;  3SEJ A;  2OBT A;  2ZL7 A;  4X0C A;  3D26 A;  3PUM A;  3ONU A;  2OBR A;  4X7F A;  3Q38 A;  4Z4U A;  3BY2 A;  3Q3A A;  3RY8 A;  3PUN A;  4P2N A;  1IHM A;  3R6K A;  4X06 A;  4P25 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...