3BY2A

Norwalk p polypeptide (228-523)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
287
structure length
280
Chain Sequence
b'PFTLPNLPLSSLSNSRAPLPISSMGISPDNVQSVQFQNGRCTLDGRLVGTTPVSLSHVAKIRGTSNGTVINLTELDGTPFHPFEGPAPIGFPDLGGCDWHINMTQFGHSQTQYDVDTTPDTFVPHLGSIQANGIGSGNYVGVLSWISPPSHPSGSQVDLWKIPNYGSTEATHLAPSVYPPGFGEVLVFFMSKMPGPGAYNLPCLLPQEYISHLASEQAPGEAALLHYVDPDTGRNLGEFKAYPDGFLTCVPNGAGPQQLPINGVFVFVSWVSRFYQLKPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 58 kd capsid protein
publication title Structural basis for the receptor binding specificity of Norwalk virus.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Viral protein
total genus 58
structure length 280
sequence length 287
ec nomenclature
pdb deposition date 2008-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 3by2A02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 3by2A01
3PUNA 4OOXA 5HZAA 4Z4WA 2OBSA 2OBRA 3V7AA 3Q3AA 4OOVA 4Z4SA 3ASSA 4OP7A 4P1VA 4X7CA 5F4OA 3R6KA 5IYNA 3PUMA 4Z4ZA 4RDLA 3D26A 2ZL5A 3R6JA 3SJPA 5IYPA 4X0CA 4X7FA 3Q38A 5IYQA 4P2NA 4WZLA 5F4JA 4QVJA 5F4MA 5BSYA 3RY8A 3LQ6A 5HZBA 3ONUA 5J35A 4Z4VA 4QV2A 5E6TA 4RLZA 3PVDA 4P3IA 4X07A 4QVAA 3Q39A 4OPOA 4WZKA 4WZEA 5IYRA 4RDJA 1IHMA 3ONYA 3PA2A 3BY2A 4P25A 4RPDA 4OOSA 3Q6RA 4WZTA 3SLNA 3SKBA 4RDKA 2OBTA 4ROXA 3LQEA 4RM0A 4OPSA 2ZL7A 5J3OA 3ASTA 4X06A 3SLDA 3BY1A 4X7DA 2ZL6A 4Z4UA 4RPBA 4QUZA 3ASPA 3BQJA 4OPVA 4X7EA 3SEJA 4Z4YA 4P26A 3Q6QA 3ASQA 4P12A 5BSXA 5IYWA 3PA1A 3ASRA 4Z4RA 4Z4TA 4X05A 5KW9A
chains in the Genus database with same CATH superfamily
2QA4B 1N07A 4OOXA 4K1XA 3VO2A 2PLFA 1VQ9B 3A3BA 3QFCA 1K73D 5A8AA 3WY9A 1NDHA 4BPRA 1TTTA 4XN3A 1JNYA 3QFRA 1E62A 4Z4SA 2CF4A 1G7RA 1PJ5A 2CC2A 2ZITA 3ASSA 5FL7A 1K8AD 1XB2A 5F4OA 5IYNA 3AVTA 1QUEA 2V4DA 4NCNA 4RDLA 3FJOA 2KVOA 5A89A 2BM1A 2XNDA 3A35A 2ZL5A 3D26A 1PJ7A 4XD7A 1YLOA 4X0CA 1TVCA 5FA6A 3ES9A 4G5GA 5IYQA 4LBZA 2D3NA 2WZPP 4TKOB 4P2NA 3QFSA 4FK8A 1FX0A 2RC5A 3W2EA 5LMZA 3OW2B 5F4JA 3A8IA 4PAAA 2Q6OA 1T6ZA 1S4MA 3DDYA 1YITB 4M1KA 2QGGA 3AVUA 3ONUA 1AIPA 1E43A 2X6XA 3OZUA 4Z4VA 5H59A 4QV2A 3H94A 1Y0RA 3BH4A 1J9ZA 3PVDA 2QTLA 2B7BA 3Q39A 4P3IA 4QVAA 4X07A 3JU4A 4WZKA 1KRHA 2HMAA 4RD0A 1N08A 4RDJA 5FNZA 3ZC3A 5FO1A 1W35A 1T5EA 3PA2A 2JJ1A 3GIRA 1I8DA 3QSYA 1G7CA 1SKYB 5GV7A 3AGQA 4G6IA 4Z1MA 1E1QA 4RCYA 4XL9A 1EFUA 3CESA 1WSRA 1XFOA 2OTLB 4P9SA 4RDKA 4P22A 1UD2A 3GVLA 3FKSA 4RD4A 1QGAA 4RM0A 1ZM4A 2ZL7A 3QE2A 2VNIA 1JA0A 3G71B 4B3XA 1EP3B 2OYNA 3BY1A 4F7DA 4CQJA 2E1RA 1H8EA 2ZTGA 3AVYA 2QN6A 5AN9A 4KKSA 1N06A 1Q9SA 2WSSA 1GO2A 1H8HA 2WR8A 2YWHA 5TV2A 3CMMA 3BQJA 1FRNA 1VLOA 1W87A 1UD6A 1FNBA 2BF4A 2GQFA 2R9VA 3G05A 4KKTA 4TMZA 1BX0A 5FO0A 4X7EA 4YAUA 2DIEA 4PC3A 4AF6A 4NBSA 3ZZUA 4N3NA 3WBKA 4N3GA 3LVBA 3V76A 1WOSA 3WQZA 4RD2A 4AF7A 2X3UA 5TR9A 4LBYA 1G7SA 1KK3A 5IYWA 2GJPA 4XLFA 4UZEA 1S72B 3PA1A 1VQ6B 4YHBA 2Q6KA 3ZUGA 1FDRA 1VJSA 3ASRA 3CCQB 2EFGA 4AC9A 3CC7B 1YJ9B 4PGOA 4XKVA 4X05A 2X0KA 3A3GA 4B44A 1COWA 1EFTA 1PKVA 1WP6A 3BNWA 3CC4B 2V31A 2VNHA 1YIJB 3VMFA 2WPDA 1KQSB 1KK0A 1R5NA 3CCJB 3U2QA 3LNNA 2VZLA 4LBVA 3G4SB 1VHOA 4II2A 2RC6A 1W34A 4NNJA 3OZWA 4ACAA 1QVFB 4ZCLA 4XLAA 4B48A 1XQBA 3MCAA 2QTZA 2BM0A 3ZBTA 1KJZA 1FNDA 3R6JA 3CCSB 4XR6A 3OEEA 4XOPA 3QFTA 4UAJA 1FNMA 1P4MA 1U2RA 1VLYA 4WZLA 4EH1A 1SKQA 3W5UA 2C4UA 2XNJA 5BSYA 2HCJB 3W2IA 3G6EB 4PABA 2V7WA 2FX3A 2QMUA 3CXCB 1V0FA 1H85A 5KNLA 1T6YA 4M0LA 2DEUA 4XN0A 4RLZA 2PE3A 4XLCA 5KSWB 2BGIA 3CCEB 2BPOA 2HDNB 2V7QA 2NPFA 4YALA 1FNCA 4B4DA 4II3A 3T51B 3LO8A 4L8JA 3ZPNA 1UD3A 5IYRA 3GQBA 1EXMA 1IHMA 3OP1A 1E3XA 3ONYA 2Q6LA 2ZZEA 3BY2A 3B82A 2OK8A 2XZOA 2WJYA 3OFNA 4GQNA 4G1VA 4ZGQB 4KKUA 2GREA 3VR6A 1VQ7B 4YXWA 2OBTA 4XONA 4LBWA 2C5HA 4XNFA 2ZZFA 3CD6B 2DYIA 1BMFA 1QFYA 1YHQB 1ZM2A 3A8JA 4TT3A 1JB9A 2VYQA 3ASTA 5THXA 1VF7A 1OB2A 4FXUA 2J7KA 1OHHA 1S0UA 2ZZGA 2HLDA 2C5BA 3AVXA 1NRKA 2P3MA 4RPBA 2V7XA 2E1BA 2DCUA 4QUZA 1W2BB 4DQLA 1BJKA 3CCUB 1EFRA 4RJLA 5B6IA 2W6IA 3I1FA 1WSVA 1CQXA 4FN5A 3SEJA 2W6JA 2ZXIA 4XQFA 2WZNA 1IB0A 4Z4YA 3CMEB 4Y9UA 1WDTA 3MMPA 3CPWB 4G7WA 3WBJA 4XLEA 4WQMA 1HZEA 2CRVA 1QGYA 3WNBA 1JJ2B 4HE6A 3KEWA 3AVWA 3JQPA 2M5SA 4YAWA 1BQEA 4G7XA 3GVKA 1WPCA 4PC1A 1QGZA 2YWFA 3PUNA 1YI2B 5HZAA 1DARA 4MYTA 1K28D 2PMDA 4M53A 4Y9RA 1DDIA 3ZZ0A 5GV8A 3VNUA 1PJ6A 2ZBVA 2VNKA 3PENA 3V7AA 1EP2B 3Q3AA 5CDFA 1Q81D 1B2RA 2PIAA 1WTHD 4OOVA 5DN6A 2LZJA 4XMYA 3W2GA 4DNTB 1VQ8B 3BC9A 3PUMA 1RQRA 4Z4ZA 3HAGA 1OB5A 3W2HA 3U6BA 2JDIA 2I1LA 3SJPA 5IYPA 1ZUNB 3ZIAA 2FVGA 3AGPA 3GSIA 4R71A 5L46A 1DDGA 4QVJA 4ACBA 1UD4A 1VQ4B 2DERA 3FPKA 5J35A 4RCZA 1OGIA 2AHOA 2OK7A 3OW7A 5E6TA 5HKKA 2XGJA 1Q86D 1XE1A 4IW3B 3CCLB 4FWTA 1MABA 1F60A 1GVHA 2BN4A 2V7UA 3ZBUA 4HE5A 4XM3A 1WORA 2YWEA 3ZZTA 3T53B 1N0UA 2BMWA 1HA3A 1KD1D 4YAFA 2V7TA 1TUIA 3W2FA 2XZLA 4E0FA 1GAQA 3CB4A 3B8HA 3E1YE 3OJXA 5JBQA 2C77A 3W5VA 2OTJB 1BLIA 1NB0A 2ZZQA 4WZTA 4YAOA 4B43A 2BGJA 3CCVB 1TLLA 4XKWA 3SJZA 3SKBA 1HVXA 3CC2B 1WOPA 2D9RA 4AVZA 4TMWA 3A1PA 2ZBUA 1QUFA 2ZXHA 4QFMA 5A88A 4OPSA 2ZTNA 5J3OA 5EMNA 3T56B 1I7PA 3CP8A 4X06A 3SLDA 1N05A 1I18A 3VNVA 3MHPA 2ZL6A 4Z4UA 2QDXA 1QVGB 4ZGNB 2VBUA 1GR1A 1NBMA 3ASPA 1KTVA 1A8PA 1N8RD 1W9XA 1UMKA 1QG0A 2CW5A 4OPVA 4ZCMA 3H9NA 1D8TA 2QEXB 4YELA 4DK0A 1M90D 2VBTA 3OEHA 4P26A 4DK1A 2GPJA 3P26A 2F1LA 1SM4A 2Z6BD 1R5OA 3OZVA 3Q6QA 4YEJA 3KL9A 3W5HA 4QHYA 4UZUA 1EFCA 4P12A 2CBXA 3JQRA 1KK2A 4Z4RA 1UD5A 5TRDA 2QE7A 4Z4TA 4DQKA 1D1NA 3BCDA 3OJWA 2X85A 1T6XA 4P3YA 5TY0A 2B5OA 3CCRB 2Q6IA 4MYUA 4P6YA 2DOGA 4HIZA 4XLHA 1FRQA 3VO1A 2VBSA 3OOCA 5DS0A 4Z4WA 2F4NA 4XORA 1KK1A 1AMOA 1VQOB 3CW2A 1VQKB 2OBSA 1B23P 3OPOA 3CMAB 2C2WA 2OBRA 4PC6A 1ZM9A 1Y0YA 4Y7CA 4JMQA 1EWYA 1F20A 1W0KA 4Q7JB 1OB0A 4OP7A 5IK2A 2VBVA 2EIXA 4P1VA 4X7CA 1BPLA 3R6KA 2R6HA 4TMVA 1RQPA 1MRZA 4B3GA 1E64A 1KMHA 2BSAA 1WOOA 1IJFA 1VQLB 1Q82D 2GJRA 1IJEA 2XOKA 3OAAA 2XEXA 3OE7A 3OKXA 3BCFA 3WNCA 4X7FA 3Q38A 1CNEA 1NJID 4ASUA 1W0JA 2JJ2A 1V0EA 1KZLA 1QFZA 1E3ZA 2JIZA 2VJJA 4M4SA 3WXMA 1QFJA 4H9GA 1BX1A 1WU8A 4RD3A 5F4MA 3RY8A 3LQ6A 5HZBA 1YJWB 1NB9A 3I55B 1N0VC 1YX2A 4TMTA 1VQPB 1H42A 2X8KA 2C4TA 4OPOA 3ISXA 4C0SA 4ZV4A 3GVJA 3E20A 1E1RA 3J81k 2GK6A 3CP2A 1V5VA 4WZEA 2DY1A 2BV3A 1ZM3A 2YWGA 2NV4A 2F1MA 4M2LA 1Q7YD 2WYRA 1QH0A 1GJRA 4P25A 4J0QA 4RPDA 5HXBA 1VQ5B 3A8KA 4OOSA 3Q6RA 4U9UA 1VQMB 3I56B 1OGJA 3FPPA 3CTAA 4TSFA 2JN9A 2X53S 1VHEA 3SLNA 2XNCA 3B78A 3CPXA 3NE5B 5DSZA 1E79A 2V7VA 1JA1A 1QX4A 3LQEA 4ROXA 1D2EA 1DG1G 1GAWA 2B7CA 2C78A 2CK3A 2X6YA 1G7TA 3CCMB 5FIUA 4DNRB 4C43A 1E63A 2F43A 4ZCIA 4TMXA 3CRZA 4X7DA 2CNDA 1VQNB 4WWVA 1KC8D 2D3LA 4LC0A 1EP1B 2D74A 4B3FX 1UD8A 4RD6A 3AVVA 1M1KD 2BVNA 4PC7A 3WYAA 1YJNB 2VNJA 4B47A 4RD1A 4UZFA 2DETA 3JQQA 2GK7A 2VJIA 1R5BA 4PC2A 1ELOA 1CNFA 4P6VF 3ASQA 2WJVA 4X8IA 3WNDA 5BSXA 2X6WA 3P27A 3U6KA 4XOTA 5H5JA 2GJKA 1K9MD 4TN1A 4G1BA 2XZPA 5KW9A
chains in the Genus database with same CATH topology
3PUNA 4OOXA 5HZAA 4Z4WA 2OBSA 2OBRA 3V7AA 3Q3AA 4OOVA 4Z4SA 3ASSA 4OP7A 4P1VA 4X7CA 5F4OA 3R6KA 5IYNA 3PUMA 4Z4ZA 4RDLA 3D26A 2ZL5A 3R6JA 3SJPA 5IYPA 4X0CA 4X7FA 3Q38A 5IYQA 4P2NA 4WZLA 5F4JA 4QVJA 5F4MA 5BSYA 3RY8A 3LQ6A 5HZBA 3ONUA 5J35A 4Z4VA 4QV2A 5E6TA 4RLZA 3PVDA 4P3IA 4X07A 4QVAA 3Q39A 4OPOA 4WZKA 4WZEA 5IYRA 4RDJA 1IHMA 3ONYA 3PA2A 3BY2A 4P25A 4RPDA 4OOSA 3Q6RA 4WZTA 3SLNA 3SKBA 4RDKA 2OBTA 4ROXA 3LQEA 4RM0A 4OPSA 2ZL7A 5J3OA 3ASTA 4X06A 3SLDA 3BY1A 4X7DA 2ZL6A 4Z4UA 4RPBA 4QUZA 3ASPA 3BQJA 4OPVA 4X7EA 3SEJA 4Z4YA 4P26A 3Q6QA 3ASQA 4P12A 5BSXA 5IYWA 3PA1A 3ASRA 4Z4RA 4Z4TA 4X05A 5KW9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PUN A;  4OOX A;  5HZA A;  4Z4W A;  2OBS A;  2OBR A;  3V7A A;  3Q3A A;  4OOV A;  4Z4S A;  3ASS A;  4OP7 A;  4P1V A;  4X7C A;  5F4O A;  3R6K A;  5IYN A;  3PUM A;  4Z4Z A;  4RDL A;  3D26 A;  2ZL5 A;  3R6J A;  3SJP A;  5IYP A;  4X0C A;  4X7F A;  3Q38 A;  5IYQ A;  4P2N A;  4WZL A;  5F4J A;  4QVJ A;  5F4M A;  5BSY A;  3RY8 A;  3LQ6 A;  5HZB A;  3ONU A;  5J35 A;  4Z4V A;  4QV2 A;  5E6T A;  4RLZ A;  3PVD A;  4P3I A;  4X07 A;  4QVA A;  3Q39 A;  4OPO A;  4WZK A;  4WZE A;  5IYR A;  4RDJ A;  1IHM A;  3ONY A;  3PA2 A;  3BY2 A;  4P25 A;  4RPD A;  4OOS A;  3Q6R A;  4WZT A;  3SLN A;  3SKB A;  4RDK A;  2OBT A;  4ROX A;  3LQE A;  4RM0 A;  4OPS A;  2ZL7 A;  5J3O A;  3AST A;  4X06 A;  3SLD A;  3BY1 A;  4X7D A;  2ZL6 A;  4Z4U A;  4RPB A;  4QUZ A;  3ASP A;  3BQJ A;  4OPV A;  4X7E A;  3SEJ A;  4Z4Y A;  4P26 A;  3Q6Q A;  3ASQ A;  4P12 A;  5BSX A;  5IYW A;  3PA1 A;  3ASR A;  4Z4R A;  4Z4T A;  4X05 A;  5KW9 A; 
#chains in the Genus database with same CATH topology
 2QA4 B;  1N07 A;  4OOX A;  4K1X A;  3VO2 A;  2PLF A;  1VQ9 B;  3A3B A;  3QFC A;  1K73 D;  5A8A A;  3WY9 A;  1NDH A;  4BPR A;  1TTT A;  4XN3 A;  1JNY A;  3QFR A;  1E62 A;  4Z4S A;  2CF4 A;  1G7R A;  1PJ5 A;  2CC2 A;  2ZIT A;  3ASS A;  5FL7 A;  1K8A D;  1XB2 A;  5F4O A;  5IYN A;  3AVT A;  1QUE A;  2V4D A;  4NCN A;  4RDL A;  3FJO A;  2KVO A;  5A89 A;  2BM1 A;  2XND A;  3A35 A;  2ZL5 A;  3D26 A;  1PJ7 A;  4XD7 A;  1YLO A;  4X0C A;  1TVC A;  5FA6 A;  3ES9 A;  4G5G A;  5IYQ A;  4LBZ A;  2D3N A;  2WZP P;  4TKO B;  4P2N A;  3QFS A;  4FK8 A;  1FX0 A;  2RC5 A;  3W2E A;  5LMZ A;  3OW2 B;  5F4J A;  3A8I A;  4PAA A;  2Q6O A;  1T6Z A;  1S4M A;  3DDY A;  1YIT B;  4M1K A;  2QGG A;  3AVU A;  3ONU A;  1AIP A;  1E43 A;  2X6X A;  3OZU A;  4Z4V A;  5H59 A;  4QV2 A;  3H94 A;  1Y0R A;  3BH4 A;  1J9Z A;  3PVD A;  2QTL A;  2B7B A;  3Q39 A;  4P3I A;  4QVA A;  4X07 A;  3JU4 A;  4WZK A;  1KRH A;  2HMA A;  4RD0 A;  1N08 A;  4RDJ A;  5FNZ A;  3ZC3 A;  5FO1 A;  1W35 A;  1T5E A;  3PA2 A;  2JJ1 A;  3GIR A;  1I8D A;  3QSY A;  1G7C A;  1SKY B;  5GV7 A;  3AGQ A;  4G6I A;  4Z1M A;  1E1Q A;  4RCY A;  4XL9 A;  1EFU A;  3CES A;  1WSR A;  1XFO A;  2OTL B;  4P9S A;  4RDK A;  4P22 A;  1UD2 A;  3GVL A;  3FKS A;  4RD4 A;  1QGA A;  4RM0 A;  1ZM4 A;  2ZL7 A;  3QE2 A;  2VNI A;  1JA0 A;  3G71 B;  4B3X A;  1EP3 B;  2OYN A;  3BY1 A;  4F7D A;  4CQJ A;  2E1R A;  1H8E A;  2ZTG A;  3AVY A;  2QN6 A;  5AN9 A;  4KKS A;  1N06 A;  1Q9S A;  2WSS A;  1GO2 A;  1H8H A;  2WR8 A;  2YWH A;  5TV2 A;  3CMM A;  3BQJ A;  1FRN A;  1VLO A;  1W87 A;  1UD6 A;  1FNB A;  2BF4 A;  2GQF A;  2R9V A;  3G05 A;  4KKT A;  4TMZ A;  1BX0 A;  5FO0 A;  4X7E A;  4YAU A;  2DIE A;  4PC3 A;  4AF6 A;  4NBS A;  3ZZU A;  4N3N A;  3WBK A;  4N3G A;  3LVB A;  3V76 A;  1WOS A;  3WQZ A;  4RD2 A;  4AF7 A;  2X3U A;  5TR9 A;  4LBY A;  1G7S A;  1KK3 A;  5IYW A;  2GJP A;  4XLF A;  4UZE A;  1S72 B;  3PA1 A;  1VQ6 B;  4YHB A;  2Q6K A;  3ZUG A;  1FDR A;  1VJS A;  3ASR A;  3CCQ B;  2EFG A;  4AC9 A;  3CC7 B;  1YJ9 B;  4PGO A;  4XKV A;  4X05 A;  2X0K A;  3A3G A;  4B44 A;  1COW A;  1EFT A;  1PKV A;  1WP6 A;  3BNW A;  3CC4 B;  2V31 A;  2VNH A;  1YIJ B;  3VMF A;  2WPD A;  1KQS B;  1KK0 A;  1R5N A;  3CCJ B;  3U2Q A;  3LNN A;  2VZL A;  4LBV A;  3G4S B;  1VHO A;  4II2 A;  2RC6 A;  1W34 A;  4NNJ A;  3OZW A;  4ACA A;  1QVF B;  4ZCL A;  4XLA A;  4B48 A;  1XQB A;  3MCA A;  2QTZ A;  2BM0 A;  3ZBT A;  1KJZ A;  1FND A;  3R6J A;  3CCS B;  4XR6 A;  3OEE A;  4XOP A;  3QFT A;  4UAJ A;  1FNM A;  1P4M A;  1U2R A;  1VLY A;  4WZL A;  4EH1 A;  1SKQ A;  3W5U A;  2C4U A;  2XNJ A;  5BSY A;  2HCJ B;  3W2I A;  3G6E B;  4PAB A;  2V7W A;  2FX3 A;  2QMU A;  3CXC B;  1V0F A;  1H85 A;  5KNL A;  1T6Y A;  4M0L A;  2DEU A;  4XN0 A;  4RLZ A;  2PE3 A;  4XLC A;  5KSW B;  2BGI A;  3CCE B;  2BPO A;  2HDN B;  2V7Q A;  2NPF A;  4YAL A;  1FNC A;  4B4D A;  4II3 A;  3T51 B;  3LO8 A;  4L8J A;  3ZPN A;  1UD3 A;  5IYR A;  3GQB A;  1EXM A;  1IHM A;  3OP1 A;  1E3X A;  3ONY A;  2Q6L A;  2ZZE A;  3BY2 A;  3B82 A;  2OK8 A;  2XZO A;  2WJY A;  3OFN A;  4GQN A;  4G1V A;  4ZGQ B;  4KKU A;  2GRE A;  3VR6 A;  1VQ7 B;  4YXW A;  2OBT A;  4XON A;  4LBW A;  2C5H A;  4XNF A;  2ZZF A;  3CD6 B;  2DYI A;  1BMF A;  1QFY A;  1YHQ B;  1ZM2 A;  3A8J A;  4TT3 A;  1JB9 A;  2VYQ A;  3AST A;  5THX A;  1VF7 A;  1OB2 A;  4FXU A;  2J7K A;  1OHH A;  1S0U A;  2ZZG A;  2HLD A;  2C5B A;  3AVX A;  1NRK A;  2P3M A;  4RPB A;  2V7X A;  2E1B A;  2DCU A;  4QUZ A;  1W2B B;  4DQL A;  1BJK A;  3CCU B;  1EFR A;  4RJL A;  5B6I A;  2W6I A;  3I1F A;  1WSV A;  1CQX A;  4FN5 A;  3SEJ A;  2W6J A;  2ZXI A;  4XQF A;  2WZN A;  1IB0 A;  4Z4Y A;  3CME B;  4Y9U A;  1WDT A;  3MMP A;  3CPW B;  4G7W A;  3WBJ A;  4XLE A;  4WQM A;  1HZE A;  2CRV A;  1QGY A;  3WNB A;  1JJ2 B;  4HE6 A;  3KEW A;  3AVW A;  3JQP A;  2M5S A;  4YAW A;  1BQE A;  4G7X A;  3GVK A;  1WPC A;  4PC1 A;  1QGZ A;  2YWF A;  3PUN A;  1YI2 B;  5HZA A;  1DAR A;  4MYT A;  1K28 D;  2PMD A;  4M53 A;  4Y9R A;  1DDI A;  3ZZ0 A;  5GV8 A;  3VNU A;  1PJ6 A;  2ZBV A;  2VNK A;  3PEN A;  3V7A A;  1EP2 B;  3Q3A A;  5CDF A;  1Q81 D;  1B2R A;  2PIA A;  1WTH D;  4OOV A;  5DN6 A;  2LZJ A;  4XMY A;  3W2G A;  4DNT B;  1VQ8 B;  3BC9 A;  3PUM A;  1RQR A;  4Z4Z A;  3HAG A;  1OB5 A;  3W2H A;  3U6B A;  2JDI A;  2I1L A;  3SJP A;  5IYP A;  1ZUN B;  3ZIA A;  2FVG A;  3AGP A;  3GSI A;  4R71 A;  5L46 A;  1DDG A;  4QVJ A;  4ACB A;  1UD4 A;  1VQ4 B;  2DER A;  3FPK A;  5J35 A;  4RCZ A;  1OGI A;  2AHO A;  2OK7 A;  3OW7 A;  5E6T A;  5HKK A;  2XGJ A;  1Q86 D;  1XE1 A;  4IW3 B;  3CCL B;  4FWT A;  1MAB A;  1F60 A;  1GVH A;  2BN4 A;  2V7U A;  3ZBU A;  4HE5 A;  4XM3 A;  1WOR A;  2YWE A;  3ZZT A;  3T53 B;  1N0U A;  2BMW A;  1HA3 A;  1KD1 D;  4YAF A;  2V7T A;  1TUI A;  3W2F A;  2XZL A;  4E0F A;  1GAQ A;  3CB4 A;  3B8H A;  3E1Y E;  3OJX A;  5JBQ A;  2C77 A;  3W5V A;  2OTJ B;  1BLI A;  1NB0 A;  2ZZQ A;  4WZT A;  4YAO A;  4B43 A;  2BGJ A;  3CCV B;  1TLL A;  4XKW A;  3SJZ A;  3SKB A;  1HVX A;  3CC2 B;  1WOP A;  2D9R A;  4AVZ A;  4TMW A;  3A1P A;  2ZBU A;  1QUF A;  2ZXH A;  4QFM A;  5A88 A;  4OPS A;  2ZTN A;  5J3O A;  5EMN A;  3T56 B;  1I7P A;  3CP8 A;  4X06 A;  3SLD A;  1N05 A;  1I18 A;  3VNV A;  3MHP A;  2ZL6 A;  4Z4U A;  2QDX A;  1QVG B;  4ZGN B;  2VBU A;  1GR1 A;  1NBM A;  3ASP A;  1KTV A;  1A8P A;  1N8R D;  1W9X A;  1UMK A;  1QG0 A;  2CW5 A;  4OPV A;  4ZCM A;  3H9N A;  1D8T A;  2QEX B;  4YEL A;  4DK0 A;  1M90 D;  2VBT A;  3OEH A;  4P26 A;  4DK1 A;  2GPJ A;  3P26 A;  2F1L A;  1SM4 A;  2Z6B D;  1R5O A;  3OZV A;  3Q6Q A;  4YEJ A;  3KL9 A;  3W5H A;  4QHY A;  4UZU A;  1EFC A;  4P12 A;  2CBX A;  3JQR A;  1KK2 A;  4Z4R A;  1UD5 A;  5TRD A;  2QE7 A;  4Z4T A;  4DQK A;  1D1N A;  3BCD A;  3OJW A;  2X85 A;  1T6X A;  4P3Y A;  5TY0 A;  2B5O A;  3CCR B;  2Q6I A;  4MYU A;  4P6Y A;  2DOG A;  4HIZ A;  4XLH A;  1FRQ A;  3VO1 A;  2VBS A;  3OOC A;  5DS0 A;  4Z4W A;  2F4N A;  4XOR A;  1KK1 A;  1AMO A;  1VQO B;  3CW2 A;  1VQK B;  2OBS A;  1B23 P;  3OPO A;  3CMA B;  2C2W A;  2OBR A;  4PC6 A;  1ZM9 A;  1Y0Y A;  4Y7C A;  4JMQ A;  1EWY A;  1F20 A;  1W0K A;  4Q7J B;  1OB0 A;  4OP7 A;  5IK2 A;  2VBV A;  2EIX A;  4P1V A;  4X7C A;  1BPL A;  3R6K A;  2R6H A;  4TMV A;  1RQP A;  1MRZ A;  4B3G A;  1E64 A;  1KMH A;  2BSA A;  1WOO A;  1IJF A;  1VQL B;  1Q82 D;  2GJR A;  1IJE A;  2XOK A;  3OAA A;  2XEX A;  3OE7 A;  3OKX A;  3BCF A;  3WNC A;  4X7F A;  3Q38 A;  1CNE A;  1NJI D;  4ASU A;  1W0J A;  2JJ2 A;  1V0E A;  1KZL A;  1QFZ A;  1E3Z A;  2JIZ A;  2VJJ A;  4M4S A;  3WXM A;  1QFJ A;  4H9G A;  1BX1 A;  1WU8 A;  4RD3 A;  5F4M A;  3RY8 A;  3LQ6 A;  5HZB A;  1YJW B;  1NB9 A;  3I55 B;  1N0V C;  1YX2 A;  4TMT A;  1VQP B;  1H42 A;  2X8K A;  2C4T A;  4OPO A;  3ISX A;  4C0S A;  4ZV4 A;  3GVJ A;  3E20 A;  1E1R A;  3J81 k;  2GK6 A;  3CP2 A;  1V5V A;  4WZE A;  2DY1 A;  2BV3 A;  1ZM3 A;  2YWG A;  2NV4 A;  2F1M A;  4M2L A;  1Q7Y D;  2WYR A;  1QH0 A;  1GJR A;  4P25 A;  4J0Q A;  4RPD A;  5HXB A;  1VQ5 B;  3A8K A;  4OOS A;  3Q6R A;  4U9U A;  1VQM B;  3I56 B;  1OGJ A;  3FPP A;  3CTA A;  4TSF A;  2JN9 A;  2X53 S;  1VHE A;  3SLN A;  2XNC A;  3B78 A;  3CPX A;  3NE5 B;  5DSZ A;  1E79 A;  2V7V A;  1JA1 A;  1QX4 A;  3LQE A;  4ROX A;  1D2E A;  1DG1 G;  1GAW A;  2B7C A;  2C78 A;  2CK3 A;  2X6Y A;  1G7T A;  3CCM B;  5FIU A;  4DNR B;  4C43 A;  1E63 A;  2F43 A;  4ZCI A;  4TMX A;  3CRZ A;  4X7D A;  2CND A;  1VQN B;  4WWV A;  1KC8 D;  2D3L A;  4LC0 A;  1EP1 B;  2D74 A;  4B3F X;  1UD8 A;  4RD6 A;  3AVV A;  1M1K D;  2BVN A;  4PC7 A;  3WYA A;  1YJN B;  2VNJ A;  4B47 A;  4RD1 A;  4UZF A;  2DET A;  3JQQ A;  2GK7 A;  2VJI A;  1R5B A;  4PC2 A;  1ELO A;  1CNF A;  4P6V F;  3ASQ A;  2WJV A;  4X8I A;  3WND A;  5BSX A;  2X6W A;  3P27 A;  3U6K A;  4XOT A;  5H5J A;  2GJK A;  1K9M D;  4TN1 A;  4G1B A;  2XZP A;  5KW9 A; 
#chains in the Genus database with same CATH homology
 3PUN A;  4OOX A;  5HZA A;  4Z4W A;  2OBS A;  2OBR A;  3V7A A;  3Q3A A;  4OOV A;  4Z4S A;  3ASS A;  4OP7 A;  4P1V A;  4X7C A;  5F4O A;  3R6K A;  5IYN A;  3PUM A;  4Z4Z A;  4RDL A;  3D26 A;  2ZL5 A;  3R6J A;  3SJP A;  5IYP A;  4X0C A;  4X7F A;  3Q38 A;  5IYQ A;  4P2N A;  4WZL A;  5F4J A;  4QVJ A;  5F4M A;  5BSY A;  3RY8 A;  3LQ6 A;  5HZB A;  3ONU A;  5J35 A;  4Z4V A;  4QV2 A;  5E6T A;  4RLZ A;  3PVD A;  4P3I A;  4X07 A;  4QVA A;  3Q39 A;  4OPO A;  4WZK A;  4WZE A;  5IYR A;  4RDJ A;  1IHM A;  3ONY A;  3PA2 A;  3BY2 A;  4P25 A;  4RPD A;  4OOS A;  3Q6R A;  4WZT A;  3SLN A;  3SKB A;  4RDK A;  2OBT A;  4ROX A;  3LQE A;  4RM0 A;  4OPS A;  2ZL7 A;  5J3O A;  3AST A;  4X06 A;  3SLD A;  3BY1 A;  4X7D A;  2ZL6 A;  4Z4U A;  4RPB A;  4QUZ A;  3ASP A;  3BQJ A;  4OPV A;  4X7E A;  3SEJ A;  4Z4Y A;  4P26 A;  3Q6Q A;  3ASQ A;  4P12 A;  5BSX A;  5IYW A;  3PA1 A;  3ASR A;  4Z4R A;  4Z4T A;  4X05 A;  5KW9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...