3BY2A

Norwalk p polypeptide (228-523)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
287
structure length
280
Chain Sequence
PFTLPNLPLSSLSNSRAPLPISSMGISPDNVQSVQFQNGRCTLDGRLVGTTPVSLSHVAKIRGTSNGTVINLTELDGTPFHPFEGPAPIGFPDLGGCDWHINMTQFGHSQTQYDVDTTPDTFVPHLGSIQANGIGSGNYVGVLSWISPPSHPSGSQVDLWKIPNYGSTEATHLAPSVYPPGFGEVLVFFMSKMPGPGAYNLPCLLPQEYISHLASEQAPGEAALLHYVDPDTGRNLGEFKAYPDGFLTCVPNGAGPQQLPINGVFVFVSWVSRFYQLKPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 58 kd capsid protein
publication title Structural basis for the receptor binding specificity of Norwalk virus.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Viral protein
total genus 58
structure length 280
sequence length 287
ec nomenclature
pdb deposition date 2008-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 3by2A02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 3by2A01
3ONYA 3Q3AA 4P2NA 5F4JA 4QVJA 4P1VA 5E6TA 4RPDA 3BY1A 3ONUA 5BSXA 5IYPA 1IHMA 3D26A 4OOSA 4OOXA 4Z4WA 4RDKA 4WZEA 4WZLA 4OP7A 4RDLA 3R6JA 5F4OA 3PUNA 2OBRA 4WZTA 4QUZA 3V7AA 4X7EA 3Q39A 4RM0A 2ZL6A 3R6KA 5KW9A 4RLZA 4OPVA 3RY8A 3LQEA 2OBTA 4X7DA 3PVDA 3ASQA 5J35A 3BQJA 3Q6QA 3ASTA 3SJPA 4P25A 2ZL5A 3PA1A 4P12A 5HZAA 3SLNA 4Z4SA 4X06A 3ASRA 4RPBA 4X7FA 3PA2A 4QVAA 4RDJA 4Z4VA 4WZKA 4OOVA 5J3OA 4X05A 3SLDA 4OPOA 5IYNA 3LQ6A 3SEJA 4Z4TA 4X07A 4X0CA 2ZL7A 4P3IA 4OPSA 4Z4RA 4Z4ZA 4QV2A 5F4MA 3Q38A 4Z4YA 4Z4UA 5IYQA 4P26A 5IYRA 3ASPA 5HZBA 4ROXA 5IYWA 3BY2A 3ASSA 2OBSA 4X7CA 3SKBA 3PUMA 3Q6RA 5BSYA
chains in the Genus database with same CATH superfamily
3CRZA 4RCYA 2Q6LA 3ONYA 3E20A 1ZM4A 3CXCB 1VQOB 2YWHA 4P1VA 5E6TA 3WXMA 1XFOA 1OB5A 3A1PA 1VQ6B 4NBSA 3ONUA 2FVGA 1YI2B 3CCRB 4XN0A 1DDIA 2B7BA 4TKOB 1IHMA 4M0LA 5TR9A 3V76A 1CNEA 2QDXA 3OFNA 3W5HA 4UZEA 4PAAA 2JN9A 4OOSA 1VQ5B 3AVYA 4UZFA 1IB0A 4X8IA 1SKYB 3HAGA 3CCSB 2BSAA 1EFTA 2BM0A 5TY0A 3PUNA 1OGJA 3G71B 1H85A 4XN3A 3A35A 4X7EA 1E3XA 3LNNA 4RM0A 3R6KA 2B5OA 4GQNA 3CCEB 3GQBA 1RQPA 1T6YA 1VQNB 5A8AA 2NV4A 3A3GA 1V0EA 4K1XA 2WZPP 4WQMA 2E1RA 1KD1D 2CRVA 3ZC3A 2X6XA 2I1LA 2OBTA 2Z6BD 4LBVA 1BJKA 4XD7A 3E1YE 2X53S 4PC3A 4Y9UA 3CMEB 2YWFA 2R6HA 3OP1A 2QMUA 1D8TA 1EWYA 2WJYA 3OJXA 3SLNA 5B6IA 1N07A 1IJEA 1H8HA 4KKSA 5GV8A 4Z4SA 1VQ4B 2YWEA 5FA6A 2BMWA 1WPCA 4XM3A 2CBXA 1OGIA 1Y0YA 2CF4A 2WPDA 4YAWA 1WOPA 2V4DA 2QA4B 2EIXA 1WTHD 2V7XA 1M90D 2QGGA 3ZBUA 4RDJA 3OEEA 4WZKA 1OB2A 3AVUA 1JA1A 4PC7A 1KMHA 4B3GA 5CDFA 3CCMB 3OZWA 3SLDA 2XGJA 4OPOA 3SJZA 4XMYA 3U6KA 4N3GA 2BN4A 1QFYA 1W34A 4L8JA 1VQLB 1NB9A 3H94A 2Q6IA 4G5GA 4Z4TA 4AF6A 5H59A 3I55B 2VBUA 2ZL7A 1T6ZA 4TT3A 3J81k 1PJ7A 4TMXA 4QV2A 5F4MA 1FNBA 3G4SB 3Q38A 4TMWA 3GSIA 5DS0A 4M1KA 2JIZA 4G1BA 4Z4UA 4J0QA 5FO0A 2GPJA 4M4SA 5KSWB 1K73D 2QTLA 3ASPA 2GK6A 3CMMA 1V0FA 4XQFA 5KNLA 4ASUA 1E3ZA 4TMZA 1FRQA 5IYWA 1K9MD 2PLFA 3W2EA 1KQSB 1KRHA 1VQ8B 4DQKA 4YXWA 3SKBA 1KJZA 1AMOA 4G6IA 4C0SA 4YAUA 1QUEA 1ZM2A 1DARA 1QX4A 1N06A 1E1RA 1QG0A 2C5BA 3BCFA 3OPOA 1MABA 3ES9A 4KKUA 4P2NA 5EMNA 1M1KD 3GIRA 2GJPA 2ZITA 2F1LA 2XZPA 3NE5B 4QVJA 5F4JA 3ZUGA 4XLHA 2BVNA 3BY1A 4Y7CA 1VQ7B 1GR1A 5DN6A 2BGIA 1K28D 3WQZA 1IJFA 4YALA 2CNDA 1MRZA 3ZZUA 3OJWA 5IYPA 2XNDA 5JBQA 1E62A 1UMKA 1P4MA 2ZTGA 3CB4A 1W2BB 4B4DA 1D1NA 1WOSA 4PC1A 4FK8A 1VHOA 2CK3A 2D3LA 4LBYA 4OOXA 4RCZA 3WYAA 4Z4WA 1OHHA 4RDKA 1FDRA 2ZZQA 4WZEA 2BM1A 2DIEA 4ACAA 4QHYA 2OTLB 5TV2A 3OKXA 1TTTA 2BGJA 1GAWA 2VNIA 2OBRA 1H8EA 4WZTA 4XL9A 4QUZA 2GJKA 1XE1A 1N08A 1GJRA 1JNYA 1WU8A 2F4NA 4DNRB 4ZGNB 1NJID 2HLDA 3CCJB 5KW9A 2D9RA 4LBWA 2BPOA 1EFCA 3AVTA 3OZUA 3RY8A 2DOGA 2V7UA 3G6EB 2C77A 2QTZA 1FNCA 1BQEA 2X85A 2RC5A 2P3MA 4RD1A 4RD0A 2C78A 1XQBA 2HMAA 2VNJA 3ASQA 2DERA 1QUFA 1GVHA 1PJ6A 3BQJA 4CQJA 3ASTA 3CP2A 3SJPA 3LVBA 3ZZTA 1VQKB 4KKTA 1BPLA 4HE6A 2ZXIA 3QE2A 4F7DA 4X06A 1VHEA 3ASRA 2F1MA 3CCVB 2GK7A 3CD6B 3QSYA 3CMAB 1WDTA 1COWA 1UD6A 3OZVA 2LZJA 4QVAA 1VQPB 1G7CA 5HXBA 3W2GA 4DK0A 3GVLA 5J3OA 4G7XA 1OB0A 1A8PA 2DY1A 2JDIA 2XZOA 2XOKA 4XKWA 3WNBA 2X8KA 2ZTNA 4M2LA 4UZUA 1YLOA 3LQ6A 5THXA 1R5NA 4X07A 4Y9RA 2W6JA 4Z4RA 3LO8A 1W0JA 1E64A 1TLLA 3BH4A 5FNZA 1VQ9B 1XB2A 5BSYA 5A88A 2DCUA 4WWVA 4Z4YA 5IYQA 1E79A 2ZZGA 1PJ5A 2GJRA 3CC2B 3BCDA 2HCJB 4MYTA 1KK1A 1G7SA 3MMPA 4MYUA 3MCAA 1VJSA 2C2WA 1BX0A 1WP6A 2WYRA 3PUMA 4YAFA 1I8DA 4RD6A 3Q6RA 2OK7A 3ZPNA 2XNCA 2XEXA 3AVVA 1KTVA 3GVKA 4XONA 3Q3AA 3W2HA 3VNVA 1VLYA 1YHQB 2KVOA 4BPRA 3VMFA 2RC6A 1YX2A 2ZBUA 4HIZA 4XLAA 1N0UA 5IK2A 1AIPA 3OAAA 3VO2A 4FXUA 1KZLA 3D26A 3WBJA 5FIUA 4DQLA 5TRDA 1E63A 1W87A 4N3NA 1ZUNB 3CC4B 3VO1A 2NPFA 2X6WA 4WZLA 2GREA 4RDLA 3R6JA 4TMTA 3JQPA 3FJOA 2V7QA 4Z1MA 3V7AA 2W6IA 1WSVA 4HE5A 4ZCLA 3Q39A 3CCLB 1U2RA 2ZL6A 1QGYA 3QFTA 1YITB 4IW3B 2VJJA 4YELA 4RJLA 4RLZA 3VR6A 1KC8D 2YWGA 2QN6A 3FPPA 1FRNA 4R71A 2E1BA 3W2IA 1VF7A 1E1QA 1W9XA 2M5SA 4YEJA 1YJWB 3PVDA 2VNKA 2BV3A 4FN5A 3CCUB 3W5VA 4RD2A 1Q86D 3JU4A 4DK1A 1V5VA 2ZL5A 3PA1A 2VJIA 4TMVA 1FX0A 2OYNA 1VLOA 2PMDA 3A8IA 1UD8A 1QGZA 3A8JA 4B48A 5L46A 3WY9A 4II3A 1NDHA 1D2EA 1BX1A 1SM4A 4RPBA 2DETA 1UD5A 3PA2A 3ZBTA 4XNFA 3BNWA 2QEXB 3CW2A 5DSZA 1TUIA 4Z4VA 1T6XA 2V7TA 3BC9A 4B43A 3KL9A 4C43A 1R5OA 3JQQA 1UD3A 3A3BA 4X05A 3CPXA 5H5JA 3OEHA 1CQXA 1DDGA 3MHPA 4XOPA 2DEUA 3WNCA 4LC0A 2PE3A 1ZM9A 2V7WA 3SEJA 4XLEA 2Q6OA 4X0CA 4ZGQB 1QFJA 4U9UA 3AGQA 4E0FA 3A8KA 3CP8A 4Z4ZA 4P3YA 1PKVA 3ZZ0A 4P22A 1S0UA 1WSRA 2VNHA 5AN9A 1HZEA 1YJ9B 2D3NA 1YIJB 2R9VA 4II2A 2C4TA 3OOCA 4AC9A 4B44A 5HZBA 2EFGA 1GAQA 1ELOA 2WZNA 3BY2A 3CCQB 3JQRA 4H9GA 2OBSA 4Q7JB 5LMZA 4B3XA 1BLIA 1NB0A 3ISXA 2XZLA 4TN1A 4XKVA 1W35A 1I7PA 1ZM3A 4NCNA 1JA0A 3H9NA 3U2QA 3QFRA 1I18A 2VBTA 4PABA 1EFUA 1QFZA 4ZCIA 3T51B 2JJ2A 4RPDA 1F60A 4DNTB 4ZCMA 5BSXA 3G05A 2BF4A 1K8AD 3QFSA 3VNUA 4P6VF 1QGAA 1S72B 1RQRA 1FNDA 1G7TA 2WR8A 1HVXA 1KK0A 3W5UA 2FX3A 2X0KA 4AF7A 2VYQA 5GV7A 4PC2A 2ZZEA 3KEWA 1N05A 2HDNB 5FL7A 2VZLA 5HKKA 2DYIA 4OP7A 1VQMB 2X3UA 2V7VA 2Q6KA 3FKSA 5F4OA 1DG1G 3QFCA 4EH1A 1NRKA 4FWTA 1E43A 1EP1B 5FO1A 3P27A 2OTJB 4P6YA 1F20A 2V31A 3FPKA 2D74A 1J9ZA 1S4MA 3GVJA 2X6YA 2VBSA 3OE7A 4OPVA 3AVXA 3LQEA 2C4UA 2J7KA 1JB9A 1EFRA 1UD4A 1B23P 1Q82D 4X7DA 4XOTA 3W2FA 1Q7YD 3B82A 1T5EA 2JJ1A 5J35A 3Q6QA 4P25A 4RD3A 1FNMA 4UAJA 4P12A 1N0VC 1WORA 2WSSA 5HZAA 3CTAA 1G7RA 4AVZA 1EXMA 1EP2B 1KK3A 3CESA 4YAOA 1Y0RA 1NBMA 2OK8A 4PGOA 4X7FA 4B47A 3AVWA 1WOOA 1CNFA 3PENA 4M53A 4XR6A 3U6BA 3OW2B 3I56B 3T53B 1TVCA 3AGPA 1W0KA 2WJVA 4OOVA 3B8HA 1GO2A 1B2RA 1R5BA 2ZBVA 3CPWB 4G1VA 1HA3A 2F43A 1QVFB 1QVGB 3ZIAA 4G7WA 5IYNA 4NNJA 3CC7B 2CW5A 3I1FA 4XLCA 2QE7A 1QH0A 2AHOA 4ACBA 1BMFA 4P3IA 1YJNB 4OPSA 2PIAA 2XNJA 4B3FX 1JJ2B 1SKQA 4QFMA 3WBKA 2C5HA 4LBZA 4JMQA 2GQFA 4P26A 1UD2A 3B78A 5IYRA 4RD4A 3T56B 1Q9SA 4ZV4A 1KK2A 1Q81D 2B7CA 4P9SA 2CC2A 3P26A 4ROXA 1N8RD 3WNDA 3DDYA 2ZXHA 3ASSA 4XORA 3OW7A 5A89A 4XLFA 4X7CA 4PC6A 1EP3B 2ZZFA 1H42A 4YHBA 2VBVA 4TSFA
chains in the Genus database with same CATH topology
3ONYA 3Q3AA 4P2NA 5F4JA 4QVJA 4P1VA 5E6TA 4RPDA 3BY1A 3ONUA 5BSXA 5IYPA 1IHMA 3D26A 4OOSA 4OOXA 4Z4WA 4RDKA 4WZEA 4WZLA 4OP7A 4RDLA 3R6JA 5F4OA 3PUNA 2OBRA 4WZTA 4QUZA 3V7AA 4X7EA 3Q39A 4RM0A 2ZL6A 3R6KA 5KW9A 4RLZA 4OPVA 3RY8A 3LQEA 2OBTA 4X7DA 3PVDA 3ASQA 5J35A 3BQJA 3Q6QA 3ASTA 3SJPA 4P25A 2ZL5A 3PA1A 4P12A 5HZAA 3SLNA 4Z4SA 4X06A 3ASRA 4RPBA 4X7FA 3PA2A 4QVAA 4RDJA 4Z4VA 4WZKA 4OOVA 5J3OA 4X05A 3SLDA 4OPOA 5IYNA 3LQ6A 3SEJA 4Z4TA 4X07A 4X0CA 2ZL7A 4P3IA 4OPSA 4Z4RA 4Z4ZA 4QV2A 5F4MA 3Q38A 4Z4YA 4Z4UA 5IYQA 4P26A 5IYRA 3ASPA 5HZBA 4ROXA 5IYWA 3BY2A 3ASSA 2OBSA 4X7CA 3SKBA 3PUMA 3Q6RA 5BSYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ONY A;  3Q3A A;  4P2N A;  5F4J A;  4QVJ A;  4P1V A;  5E6T A;  4RPD A;  3BY1 A;  3ONU A;  5BSX A;  5IYP A;  1IHM A;  3D26 A;  4OOS A;  4OOX A;  4Z4W A;  4RDK A;  4WZE A;  4WZL A;  4OP7 A;  4RDL A;  3R6J A;  5F4O A;  3PUN A;  2OBR A;  4WZT A;  4QUZ A;  3V7A A;  4X7E A;  3Q39 A;  4RM0 A;  2ZL6 A;  3R6K A;  5KW9 A;  4RLZ A;  4OPV A;  3RY8 A;  3LQE A;  2OBT A;  4X7D A;  3PVD A;  3ASQ A;  5J35 A;  3BQJ A;  3Q6Q A;  3AST A;  3SJP A;  4P25 A;  2ZL5 A;  3PA1 A;  4P12 A;  5HZA A;  3SLN A;  4Z4S A;  4X06 A;  3ASR A;  4RPB A;  4X7F A;  3PA2 A;  4QVA A;  4RDJ A;  4Z4V A;  4WZK A;  4OOV A;  5J3O A;  4X05 A;  3SLD A;  4OPO A;  5IYN A;  3LQ6 A;  3SEJ A;  4Z4T A;  4X07 A;  4X0C A;  2ZL7 A;  4P3I A;  4OPS A;  4Z4R A;  4Z4Z A;  4QV2 A;  5F4M A;  3Q38 A;  4Z4Y A;  4Z4U A;  5IYQ A;  4P26 A;  5IYR A;  3ASP A;  5HZB A;  4ROX A;  5IYW A;  3BY2 A;  3ASS A;  2OBS A;  4X7C A;  3SKB A;  3PUM A;  3Q6R A;  5BSY A; 
#chains in the Genus database with same CATH topology
 3CRZ A;  4RCY A;  2Q6L A;  3ONY A;  3E20 A;  1ZM4 A;  3CXC B;  1VQO B;  2YWH A;  4P1V A;  5E6T A;  3WXM A;  1XFO A;  1OB5 A;  3A1P A;  1VQ6 B;  4NBS A;  3ONU A;  2FVG A;  1YI2 B;  3CCR B;  4XN0 A;  1DDI A;  2B7B A;  4TKO B;  1IHM A;  4M0L A;  5TR9 A;  3V76 A;  1CNE A;  2QDX A;  3OFN A;  3W5H A;  4UZE A;  4PAA A;  2JN9 A;  4OOS A;  1VQ5 B;  3AVY A;  4UZF A;  1IB0 A;  4X8I A;  1SKY B;  3HAG A;  3CCS B;  2BSA A;  1EFT A;  2BM0 A;  5TY0 A;  3PUN A;  1OGJ A;  3G71 B;  1H85 A;  4XN3 A;  3A35 A;  4X7E A;  1E3X A;  3LNN A;  4RM0 A;  3R6K A;  2B5O A;  4GQN A;  3CCE B;  3GQB A;  1RQP A;  1T6Y A;  1VQN B;  5A8A A;  2NV4 A;  3A3G A;  1V0E A;  4K1X A;  2WZP P;  4WQM A;  2E1R A;  1KD1 D;  2CRV A;  3ZC3 A;  2X6X A;  2I1L A;  2OBT A;  2Z6B D;  4LBV A;  1BJK A;  4XD7 A;  3E1Y E;  2X53 S;  4PC3 A;  4Y9U A;  3CME B;  2YWF A;  2R6H A;  3OP1 A;  2QMU A;  1D8T A;  1EWY A;  2WJY A;  3OJX A;  3SLN A;  5B6I A;  1N07 A;  1IJE A;  1H8H A;  4KKS A;  5GV8 A;  4Z4S A;  1VQ4 B;  2YWE A;  5FA6 A;  2BMW A;  1WPC A;  4XM3 A;  2CBX A;  1OGI A;  1Y0Y A;  2CF4 A;  2WPD A;  4YAW A;  1WOP A;  2V4D A;  2QA4 B;  2EIX A;  1WTH D;  2V7X A;  1M90 D;  2QGG A;  3ZBU A;  4RDJ A;  3OEE A;  4WZK A;  1OB2 A;  3AVU A;  1JA1 A;  4PC7 A;  1KMH A;  4B3G A;  5CDF A;  3CCM B;  3OZW A;  3SLD A;  2XGJ A;  4OPO A;  3SJZ A;  4XMY A;  3U6K A;  4N3G A;  2BN4 A;  1QFY A;  1W34 A;  4L8J A;  1VQL B;  1NB9 A;  3H94 A;  2Q6I A;  4G5G A;  4Z4T A;  4AF6 A;  5H59 A;  3I55 B;  2VBU A;  2ZL7 A;  1T6Z A;  4TT3 A;  3J81 k;  1PJ7 A;  4TMX A;  4QV2 A;  5F4M A;  1FNB A;  3G4S B;  3Q38 A;  4TMW A;  3GSI A;  5DS0 A;  4M1K A;  2JIZ A;  4G1B A;  4Z4U A;  4J0Q A;  5FO0 A;  2GPJ A;  4M4S A;  5KSW B;  1K73 D;  2QTL A;  3ASP A;  2GK6 A;  3CMM A;  1V0F A;  4XQF A;  5KNL A;  4ASU A;  1E3Z A;  4TMZ A;  1FRQ A;  5IYW A;  1K9M D;  2PLF A;  3W2E A;  1KQS B;  1KRH A;  1VQ8 B;  4DQK A;  4YXW A;  3SKB A;  1KJZ A;  1AMO A;  4G6I A;  4C0S A;  4YAU A;  1QUE A;  1ZM2 A;  1DAR A;  1QX4 A;  1N06 A;  1E1R A;  1QG0 A;  2C5B A;  3BCF A;  3OPO A;  1MAB A;  3ES9 A;  4KKU A;  4P2N A;  5EMN A;  1M1K D;  3GIR A;  2GJP A;  2ZIT A;  2F1L A;  2XZP A;  3NE5 B;  4QVJ A;  5F4J A;  3ZUG A;  4XLH A;  2BVN A;  3BY1 A;  4Y7C A;  1VQ7 B;  1GR1 A;  5DN6 A;  2BGI A;  1K28 D;  3WQZ A;  1IJF A;  4YAL A;  2CND A;  1MRZ A;  3ZZU A;  3OJW A;  5IYP A;  2XND A;  5JBQ A;  1E62 A;  1UMK A;  1P4M A;  2ZTG A;  3CB4 A;  1W2B B;  4B4D A;  1D1N A;  1WOS A;  4PC1 A;  4FK8 A;  1VHO A;  2CK3 A;  2D3L A;  4LBY A;  4OOX A;  4RCZ A;  3WYA A;  4Z4W A;  1OHH A;  4RDK A;  1FDR A;  2ZZQ A;  4WZE A;  2BM1 A;  2DIE A;  4ACA A;  4QHY A;  2OTL B;  5TV2 A;  3OKX A;  1TTT A;  2BGJ A;  1GAW A;  2VNI A;  2OBR A;  1H8E A;  4WZT A;  4XL9 A;  4QUZ A;  2GJK A;  1XE1 A;  1N08 A;  1GJR A;  1JNY A;  1WU8 A;  2F4N A;  4DNR B;  4ZGN B;  1NJI D;  2HLD A;  3CCJ B;  5KW9 A;  2D9R A;  4LBW A;  2BPO A;  1EFC A;  3AVT A;  3OZU A;  3RY8 A;  2DOG A;  2V7U A;  3G6E B;  2C77 A;  2QTZ A;  1FNC A;  1BQE A;  2X85 A;  2RC5 A;  2P3M A;  4RD1 A;  4RD0 A;  2C78 A;  1XQB A;  2HMA A;  2VNJ A;  3ASQ A;  2DER A;  1QUF A;  1GVH A;  1PJ6 A;  3BQJ A;  4CQJ A;  3AST A;  3CP2 A;  3SJP A;  3LVB A;  3ZZT A;  1VQK B;  4KKT A;  1BPL A;  4HE6 A;  2ZXI A;  3QE2 A;  4F7D A;  4X06 A;  1VHE A;  3ASR A;  2F1M A;  3CCV B;  2GK7 A;  3CD6 B;  3QSY A;  3CMA B;  1WDT A;  1COW A;  1UD6 A;  3OZV A;  2LZJ A;  4QVA A;  1VQP B;  1G7C A;  5HXB A;  3W2G A;  4DK0 A;  3GVL A;  5J3O A;  4G7X A;  1OB0 A;  1A8P A;  2DY1 A;  2JDI A;  2XZO A;  2XOK A;  4XKW A;  3WNB A;  2X8K A;  2ZTN A;  4M2L A;  4UZU A;  1YLO A;  3LQ6 A;  5THX A;  1R5N A;  4X07 A;  4Y9R A;  2W6J A;  4Z4R A;  3LO8 A;  1W0J A;  1E64 A;  1TLL A;  3BH4 A;  5FNZ A;  1VQ9 B;  1XB2 A;  5BSY A;  5A88 A;  2DCU A;  4WWV A;  4Z4Y A;  5IYQ A;  1E79 A;  2ZZG A;  1PJ5 A;  2GJR A;  3CC2 B;  3BCD A;  2HCJ B;  4MYT A;  1KK1 A;  1G7S A;  3MMP A;  4MYU A;  3MCA A;  1VJS A;  2C2W A;  1BX0 A;  1WP6 A;  2WYR A;  3PUM A;  4YAF A;  1I8D A;  4RD6 A;  3Q6R A;  2OK7 A;  3ZPN A;  2XNC A;  2XEX A;  3AVV A;  1KTV A;  3GVK A;  4XON A;  3Q3A A;  3W2H A;  3VNV A;  1VLY A;  1YHQ B;  2KVO A;  4BPR A;  3VMF A;  2RC6 A;  1YX2 A;  2ZBU A;  4HIZ A;  4XLA A;  1N0U A;  5IK2 A;  1AIP A;  3OAA A;  3VO2 A;  4FXU A;  1KZL A;  3D26 A;  3WBJ A;  5FIU A;  4DQL A;  5TRD A;  1E63 A;  1W87 A;  4N3N A;  1ZUN B;  3CC4 B;  3VO1 A;  2NPF A;  2X6W A;  4WZL A;  2GRE A;  4RDL A;  3R6J A;  4TMT A;  3JQP A;  3FJO A;  2V7Q A;  4Z1M A;  3V7A A;  2W6I A;  1WSV A;  4HE5 A;  4ZCL A;  3Q39 A;  3CCL B;  1U2R A;  2ZL6 A;  1QGY A;  3QFT A;  1YIT B;  4IW3 B;  2VJJ A;  4YEL A;  4RJL A;  4RLZ A;  3VR6 A;  1KC8 D;  2YWG A;  2QN6 A;  3FPP A;  1FRN A;  4R71 A;  2E1B A;  3W2I A;  1VF7 A;  1E1Q A;  1W9X A;  2M5S A;  4YEJ A;  1YJW B;  3PVD A;  2VNK A;  2BV3 A;  4FN5 A;  3CCU B;  3W5V A;  4RD2 A;  1Q86 D;  3JU4 A;  4DK1 A;  1V5V A;  2ZL5 A;  3PA1 A;  2VJI A;  4TMV A;  1FX0 A;  2OYN A;  1VLO A;  2PMD A;  3A8I A;  1UD8 A;  1QGZ A;  3A8J A;  4B48 A;  5L46 A;  3WY9 A;  4II3 A;  1NDH A;  1D2E A;  1BX1 A;  1SM4 A;  4RPB A;  2DET A;  1UD5 A;  3PA2 A;  3ZBT A;  4XNF A;  3BNW A;  2QEX B;  3CW2 A;  5DSZ A;  1TUI A;  4Z4V A;  1T6X A;  2V7T A;  3BC9 A;  4B43 A;  3KL9 A;  4C43 A;  1R5O A;  3JQQ A;  1UD3 A;  3A3B A;  4X05 A;  3CPX A;  5H5J A;  3OEH A;  1CQX A;  1DDG A;  3MHP A;  4XOP A;  2DEU A;  3WNC A;  4LC0 A;  2PE3 A;  1ZM9 A;  2V7W A;  3SEJ A;  4XLE A;  2Q6O A;  4X0C A;  4ZGQ B;  1QFJ A;  4U9U A;  3AGQ A;  4E0F A;  3A8K A;  3CP8 A;  4Z4Z A;  4P3Y A;  1PKV A;  3ZZ0 A;  4P22 A;  1S0U A;  1WSR A;  2VNH A;  5AN9 A;  1HZE A;  1YJ9 B;  2D3N A;  1YIJ B;  2R9V A;  4II2 A;  2C4T A;  3OOC A;  4AC9 A;  4B44 A;  5HZB A;  2EFG A;  1GAQ A;  1ELO A;  2WZN A;  3BY2 A;  3CCQ B;  3JQR A;  4H9G A;  2OBS A;  4Q7J B;  5LMZ A;  4B3X A;  1BLI A;  1NB0 A;  3ISX A;  2XZL A;  4TN1 A;  4XKV A;  1W35 A;  1I7P A;  1ZM3 A;  4NCN A;  1JA0 A;  3H9N A;  3U2Q A;  3QFR A;  1I18 A;  2VBT A;  4PAB A;  1EFU A;  1QFZ A;  4ZCI A;  3T51 B;  2JJ2 A;  4RPD A;  1F60 A;  4DNT B;  4ZCM A;  5BSX A;  3G05 A;  2BF4 A;  1K8A D;  3QFS A;  3VNU A;  4P6V F;  1QGA A;  1S72 B;  1RQR A;  1FND A;  1G7T A;  2WR8 A;  1HVX A;  1KK0 A;  3W5U A;  2FX3 A;  2X0K A;  4AF7 A;  2VYQ A;  5GV7 A;  4PC2 A;  2ZZE A;  3KEW A;  1N05 A;  2HDN B;  5FL7 A;  2VZL A;  5HKK A;  2DYI A;  4OP7 A;  1VQM B;  2X3U A;  2V7V A;  2Q6K A;  3FKS A;  5F4O A;  1DG1 G;  3QFC A;  4EH1 A;  1NRK A;  4FWT A;  1E43 A;  1EP1 B;  5FO1 A;  3P27 A;  2OTJ B;  4P6Y A;  1F20 A;  2V31 A;  3FPK A;  2D74 A;  1J9Z A;  1S4M A;  3GVJ A;  2X6Y A;  2VBS A;  3OE7 A;  4OPV A;  3AVX A;  3LQE A;  2C4U A;  2J7K A;  1JB9 A;  1EFR A;  1UD4 A;  1B23 P;  1Q82 D;  4X7D A;  4XOT A;  3W2F A;  1Q7Y D;  3B82 A;  1T5E A;  2JJ1 A;  5J35 A;  3Q6Q A;  4P25 A;  4RD3 A;  1FNM A;  4UAJ A;  4P12 A;  1N0V C;  1WOR A;  2WSS A;  5HZA A;  3CTA A;  1G7R A;  4AVZ A;  1EXM A;  1EP2 B;  1KK3 A;  3CES A;  4YAO A;  1Y0R A;  1NBM A;  2OK8 A;  4PGO A;  4X7F A;  4B47 A;  3AVW A;  1WOO A;  1CNF A;  3PEN A;  4M53 A;  4XR6 A;  3U6B A;  3OW2 B;  3I56 B;  3T53 B;  1TVC A;  3AGP A;  1W0K A;  2WJV A;  4OOV A;  3B8H A;  1GO2 A;  1B2R A;  1R5B A;  2ZBV A;  3CPW B;  4G1V A;  1HA3 A;  2F43 A;  1QVF B;  1QVG B;  3ZIA A;  4G7W A;  5IYN A;  4NNJ A;  3CC7 B;  2CW5 A;  3I1F A;  4XLC A;  2QE7 A;  1QH0 A;  2AHO A;  4ACB A;  1BMF A;  4P3I A;  1YJN B;  4OPS A;  2PIA A;  2XNJ A;  4B3F X;  1JJ2 B;  1SKQ A;  4QFM A;  3WBK A;  2C5H A;  4LBZ A;  4JMQ A;  2GQF A;  4P26 A;  1UD2 A;  3B78 A;  5IYR A;  4RD4 A;  3T56 B;  1Q9S A;  4ZV4 A;  1KK2 A;  1Q81 D;  2B7C A;  4P9S A;  2CC2 A;  3P26 A;  4ROX A;  1N8R D;  3WND A;  3DDY A;  2ZXH A;  3ASS A;  4XOR A;  3OW7 A;  5A89 A;  4XLF A;  4X7C A;  4PC6 A;  1EP3 B;  2ZZF A;  1H42 A;  4YHB A;  2VBV A;  4TSF A; 
#chains in the Genus database with same CATH homology
 3ONY A;  3Q3A A;  4P2N A;  5F4J A;  4QVJ A;  4P1V A;  5E6T A;  4RPD A;  3BY1 A;  3ONU A;  5BSX A;  5IYP A;  1IHM A;  3D26 A;  4OOS A;  4OOX A;  4Z4W A;  4RDK A;  4WZE A;  4WZL A;  4OP7 A;  4RDL A;  3R6J A;  5F4O A;  3PUN A;  2OBR A;  4WZT A;  4QUZ A;  3V7A A;  4X7E A;  3Q39 A;  4RM0 A;  2ZL6 A;  3R6K A;  5KW9 A;  4RLZ A;  4OPV A;  3RY8 A;  3LQE A;  2OBT A;  4X7D A;  3PVD A;  3ASQ A;  5J35 A;  3BQJ A;  3Q6Q A;  3AST A;  3SJP A;  4P25 A;  2ZL5 A;  3PA1 A;  4P12 A;  5HZA A;  3SLN A;  4Z4S A;  4X06 A;  3ASR A;  4RPB A;  4X7F A;  3PA2 A;  4QVA A;  4RDJ A;  4Z4V A;  4WZK A;  4OOV A;  5J3O A;  4X05 A;  3SLD A;  4OPO A;  5IYN A;  3LQ6 A;  3SEJ A;  4Z4T A;  4X07 A;  4X0C A;  2ZL7 A;  4P3I A;  4OPS A;  4Z4R A;  4Z4Z A;  4QV2 A;  5F4M A;  3Q38 A;  4Z4Y A;  4Z4U A;  5IYQ A;  4P26 A;  5IYR A;  3ASP A;  5HZB A;  4ROX A;  5IYW A;  3BY2 A;  3ASS A;  2OBS A;  4X7C A;  3SKB A;  3PUM A;  3Q6R A;  5BSY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...