3BYTA

A complex between a variant of staphylococcal enterotoxin c3 and the variable domain of the murine t cell receptor beta chain 8.2
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
109
structure length
109
Chain Sequence
AAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T cell receptor beta chain 8.2
publication title Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
rcsb
source organism Mus musculus
molecule tags Toxin
total genus 27
structure length 109
sequence length 109
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2008-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bytA00
4ZUWA 5CHNB 3K3QA 5F7FA 1G84A 3LSOB 3F7RA 4P2RB 5CEZE 1FN4B 2C5DC 3MGTA 2FGWL 5CZXC 1KPRB 1ZT1B 2FJHA 3Q1SL 1WQVT 4UDUB 3SJVD 4QRQB 3ULSA 2GAZB 3LH2H 2Y06H 1LO4L 4FQJL 5B22A 3LN5B 7FABH 1JCKA 1HDMB 5CP3H 3WMSA 5BOZG 2COQA 2LVCA 2R1XA 3GSVB 3KAAA 4HCRL 3OZ9H 3P4MA 1Z9OA 2C1OA 5JUEH 3MLRL 2EEDA 2Y5TB 4X6CA 4CDHA 1XF3B 1TJHH 3CK0H 3LKOB 3BD4A 4RNRB 3T77B 4G8GB 1ITBB 4OCRH 4YC2C 3GNMH 4I4WB 1FP5A 3A6CL 5JOEA 2BOBB 4N1EA 3MGOB 4H5SA 5JTWA 2FB4H 3BP6B 1MCBA 4P5MB 5J6GB 3BISA 4NFDA 1J87A 4RISH 4NQDA 2LU7A 4PJDA 5GGRB 3M17A 4FG6D 1NCWL 3BDXA 3PP4L 4GW5A 5GS2H 5GSVB 2X9WA 3VGBA 3NFSL 1AE6H 1WWCA 5FHAL 4ODVH 3BO8A 1EDQA 4FQXB 4K7FA 2XTLA 5IVOA 5ANMA 1YMMB 3OQ3B 3OTTA 2ZNWA 5DT1H 4UNUA 4PPTA 3VFRA 3U4BH 3VFTB 4R26L 4OBRA 3BKMH 5AUMB 2AXJA 1A5FH 2R2HB 3GRWA 2DDQL 2DQIL 4TVPH 3D3VD 3NIGF 2KDGA 1CE1H 2Q86A 5JIHA 5C6TH 2WANA 2D4FA 3VMOA 1N0XH 2VDNH 4WHDA 1JZ4A 2GUOB 4JDVA 4OUUB 2VDRL 4QLRA 3V6OC 3VG9B 5ETUA 4AL8H 2NX5E 2MQCA 1I9EA 1INEL 3MV8A 3CVHH 4RBPK 2QR0B 1PFCA 1HHGB 5DRXB 3GIZH 4PRIE 5F1SA 1XF5A 3JWDH 5IWLA 3VFNA 4EDXB 2AV7B 4Z18A 1T22B 1JL8A 1AY1L 4JB9H 4GW1A 4RX4A 2Z8WC 1N7MH 2JJTA 5BZWB 2OZ4H 3QA3A 1X5XA 3U4AA 4Z8FH 5EIIA 3EJYD 3C08H 4LSSH 3LDBB 2XZQH 3BGMB 1X6LA 3STLB 5KOVC 3OF6A 3O6LH 2DLFL 4NKMB 3FRPG 1ND0A 2VUOA 5I2IB 1AQKH 3QEHA 2P5EB 4DW2H 1NCDL 5TJWK 4JJ5B 3E8UL 5E2TH 2CDGA 3G6JE 4LCYA 4JFDD 4UB0H 5CD5D 2VLJD 1WZ1H 3RZCA 2VLME 3MOBL 5EN2B 2B5IC 3VXQB 5I8OH 1QYGL 5GRJH 1IGYB 4JE4B 3D39B 3I6GA 1HWHB 3QQ4B 4R3SB 4WEBL 4CAGA 4HUVB 4PRNB 2AK1L 3O81A 3VXPB 4OZIE 5D7SH 4L9LB 1TJGL 4KXZH 5DMIH 4WFED 5J11C 1I9JL 5KANI 4XBGB 1FO0L 5HJ3B 3U7YH 4V2CB 1BF8A 1I4FA 3O4OB 2B1HL 1XCTA 3CD4A 4N0CC 4JPWL 5I17B 3T4AB 5FF6B 3ZTJG 1A1MA 1KG0B 1Q1JH 3SCMA 2AEWA 3ORJA 3KXFB 1YEKH 3ARVA 4EBQH 4JPVL 4FOMA 1U2CA 1F58L 3BKYL 1GYAA 1F8TL 5I18L 2ZJSL 1P5VA 5CJXC 3QDME 2DYPB 1YEFL 1EIBA 3OHXB 1P4IH 3T0EA 2FIRT 3NCBB 4XI5D 3CC5B 4QHNA 2HKFH 4XCCH 4YHYB 1UACH 2R56L 1P5UA 3O2VH 2MQ3A 3P30L 4PJBF 1R5WA 1C7TA 2CRIA 4ZTOL 4M6OL 1AC6A 1Q0YL 1DL7H 3CSYB 4HJ0D 3M1BA 4U1GC 3LMJH 1HINH 3T3ME 5DJYB 3QXUA 5C0CB 1IBGL 5L0QB 3RVTC 2WUBL 3QCUL 4YXHL 2J88H 4X7TA 1SEQH 5HD8C 1NAML 1RURH 5F3HA 3MRNA 1F4WH 1SEBA 1CDUA 3OPZH 1SVZA 4LU5H 1T7ZA 4K7PY 4ZSOE 2YUZA 5E4IA 3WD5L 5BRZA 2F15A 3RUGB 3DXAB 4GRLA 1BPVA 2RGSA 1U3HA 4HBQA 4HH9B 3K7UA 4LKCA 4BUGA 4O2FB 2X9YA 2V5RA 3S5LA 3TA3B 4ZAKA 4N90D 5ESVA 2GJ6A 4G43A 2VDQL 4ERSL 4L1DA 4PJCB 3B9KB 5D7IF 1AFVH 3GJFK 5I1CH 1KCUH 2V5MA 1J0HA 4JM2D 4OGYL 3P4LA 3VXME 4WEMB 3DX6A 1MRFL 3TT3L 5I1HH 4XC1H 5ALCL 3OL2A 5DJZB 4L3EE 5HHOA 3ARFB 4QHKI 4PJFA 4QXGH 1QOKA 4BFIA 4JHZA 1U8JB 4CW1A 4DK3A 1QP1A 1K4CB 1MY5A 4X8JB 4M7LH 2H6PA 4PJGB 3SE4C 1G7JB 4JZJC 3PDOB 4H26B 4P0DA 1W0WA 5E2VH 1UWGH 4O2CB 3MRKB 1TZIB 5CILL 3QIWD 5J12B 2F74A 4MJ5B 1RIHL 4N0FA 4YAQB 2QEJA 3U6RA 1T6WA 2VR9A 5D7LD 3SGJC 2X4TB 1IM9A 3GBML 2W0FB 4R7NB 4WGVB 5DFTA 1XFPA 5GPRA 1NFDE 4HW6A 3DNKA 4NNYB 5DRNA 4N8VG 3KLHD 5ELIA 3TCLB 3V4PH 4C83A 4OV5A 3JWDC 4G8EB 3K0WA 2R0KH 4P57A 1U8LB 1KJ2A 2JCCB 2J8OA 3G5VB 5BS0A 2NW2B 3AREA 1JZ2A 3PJSB 3KDMA 3HMWH 3U9UA 1UCTA 5DD3L 3DI2B 4UUJA 5MHSD 3QSKB 3TVMA 5HHQB 3KPRA 3IJSA 4RMQA 3G6DH 4CU8A 3JXAA 5FECA 1JGEA 3NZ8B 1PKOA 3SPVA 2ATKA 5IOPB 5D93B 4FQQB 2ZZUT 3VFPA 3ZE1F 1MLCB 4WFFE 2J8UE 3B5GA 4UQ2A 1CE6A 3VI4E 2VZSA 4YX2L 2HTLC 5DJXB 3V4UL 5C0EA 4Q74A 1XGYL 3I6LD 5CZKA 3AC0A 3DURA 3D85D 4UQ3B 4S2SB 8FABA 4P59L 3F5WB 3LN9A 3O11B 4NKOA 5I1LB 3GM8A 3HMXL 5BVPH 4Y0GA 4HS6A 4YDVB 4L4VA 1C12B 1PAMA 1ZVHA 3F7YB 4NBXB 4HGKC 1NGYB 3OKKA 2KUTA 1ORQA 5HDQH 2W0LA 4X9IA 1S7RB 4Y2DA 1MI5E 2GJJA 1YNTB 5DJDB 3WIHL 1IEAB 2ITDB 2OL3A 5IQ9B 1WSST 4LF3A 4EUPA 1YDPA 4NSKA 3MRDA 3TGXA 2BSTA 3SDDC 4K94H 1DLFH 5L88H 1F2QA 4TOYL 3KJ6H 4HWBL 5C07A 5FCUH 5J6HA 2W59A 1P6AB 3M8OH 3E2HC 4DJMA 3GHEL 2YN5A 4YQXL 4P2QA 1OTSC 1JN6A 5FB8B 3QXVA 3UJIL 2IH3A 5INDA 5ESQA 3O2DL 1J8HD 4WUKL 1KCSL 1RK0A 4L4TE 4PB9H 5DFVD 1KXVC 4PJXB 4WWKD 1NQBA 1R5IB 5EBLA 1UZ8B 4WI2A 4K3EL 5F1IB 3H9SD 1CFNA 3EW3B 4HXBL 5L8LB 4TULH 4OM1L 5BQ7B 3CMOH 1RUKH 3OJ2C 2E7BA 4TSCH 2V7HA 4DZ8A 5FA3A 3CDYA 4DVBB 1TVDA 1YEHH 2MWCA 4PY7A 1YN7B 2F53B 3RWJB 2XWJB 5E7FA 3RWDB 2K7PA 4FXGB 4PJAB 5HYJE 4TUJA 3HZMB 4CU7A 1HZHL 4Y16D 5D96C 3HE6D 2ED8A 3DSFL 4I18A 4XPHH 1BREA 5C9JA 2SEBA 3AM8C 4XCEA 1CLYH 1MAKA 2A83A 4PJ5E 32C2B 4OKDA 3WE6B 3VXOB 1LE5A 3WNKA 2HKHH 4HDIA 2EH8L 5BV7B 1OGAD 2DQCH 3K2MC 3NAAH 3GMQB 1IGTA 4QHUA 1E4WH 1F4AA 1VACA 4N8CH 1FFRA 4JFFE 5JIKA 1XGUA 3E6HB 5IHUL 1XF2B 1CXLA 4L1HA 4Z6AT 2B0SL 1LP9E 4PLKD 2R2BA 3W5MA 5EUKA 4XZUB 2JIXA 2OR9L 2VAAA 1OTTD 5IGXL 3EFFB 4KHXL 1G9MH 3OG4B 4K7PH 4XVUD 3VWKB 4UT6L 4UV4L 3SGKC 2XY2A 4N9GB 5AZEH 2BNQD 2CDEA 5HHMB 3IXTA 2OI9C 1A1NB 3KPOB 1HQ4A 3ARBB 2I60H 5CIPB 5EC2A 1UEYA 2IG2H 3WUWB 1Q9WA 2YD7A 2CLRA 3BPCA 4NQCA 1PBYA 1EO8H 3AS0A 1J0IA 1Q0XH 2BY0A 2E9BA 4KGJA 4PRPD 4HH8A 1J5OH 1X5GA 3T0BA 4JY6A 4NUGL 2KBGA 2ATPA 2R9HC 4I9WD 1OSZB 3KPLA 2VQTA 4NPYB 1S9WA 3LS4H 4NQXB 1Y0LB 5FYJE 3TZVA 2UWEF 5IP4A 4L8DB 3SHSA 1VADB 3PNWB 4EJ1C 5IEHB 2ZCLL 1OQXA 3GRWH 2V2WA 2Q8BL 1KXTB 1ORSB 1S7UB 4ODTL 5JW4Q 1F11A 5CINL 2FHBA 4J3OC 1R3LB 3RX8A 4HUKB 4BZ2L 4YFEA 5E2UH 2YRLA 4GG6A 4IMLB 3ZO0A 2C4FU 1MCSA 4M03A 3S3PA 3DXAE 4DOHE 1ZOXA 4X4MA 4I0PC 1IC7L 1NDGB 4BZ1L 1JWSB 5BW7A 5JW5A 5INCA 1ADQH 2YK1H 4R4NC 1QBAA 4CNIB 1S7WA 3BKCH 4OCYL 5EFIB 5F7NC 3MJ7A 4NKDB 1P7KA 1EFXD 1BFOA 2OJZH 3ME0A 4UT9L 1MAML 5JHLH 1XR8A 4YDJA 3DUUB 2NW3B 1OLZA 2YPLA 1I85C 5B3NA 4AZ8A 1KCVH 2Q6WA 4XCNB 3B83A 3BGAA 3RKDD 4XXCC 1E6OL 1A7BA 3O9WB 1NH6A 5HY9B 1ZK9A 3ILQC 1V7NH 4EIZC 2Q87A 2XFXB 1YC8A 5FDWB 4UILL 3I6KB 1VERA 3U0PA 1GGCH 2ESVB 5IG7A 4PJIF 1ZT7A 3PE9A 4AIZA 3VWJB 1PG7W 1VCAA 4N9OB 4EDWL 4XNYL 4UMGA 3VW3L 4OZGF 2GHWB 2GFBB 3WHXA 3E1F1 4DCQB 1XH3A 2OS7A 3GSQB 4PJHF 2UV3A 2AJXL 2UY6A 1FFOB 4P23D 1AD0A 2VABA 5A2JH 1BF2A 4NRYB 4DKFL 1H3TA 4MYWB 1MAJA 1VFAA 1F02I 5DEFB 4X6DA 5HDBE 2I9LB 2PNDA 3CH1B 4YHKL 4WO4C 2XN9B 5J56B 4Q9RL 3GIVB 3SJVA 1NEZA 5HHNB 3BN9D 4JVUA 1MEXH 2VDPH 2WIIA 4DFHA 5EORL 5GGQH 3O4LD 3QUYB 3GSRA 3L1OH 4ZPTA 3KYKL 3HFML 5HHXL 2Y7QA 5E6ZA 4FP8H 3BMWA 2ZWLT 4ZUTB 1J1PH 5TE4L 4MCZA 1NBVH 3C6SB 1UM6L 4GS7C 1QKZH 5CEXB 3WJJA 5JXED 3L3JA 1D5XB 3AU1A 3BZFA 1MFEH 1YEGL 5JZ7C 1J1OH 2HTKC 1U3ZA 2YPKA 5EU6E 1WBZA 3IDIA 3RTQC 2JKXA 4YHLL 5AD0B 2FBOJ 3BEWB 1RJLB 3QUXB 1NCAL 4NN7C 3RNQB 5DVMA 3EO0A 4JVWA 1JK8A 1I7TB 4CVZA 3SY0B 5B3JF 1CT8A 1H15A 4H20L 4D8PA 1IEBB 1B6UA 4DUXA 2X7LA 3DRQB 3UTSE 1IQDA 3UTTD 4X7DC 1OW0A 2VXTL 4LEXL 2IPTL 4KK8C 1N5AB 1QPPA 5TF1H 4KVNH 4GAJL 2NY1B 5D1QD 1RZKL 1CFTB 4XP6H 4ZDHA 4V1DD 4L5FH 4QRRD 1XF4A 3FN3A 5CKGA 4G9FB 3RQ3A 4GAYA 5IR1B 3VJ6A 3S37X 4APQD 3UTOA 3V0WH 3D3VA 4LHJB 4LCCA 1KPRA 1GAFH 3L5IA 1C5BL 4ZUUB 3PABB 1PZ5A 1YYLL 5HHVL 4NRZA 4PJXE 3CPLB 1SMAA 2VR4A 4X6CE 4NWUH 5JR1H 5KW9L 3LN5A 3MLXH 4NQED 1PYWA 3LKQB 1QUNA 4S11A 4QF1B 1X5IA 1AR1D 3ARUA 3HI6H 1DBML 3VD4A 3MBXH 4LARL 1RK1A 3LQAL 3QG6B 4XAKD 1GOFA 4CN4A 1DSFH 1MWAL 2XA8H 5IVXB 4OFDA 4LSTL 4NO2A 1DFBL 4NQDE 5CFHA 4GRMA 4PJDE 4FFZH 4X5XA 5DUML 1UC6A 2EKJA 1EA9C 3DBXA 4I4WA 3HG1D 4C59B 2VLKA 3CXHK 4BQCA 2WLYA 1FORL 4XH2B 3UJJH 1EEUA 3HC0A 5F1KC 4LLDB 5HYSB 4B53A 3WN5A 5KVFL 1LQSR 3REVA 1GC1C 4HJJH 5GGRA 3WYRA 4JFDA 3PWLB 3ARQA 3NIDF 2HFFA 1UB6B 2V2TA 3NABH 1IVLA 1WBXB 5ANME 1E27A 5GSVA 4IRSC 3VXUB 1TVHB 1ZTXL 5KSBA 3MOAL 5CD3B 1ZLWK 4NYLB 4RGND 2BXYA 1R24A 2VQUA 1YMMA 2A6IA 5E2WH 3OKLA 3HRZB 1QSEB 5DF0A 1IT9L 4TQEL 4XHJC 2IQ9H 3RP1A 1IC5L 5F8RC 4JO4H 1KT2A 3ROOA 2UZYB 3FRPA 3X14A 3MV8E 4PBVC 4KI5E 3V9FA 1TCRB 3RA7H 4FTVE 4G9DA 1GGIH 3BSZL 3QCVH 3IRZA 4XP4H 3MRQA 5KBNC 5BOPA 1K3IA 2H2PD 1HHGA 4PJ8D 2DQGH 2IBBA 5KSAB 1RD6A 3EIFA 3O3EB 4MAUH 3P9WB 4P4KD 4LCUB 1FZOA 2AEQH 4Y19D 1EHLH 1MFAL 3DETD 1FVDA 4ZFZB 2OL3H 4QT5A 5I75C 5CBAA 3BVNA 3VFOB 4EUPH 3DO7B 1BQSA 4PV9B 3R4DA 1A3RL 2J4WL 3MRIA 5JOFA 4I3GA 2W0KA 3MODL 4MB3A 4NKMA 4OBSA 2ORBL 5C7XH 2P5EA 4LCWE 3L5WB 3LZFH 3H6JA 1PG7X 3WSQH 2EDJA 4OF7A 1A4KA 1D6EA 1KTDB 1RZ8B 4ZD3H 2MHAB 4JQVC 5IM7A 3S88H 4M5ZL 2PR4L 1J1XL 3O6FC 1FBIL 1U58B 2CGRH 4ZFGL 5C0AD 1HSBB 5EN2A 1QTYT 5FOBB 5D2LA 1RUQL 4KDWA 1R3KA 4AENB 2Y72A 5IT2H 2H2SD 5CJ8A 1V8HA 1IGYA 1RPQA 3WXVH 4HWEL 3WLWD 4R3SA 4KQ3H 3IETB 15C8H 4Z7OE 2KPNA 2AXFA 3QNZA 1W72H 1XCQB 1KN4H 4G7VL 4LAQH 4PG2C 5IMKA 4HIJB 3CZFA 5HJ3A 1MREL 4IRZL 2CKBB 4Z7WF 3V95A 3QPQD 1X9QA 3MRCA 1L7IH 1YEEH 5I17A 4JM2A 3V7AE 4J6RH 4ORGB 3SQOL 4MQTB 1BBJB 3C8DA 1WFTA 3MLWH 4LQFL 1ONQA 2ICWJ 2NZ9D 3GJEA 1DQTA 1AGDA 4S1SH 5D6DA 1MCRA 2O61B 1WBYB 2PYED 3OHXA 4X9GA 1T2QH 5E6IC 2APXA 1BZ9A 5AZ2L 4MD4A 5HGGS 2HRPH 3OJDB 1EMTH 4M7KH 1JNNL 4XNQB 1BZ7B 1JGVL 1FJ1B 5DUPH 4JKMA 1Q9KB 3OV6A 1FO0B 3RHWF 2X1PA 2Q3AA 2NY2B 1U8QA 4R9HA 3T1FB 5CZVH 5DJYA 4PRDA 3SGDI 1WCBB 3LV3A 4PGJA 4OLYH 1H5BA 3QIWA 5H35A 1C7SA 4P2YA 4U1SA 1YNKL 3Q6GL 5ITFA 4RAUB 4GO6B 5D7LA 1DDHA 1K5NA 4WEUD 5BRZE 2IGFL 3T3PF 5K9KA 1OTUC 4HV8A 1XZ0B 5H2BA 5IMMA 1JPGB 1W0YT 1PEZA 2AJVL 1LO5B 4HIHA 1KPUA 1U93A 3UBXB 3ULUC 1Y6MR 1IM3A 3NGBB 1PLGH 5L9DH 1QA9B 1FNEB 3MZGB 2AI0H 2E9JA 2H26B 1OL0A 4QKXB 1BEYH 1UH2A 4NM8H 2DWEA 5GGRY 5I9QC 4PJCA 1LVEA 2HT3C 2A1WH 4RQQB 4WCYH 4EN3D 1T1XB 4JANA 3TBYB 4D0BA 2FATL 1NAMB 1RZJH 5HHOE 5C1MB 1NFIB 4OZFB 1U41A 2UZXB 5D1XC 4PJFE 4QCIA 3FT2A 4MJ6B 3OKMA 1T89C 3GK8H 4WI9A 5GIRA 1MCPL 2NY7H 4N8VA 2BK8A 3V8OA 3D85A 1NUGA 3UZVB 1J0JA 1X5ZA 4JY5H 3EDKA 2JELL 5DQJB 3S37L 4KROB 4PJEF 3C5JB 3G9VA 4JJHA 1EJ6A 4GG8A 4X8JA 4ELKB 1FH5L 3KYNB 4W70A 3F6LA 1AQDB 5F7YC 3TLRA 1FFNB 2YD3A 4P48A 4UIMB 2FEEL 4XAWL 3WFDL 1D3CA 4NHCH 2ADGB 1KV3A 4G9FE 2YZ8A 1F97A 3D25A 1A1OB 1KTLB 4DTGL 5AYUL 1P84J 5I15L 3NFPB 3GSOB 2V17L 2VXSH 2VLLB 4U1MB 1J10A 4EQ3A 3H3BC 4R7NA 4MXQC 1CFQB 4NNYA 4HIIA 2A73A 3KPRE 4RWYH 1QFWM 5GJSL 2FYYA 4M62L 5FO8B 3G5VA 1JP5A 2NW2A 3SKJL 2N4IA 3PJSA 4KDTA 4P3CH 5I1IL 4MX7A 4NHUA 5HDLA 1GJIA 1J8HA 4FQLL 2Z93A 3FB6B 2HJLA 4PJ7E 3C09C 5IVZB 3MCKA 1CLCA 1HH6A 1MLBA 3AB0C 4M48H 1N2RA 4WWKA 4DGIL 2YWYA 3NZ8A 3O2WH 4YEFA 3MUGB 2DI8A 5DJ0B 1HXMA 1NUNB 1U0QA 3NCJH 5D7JB 3NFNA 4HT1L 4PGDB 3CFEB 1QSFE 5DVNA 2HN7A 5IB1A 1HCFX 2DLIA 1K6QL 2Z31D 1T1ZB 3EFDL 1K4DB 1WFOA 5KVDL 4L4VE 4KK5C 3HE6A 4Y16A 1IGML 5KJRH 3OKYA 3GMLB 1U8MA 3LKRB 5FYKE 3QIUB 1PGRB 1D5IL 1I3RA 5E03A 3VXUE 2XACC 3ULVC 2W9EL 2EDTA 2EKSB 2XZCL 5D70H 1JNJA 4YDVA 1OGAA 4XB7A 1IJ9A 1A6WH 3W11D 5I1KL 4R2GC 5D71H 4J3UA 5CBEA 1S7RA 5DJDA 5C07E 2APVA 3HUJA 1IEAA 1HHIB 1UKQA 1XAUA 3KJ4B 4XGZB 4RA0C 3AFLA 3ZLQC 1CGSL 2X9XA 4I2XB 5T33H 1YQVL 3MYJA 5C8JB 4O9HH 4HFWA 4WU5B 2BMKB 2Q8AL 4N8PA 1R3JA 4XVTH 1BFVL 1RFDH 3EO9L 4FQPA 3P9MB 4YGVB 3TPKA 3U46B 2W0PA 1AHWA 2R29L 1EAPB 1VEPA 2BNQA 4JFED 4KJPC 3DROB 2DJ4A 4UTAH 3N1FC 1DBKL 3D2UB 1Z9MA 7CGTA 4WW2B 1D9KC 3LKNA 4X80L 3WHE1 3T0AA 3OAZK 1UJTA 4DVRL 1N3NA 3N85L 4HEME 2WINA 4ZOCA 4YWGL 1IZJA 3WCYA 3MV11 3ZDYF 5DO2D 3DLQR 3CSGA 5C09B 2XOTA 4HKXB 3VXSD 2YN3A 3L7EB 2Y07H 3RWJA 2XWJA 5C3TA 4LPTA 1KN2L 3PIQB 4MJ2A 3PP3H 3QI9B 4OJFL 3QQ3B 4LSUL 5DRZB 5EWIH 3DGGB 3HNSH 4C56B 4D9RE 6FABH 1MJ8L 1AO7D 2DQTL 4JZNA 5C0FB 4Z95H 3FTGB 1LK2B 5GGUA 1MJJA 4O58H 1CBVL 3MV7D 3FFDB 3SDYL 4L3CB 3WE6A 1PKQB 2C3HA 3L5JA 4LK4A 3B9EA 3U4EA 3SDAD 1DTUA 1PD6A 1HKLL 2A9ML 2GK0B 1S9VB 3IRPX 3RHWK 1X5AA 1G6RL 2F8OA 4NKIL 1DE4B 3ZE2F 5HTSA 2GSGB 4POYA 5DVOA 3VRJA 2ADIB 4GQ9H 4BH8B 3BHBA 4E41B 2M26A 4OZ4B 3D18B 5T3XD 1FYTB 3IFPB 5LBSL 5LGJB 2G9HA 5IVNA 2NY0B 3VWKA 2ICEA 4Y4HC 4NQCE 4N9GA 2XKNB 4YBLB 1I8IA 1IGJA 4AEIL 1KSRA 3KPOA 3TO4B 3ARBA 1NMCB 1X5JA 1Y18B 3BDYL 3WUWA 3NCMA 3FL7A 1HSAB 4FQIH 1BQLL 5DMJB 2QLVB 4WUUD 5BO1L 4NQTA 4PLNC 3P4NA 2ERJC 5C0GB 4HZLB 4NPYA 4CJ0A 5J1SC 2VLRE 3E6FA 3DMMD 3RDTC 4NQXA 4MJ4A 3DHJA 4F7MB 5EU3B 4P23A 4JG1H 2FX9L 4G80B 4L8DA 4XP1L 4Z0XA 3NCCB 4GG6E 4RMRA 3PNWA 4MSWB 3HZKA 4G8IA 4YZFE 3ZTNH 5TFSL 4JY4B 1S7UA 1T5WA 4TUOB 4BQBA 1RULL 4XRCB 2MMXA 5EZLB 5ISZD 2Z92A 2VXQH 5FKPA 1R3LA 1QHPA 4QWWC 1LEIB 3S34L 1T83C 2Z9TA 1IKFL 2WIMA 4LHUG 4H1LG 2ARJQ 3A0OA 3BQUC 2BVPB 3O4LA 3TESA 4JFOB 2EDDA 3L3OB 4CNIA 1D6VL 1AGCB 3GBNL 3JV6A 3X17A 4WV1C 4BQ9A 1BM3L 1Z5LA 2YPLE 3MACH 2Z8RA 5JDSA 3TYGH 1DN0B 2VWEE 4HKZA 4NZTL 1YPZB 1NGQL 4ELMB 1EPFA 3FONB 3VXRB 5TE7L 2IALA 4HAGA 5JXEA 4OLXL 3TJEH 2NW3A 5EOTB 4CMHC 5ID0B 2P8PB 2ZCHH 1IGCL 3D69B 1LNUB 1VFUA 3UTQB 1KACB 3QZWB 3K81A 2M1KA 3OSKA 3MUY1 4LLVB 3DV4B 3EAKA 2ADJA 1IAOA 1PZUB 1T1WA 3W39B 3KWWB 2DBJA 2R23A 2V6HA 4LHUD 4PRHD 2Z4QB 3B5HA 1XMWA 3UTTA 2F5AL 5CJQH 1ZLSH 5D7IB 1MCJA 1TPXC 5D1QA 4X6DE 1FFOA 4UZGA 3GMOA 4MNGA 4X9BA 3ULUF 2IADA 4IRJB 4V1DA 3W81A 5CSZB 4OF0A 4QRRA 5B38G 4ZOAA 3PWNB 3SJVE 2BOCA 3X13B 1CTOA 4JEGB 4F2MA 2EIZB 3FO2B 2C3VA 1HH9B 3WO4C 2P7TB 2I9LA 3UXFA 3CGTA 2GT9B 5E5UB 4APQA 4NN5C 4L8SC 5J3HD 1BZQK 5ID1B 5JPMB 1EZVX 3C5ZB 1PW3A 4H0IA 1FFPB 5JXAL 4R97C 4NQEA 3QUZC 1QNZH 2GQHA 3QUYA 1ZANH 2AEIT 3JVGC 3T2NL 4CKVX 2OTUA 4KKBD 3L9RA 3I50L 3RZWA 2GK2A 1RY7B 2XT1B 5FCSH 5CEXA 4JPIA 1Q94B 2VDML 4KVCL 5T1KD 1I1RA 1D5XA 3KPQB 3ILPB 4FXKA 4JQXA 3CLFL 1DBAL 3QIBC 5IJVB 1A4JB 1ERNA 4UV7L 3V6FA 2I5YL 4MWFA 5IBTL 1OVZA 1C5CH 3FO0H 4OFVA 4M1GH 2IH1A 1NCCL 4QTHA 5EC1A 4D9LL 1GGBH 3QBTB 3TYFA 4LASH 4IIQA 2O5ZL 4MD5A 4PFEA 4S1QH 1NKOA 2HVJB 4KK6C 4TPRH 3O0RH 1GIGH 1DN2A 1CQKA 1IFHH 5F9OH 4OF3A 4OV6F 4YE4H 3P0YH 1WFNA 3DX7B 5DHYA 4ZUSB 1PX4A 5IJKA 5HGBB 3G6AB 1ZGLM 1AIFA 3D3VE 3RNKB 1IAKA 3C8KB 3LPGA 3JWOC 4U1KB 3DI3B 2VIRA 4PUBH 3ZL4L 3ALWA 3SO5A 3LY6A 4OT1H 1F4XH 4XTRC 5IK3A 5E8DL 1UT9A 2OXGA 3V0AC 5IB5B 5KS9F 5HGDA 4MVBC 1B90A 5TGBA 1GCFA 2AW2A 4YPGA 5C6PB 3HNTL 4MNQD 4DN4H 4WWID 3U1SL 4FQXC 1JE6A 2E7CA 1KIUA 3QISA 3IFLH 4JRXB 4YHPA 4HXAH 2Y23A 4OGXL 4O2EB 4PJ8A 3EJZC 1JJUA 1FVCA 1GC1L 3FQXA 1T4KA 4P4KA 2G75A 3QG6A 4YFDB 2FH8A 5FGCE 3H42H 5F7HA 3ULVF 1NFKA 1YUHA 4E42A 5E56A 2WBKA 1MQKH 1F3DH 4JFDE 4RIRA 3H7BB 3HR6A 2VLJE 2CUHA 2DJUA 3MRRA 5CGYC 4AMKH 3UTZA 1JGDA 3VG9C 1NMBH 1QFUH 4P9HH 5FO7B 4ODHL 5KSBE 2QQLH 1A7RH 3NCYP 4YC2B 5A3ID 5CUSL 5JHDB 3TN0B 4YPJA 2BNRB 1U2HA 3KVQA 5ILTL 3RGVB 5F88B 4CJ1A 4KJYB 2AJSL 4XMKH 4EOWH 2B8OT 5C0AA 4P5TA 2IPKB 5K9QG 4WFEE 4X6FA 2UYLB 4PGZA 1A7PH 3TIEB 1MWAB 5I66B 3LEVH 5FO9B 4KRPB 3KGRA 4NZRH 1P9MA 3IDYB 1L7TH 3LDBC 2DBLL 1U8NB 3HRZA 1LO0L 3GB7B 1KCKA 3IDGA 4OCMC 3S36L 3P77A 4GBXB 2A0LD 3NIFF 3AAZB 3IDJB 3MNVA 2EDLA 4M6NL 2HJKB 5EA0H 3TBSA 5C0JA 4U6VH 4P2OD 2FZ3A 5AWNL 2D0HA 2HT2C 4BSVB 3EYFB 1X5FA 1FRGH 2XQBH 2IANB 5CZXD 1FCCA 1UENA 1FE8H 2JJWA 2MCPL 1F6LL 3ZDXF 3FHAA 3STZB 2PYEA 1VFBB 2YMXL 3ZT7A 4QOKB 3FQUB 1MVFA 3QWRD 4OCXH 1B2WL 1AI1H 3OGCA 2ILLA 1K3ZA 3O4OC 2BVYA 3BZEA 1UM4L 3DVFA 1MNUL 3QJHA 5SWQA 3T09A 5HHPA 5SWSB 1S3KH 4U6HA 5FK9A 1BD2D 1E6JL 3VFOA 2VSDA 1QR1A 3V6ZA 3R8BB 4WHTB 2C7UA 1LE9B 4IOIA 3S96B 3V7MA 3ZE0E 1MCOH 1KCRH 3CCHA 1T1YA 5D2LE 3WXWH 3EOTL 2LAAA 4LP4A 4YHYC 3IDNB 4N90E 2J6EA 4F7TB 1WTGT 1U58A 3BIKB 3QEUA 4YHIB 2E8ZA 1HSBA 2GTWB 4O02L 2DKMA 3G6JF 5FA4A 1LDPL 3I9GL 4ENEC 3VI3E 1EFXB 4K9EH 1JF6A 3BZ4A 4JKKA 4L8CA 3QJFB 4F57H 1BX2A 3WDHA 1ED3B 5GHWH 1F00I 2LAGB 3FN0L 1OAYH 2B5IB 5E1HB 2UUDH 3RX7A 4EN3A 2XTJB 4JHWL 4YXKH 2CKBA 3GKWH 2O5YL 4YDKH 3L7FA 5HI4D 2NLJB 5T1DH 1KIQA 2QHRL 4QRPD 1MRCL 1DQLL 4TUKL 1X44A 4ORGA 3VMNA 5I1JH 3V2AR 4M1CD 1YJDH 5I1DA 4DKDC 4LSVL 5T3ZD 4F8TA 4DKEH 4OCSH 5FGBA 1U8PB 1FV1B 3TA3C 5KSVA 4YFLF 4DGYL 5IMOB 2FSEB 1WBYA 5JIIA 4MAYD 2NXYD 3R06B 3B9KC 5BV7H 4EVNA 3Q5YA 4MZ3A 2ADFH 1MHHB 4M7ZB 1ZHKB 5D7LE 1KEML 4NBZB 2B39A 3AY4C 3WEXB 3GI9H 2OSLB 5J9PB 3JBG7 3WLBB 1PY4A 1WCBA 4FMKA 5DJ6A 4BA8A 3F7QA 4Y1AD 2W65B 3ARFC 4RAUA 2BVOA 2IF7A 3QDGB 4FZEH 4U1GB 4N0YH 4J8RB 5I8EB 1KGCD 5MHSE 2EDYA 5I6XB 3TF7C 4H88L 4JR9L 4QRTB 3EZ8A 5L2KB 1CDYA 4OZGB 5ICYB 3RL1A 1XGQB 3NH7H 4JO2L 1UA6H 2A6KB 3OX8A 2E6JA 4WW1A 1EX0A 3WFBL 1C1EL 2Z35B 4BFEA 1MIML 2WV3A 5J12C 2A74A 2CMRH 3LIZL 1QFWL 3TH4T 4PP2A 2ED7A 4ETQB 2IBGA 1DVFD 2PW2A 3I6LE 2DD8H 3UP1A 4S0SD 5CSGA 4WY7H 1JNHA 4JFZL 3GI8H 1P7QD 2FX8H 2Z31A 5F6HJ 4IJ3B 2CLVA 3QFJD 4W6YB 4QTIH 3VFWA 1R5VA 1I9IL 4HUXB 1DBBH 2VTFA 4LLUB 4LMQE 3SKOB 2VL5B 1CG9A 4NGHL 3O3AA 5SX5H 2P24B 4NN6C 5E7BA 4O51A 1FPTL 4HEPG 3CH8A 3ARGD 5DQJA 1QHOA 4FHBD 5F1NA 4PGEA 5AG8A 1DLHA 4ODXA 3KLDA 3AS3A 4UBDC 2OJEA 2X4UB 5IROC 4FQCL 3MLZL 1MJ7H 4GUPA 1R3HB 4OLZL 2A38A 1BQHB 3RL2B 3MLTA 4DK6A 3FO9B 2BY3A 3GSOA 4FNLH 1U36A 3ARZA 1OF2B 2R1WA 1ZT4B 1J8HE 3LB6C 1CFQA 2LU3A 1RUMH 3B2VL 1AJ7L 5GRWA 2FNBA 5KVEH 1MUJB 4ZO9A 4JFEA 4PV8B 4CVXA 3QXTA 1UJ3A 1JPSH 1FL3A 4I3SH 4LLWB 3H9SE 4HHAA 1TZHB 3D0VA 1I7RA 3BWAA 3FB6A 5EO9B 1B4JL 5IVZA 5M7QA 5E99H 2YD6A 4U1JB 2BRRH 4OD2B 2EYTB 1YNLL 4KMTL 1I3UA 2PCPA 3MCLL 3QAZB 4K8RH 3IF1B 3DX8B 2OXHA 3WFEL 2X4QB 2L7UA 1EEYA 1KPVB 3QDAA 1T0MB 3GJFA 3HG1B 1PQZB 3UMTA 5D7JA 4U6YB 5IHZA 3VXSA 3PGFL 2IEPA 4L9DA 4F9LC 4M43L 2P8LA 1NC2B 1CQYA 1FGNH 2R69H 2X42A 4J1UB 2Y6SD 2FIKB 4ODSL 2YEZB 5LQBH 4XCYB 1HHKA 5FDYA 1OGAE 2H3NA 3LEXB 1AO7A 2AXHA 3QNYB 3LKRA 4XCFH 3VI4F 4UDTB 5HPMA 5EO1A 3MLSH 3MV7A 4LIQL 3B3IA 2IQAB 3QEQB 4U1LA 3UDWC 2FJFA 1VHPA 1PEWA 3W2DL 5I8KL 1N6UA 1DQDL 2BVEA 4LEOB 4LSQL 1NAKH 3EKCA 1RUAH 2PKDA 1NBZA 3MJ9A 4F33A 2NNAB 3JZ7A 2NXZD 4XC3H 1J8KA 4OZHE 3REWA 4I2XA 2H1PL 3C6LB 4JFYB 4MGXA 4G6ML 1YJDC 5KAQF 2BFVL 2BNQE 3P0VH 1NCBH 1UVQB 4G6KH 4TVPD 1KJVA 3EDDA 4KKAC 2Z91A 3HZVB 3QDJB 1T7VA 3HCVB 4MJID 3RPIA 5IV2B 3V52L 4JN2A 2XY1A 1I8MA 3BJLA 2XZAH 5ACMA 2Q7YA 5L6YH 4PRPE 3V5DA 3GSNL 1RHHA 3ARXA 4OQTH 5DMGC 4I9WE 3QHZH 5DJ8B 2YC1A 1UXWA 1HIMH 3TM6A 5IB4B 2BNUA 4Y19B 2VDKL 4A6YL 5E8PA 1JWUA 4WUUA 3BZDA 3OR7B 4FXLA 3GSXA 4Z76B 1J0KA 1REIA 2YKLL 4P4RB 2HLAB 2JE8A 3VRLF 3X12B 1LO3L 4KFZC 3HI1B 1ZGLP 5IESH 1EHNA 5FUOH 4KI5C 4KZDL 4PGCB 4TRPH 1J86A 3QQ3A 2FEEI 1YEIH 2DQFA 4R4FH 3MRPA 4MB4A 1NL0H 1U8KA 3THML 2HTLD 3MRLB 1LK2A 5ISZA 2VXVL 3U9PL 1S9XB 5D5MB 5KVGH 5IW3A 3PHSA 4M8VA 1U8IA 3Q6FB 5CWSB 3JSSA 1OARL 4MA7H 1BLNA 1T20B 3QH3A 1X6NA 4NWTL 2NY3C 5J4MA 2YA0A 4QGTA 5EO0B 3CDFA 3HRPA 2R4SL 1EUTA 4NP4L 5GS0C 3MBEB 4NCC1 3JUYA 4OZ4A 3VA6A 2HWZH 2FD6H 1FYTA 3ESVF 5GSRA 3LOWA 4Z0BL 5LGJA 3V0VB 4HKBA 4JGUA 4PJ9A 3SDDD 4DAGL 1AGEA 3S7GA 2G5BB 4OD3L 5IW1A 2P8MB 3IAPA 5L8KB 2XKNA 4R96B 2WAHA 1HHHB 3O45B 4IMKA 1CICD 4M6MH 3PGDB 4OI8A 4GW4B 3CDGA 4F7EB 2Q20A 4FQJH 3BE1L 3MRBA 4Q58C 4UIKL 1G6RB 3QUMA 5F9AC 4HCRH 4WDIB 1WTLA 2OI9B 4LHUA 4H1LA 3LEYL 5D1ZB 2HH0H 1WCQA 3MLRH 5GRVL 5F7DA 4OTXL 3BT2H 2XXCB 2J2ZA 3WL9A 1I7UA 1ZA6B 4YHML 1HWGB 3B4NA 3D0LA 5DMKA 1G9EA 4G6AC 1UQSA 4G80A 2BSSA 4GAGH 3O3DA 1CGYA 3O9WC 5C2UB 4HPYL 2P43B 2GTZB 4F3FA 3RVUC 1CR9L 3UYRL 5B8CB 5IUSA 3VGAB 5JDJA 1G9NC 2PO6B 3KNBB 5EZLA 3KPSD 3VWJC 4NDMB 1AXSB 4LP5A 5FYLH 3O4LE 5E4EB 3PP4H 1M7IB 4RAHA 2X4SA 3SBWA 5C0IA 3MNZA 3NFSH 4WNQB 1INDL 3QCTL 3SGDH 3ECBA 3KLSA 1EVTC 4PJBA 5FHAH 4U6XB 4IDJH 3CVIL 3L3OA 4ONFH 1AGFA 4ZTPL 3RUGF 2C1PA 3O3BB 2P48B 5I1EL 3B43A 1ES0B 4R26H 1A0QL 3FONA 1BIIB 1Q9LB 4KWUA 3RWCB 2DDQH 5DK2B 3F12A 4Q6YA 2JK5B 2VKWA 3PP3K 3DOSA 1F6FB 3WKMH 3D69A 3KLAB 5EBMA 1HHJA 4N0RA 4TTGA 5B39G 3PXJA 1FC1A 3UAJD 3UTTE 1FC2D 2VDRH 4G3YH 4PR5B 4I5BB 7FABL 5DFWH 3U79A 4ZPVB 1DBJL 1ZS8B 3H3PL 1IE5A 3GUTA 3S97C 2FH6A 1O0VA 3DIFA 3OZ9L 2J6EH 5JUEL 4BK4A 4MNGE 1JPTL 4V1DE 5DI8A 5GGVL 4QRRE 2OCFD 2VZOA 4LLYA 5D7IA 5DUBB 2XKSA 1RMFH 3CFJB 3RWGA 1C08A 4NCC2 1WT5A 3EHBC 2ED9A 4OCRL 3HAEB 4PTTB 3PWPB 1HQRB 1YEDA 2FB4L 1B0GA 5I71B 1AXTH 5A2KH 2CKBH 1NCDH 4RISL 4HKJA 2AJ3A 2F5BL 2XWBB 4NNXB 4KQ4H 3E8UH 3GBLA 5ESAB 4ZFOA 4NQEE 3RPKA 1SJHB 4PJEB 2D7NA 5ID1A 2JJSC 2QL1A 4Y88A 1HOCA 3ARDD 2DQJH 3B2UD 1WZLA 4MNQA 1AE6L 1EUUA 2NY1C 2DTML 2BVTA 4XAKE 3JV4A 3NN8A 2JCCF 2AS5M 1T0PB 4GQPH 1QYGH 3BD3A 5DURB 4RBPH 3C60A 4I0PD 5KN5B 2AK1H 1YZZA 1HYRC 4TN9A 3UJTH 5DT1L 1TJGH 3HG1E 3U4BL 1CFBA 2X4OB 4P46D 1NANI 3BKML 4ONGL 4DUWA 4ZXBA 2XNAA 1RZFL 1FO0H 3R1GL 1FVEA 1Q94A 3FB8A 4OLUH 4JFPA 1JZ7A 3DYMA 4JPWH 3AROA 1FGVL 3DV6A 3MLYH 4EKXA 3GEWB 1EEQA 3PUCA 4KJWC 1N0XL 5IFJB 2VDNL 4JPVH 2H8PA 4MA3B 1OCWH 2H41A 1O7SA 3FQTA 5DS8A 2DKSA 1F8TH 1LILA 5E00A 2ZJSH 4AL8L 4UNVA 5F70A 2Y36L 2R39A 1YEFH 4RGNE 1FDLL 2F54D 1AD9A 5HVGB 3U36A 4NN7B 2C9AA 2ZUSA 3MCG1 4ZTOH 3P30H 2GKIA 1V3MA 5GGTL 4M6OH 1Q0YH 5C08D 3MUJA 4XB8A 4J3SA 4J3TA 1N7ML 1Q9OB 2O93L 3KPMB 3MROA 3AXLB 3DX9A 1MVUA 3MNWB 4FQ1H 5IKCA 4Z8FL 1CFSA 3BW9A 1PJ9A 1IBGH 1WZMA 3MV9B 2XZQL 5BVJA 1RIVH 4OLWL 4Y5VA 3OB8A 2BXZA 4RGMC 3QHFL 2QKIB 3WNNA 1NAMH 3JUZA 4OZFH 3PHQA 4Y2DC 5DQDH 3E3QC 1F3RB 4OUOA 2X4RB 3KPPB 1A2YB 5F9JB 4X98B 5HGHA 4D0CB 3B8YA 2MKLC 5IF0B 3WD5H 3CFDA 4Y19E 4WO4D 3S98A 5I8OL 4M02A 5GRJL 5IFHL 5T1MA 5FV1L 1DUZB 3EYVB 1MF2L 4PJXF 2VSCA 1CZ8H 5EU5A 4W81A 2A6DB 3U7YL 3DSNA 1A9EA 3QXWA 3EOBB 3TFKC 1BD2A 1MCCA 1X5YA 5FM4A 1DQQB 2EDEA 3T2PA 1Q1JL 2AJYH 1BOYA 5EIQA 3MREA 4EBQL 5DYOB 4P5KB 3FCTB 4FN0A 1UXSA 2VE6B 1MFBL 3P0GB 5C0AE 1FNLA 5JZ7D 4PJDF 2HTKD 4U7KA 2XICA 3HLAB 2FRGP 3GGWA 4PJAF 4P9ML 1AGBB 1LD9A 3SDAB 1RZGB 5F88A 5KSAC 1QVOA 2Y1VA 4KJYA 1FYHB 3OAYH 2HKFL 5JO5B 1KLUA 2C4FT 2IPKA 5FKAA 5CMAB 1J11A 5I66A 2DMBA 1EGJA 4IRSB 2QJDA 1FQ9C 3SKMB 3VH8B 1FNAA 5F72S 4U1IA 3LAFA 1RIHH 1JWMB 2J88L 5BMFH 4X4ZA 1AKJD 3VMPA 2UZIH 3QFDB 5ADPH 1U95A 1F4WL 5E8NB 2PYEE 1TXKA 1BOGB 4QRPA 1ZV5A 2V7NB 3OPZL 4Q9BA 1A6PA 3TJHC 3PL6B 2VC2H 3MRJB 1I8KA 1U92A 4X6EB 4E5XA 1ZE3C 5DD3H 4KTDL 5IQ7L 3BP7A 4KI5F 3RU8H 3JTSA 3L3DA 1I8LA 4BH7B 1XIWB 1R6VA 1AC0A 2HFTA 4NQUA 5DHVA 3FFCB 4HF5L 2BVQA 2ZSVA 3IB4A 3V6OA 4KJQC 4GFTB 3MJ9H 5DVLA 2CIIB 3DMMB 2O26U 5MEOA 2QHLA 5K93A 4IS6A 1CL7H 4JO3L 1MCLA 3DRTA 4K2UL 1JF1B 3IJHA 5JW4R 1XGYH 2AKRB 1LE9A 4JRYD 2F8XC 1KB5A 5I1HL 3FO1A 3K74B 4XC1L 5A40E 1MCWW 5FYJL 3U48A 4RGOL 5L8JB 1PSKH 4QXGL 3V5KB 1WVZA 2D7MA 5E5MB 3TZVC 3BIKA 4P3DB 2GTWA 3FQNA 1FZKA 1X3DA 2NY2C 3WIHH 5HYQB 1EEZA 2HG5B 3O6FB 1S7TB 3VFMB 3H3KA 2UWEA 3O8XC 4RX4D 1OSPH 5TDNB 2W60A 4LQ1A 4PP1C 3L3IB 3QO0A 1M6OB 4NUJA 1DVFA 4TOYH 3V4VH 3PQYB 1P4LA 4ISVB 4MQ7A 3OF6D 5C0BB 3L3KB 4QY8A 3S3JA 2ZUQB 4Z7OF 3S4SB 4N0UB 2D31A 4DZBA 3GHEH 4YQXH 5MEND 2R0KL 3NGBC 3K80A 4MA8H 3HMWL 3U0TB 1GZPB 5F7KC 1T2JA 3O2DH 1LEKB 5T1LD 4YHNB 1EHXA 1A3LH 1EXUA 4XVSH 5BJTA 1BP3B 3MRMB 5DD6A 2F19H 3RZCD 1S7XA 1A6TA 5DJCA 3ZZ1A 5LXGL 3H9HA 5LAXA 1N59B 4A2LA 3BP5B 4HXBH 3PDGA 2EH7H 4W68A 1JMZA 4OM1H 1ZHKA 1ZEAH 2DQHH 3QNXA 3WFCH 3O6KL 4MQSB 2B4CC 2ICWI 4N1CA 3R0MA 5CEYA 4PS4H 3RVVD 1ZA3B 4JZOA 1Z3GL 1PY9A 4Z7VB 3T8XB 2QQNL 4PJIA 3HNVH 4NQVB 4FFWD 1ZHBB 5BVPL 2FECL 4OZGA 2EH8H 4EUPB 1INQB 5CP3A 5ICYA 2APTA 2HFGL 1LEGA 3T0ED 3G5XB 2NY4B 2P5WB 3QUMH 4OKVA 4PJHA 1VA9A 4HSQA 4RFEA 1KNOB 5IHUH 5EPMA 5SWZB 1KELL 1QQDA 3D5OF 2WP3T 4PREA 4HUMB 4NQSB 3ET9F 1YYML 1JZ3A 5FCUL 4FZ8L 3IFNH 3M8OL 1D5MB 2ZSWA 5I9QB 4UT6H 4UV4H 2EYRA 3BESR 3W0WA 4ZO8A 1YY8A 3G04B 4PYGA 5DTFA 3TIDA 4GRWB 5D1XB 4LLQA 4PYHA 2YZ1A 4HMCA 3MXWH 2AK4B 1E0OB 5DRWB 2OTWA 3IVKA 3HZYB 2Y4SA 4U0RB 2AJZB 4TULL 2GJ6D 3CMOL 1RUKL 4PRAB 5E6ID 4NRXA 4MNHB 2UUDK 3MOQA 1A14H 2HT4D 4FG6C 4UI2A 5FYJU 3S35L 3SE4A 4JZJA 4GXUM 3I2CH 4JFEE 1NCTA 2Q8BH 4ODTH 4Y4FD 5GS1B 4HWZB 4B7IA 3CDCA 1NLDL 3FQRA 4BZ2H 4ZS7H 1JUFA 1MUJA 1U8OB 2YOCA 1DP0A 2DQCL 3NAAL 1IC7H 1QRNB 5EH1A 4D94A 4GKSB 3CVHA 1E4WL 1OTUD 1VKXB 3KJ4C 1TZHA 1OB1B 3P9LA 4N8CL 5E8EA 1W8OA 1NGWB 1T3FA 2PTVA 3G9AB 4CVUA 4OD2A 2EYTA 3VXSE 4F7PB 3ULUD 1Z6JT 3TBVA 4HG4J 1RZIA 5A2FA 1TCMA 5E8OB 5D2NB 2OZ4A 1MAMH 3AB0B 4PJ7F 3RVXC 1PQZA 1AO7E 4K7PL 1WAAF 2I9TB 2ZG2A 5JLZB 4XP5H 5J89A 3SE9L 5IVXF 4MHHI 2HT3D 3MV7E 1IM9D 4UTBL 4WW2C 1CN4A 3AS2A 3MV01 1QRKA 2FIKA 5D9SB 5JORB 3AS1A 2I60L 4LFHG 3PGCB 4UILH 5JA8B 5BS0D 1UG9A 3ARED 2IG2L 3QNYA 4HBCL 4ZYKB 5BZDA 1IAIH 1KTRL 2FX7H 4RMTA 1Q0XL 3TVMD 4XNYH 3CLEH 2A6JA 1RAMA 4Q2ZA 4JN1L 1H8OA 1CFVL 5T3XE 43C9B 4Y4KD 5DDHA 5KVMC 1JRHL 2AJXH 5HGAB 4EUPG 3WN5C 3TO2B 3M07A 3QI9C 4R2GB 1BVLA 2GY7B 5CD5C 3G5YB 3GRWL 3TNMA 3MLUL 2HLFC 4P2OB 4OGAC 2XA3A 3T4YB 3QYCA 1C8PA 1CCZA 3QDJA 1QFWI 5I1GH 1YC7A 4YHKH 5DD1L 3SDDA 5E2UL 3U2SB 4QRUA 4LFHD 3AGVA 1KC5L 3BUYA 4WUUE 2DB8A 4MDJB 2EXWC 5EORH 3VDBA 3UX9B 2DLEA 3GSWA 1ZMYA 5DJ8A 43CAA 5IB4A 3BKCL 4HX1B 3HFMH 3OKDB 1D9KB 4YDLB 3EYUL 3OR7A 3BKJL 2GSIB 2OM5A 1UM6H 3IU3B 2NY0C 5CJOL 4M8QA 4HQQL 1X5LA 2YD9A 3T04D 5ISZE 1HNFA 3QXAB 5J8OA 4HUUA 3TO4C 3WIIL 3TBTB 4U3CA 1NMCC 1RUPL 4YHLH 4DQOL 4XI5C 3J7HA 4P2QD 1NCAH 3LRSB 2LTQB 3GSNB 1SJEB 3K4DA 1S9XA 3DARA 4YJZL 5C0DA 4KK5D 4KDVA 5KTEH 3AM8A 4HJ0C 2MCG1 1RJZA 4A6YB 5DJ2A 2BSRB 2IPTH 2ITCA 1KIRA 2NX5B 1E28B 4YIQB 3ULVD 4OLVH 4OCWH 2OLDA 3IS1X 4F15B 3PV6A 1A6ZB 4PRIB 3QQNA 1KJMA 3OXSA 1JGUL 1QLRA 4PD4J 4WI8A 4CL7A 3RWEB 5ABDE 2O5XH 3P3YA 4NO0B 2NY5C 2Y5EA 1J0ZA 2X4PB 3VGGA 2R2EA 3H9YA 2P8MA 2AABL 5CP7A 2FR4B 1YYLH 2CH8A 3STBA 4PRHE 4Z7QF 2VYRE 1N8ZA 4I48A 1NDMA 1MHCB 2NY6B 4MAYB 4GW4A 4U1NB 4Y4HB 3G6JB 5KW9H 1S9KC 3SGKA 4G8FA 1FAIL 1OWRM 1Z9LA 4QXUL 3V5HA 2MKWA 3L1OL 4KHTL 1A6AB 1V3KA 1DBMH 4D0DA 4FP8L 3SOBL 4LARH 5D72L 1ZSDB 1J1PL 4JM2C 1IARB 3H0TA 1QKZL 4M93C 1MWAH 2R4RL 3IS0X 4LSTH 3ZYZA 4Z7WA 5DLML 1MFEL 4QRSB 2JIXD 5EOQL 3PWJA 3OKOA 5EU4B 4OZIB 4X5WA 3IKCB 2ZUYA 1SYVB 2Y9RT 1FORH 1G7HB 5F7UA 4Z7VE 5I16A 2IAMB 1KTKE 2D9CA 5F9DC 3KNBA 5B39A 2DM2A 2L7JA 4R7DA 3SN6N 3DECA 5IHLB 2P5WE 4YZFF 3ARDA 4MXVF 1ZTXH 2ZOKA 3QDMB 1MFDL 4U6XA 1JYXA 1I1FA 3U7WH 4FRWA 5E1AB 5GZOC 1G7IA 3K1KC 1FL5B 4I0PA 4POUB 1BGXH 1TJIH 4L5FL 1I1YB 4M1DH 2FCBA 4TNWF 1IT9H 4TQEH 4P46A 2BC4A 3ELAT 1BIIA 1IC5H 3LRGA 4WV1B 3T0XA 3QFJB 3AMLA 1GAFL 2WBJD 3CZJA 1WZKA 3KLAA 4GSDH 3C5ZC 1KB5H 2FLBT 5TQ2H 1OAQH 3CFBA 3NTCH 1TETL 4CMHB 1I85A 4Z7UA 4I5BA 3BSZH 3L6FB 4JAMA 4NWUL 4ZPVA 1BVKB 2YD1A 4X83A 2F54A 3HC4H 1YN6B 4JQIH 4RMUA 3MBXL 4ZUVA 4ZSOB 4HK3N 3EDEA 4NOBA 1MFAH 1DSFL 1FAKT 5C08A 4FFZL 5DGQA 2FL5B 1S7QB 2G60H 4RMVA 2GYSA 4WGWB 4KTEH 5TE6H 3UJJL 3DWTA 4MNQE 2ORBH 3RDTD 5C3LD 2DM7A 4NNXA 3GMNB 4HJJL 2EXYD 4QHLB 3VXMB 3NABL 1KJ2L 1KIPB 4PJEA 1NEZG 4M5ZH 1J1XH 1T0NB 1MH5B 4PLOB 3I02B 4OCLC 2AXGA 4AH2B 4BUHA 4AEFA 3DUSB 4NC0B 4WO4A 1YA5A 2YUVA 4LAJH 5E2WL 2EYSB 3CIQA 1U8HB 1JFQH 2HFEB 3LD8B 4Y5YB 4MDIB 4YFLI 4G7VH 4J2XA 1JBJA 4R97B 3BQUD 3QUZB 2IQ9L 3T0WA 2DQDH 3V79C 1MREH 3EYOA 3DVGA 1JZ8A 1UB5A 4XBEH 2OQJA 3VD5A 5ICZA 1NGZB 1NJ9A 3SQOH 1ZGLB 4R8WH 1A9BB 3P73B 5IFJA 3C5SB 5MEQB 1GGIL 1NFDB 1RZKC 2QBWA 3QCVL 3QIBB 4TTDC 4GKZB 5K9OA 4M6AA 3RTQA 4WJ5B 2PN5A 1ZHLB 4MAUL 3QHTC 1JNNH 1JGVH 1NBQA 2AEQL 2CXGA 4XWOC 1EHLL 5FYKL 2OL3L 3Q3GA 4Y16C 3HE6C 4HLJA 5I74C 3LN4A 5E9DD 4HJGB 3RKPA 1WLHA 2OK0L 1S8DB 4U6TA 5DK0B 3MV9A 2OTPA 3Q6GH 2FO4A 4MJIB 1HKFA 1S9YB 3B6SA 2J8UB 5CLTA 3TN0C 3RGVC 2WQRA 1SBSH 1AKJA 2IGFH 3WSQL 4LIQE 1RIUH 1MCQA 3P4OB 1MCDA 2R0WH 5MEPA 2AJVH 1ZHNA 3LQAC 2CGRL 3GMMB 5BXFA 5HI5D 4WHYH 4L3ED 4KRPC 4NZUH 3VD3A 2H32B 4LPVA 3IDYC 5IT2L 3WXVL 4K3DH 4WW2F 3WO3B 1MHEA 1BD2E 1I1AB 1IGIL 3VCLB 3MJ8B 4KQ3L 1ZVYA 4LRNL 2F8VA 3T65A 4GBXC 1JZ6A 5F6IC 1S7SB 3QXDA 3QRFM 1MI5B 1KULA 2YD4A 1C5DA 2FATH 5EZIL 1YEEL 3BDBA 5E0QA 3DTXB 5DD0L 4HAFA 4P2RD 3U83A 4XP9H 4JRYA 2HVKB 4KKLD 5A16A 3MLWL 1MCPH 2NTFB 2VDOH 4S1SL 1G7QB 5KANG 3S37H 2JELH 3OKNA 1L0XA 4X4XA 3HR5B 1Z0MA 1JMXA 3TT1L 1ADQA 1EMTL 1FH5H 1Q72H 2QQQA 1GPOH 1OAKH 3NA9L 4OD1L 5JNYB 2PF6A 4L4TB 1KB9J 4UINL 4QYOB 1C16A 4LNRB 5ENWB 3LKSB 5KAQG 1MOEA 1JTOA 3O6MH 1N4XL 1M05B 5F7LB 5CZVL 3SKMA 4QRPE 4UNTA 4OLYL 4DTGH 5AYUH 3FOMB 3PWUA 3ZKXB 4G8GD 1GHFH 2V17H 2DQUH 5T3ZE 1F3JA 2E7MA 2VLKD 4IOFC 2RIKA 3F7VA 4XPGL 4EI6A 4BZYA 5E8NA 4CRPA 4YO0A 1CICB 1DEEA 1ZKAA 4HGMA 4HK0B 5GJSH 5MENA 3W9EA 1NSNH 5HYJB 3HPJA 3SDXA 3VXTB 3SKJH 4XTRD 4X6EA 3V6OE 1FZJB 5T1LA 1RVFL 1PLGL 3MQIA 2ICWA 5EBWB 5AG9A 4DEPB 4X0KA 4PJ5B 1WEJL 5EU7E 3WJLA 5J1AB 4DGIH 4HMDA 1BEYL 2KZWA 2E9IA 4FQXD 4NM8L 3FFCA 4JCMA 4YR6B 2XTJC 4J7RA 2ARJB 2FBJH 2VZTA 1YMMD 4WCYL 1BBDH 4Y1AE 3G5ZB 4JFFB 3FOLB 3RKDC 3F8UB 4JFXB 4YDIL 1TITA 1RZJL 1CDIA 2I25N 3AMKA 5ACZA 4XNMB 1KGCE 4HS8H 1LP9B 5F7WC 2AKRA 3HPLB 2G2RA 5KVDH 4R4BB 3EGSB 3VXNB 4F7CA 1NLBH 2ENSA 5EDXA 4JY5L 3PG2A 1FNGB 2BSED 5FYKU 1LHZA 3F6IA 3VA2C 2W9EH 2XZCH 4Z78B 5IB3B 4M7ZC 4PLJC 2B2XH 3R0NA 5I1KH 4L29B 2X4NA 2HYMA 4JQVA 3MA7A 3LQMA 1IEHA 3MO1A 1FL6A 2QV2A 5BCAA 3BPLB 1VGKB 3OJVC 1BJ8A 1M1SA 1NBYB 5DQ9B 1CGSH 3BXNB 5TDNA 4EI5B 3QWQB 1ZVSA 2Q8AH 3SKNA 4N5UA 3QFJE 5HVFB 1JI1A 2VQ1B 2VXSL 1BFVH 4CMMB 5I6XC 4L8BB 4M61A 1M7DA 1YPZF 2DIAA 3VFVA 4ELMF 1XGTA 5I76B 5D8JL 2WW8A 2P5ED 3OXRA 2EC8A 4RWYL 2R29H 4PG2A 3U30B 5FUCE 3OG6B 1UGNA 2EDHA 4YHZL 1SJVA 3KYMA 3U0TA 4P3CL 1QO3B 1MIEH 5C0NC 1FCGA 2JJUA 3K4AA 2B4CL 3OAYK 1PG7H 4IBLT 1OQOA 5FIEA 3LS5H 4M48L 3BP4B 4DOHB 3BIAX 4YWGH 1AP2B 3D39D 4YXLH 3MRHA 2CLZB 1V3JA 2QADB 1IC4L 4NO3A 3WIFB 1BFSA 3NCJL 5E6IA 4IJ3C 4ODWA 4PJIE 1U3YA 2Y25A 4PG9B 2UVEA 4KUCF 4RA3A 3X3FL 1AXIB 4MD0B 3ES6A 3O41B 3SDCB 3KXFD 2YPVH 1I7ZB 2CIKB 4Y4FA 3MFFB 5ERWA 4KMQA 2BHUA 3QUKA 1KOAA 1CBVH 2E5EA 1UKTA 3LHPL 2AJUH 4MS8D 3VE0A 4R0LC 5D70L 1I75A 3IDUA 4ODUB 1A6WL 1D5BB 4M5YL 3G5XA 5D71L 1T7XA 5IIEB 1G6RH 3IDMB 2DI9A 3ZKMD 1EBPA 3OAZH 3LKPA 2PW1A 2X70A 1G7LB 1ZWIA 5DEGB 5T33L 2GCYB 5SWZA 4ZOBA 4ENED 2H9GA 2RFXB 4QHMA 4XVTL 5LBSH 5C0CD 5MERA 1QEWA 3UCRA 2Q3ZA 1D5MA 5IBUB 4E0RA 1S7VB 2PXYB 3DVNB 4JFQA 4RZCB 4UTAL 3HE7B 1AR1C 3S9DB 2DMKA 4U1HA 4AEIH 1UWXK 3CXDH 3NBNA 1YECL 1JPFB 1F6AB 4B0MM 1NANH 3BDYH 4Z77A 3H2WA 1BQLH 1T89A 3JTTA 3QAZC 1P2CB 3DXAD 1QACA 5HVWA 2EE6A 4NT6A 5BO1H 3HZYA 4NN6B 4ZFFA 3TA3D 4BKLB 4K71C 2Q76B 2DJSA 1FHGA 4TVPE 4Y4KA 4CVWA 1T21A 2I07A 5F6HI 3B9KD 4HIEB 3VFUB 4ZMAT 4MJIE 4LLMA 5B3JE 4PD4K 1NC4A 4JKLA 1TENA 5EWIL 2XI9A 5TFSH 4H8WC 6FABL 4HWZA 3FT3A 1QLFA 3OKEB 3BPNC 2E7HA 4O58L 2FHCA 1QD0A 5H37H 2ZOLB 5EU6B 3ARFD 1MFCH 5DMYA 5IJKC 5D6CB 4MLIA 1G7MA 4KUZL 3EUUA 4XMLL 4GKNB 3Q48A 5ICXB 3IXAA 4WFGD 1D6VH 3GBNH 3BUTA 1BM3H 3C6LC 1HYSC 4F7PA 3UTSB 5I73B 3U0WL 4NZTH 3MR9A 3QULB 3CUPB 4B50A 5J13C 1W0VB 4I0KA 4PRBB 4NM4L 1GGUA 1DANT 4OLXH 3LQZA 2I9TA 5JLZA 3MGTB 3UTPD 3HAEH 1XGPA 2FJHB 5KS9A 2NQCA 3ULSB 1JHTA 1SQ2N 2BERA 4H0HB 4PJ8C 3EOAA 4P4KC 1T5XA 2R1XB 3RWFA 4FQIL 3DETC 3EO1A 3UPAA 3P4MB 5IMLA 2C1OB 4RFNB 3UPRA 3EDJA 2F5AH 3SKUD 4X6CB 2HA1A 1W72A 5HGAA 2YSSA 4UBDD 3SO3C 4X6BA 3TO2A 4WHCA 1Q38A 5IB2A 1CIDA 4H5SB 2FJGA 1CD1A 4POZD 1TTFA 3DYPA 4NQDB 4PJDB 3W9DB 1FNSL 3WUZA 3M17B 4OZHF 5HBBA 3NZHL 1ROWA 4GW5B 2H2SC 3VGHA 3FB5A 3WLWC 1P9MC 4ZG1A 4AJ0A 2DN7A 4G6JH 3LB6D 5DD5L 3FB7A 1L9NA 3BO8B 5JXAH 3A67H 1HXYA 4WENB 3MACL 2F58L 3MBEC 5ANMB 3OKDA 3CX5K 3VFRB 2BX5A 3I50H 4LBEA 4KGLA 1K8IA 4KVCH 1I1CA 3TJEL 1SYSA 5LG1A 5ALBL 2ZCHL 3KG5A 3CLFH 3RJDA 3KPSE 1EZVY 1DBAH 6CGTA 1KUMA 4JDVB 2W1NA 4YH6A 3L95A 1LO2L 4M4PA 5ETUB 4D9LH 5D1ZC 5EB9A 3MV8B 3KPNA 3SGEI 1G7PA 2O5ZH 2XKUA 1XF5B 2NY5L 4FTVB 5GJTH 3HS0A 3FJTA 4M3JA 3HB3D 1N6QL 1DUYA 3VFNB 1MELA 3CFKA 1E28A 3RBSA 1T7YA 4GW1B 4IHOB 3RFZC 1CLZH 3LCYA 3QA3B 5EIIB 5CJ5A 5F8QC 3RWHA 1CF8L 1VSCA 2AQ1A 5B8CC 3VGAC 1L0QA 2NY3B 1PDKA 1ND0B 2PO6C 3QEHB 2F53D 3ZL4H 4NO0A 5E4EC 3RY4A 4NO5B 5E8DH 4C54A 4LCYB 3VD9A 2WBJA 5F9WB 2AGJL 5CAYB 3HNTH 3RWIA 4OAWB 4PGBB 4LCWB 4JM4L 3GO1H 3RZCB 4MCYA 3WUWG 5EUOA 5DA0B 1UFUA 2BRQA 3I6GB 1ZANL 1ETZA 1JVKA 3H8NA 2DL2A 1JNLL 4OGXH 4XXDA 1A6AA 1GC1H 1ZSDA 5H94A 5DMGD 3B9DA 5DSCB 2P46B 1I4FB 4PTUA 1I3GL 1XCTB 1QFHA 5C9KA 5KG9A 1A1MB 3SCMB 1F13A 2DIBA 2FWOA 1QLEH 1SYVA 2DWDA 5EBGA 3VWKD 1JRHI 3TNNA 4WIQA 3RDTA 5HHMD 4M1GL 2BDNH 4IM8A 4ONOA 1CDCA 3WFHB 2QSQA 1GGBL 3IFOB 3ARBD 3OBAA 5ILTH 3T0EB 4ONHB 4LASL 4LDOB 2NYYD 1OOAA 2EDBA 4QHNB 2AJSH 5L2JA 4TPRL 2VZ3A 3O0RL 1GIGL 3TBWA 4AM0B 4ALAL 3KYOA 2VDLL 3QDMA 4JLRA 4QXTA 2ZUWA 5JIPA 1QR4A 2DBLH 4NJAH 5I71C 4GMTH 1MPAH 1TNNA 5CGTA 3BQUA 4S10A 4JDZB 3INUL 4Z7UE 5F3HB 1F4XL 5GS0D 2D7QA 1SEBB 2PTTA 4YHOH 3TCXA 2F54E 3GKZA 4DN4L 3IYLW 1QSVA 1IL1A 5BRZB 4TSBL 2V2XA 4GRLB 1U3HB 4LKCB 1ZXQA 5C08E 3S5LB 4ZAKB 2A77H 3G08A 3SE8H 5ESVB 4G43B 3QWOA 1A6UH 3OR6A 3FRUA 4PB0H 3GMPA 1U91A 1M71A 1LK3L 4M7JL 1UM4H 1MNUH 2RB8A 5C0RL 1L4IA 1DQJB 2WM0A 1VEMA 4CADA 1JIBA 1E6JH 1IKNC 1K8DA 5DEZA 1U9KA 4RAVB 5E9DA 2XPGA 2YBRA 1S7QA 4NJ9H 2PYFA 3I75A 3DX6B 5TDPB 2P42B 3C9NA 35C8H 2YS4A 1NMBL 4P9HL 1CD9B 5EZJA 1H3VA 2QQLL 5HHOB 1GVIA 3EOTH 3O9WD 1XGRA 4PJFB 3VXMA 4BFIB 4CW1B 1HNGA 5CCKH 1EERB 2ESVD 1Y6KR 1KLGA 3TH3T 3VWJD 2H6PB 4L3EA 1LDPH 2E27H 4L8SA 3I9GH 3QO1A 1W0WB 4K8RD 3NCEB 3IJYA 1L7TL 4LGPB 5TQ0L 3FN0H 2F74B 4N0FB 3QUZA 2DQEL 4UU9A 2NTSP 1JGLH 4LVEA 3JVGA 1T03H 5EA0L 1MCIA 5CHNA 5DRNB 4C83B 2QHRH 4OV5B 1MRCH 3BWUC 1OGTB 2P49B 4HD9A 4TUKH 3LSOA 5T5NF 5LWYL 4P2RA 1KJ2B 3P73A 2VISB 1FN4A 5BS0B 1IGFH 4LSVH 1ZT1A 2XN9D 3KDMB 2XQBL 3U9UB 4UDUA 3QRGH 4UUJB 4QRQA 4X7SL 3IAQA 3TVMB 2GAZA 4FFVC 3QIBA 4DGYH 1SY6A 3KPRB 1F5WA 3IJSB 5DO2C 4GKZA 4QO1A 1FIGH 4I77L 3SE3A 5FECB 1JGEB 3QB7C 1HDMA 3SPVB 2ATKB 1AI1L 3QUYD 3GSVA 1N5YH 4LRIC 4S1DD 3VFPB 3ARYA 4W4NA 2EIBA 4Y2OA 4PJ7B 4UQ2B 2MNUA 1CE6B 2Y5TA 1KEMH 1NMAL 4ZQKB 3JV0A 3ULUH 3I3EA 1XF3A 3LKOA 5C0EB 1ULVA 2QQKL 1L9MA 2HWZL 4RNRA 4G8GA 3T77A 3DURB 5FHBH 2BOBA 1KCRL 3MGOA 1QSFB 3BH9B 3BP6A 3FT4B 4P5MA 2WBWB 3SDAC 1BHGA 8FABB 4LSRL 5J6GA 3QUXD 5AAMA 4JR9H 4HS6B 4RGMB 4L4VB 4GRWH 1OAZL 4JO2H 3OKKB 1ORQB 4Y2DB 2HMIC 1OT2A 2MQ0A 4K9EL 2CK0L 4LF3B 3MJ8A 1YDPB 4F57L 2NY1D 1QFWH 4FQXA 2BSTB 5GHWL 1OAYL 4JRYE 5C07B 3VG0H 3P40A 5J6HB 1JV5B 3VFTA 3D6GA 1GGTA 2A9NL 5AUMA 2QSCL 4JFZH 3PL6C 2R2HA 3C87A 1SBBA 2WZPD 5L7XH 1UZ6F 4P2QB 5I1JL 1JN6B 5ACLA 2IH3B 5HYSG 3IT8D 5HVHC 5INDB 5ESQB 4NGHH 3ZDYE 1ACYH 1RK0B 1XIWC 4KJWD 2GUOA 4OUUA 4X7FC 2AEPL 5ITBL 3HR5A 3DMMC 5EBLB 5LCVH 3P11L 5D5MF 3I3BA 1CFNB 2QR0A 1WWAX 3CU1A 1UYWH 5DRXA 3UO1L 5JQ6L 5JNYA 4W4OC 5F3BB 4LNRA 2V7HB 4DZ8B 1OD9A 1T80A 5FA3B 4EDXA 2AV7A 1T22A 3GI9L 4PY7B 1M05A 5MENE 4FFYL 3T0VA 5BZWA 1BFTA 4TUJB 1A7NH 1E4KC 1CU4L 3SDXE 1CD8A 2VERN 5C9JB 2SEBB 5JW4M 4XCEB 4FZEL 3BGMA 4N0YL 3STLA 2EE3A 5I2IA 2A83B 1AJ7H 4XVJH 1LE5B 4MQXD 4JJ5A 4HDIB 3ZSSA 5HDOA 2N7AA 2EO9A 1IGTB 2BJML 3NH7L 4HPOL 4QHUB 5CEZH 1JTPA 1FLRH 4P5TD 1XGUB 2CMRL 3VXQA 1SJXA 1OM3L 2IWGA 3MCLH 3D39A 3TV3L 1KF9B 3QQ4A 2R2BB 2J8HA 5EUKB 4HUVA 4PRNA 2VAAB 3ULVH 2DD8L 3CSBA 4JO1H 3VXPA 1QSED 2WP3O 2ZUQC 4L9LA 4WY7L 5GGVY 4XBGA 3GI8L 4M43H 4KAQH 2X1XR 3BYTA 2CDEB 4JDTL 3IXTB 1UH3A 4ODSH 3T4AA 2DL9A 1WITA 4KV5F 5FYLD 1KG0A 3VXNA 5FEBA 1HQ4B 5FF6A 3KXFA 5EC2B 3T0EE 1R3IL 1Q9WB 4JG0L 2CLRB 3BPCB 4NQCB 2WK2A 3X3GH 2DYPA 3W2DH 5I8KH 4JY6B 1DQDH 3BGFB 4N5ED 1A21A 2ATPB 2J5LB 4HC1A 3KPLB 3CC5A 1S9WB 5KSAD 5EG6C 1MCEA 3TZVB 1JYNA 2BCKB 4G6MH 3CSYA 4X8XA 2VAJA 2V2WB 4I1NB 2VLRB 5I30L 2E7LC 5C0CA 1F11B 3O8XB 4K23H 4OI7A 4M00A 1G6VK 2AQ2A 1B9ZA 1RU9H 3V52H 4GG6B 4N68A 5KVEL 3RI5F 4AIOA 1P4BL 2NY4C 1S5IH 5KZCB 3NPSB 5JW5B 1RQ5A 2EDKA 5INCB 2GJ6E 2GIYA 5E99L 25C8L 1S7WB 2BRRL 3RUGA 3MJ7B 1NCNA 2V5SA 2VDKH 3DXAA 4A6YH 4TVSa 4HH9A 4O2FA 2KQNA 4TSAH 5SX4I 3TA3A 1XR8B 4YDJB 3B9KA 2YPLB 3EYSH 1LO3H 3L3GB 4J23A 2Q6WB 4WI7A 3ZT5A 4PG9A 2R69L 5LQBL 1JYWA 3EYQC 5I19H 1I9RH 4K07A 5TPWH 3THMH 4YLQT 3U0PB 2CD0A 3OAUL 4XCFL 3U9PH 3MLVL 4U3HA 4AIZB 5DJZA 3ARFA 4U0RC 3I85A 3ULUE 3UBXG 5GZNC 3WHXB 4U49A 1VFOA 1OARH 2C3WA 1XH3B 1U8JA 1RUAL 1K4CA 2D9QB 5K59E 1IAMA 2CXKA 1ZLUH 4PJGA 2VABB 1G7JA 3PDOA 5DEGA 4H26A 1URLA 5GS1C 4O2CA 1UM5L 1NCBL 3MRKA 1VFAB 1TZIA 4X6DB 4MJ5A 4OZFG 2YXMA 4YAQA 4YBQC 5BS0E 4PP1D 4JKPH 4DAGH 1S7VA 1IZKA 1W2KT 2X4TA 1XF1A 2DI7A 2XZAL 2DM3A 2W0FA 3SJVB 4XPAH 3VGFA 3MJ6A 3RY6A 2FEDD 1MJUL 3TCLA 4HIXL 1UCBL 4G8EA 1JPFA 1U8LA 2JCCA 3NACL 3QHZL 4UIKH 2NR6C 2R0LL 4ZPTB 4AG4H 1DCLA 1P2CA 1E4XH 4Q0XH 3LEYH 4H8WL 2Y7QB 4RWHA 1WWWX 5HHQA 5D2NC 4U7SA 5HPOA 4OTXH 4MCZB 4CU6A 1CXHA 4YHMH 3L3JB 5IOPA 3AU1B 1WF5A 3LPWA 4FQQA 2DKUA 3IU4H 3PF2A 1MLCA 5IROA 4ZO6A 4NC1E 4LPWA 5A3IC 2N7BA 2YPKB 4HPYH 5AAWA 1WBZB 2P4AB 3RGHA 1WICA 3IDIB 3UBXI 3L5HA 2D7TL 1YEIL 2KL6A 4RFOL 3UYRH 5DJXA 5FM5M 1NL0L 3VFGL 4F80A 1JK8B 2P1YA 4WTXA 4CVZB 5KVGL 1CT8B 1H15B 4UQ3A 4D8PB 2X7LB 4S2SA 3L5XL 3F5WA 4OIBA 3O11A 4WRLA 5E70A 3D9AH 4MA7L 5I1LA 3RIFF 3QCTH 4ZNEA 4KROD 1U6AH 3V6BR 1B0WA 3N1PC 5F71A 4MMXC 2ID5A 3BI9X 1C12A 4LSPL 3F7YA 1NGYA 2A0LC 4ZTPH 1YNTA 3UTSA 4RMWA 2Z0BA 5KS9E 4KKNA 1XF4B 4P2OC 2ITDA 5IQ9A 4GAYB 4PRBA 2FD6L 4P2QE 3VJ6B 4X9FA 1OLLA 2ZKHL 1L6XA 4RDQF 3D3VB 4LCCB 2E6QA 3WDJA 1PZ5B 4HUWB 2ZUUA 3FQWB 4JREC 4NRZB 4M6ML 1U42A 4JGJA 4F9LA 5E5RB 1PYWB 5FB8A 1CS6A 3WS6C 1DBJH 3ULVE 2JLLA 3H3PH 3O3UN 4YDLC 5F7EH 2B1AH 4KK9D 4XPBL 1SM3H 2HH0L 5IBLD 1JPTH 4G42B 5GGVH 1RK1B 5ADOH 4PJXA 2D0GA 3BT2L 4KY1H 4D3CL 5GGSB 1R5IA 5JOPD 1UZ8A 4NO2B 4Q9CA 5F1IA 3QT2A 4GRMB 3UDWA 4X5XB 5BQ7A 3DBXB 4GAGL 3WNPA 5D7JD 3ALPA 1WJ3A 2EZ0D 2VLKB 3KS0J 4XPFH 2LTQC 4DVBA 5FGCB 1YN7A 1YY9C 3HC0B 2F53A 3WN5B 3RWDA 2F5BH 3REVB 3W9DA 4FXGA 1QSZA 2IFFL 4PJAA 5KOMC 3HZMA 5FYLL 4JFDB 4GOSA 2HFFB 2V2TB 2VLJB 1XEDA 1FZMB 1E27B 1EK3A 3FMGL 3QIUD 5KSBB 5I1AB 32C2A 1BAFL 2DTMH 3VXOA 1H3PH 4F15C 3ARTA 1SY6H 4IDJL 1U3JA 3NIFE 3GMQA 4ONFL 2X05A 1R24B 2A6IB 3BFOA 1FG9C 3OKLB 5HI4C 4TYUA 4ONGH 3E6HA 3K8MA 4DGVL 1XF2A 1RZFH 3R1GH 4OSUL 3PXHA 4M1CC 1KT2B 4XZUA 2DLHA 3ROOB 3WKML 3ZDXE 1FGVH 3X14B 4B5EA 4KZEL 3RI5K 3EFFA 3VGDA 2NY6C 4MAYC 2CPCA 1R0AH 2NXYC 1I8LC 1KFAL 3RVXD 3ZSTA 1DJSA 2EC9T 4G9DB 4G3YL 4LVHB 4O5LL 3MRQB 3D2UD 2Y36H 3JWOH 4JHAL 1A1NA 5CIPA 4LHQB 2J6EL 1FDLH 5EU7C 4OB5H 4FTVA 1JHKL 4Y5XC 1FZOB 4JPKL 2H32H 5GGTH 2E3VA 1FVDB 1RMFL 4QT5B 2OP4H 5CBAB 2ZUVA 3BVNB 4IHOA 3S36X 1OSZA 5C09D 3MRIB 3QR2A 5JOFB 2HJFB 4OM0L 2IAMC 1AXTL 1Y0LA 4OLWH 2YA1A 1BVZA 2CKBL 1MCKA 1WFUA 3QHFH 1VADA 5IEHA 4KQ4L 3QI9D 4NO5A 5EUOE 1T66C 1A4KB 4X4ME 2JB6B 1D6EB 4C56D 5DXWA 3NCYS 1ORSA 5IM7B 2HLFD 4OGAD 3KR3L 2DQJL 4G5ZH 4OAWA 4PGBA 4LCWA 1JF5A 4IMLA 5D2LB 1R3KB 5C71A 1TZGL 1DVFC 2ENYA 5IFHH 1GZQB 4B41A 1UH4A 1JHLL 1NDGA 1JWSA 2CK2A 4F8QA 2AXFB 3QNZB 2EXWD 3UJTL 1MF2H 3IDXH 4F9PA 3JV5A 5IMKB 5EFIA 3CZFB 4NKDA 5DSCA 4E41D 4OLUL 4W6XB 3MRCB 1FYTD 4JM2B 3U7AA 3MLYL 4BFGA 3DUUA 3ARGC 4M93B 2NY0D 4PJ9D 1F90L 5FUCC 1OCWL 4XCNA 1MFBH 1ONQB 4YUEL 3GJEB 3WFZA 1MCHA 1AGDB 1F42A 4P9MH 1RSFA 3WFHA 3O9WA 3HC3H 5HY9A 3TO4D 3BAEL 3TEUA 3IFOA 4AEHL 1OPGH 2XFXA 4ONHA 5FDWA 2AP2A 3I6KA 1BZ9B 4MD4B 4UOJA 2ESVA 4Z7VF 4AM0A 4M7LT 3VWJA 3QEGL 1KJ3L 2OYPA 2E8YA 2GFBA 4DCQA 1U8QB 4FQ1L 3GSQA 2FHFA 4PRDB 3LV3B 4I8DA 1H5BB 3QIWB 3CXHJ 5H35B 4U1SB 1RIVL 5ITFB 4JDZA 3K8LA 2EEAA 5D7LB 4NRYA 1EVUA 1DDHB 1K5NB 2X89D 4N1HB 3KYAA 5K9KB 4HV8B 5DQDL 5H2BB 1A7OL 5IMMB 5DEFA 3QZWG 3WDIA 3CH1A 2X41A 3RIFK 4HIHB 1KPUB 1U93B 4IEFB 4PBXA 3QP3A 2IBZX 2XN9A 3RVWD 1IM3B 3GIVA 5M94B 4KTDH 5IQ7H 3N0PB 4XPTH 2D03L 5HHNA 2DF3A 4GRWF 4JVPA 3LD8C 4Y5YC 1BWMA 4J4PC 4XBPB 5E9DE 2DWEB 4HF5H 3IGAB 3P2TA 2W9DL 3HI5H 4HC1H 1CZ8L 4LSDA 1DQMH 4JANB 2Y6SC 1DQJA 1KENH 4ZUTA 4D0BB 4JO3H 5DZLA 3C6SA 3MMEB 4RAVA 3VXRD 2AJYL 4K2UH 4QCIB 3FT2B 5CLWA 3OKMB 5TDPA 4OF5A 5GIRB 4N8VB 2C26A 1KEGL 3D85B 5FYJH 5HYFA 3MTRA 4RGOH 5AD0A 3BEWA 1RJLA 3QUXA 1M7XA 3RNQA 2NXZC 1X7QB 4OQTA 4GG8B 9CGTA 1I7TA 3RRQA 2I24N 3SY0A 5HYEA 1IEBA 1H3WM 3GHBH 2JB5L 3ZDZF 3DRQA 2JJSA 1TQBB 3MX0A 1N5AA 3D25B 1CFTA 2KQMA 4KUCD 4P2RE 3ZKNC 4IRJD 4O00A 5GZOD 4B7LA 5BMFL 2DLTA 4G9FA 2UZIL 5ADPL 4HIIB 5IR1A 5F96L 2A73B 1OGTA 2FYYB 4P49A 2VC2L 2VISA 3UYOD 4D9QD 1G1CA 5FUZL 4ZUUA 3PABA 3DVIA 4MX7B 4NHUB 1J8HB 4DUVA 1I1AC 2DRUA 2Z93B 4G7YL 2HJLB 3C5ZD 3MCKB 4LOUD 3RU8L 3CPLA 1HH6B 1MLBB 2XWTB 4WWKB 1N2RB 5LXGH 4LDLB 1A7QH 3LKQA 4FQHB 2RBLA 3ARPA 4QF1A 2I27N 3H9SB 3C60D 3MJ9L 4G8GE 1HXMB 2XG4A 3N9GL 1N0LA 1CLOL 4PJ7A 4Y89A 3NFNB 1CL7L 2VLKE 4FQ2L 3S8WA 4ZXBD 1WAAA 2HN7B 2K1MA 4ZQKA 5IB1B 3C2AH 5IVXA 3O6KH 1ITCA 5T3XL 3K46A 2XRAL 2KZ1B 4Y16B 3HE6B 5I74B 1U8MB 1QSFA 3BH9A 3FT4A 1Z3GH 4XH2A 2QQNH 1I3RB 1PSKL 1GL4B 5HYSA 4LLDA 1OGAB 3PWLA 2HFGH 4NC2B 1UB6A 4MXWH 4HCRA 5CBEB 3RAJH 1WBXA 1YMME 5A2LH 3HUJB 4Q6IC 3VXUA 2V9TA 1TVHA 3FN9A 4MLSA 5CD3A 1H3XA 3ZKXC 1OSPL 3MYJB 2YRPA 4NYLA 1RI8A 4HFWB 1KELH 4C4KT 1R3JB 8CGTA 1YYMH 4HLZH 4FZ8H 3QPXH 1QSEA 3V4VL 2W9LA 1JV5A 1KYOJ 4R90L 1CICC 1CXEA 4LMQI 3ROLB 4OZHB 2APBA 5HI3D 2V9QA 1MHPH 1AHWB 5F6IB 4NNPH 4BELD 2BNQB 1YMHB 2NZIA 4ZODA 4MA8L 4DEPC 3LKNB 4JHBA 4M4RA 1A3LL 1TCRA 4XVSL 2F19L 3BN3B 3H9ZA 3VRLE 1N3NB 1PVHA 4PRPB 2WINB 2DMCA 4JRXD 4TTDD 1A6VH 5C6WH 3BD5A 4GXVH 2EH7L 5F3BA 5KSAA 3O3EA 1DANU 3MRFB 1ZEAL 4LCUA 1OAUH 2DQHL 3WFCL 4ZFZA 2P5EE 4XWOD 3S35H 2V5TA 3IKKA 3LVEA 2LE9A 3DO7A 2JTDA 3SGEH 4PS4L 2EIEA 4PV9A 4JZNB 3ZHKA 1P84K 2ZPKH 5IEKB 1EJOH 1CXKA 2IMNA 5GGUB 1MJJB 1NLDH 3HNVL 3L5WA 4NZJA 1NGPL 5JHDD