3BYTA

A complex between a variant of staphylococcal enterotoxin c3 and the variable domain of the murine t cell receptor beta chain 8.2
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
109
structure length
109
Chain Sequence
b'AAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T cell receptor beta chain 8.2
publication title Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
rcsb
source organism Mus musculus
molecule tags Toxin
total genus 27
structure length 109
sequence length 109
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2008-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bytA00
4D3CL 3MNZA 3OR6A 2AJZB 3QUZB 5KSBA 1YN7A 3DPBA 1VA9A 3NCBB 4IMLB 3WXWH 3IDJB 3V0WH 1WV7T 4HFWA 4MZ3A 4LHUD 4XP5L 1C5CH 5IHUH 5D93C 1UA6L 1WC7B 3EUUA 3B3IA 1K4CA 5L8JB 3FT2B 5ICZA 4J2XA 3QDJD 3DVGB 3T0EA 1RIVL 3EDJA 3GM8A 4Z7WF 5J4MA 2DDQH 3QEQD 5DEGA 3OSKA 3TPUB 3BKMH 2IF7A 4KI1A 4ZS6C 3JTSA 4Q9CA 5D1QA 3DLQR 3GMLB 4EBQH 1QUNA 1F4WH 4JZJB 5E00A 4Y16A 3KXFB 4MXWL 5DS8A 4P9HL 1KOAA 1O7SA 1YNTB 4JPWH 5GGVH 3ZDYE 5BXFB 3QUMA 4QHKJ 2FGZA 2AV7A 4GKOA 5AYUH 3ARFC 3D2UD 1FAIH 4AIZA 3ELAT 4JANB 3U4EA 2Y07H 2JIXB 4OZIB 4DOHB 5SX5K 4EEEA 3OAUL 4ZOAA 3ZKNC 5ENWA 1TZHB 2IPKB 4JG0L 2WBWB 4JFYA 2B4CL 4MJID 1ZXQA 3C5SA 2BHZA 3P0GB 3SPVB 1FPTH 5CSZA 2ZUQB 3G6JB 4PJ5B 1EFXA 4K7FB 3VH8A 4DZ8A 2P5WD 3B2UD 3RDTC 3QULA 1PBYA 4K55A 4KJPC 4JN1L 4M5ZL 1J0YA 5T1KD 2E9IA 1Q8MA 2OMBA 5C0IA 4GMTH 5J1TC 3G6AB 3CFDB 1U8NB 5DHYB 5EOQH 1E4XL 1I3GL 4RISH 5I9QC 4X4XA 1AGFB 5GJTH 4PLJD 2APBA 2X41A 4HQQL 4OZHE 2GSGB 4Z7UF 5I8KL 3UTZB 2EDOA 2YZ1A 5AUMA 1F90L 1HQRB 3M17A 2VZSA 3FHAA 1N5AB 1NJ9A 2IADB 1WBZA 4PJAB 4PGDA 1JIBA 5SWZB 3KYKH 4ZPTA 4ZUWB 5L9DL 3MREA 1DL7L 1TVHA 3BGMA 4K8RC 4YX2L 3L3KA 1AY1H 4N0UA 1XMWA 2YUWA 3N9GH 5E8PA 4F2MB 3VMPA 1TTUA 1X5HA 2X4OB 5C6WH 3PL6B 4W4OC 3ZT6A 4QOKE 3ULUL 4YIQA 3VRIB 5E08L 2H3NA 4V2CB 1G7PB 1BD2D 5DJ0B 3VGFA 1XGRB 1W72H 2D9QB 3D0VA 5KSVB 3QEUB 2PR4H 1AE6H 2PW2B 4WWKD 4I0KA 1DVFA 3PDGA 1BEYH 2HWZL 2NZIA 4KJWC 1QEWA 3ZDZF 1YYMH 4IBLT 3HPJB 4QO1A 3T4AB 3MV7E 4LKXB 1MHPH 4L4VE 2ITCA 5ERWB 3Q5TA 4X5XB 1TJIL 2DJSA 3CFEA 4MX7A 2SEBA 3BDXA 4HIIB 3K1DA 1U95A 3R1GH 2A77H 2XN9B 3KGRA 2H1PH 4YO0B 1BAFH 2VKXA 5T1LB 4PGEA 5EFIA 3WFBH 2D4DA 5D7KE 4E0RB 1Q0YH 5C0NC 3THML 1VFOA 4HPYL 2YEZB 4BSJA 1P9MC 1IT9H 4MCYB 3V6OA 1V3MA 2YMXL 1UWXK 4P2RB 5D7IE 4EIGB 4L8SB 2ESVB 1A1MA 4JFEE 3TV3H 1K4DA 4YXHL 2NY2C 2VITA 4M9PA 5KG9B 5CJBA 5D2LE 5IMOA 4NNPH 4DN3L 3GMQA 2J6EH 2IPTH 4HZLA 2D0HA 4UILH 1UACH 1I9JH 1TENA 3V52H 3IDXH 1MELA 1KTDA 4RMVA 4LOUD 3MRDB 4M6OH 4YHYB 1LE5A 3RWHA 5IFHL 3BE1L 2E7MA 3GRWL 1BFSA 1LNUB 3LKSA 4JM2F 1WWBX 2VLJB 1HHGA 1KBGL 5EU7E 3RL2A 3UBXI 4HFUH 1QBLH 4Y19E 3RU8H 2L7UA 3X3GH 4OD1H 1UM6L 1U3HB 4D8PA 3HAEA 2W9DH 5EU6D 2EDKA 3HR5A 5FB8B 1P7QA 5FK9A 3MGTA 3IJSB 3PGDA 1OAUH 3WO4C 5IVXA 4WI2A 1TNNA 2DKUA 4DWHA 3KLDA 1DLFL 1NGXB 3BO8A 4IRJA 4BZ2H 2JJTA 3QO0A 4YDLB 3AAZB 1GVIA 4PJCE 1NGZA 3VRLE 1AP2B 1EVTC 1LEGA 2FJHA 3OTTA 3QH3B 2IH3B 5D72L 5EU5A 3UTTA 5C71A 2EDHA 2FHCA 3OXRB 2IC2A 1IGJA 5EO0B 3MJGX 4PB0L 1BQHB 4LQFH 5I74C 1PKQA 3CMOL 1MIML 3C6SA 3VD4A 2G5RA 4FRWA 3WS3A 3J8F7 2VTFA 3QAZB 3LB6C 4RFOL 4M3KB 2ZOLA 3DOSA 5IMLA 2ZUTA 2FD6L 4PJGE 4UIKL 1ZLSL 1D5IL 3IXTB 1IAKB 1NSNL 2Z35B 5FGRA 1L7TH 3OXSB 3Q3GA 3K8MA 2Z31B 3QFJB 3IS1X 3MLWH 1U92B 1WIPA 3T77A 4UTAH 1RJZB 2WWKT 3PWLB 1XCQA 5AZEH 3S5LG 3V5DB 2E27L 3U0PA 3V4UL 4JFQB 2NY4C 3JWOC 1UH4A 4P23C 1IGMH 1GGYA 1JWUB 4ONFH 2NZ9C 1CG9A 4MWFB 3HRZA 1M6OA 1XGUB 2CLZB 3C60A 4MJ5B 2Y36L 5T3ZL 2IAMB 3SE3A 1UZ8A 3UPRB 1YDPB 3G6DL 1MWAL 2VAAB 2AERT 4PRIE 4OGAC 3KPPA 3GI8L 4CU7A 4ORGA 1U58A 1V3LA 3FO9A 3JWNC 2DLEA 1S7SA 4ZO6A 4OZGB 1QSFB 5CD3B 1KCVH 5F93C 5BRZA 4U6VL 2IBBA 1DUZB 5DT1L 2ICEA 2OSLB 3LRGA 4GQPH 4MB4A 5I73B 5T33L 3EO0B 3W82A 3AY4A 2M26A 4QHNB 1LE9B 3ROLA 1S9WA 5CD5C 3HI6L 4BH7A 1FL6B 4M1CC 2C3GA 4PJDF 3WFDH 3GSWB 5BCAA 5IBUG 3GBMH 4JGMA 3GSXB 1KN2H 4MA7H 1MFEH 3TBTB 2V2TA 1HHIB 3DO3A 4ZOEA 3SKMB 3KPLA 2HKFL 2Q8BL 4LPWA 4CU8A 3MV7D 3DX8A 5JOFB 1EAPA 2NTFA 3EYSH 3QP3A 1FIEA 3UPCA 3TZVA 4U7MA 5CEZL 3BPNB 2FX7H 2HRPH 3IAPA 4L9LA 4NKMB 2G75A 4KDTA 1XFPA 3SDXE 4F7CA 3VFRA 5HPMA 1I1AA 1N4XH 3BRDA 2CK2A 1MFBL 1TETL 1K8DB 1YQVH 2EO9A 1T0MB 3LEXB 1I1FA 4Y4HA 4LRNH 3SEPA 3WUWB 4UB0L 4K71B 5GGSA 3QFDA 3EOAA 4K8RH 3ZMRA 1VACA 1BWWA 4JFED 4H20L 4U1HA 4HAFA 5JHLH 2NY5H 2NTSP 4IRJC 2JJTC 1R5IA 4JKPH 3GEWB 1G9EA 3MRNB 4HCRL 5D1ZB 2XZCL 2A6JA 3RVTD 1CF8H 5FUZL 1MH5B 1DBJH 4BFBD 1E4WL 1BVLA 2EDDA 4K3GA 5EOTB 5HHQA 2FH6A 1MCLA 4QHMB 3PHSA 3IYLW 4PV9B 4RMWA 4XX1G 5DSCB 3V7AG 3IKKA 1Z5LA 4Y19D 3VI3F 1H8NA 1A1NB 1PDKA 4PTUB 3T8XA 2VISA 1RJYA 1XGYH 1QFUL 3STZA 2LAAA 2ARJA 5I16A 3H7LA 1A6PA 2VLKB 2IQ9H 5I6XB 4M02A 1ZEAH 3DV6B 3CSYA 5A40E 4YFDB 1U93A 3ARYA 5H37H 1UM4L 3SE3C 4LBEB 4HIJB 3QUMH 4X4YB 3UTSE 5BV7H 4OLUL 3GSOB 3AU1A 1J0IA 2VXQH 3OJDB 4R2GD 4F58L 5EH1A 4JG1H 4FABL 5FGCB 3SKJH 1DQML 1ZANH 2AABL 4E41A 4LLMB 3SKNA 3ZKSD 3AS2A 2XA8L 1NGWB 3P73A 1IILE 1ED3A 4Z18A 4MQXD 2WWKO 3MRIA 3F7RA 1DQJA 4GW4A 3QIWB 4A2MA 3I2CH 1ZHKA 3LEYL 5E6YA 2QQNL 4LLYA 5I8CB 3MR9B 3ULVF 1DBAH 4NDMB 1NFDF 2VZUA 4KU1A 5B3NA 4PRID 1IC5H 1EZVY 1FNGA 3F62A 1IM9D 4U0RB 5GZND 4MLIA 2JELH 3I75A 2HN7A 4L9LC 1YEIL 4PJBB 4R8WL 2Q6WA 5KVFH 3BXNB 4ZAKB 4NC2B 3EFDH 4YPJA 1TVDA 3SGDI 3W5MA 2AK4B 2MKLC 5CZXC 5C0GA 4XMKL 3O2WH 4Z0XA 2ZUVA 3PP4H 1KCRH 2YKLL 3SQOH 2NY1C 1CK0H 5FGBA 3U36A 12E8H 4CBPA 3GMOB 3DHMA 1N8ZB 3DARA 1S7QB 1G7LA 3B9KA 4QRQB 3SDYH 5LG1A 2XTJE 1JV5A 3WBDA 1OGAA 3QDMA 2BFVL 4TSCH 3DSNA 1OSZA 5EN2B 4I0PD 3C5ZD 4M43H 3OG4B 4TN9A 4QF1B 2R4SH 5ADOH 3UP1A 4XVSH 1ZLVH 1FVDA 4OIAA 4C83B 3PWVA 3MV9E 5IB4B 2C7UA 3LHPH 4P2OB 3W11C 1K2DB 3QZWG 3JXAA 3JWOH 4XBGB 4LSTL 3IXAB 1KYOJ 1H5BB 3WJJA 2BHUA 5FYLL 3HNTH 3DSFL 2X89D 3GSUA 3O81A 3D0LA 4DW2L 5EZOH 2V5MA 3LRSA 3QG6A 3O4LA 2A6IA 4PG9B 3PV6A 1IL1A 2XWBA 4Y8AA 2VDKH 3GHEL 4LSSL 1XF3B 5JW5A 3LN5B 2ITDB 1CTNA 3EOTH 4P2QB 1EK3A 2WLYA 4YK4C 4YXLH 4P4KD 4HJJL 3MLZL 2R15A 3QHZH 1VFAA 2YPVH 3DMMD 4U6XA 2XNAB 5ETUB 1P4IH 4JO1H 3VMOA 4H8WC 1QFWM 3NVQA 3NIGF 3WD5L 3U2SB 4NUJA 4TSAL 2B39A 2YD2A 3OKLA 4PJHE 2R0LL 3L3IB 3VXSA 5B8CC 5MEOB 1NFIA 1Q9LA 4XVJL 1GXEA 3UJTL 5D2NB 1FO0H 4OLXH 4TYUA 1J5OL 1CGVA 5CMAA 3NTCL 2X4SA 3S88L 4BQ8A 5FM5O 5FHAH 3B43A 4FQ1L 1G7IA 3QDAA 4U33A 1ZE3C 3R0NA 5LGHH 5DJ2B 3GJEB 1EA9C 2X4UB 2NY3B 1AIFA 2CLVB 5B4MD 3FO1B 1UJTA 4HS8H 3F58H 3IJHB 3OKEA 5IEHA 2IAND 3Q5YA 1JI2A 1OAQH 1CICD 4DK3A 3REWA 1V3KA 4LU5L 4Z9KB 4OZ4A 3RIFF 4OUOA 2XXCB 2HLAB 3MRBA 1UJ3A 3O8XD 4U3XA 3P0YL 3UTSD 4P4RB 3IU3A 3GSQA 3SGEI 5CUSL 3HAEH 3O6FB 2HRLA 3LQZB 3NFNA 4K23H 4LSQL 3QG7H 1CZ8L 2APWA 1KCLA 2CRIA 4L3AA 3VFNA 4Y5YC 1ND0B 2FH8A 4L4TD 3AB0B 4GO6B 3RVVD 4S1QL 4JY6A 3VXTA 4FQLL 1HWGB 2F5AL 2YSSA 4EXKA 2J1KA 5CBAA 5HGHA 2IBGA 2J7LA 2JKXA 4JN2A 4OQTH 5F1NB 5FGBC 2DYPA 1K3ZA 2A6KB 4N1EA 1KGCE 1UH3A 5I76B 4WJ5A 1B2WL 4DZBA 5ALBH 2X42A 1AJ7L 1U3ZA 3RVXC 1UQSA 2VQTA 4JJHA 4LSRH 2FO1A 3BKYL 4ZD3H 3DWTA 3OZ9L 4YPGA 3KDMA 3ALXA 3O6LH 3D69A 4RGOH 1SEBA 4LIQE 5C0AE 1FFOB 1KJVB 1HXMB 3SOBL 2XFXB 3W39A 3TA3B 4NQTA 1YPZB 3NIDE 3PABA 4XP9H 1SJXA 2VLRB 3NFSL 4EJ1C 1QSEE 5DO2C 1C12A 1Q38A 2PYFB 2PNDA 4GH7B 5LXGH 4MDJA 3V6BR 4Q97A 4X7CC 4KK9C 4M9OA 1U8HB 3EKCA 1S3KH 4Q9RL 1T7ZA 3K7UA 3QEGH 3CZFA 2XWJA 3DRQB 1JRHI 5KVGL 3C8HA 4OFKA 4WI3A 1UVQA 3HUJB 3NPZB 1FYTE 2B20A 1JMXA 1MHHA 4HKXA 4DGVH 3A6CH 4OCRL 1BGXH 4WENB 3LKQA 2AQ2A 5KS9F 4TNVK 2A83B 2EKSB 2DI8A 3RHWF 1A6WL 3CIQA 3BVNA 3MRKA 1KTLB 4NFBA 3MV9D 1I8KA 2W92A 2BJML 1P53A 2R2EA 1J8HB 1KV3A 4KKBC 1ZT7A 1R0AL 4UTBL 3DUUA 2DKSA 4QXGH 5EA0L 1HILB 5DJZA 4ZXBC 3ZTJH 2YRLA 4YZFE 3RKDD 2WINB 5E6IB 3H6JA 1NPUA 5FOBA 4Z7WB 2RAMA 3ROOB 3A67H 2NR6C 3K4AA 2F8VA 4MXVF 2DWEB 4LCWB 4KI5E 3VXUE 1NANI 4RMSA 3V4PL 5I1JH 1IFHH 4FQQB 1B0GB 3MLVH 1CS6A 3HFMH 4WU5A 4POYA 5IR1A 4KK5D 3W0WB 1REIA 4ELMF 2BNQB 3CFBA 5JZ7D 4PJEF 1QBBA 2J8UB 4YC2B 2YUXA 2VJXA 4OF5A 3UTQA 2GJ6A 4FTVB 1R3IL 4HF5H 2A73B 1AD0A 4KHTL 3EDDA 4DGIH 3P30H 4D9RD 2W1NA 3D39B 2EEAA 3CFKB 4NFDA 1L0XA 1PQZA 3L5WA 1GZPA 5ESVA 4DVRL 4BSVA 4D0CA 1NCBL 4Y4KD 3SJVA 4PLKC 5C0CE 4RX4D 5L2KB 3K2MC 3H0TB 5IQ9B 1XR9A 3FOLA 1KJ2B 3H9HA 2QQKL 3QRGL 1HOCB 4G9FB 1G1YA 4XCNA 2HT4C 2X9WA 3FQNA 5I1KL 4HUUA 1OP5K 4O2FB 1YMMB 2J88H 2YD8A 4L29A 2YA1A 4OD2B 4XNUH 1MCSA 2AJUL 5JORB 5AYQA 4S10A 1NAML 2KQNA 2PXYA 4XCEB 3KLHC 4X6CA 5E2VL 1CBVH 1TJHL 2H6PB 1FSKB 1WLHA 2BSRB 5A16B 3WFHA 2O5XH 4JCMA 2FR4A 2DQIH 2Z91B 4P46D 2OK0L 2WIIA 5LGJA 4X80L 5T5NG 1GPOH 2HFEB 5DD0L 5DJCA 3P9LA 4F33B 5DQJA 3X3FL 1WK0A 4Y88A 1J05A 1JPFB 5IW6A 5D8JH 3B2VH 3MFGB 1KEGH 3L7EA 1MFCL 4OB5L 4GAJH 2NXYD 5GISL 3JZ7A 4JDZA 2PTTB 5JHDB 2EZ0D 1UZ6F 4U1LA 3ZYZA 5E8DH 4YXKH 2HG5B 2Y06L 3B6SB 3HG1E 4Y4FD 4QLRA 2F58L 3R0MA 5GGQL 3WDHA 4Y5VB 4H8WH 4OCSL 4XNYH 2IALB 3H2WA 4XPTL 3VFUA 1S7TB 2BNRB 5ALCL 1C16A 2LVCA 2GTZA 3BESR 4HV8B 3T3ME 1N3NB 3BZFA 1OARL 1X9QA 2FEEI 2ADFH 1T1ZA 3VDBA 2GY5A 2NXZB 4IOFD 4L8CA 1MEXL 3U46A 4OF7A 3K2UL 3ULUE 5H94B 3WE6A 5J12C 3ES6B 4ENED 3X14A 1CFQB 2D4FA 4PD4K 3RNQA 3QO1A 3VW3H 3BP6B 4C59B 3EYOB 1TPXC 1IQWL 2ZUXA 2VRAA 2ZG1A 1BZ9A 2ZPKH 1FAKT 5L2JB 1JVKA 3RZCD 2WIMA 4Z5RA 3RWEA 4JDVA 6FABL 2C3HA 2WQ8A 4LAQL 2NW2A 3RX5A 2FBOJ 5T5FH 1FYTD 4PB9L 5B3JE 2Y7QB 2H9GB 3LKPB 4HW6A 5E9DA 2ED9A 3LDBB 3S97C 1V8HA 5FDWA 5JW4Q 4CJ1A 1B6DA 3BP5B 1BM3L 2ARWA 4HX1A 2FB4L 1YNKL 1A6ZB 3P77A 4IEFB 3IB4A 3VXMB 3FT3B 2H45A 3BP7A 1JTOA 1J0HA 4Q6IB 3EIFA 1FFNB 1X44A 1XR8B 5JLZA 4TVPH 4WW2F 1ETZB 3TC9A 5HHMD 3T2PA 3U0TA 5JNYA 5CGMA 4CMMA 1KELH 1K6QH 3I9GH 4ZG1A 4J8RA 4HIXH 4OFPA 5LBSL 1Q9WA 4CVZB 2C4XA 2FJGB 3QUXA 4UV4L 4PRBB 4LLUB 2NW3A 5SWSA 4KI5D 4I4WB 4LHUG 3VXUD 5J13C 1YUHA 2HJFA 3HE6B 4X7SL 2H2SD 4PJ7B 4Z7QE 1QBAA 2YN5A 4OZIE 4MJ6A 4I77L 4ONGH 5I1GL 1ZGLM 8FABA 5D5MA 5KSBF 4HLZG 4AENA 2X4QA 1LILA 2UWEA 3JWDC 1KJ2L 1YEEH 2VDOH 4G6AD 4WEBL 4Y7MA 4GT7A 3CDGB 1C08B 5C0FA 3G6JE 1Z9MA 2FATH 4PJ5E 1Y0LA 5EO1A 5HHPB 3SCMB 3B9DA 1EEUA 2ZJSL 4DKFH 4FQXA 1QLEL 2X4TA 4NFCA 1A64A 3UJJL 4U1IB 3L1OL 3H7BA 5I1AB 5K59E 5C0CD 1RZFL 3IDIA 4S1RL 2HAZA 3SY0B 3QUYD 3VXQA 2EH7L 5FHBL 4TOYL 4YUEH 1F3DH 2BP3A 2AGJL 1S7VA 4Z0BH 3OR7B 1NC2A 4KUCF 4D0BB 4FOMA 4GRLD 4LRIA 3IDMB 3QDGA 1ZLWK 2EDWA 5D1XD 4AQ1B 3BRFA 3KJ4C 2OZ4L 5IMKA 4LPCA 4NHCH 1RZKH 1B9ZA 2BOBB 1HDMB 1DTUA 1ZLUH 4MNQA 2WNGA 1HSAB 4PJAE 2RHEA 1OAZH 3MBXL 4N1CA 3BYYA 4MQ7A 1C1EL 3IF1B 5I1IL 3T0AA 4KHXL 3EHBD 4NWUL 2B5IB 4Y5XB 3S5LB 5IKCA 2Z8SA 3UTPD 1CLYL 2OJEA 1XGPA 5CSGA 3DVIA 5JO5A 1RZ7L 1VEPA 2R2CA 5HHOB 3TWCH 1IGCL 5EO9B 4UQ3A 1WAAE 5D7LA 5T3ZE 3JTTA 3RA7L 1EEYB 4GQ9H 4JKMA 4JM4L 1HH6A 2IG2L 3PXJA 1JPGA 4TRPH 3AREC 5CHNB 4PRHE 32C2B 4OV5A 5I17A 4HT1L 1A7PH 1D5ZB 4EIZC 4OFYD 3QQ3A 2P5ED 2AJSH 1TCRA 2Y9RT 1G6VK 4XTRD 1NGQH 4R4NC 4GKSB 3TO2B 2VERN 1MRFL 5FKAA 1QLRB 1HZHL 3KPTA 1I7RA 5E8EA 35C8H 1FDLH 2P47B 2JTDA 3LZFL 5JIIA 1GGBH 4QRSA 1M4KA 3MX0A 1HKFA 2H32A 2YPLB 2XN9E 1YC7A 5IBTH 1F3JB 4E42A 4WUUB 3AS1A 4KRMB 5B39A 5ECJE 3QUXC 3S36L 4H88H 1ORQA 1LO0L 3QUZD 4FFZL 5A2FA 3QDJA 3MV8D 5JA9A 2DRUA 3U7AA 1IQDA 1NBYA 4KRPB 3N1MC 4ZFFA 1QBMH 5FA3B 5E94A 2WP3O 2XI9A 3QEQA 3HC3L 4JFXB 4JHAH 1LDSA 4U3CA 5D96B 1CL7H 4ZPVA 5CEZE 4P2RE 2BCKA 2ESVE 4AK1A 4M6NH 4KKCC 3IKCA 4IRSC 4MGXA 4M7ZB 1FN4A 1L6ZA 2B4CC 4UT7L 4FG6D 4FFYH 3MYJB 1VERA 3DX9A 1BIIB 1H0DB 3GIVB 1S7RB 3LIZH 4U6YB 5EWIL 5IHZB 2IPUG 4IOIB 3MO1B 4GBXB 2L0DA 3C09B 4HZAA 4ISVB 2VLJE 3BQUC 3KXFD 1XF5A 4ODTL 1MVFA 2CO7B 4RAUA 2F74B 4MJIA 1NCCL 4QTHB 3G5VB 2EXYC 4KH2A 4LCCB 5CP7A 3S98A 2I5YH 2P5WA 4P3DB 4RFNC 2MCPH 3GUTB 3FB8A 5E03A 1AKJB 5F9OH 2JIXD 5C09B 1Z6JT 1OF2A 5C0JB 3W9EB 3DRTB 5IT2H 5T1KA 5ITFA 1JFQL 3T4YB 3HZVA 5A2LH 1RK1B 3U1SH 3UYRH 4PJ5D 1RIUL 4M62L 3BH8B 3T04D 3LMJH 3O6KH 1MFAH 4PR5A 5IP4A 1KULA 2FJFA 4KK8C 3VFGL 4RMUA 5J6GB 5AG8A 5JMRA 5IVNA 4HJGA 3EYVA 1ZMYA 1ONQA 1F8TL 1KENL 4A6YA 5D9SA 3T2NL 2HVKA 2QKIA 2CKBB 1JGUH 1MI5E 3K4DA 1FZKA 4M93B 4OFDA 3IFNL 3NCYS 4U1JA 2EDQA 3LS4H 3ULUC 1BOGB 4JPVL 3L3GA 3QFJE 2XZQH 1VGKB 1T1YB 1RU9L 2GKIA 4JZOB 4FNLH 4U05A 2VUOA 1LEKB 5I2IA 3MJ9A 3S34H 1MCJA 2XV6B 4JB9L 1A7QL 1CLOL 4OAWB 5HHVH 3VGAB 3FZUC 1AXTL 4KUZL 1JRHL 5SWZD 4CU6A 1IE5A 3LY6A 3CDYA 5IVXF 4CVXB 4K3EL 4XPHH 3WIHA 1UB5B 2I07A 2W60A 4K3DL 4KTEH 3ZKMC 4PRPB 3FKUS 2VQ1A 3NMEA 1N59B 5TE7L 3TPKA 4ZFOA 4WWKA 4TPRH 3ARDC 3IT8D 3IVKB 5HHXL 4W68A 1CQYA 5ICXA 1KSRA 4TQEL 1I9RL 3PL6D 4OZGE 5FO8A 3VFMA 4PLNC 1YJDL 3JWDH 4RDQG 3JV6A 4UOW0 1MJ8H 1ZA6A 4EUPA 5F9DC 3ULSB 4QGTA 1QNZH 2O26U 2WK2A 1CXFA 4XMLH 2FIKA 4GG6A 1KJ3H 5D7SH 2R29H 5DDHA 1YY8A 5ACZB 2Q76B 4GRWH 3KYOB 3F8UB 5DHVA 3S37L 1H15A 3EYFA 3TT3L 3PV7A 4P3CH 1T1XA 4DGYL 4X6DB 3BHBA 1DZBA 2J8OA 5SWQB 4OUUB 4FQJH 1FL3B 3GMMB 4N68A 1EUTA 4NN6C 4OKVA 4JRXD 2FIRT 1OTTD 5JIHA 1EAJA 3HC0A 3UPAA 3MLXH 3E6HA 3VDCA 2R0KL 2Z9TA 5CILL 5T1LD 2DQDH 5E4EB 3GKWL 4H5SA 3HCVA 1B0RA 1W0WB 2MWCA 3QQ9C 1GSMA 3SN6N 4P57A 3PDOA 2FX9L 2VXVL 5IW1A 2VL5B 4NZJA 1GAFL 3SHSA 2AEWA 4JFDB 1S7UA 1TLKA 2X4RB 3TJEH 3B2UC 2FSEB 4NUGL 1K8IB 4BYHA 5CEZD 1CVRA 4P2RD 4NQVA 3CLFL 3IFPA 1W8OA 2ADIB 5DJXB 4AEIH 4XHJC 5MI0B 3O3UN 3QZWB 5FO7A 4MCZB 4N5EC 2OLDA 3F6IA 4X8JB 4DVBA 2HH0H 5E1AB 5FFLA 3FO2B 1DBMH 2WBJA 4HS6A 2P44B 1E27A 4WDIB 5EU6A 2RFXB 4YHMH 4D3CH 4RSVA 1QRKA 2HKHL 3T3PE 2QHLA 3OBAA 4TUKH 2VLJD 3VWJB 4G43A 1RUPL 5TF0A 1T1WA 4QRRA 3ZTNH 1AR1D 5KAQG 4JY5L 1FZJB 4N8VB 1U3HD 4O2EA 1YMHA 5C1MB 3C5JA 3HB3C 4PTTA 3DV4B 4KV5E 3NGBC 4WEMB 3Q1SH 1JGDA 2OX5A 2VLKE 1I75A 5EBWB 2BY2A 3DXAE 5CS7A 4WV1A 1SEQL 1CT8A 5HYSA 2VZOA 5DK0B 1G9NC 4HPOL 4KDWA 1J12A 4P5TB 4G6KH 5C8JA 3A6OA 1KIPB 1R3LA 1CGTA 1RV6X 4LLAA 1N7ML 5DRWA 1U2HA 2FECL 2D31A 2GK2A 3F6LA 1I1RA 2DBJA 3GNMH 2JB6B 3LPWA 4LHQB 1AI1L 2CDFA 2PO6C 3KNBA 4I48A 2FX8L 1U41A 3MFFB 2VR9A 4GLRH 5I8EB 2Y72A 3OAUH 2Z31D 1ZGLA 3QFJD 4JG0H 2B4CH 1IBGH 3P4NB 4OM1L 4ZO7A 4HIHB 2CMRL 4U1KB 3MUHL 2I9LB 3ULVL 1BVKB 4XVTL 3TO4B 4NSKB 4RWYL 3QBTB 4H26B 4L3CB 4OT1L 3WNPA 3MRMB 1I8LA 4M5ZH 1E28A 2FO4A 4R90L 1INDL 2CUMA 2UVEA 4OKDA 4JY4B 2IAMD 5HHNA 4N1HB 3EYUL 1CIUA 3WFEL 2XRAL 3WXVL 1E4XH 1NL0L 4RAVA 1A9BB 4GKNA 5ANMB 1WWAX 1PYWA 4HQQH 1QFWH 3D18B 4R97B 1QSFD 4WHCA 4HKBA 4XWOD 4YFLI 5I8KH 3S35H 3DUHA 1LK2A 5F72S 3PUCA 1Q94B 3MRFB 1EFQA 4BFIA 4R4FH 4P3WA 1WFTA 2EDEA 3C6LB 3MLPA 3CPLA 1IGFH 5L88H 4OGXL 4WI5A 2EEDA 5L9DH 3TLRA 1W72B 2OQJA 4JO4H 5EIIB 1DL7H 4LCUA 1M1SA 3HTLX 4YX2H 2D03L 2AEPL 5ICYB 3T2OA 4AIXA 3O3BA 5FCSH 3L3HB 1D5BB 5DXWA 2NPLX 5EZIL 2OL3A 2X70B 2V9TA 1JN6B 2WBJC 2AK1L 5EC1A 3MLYH 3KPRD 5E08H 3V0WL 5DMYA 5DQDH 4WTZA 2G9HB 1J18A 2QHRH 2OS7A 1NBQA 5C70A 4JFEA 1RULH 4U49A 3MUGB 3EJZD 1E6JL 3PHOB 1V7NH 5IHUL 1WFUA 2C9AA 4XP4H 3HLAB 4PJ8C 3IETB 5DWUH 4HGKC 3NFPA 3ARRA 5JXAH 1U8JB 3SDAC 5CJXA 2AP2A 4PJIA 4XC3L 3GHBH 1U8IA 5L6YH 3UEZA 1KB5A 4WV1C 1KF9B 4WU7B 2QSVA 3BKML 4YDJB 4P2QE 1D9KB 3BPOB 5D1ZD 4LLDB 2VWEE 1II4E 4Y19A 1ACYH 4YDVA 4EBQL 1T20A 3CAFA 1F4WL 2AEIT 4NQXB 4C56E 3BDBA 2VZ3A 1H3WM 4R96A 2HLFD 3W9DB 4JPWL 5GGVL 5KOMC 3VXOB 1ZS8A 4IJ3C 5AYUL 4UAOB 4Z77A 2P8MA 4W6XB 2XZAL 4HPYH 3THMH 4EVNB 1FAIL 2GY7B 2Y07L 1UCTA 4S1DD 1S7XA 1TJGL 4WCYL 4EI6B 3W81A 1AHWB 2VC2H 4ZUTB 2VLKD 4DN3H 1KB9K 1JPST 5E8NA 4PUBH 1NDGB 4KZDH 3KPOA 5KSUA 5DMJB 3S4SG 5IFHH 3QI9C 3BE1H 5F3BA 2X7LB 4PY7B 5CJ5A 4NO2A 1JPSH 4NNYA 4RISL 3UYPA 3OKKB 3PXHA 1NGYA 2VIRB 1MUJA 5GJTL 3JUZA 1UM6H 5BS0B 5KVDL 4R26L 2ZSVA 5T1DH 2XTLA 3CK0L 3WEXB 2BVPB 3RVUC 3RWIB 4F15C 1ES0A 3D85B 4JJ5A 4KKAC 3KVQA 2OJZL 1A7OL 4EQ3A 3EGSA 5D93B 4P49A 4F8TA 3KYKL 5GGTL 4K7PY 5D72H 5GSRB 4JFFB 2YRPA 4PRIA 1MLCB 1YN6A 5F44A 4AT6A 1IM9A 1FVEB 4U1MA 3QIWD 3ARGC 1WZ1H 4A6YH 1MIMH 3N9GL 3FB5B 1KJMB 4GKZA 2G5BB 5IBLC 4RFOH 5FEBA 3ALWA 2V9QA 3I3BA 3KLAA 4UIKH 3RNKA 1RK0A 1D5IH 1YPZE 4NHUB 1NSNH 1ITBB 1L0QA 1W72L 2VLRE 2PR4L 1IAMA 1AE6L 2VQUA 4ZAKD 5H8DA 3ARFB 2GSIA 1BEYL 3GBLA 1K5NB 4EDWH 2AK4D 2GK0B 1G9NH 1LO4H 4LPYA 5C08D 3N1QC 3C5ZA 1YYML 4JFOB 4JEGB 2JCCA 4JKKA 5ADPH 1CWVA 3AM8C 5F9JA 1MHPL 1FZMB 3B9EA 5FYJH 3HUJE 5GRVK 1HK6A 1D5XB 3VFOB 5K9OA 3OAZK 2KZ1B 1EBPA 3RDTB 3SDXA 1MWAH 3R1GL 4BM7A 4G8EA 4OCXL 2A77L 3RIAK 3RVWC 2H1PL 3WFZA 1BAFL 1A2YB 3MNVB 4ZMAT 2X4PA 3WFBL 4PGJA 4UMGA 1CD1A 1P6FA 2X89A 3BZEA 5IJKA 2NY7L 5T33H 5I9QB 3RTQC 3X13A 2FLRT 1AH1A 3FOMB 2V7HB 43C9B 3VFTA 3T1FB 5EUOB 1R3JA 3TV3L 5DHVH 4QRTA 3LH2L 2JF1A 4Z7WE 1UT9A 3DMMA 1NBZB 2HKFH 3EFFB 3L7FA 3V52L 2B1HL 5KANG 3RWJA 2DD8L 3IDXL 1MRCH 4LCWE 5D7JC 2W9EH 1RZJC 2RR3A 1OTUD 4GW5A 1TITA 4R2GC 4NO3B 4G80A 1P7KB 4PPTA 3OJMB 3ZT7A 3SE8L 4R7DB 1I7TB 3W0WE 5J9PB 2Q7YA 2ORBL 4GUPA 2BNQE 1QBLL 2H2PD 5FF6B 2J8UE 3WYRA 2COQA 2IQAB 1MCOH 3TBYB 3MRLA 1P4LB 4FTVE 3MNZB 1OAUL 2IANA 3WMSA 5E1HB 4NRZA 2BOCA 3H3KA 1CICA 2DMKA 4BZ2L 4KJQC 2ZOKA 3TYGH 4H20H 4K9EL 5L2KE 5E8OB 4BUHA 1PG7L 1ZGLP 2EXWC 4N9OB 3REVA 3O8XA 4AL8L 4G9FE 3UTSA 4S11A 2IJ0C 4MXQD 1PY4A 4UU9B 5EU3A 5FUZH 4IIQB 3PJSA 4OTXL 1FV1A 4OCLC 1BFVL 5JPNB 1E4WH 4TSBL 3X17A 2Y5TB 4L4TA 2OXGA 2BC4B 1BX2B 2HT2D 3R4DA 1L7TL 3AMKA 1FIGL 1QP1A 5I66A 4HKJB 3O6FD 1TMCB 3MRRA 4XWGH 3QUMB 3S3PA 5JHDE 2HVJA 3RPIB 3VGDA 1I8IA 1IC4L 4LSVH 2NY2B 3C5SB 4I5BB 5F71A 4KRNA 3VD9A 3A6BL 1HWHB 1UM4H 4F3FA 1C5DB 1JGLH 2BNRE 3RWDA 4OLUH 2GJZA 1IAOA 4EQ2A 4P9ML 4UIMA 3TA3D 1KCVL 2K9UA 5BZWA 5AEAA 4FABH 4XVUC 4M7KH 4X6CF 2VLRD 4ZOCA 2AABH 1PEWA 4MD0B 3N85H 2FYYA 1T4KA 1V3JA 1P7HL 4FZ8H 1QKZL 3ZDZE 5AAWA 3WO4B 1KN2L 3V0VA 2A9ML 1EO7A 5AUMB 2EYTA 3EZ8A 2VWEC 2WZPD 1JHTA 3TBVA 2ZUUA 3LEYH 2ZKHL 1EXUB 2QQNH 1WBZB 4ZFZA 1EVUA 1FH5L 3B8SA 3DMMC 1JWSB 5ESQA 1T6WA 3BH9A 5BQ7A 4YBQD 4F7MA 2VLLA 2E8ZA 1Z3GL 3GB7B 4NT6B 4MNGE 2FX7L 3L3KB 4QWWC 3TNMB 5I74B 2K7QA 1G0DA 4N0UB 2WWMD 1U91B 3VXME 5F7DB 3ILPA 2Q3ZA 2J3SA 1N4XL 1S9XA 5E8PB 2DBLH 2BVUA 1MY5A 4J6RH 2FL5A 4HUVA 5DZLA 1DE4B 4LRNL 4YIQB 1U6AL 1J8HD 1DCLA 2E7CA 5C6PB 1HH9A 1XGQA 3D0VB 3MJ8B 2PYEB 2V5RA 1T22B 5JHLL 2NY5L 3WN5C 4J7RA 3T2QA 5DRXB 5LCVH 4JKPL 4L8BA 3DVNB 5DUMH 2NY4B 4Z78B 4P23B 4FXKA 3NCFB 4NJAH 1JZ8A 4L3EE 2OL3H 3F12B 5E5MA 2CIIB 5I1EH 1DBJL 4Q7DA 3JV5A 1XCTA 4PJHA 4QY8A 3RY4A 2ZCHL 1KPVA 5CWSA 3C08H 5IB5B 2DJ4A 3CFEB 4MX7B 2SEBB 4N0CD 4FP8L 3W0WD 3FL7A 5HYJE 1U95B 2BNQD 4Y4KA 4PJXF 1RD6A 4LPUA 2XKUA 3VWKA 1PGRB 3FONB 4S0SD 1I85A 2HJKA 3MLRH 4MB3A 5TPWL 4HHAA 5FYLH 1XGYL 2XKSA 5GS1A 2DI7A 3D39D 1QRNE 3KJ6H 1QQDA 3NIFF 4U6TA 1ULVA 5CP3H 1ZVSB 2IQ9L 4U1NB 5IOPB 5GIRA 2R1XB 4JHZA 1GJIA 5IJVB 4IS6B 5L2KD 5F1IA 1DUYB 1FO0B 5JIPA 3ZT5A 4G9FD 4P46A 3KPQB 4HJJH 4PRDA 3MLZH 4YEFA 2X4NB 4MVBD 1YMMD 3GMQB 2VLMD 4Z7UA 3QUML 2IMMA 3DUSA 5BV7L 4IOSD 2VXQL 1FLRH 3D5OF 4I13B 4M8QA 3MOBL 2E7LC 3UDWA 2R0LH 4DJMA 3HZYA 4RQQA 4XVJH 5AD0B 1OSPH 3OGOE 1ZANL 4XMPH 5EU4B 1J5OH 1HHGB 3NTCH 2OBGA 4XCCL 4Y4FA 2VXTL 2VDMH 1GGCH 5D5MF 4FQ1H 2I24N 1NCDL 2UWEF 1FJ1A 2D7TH 3HAEB 1MCWM 2QBWA 1VPOL 5GS0D 1RZJH 5JHDD 1UGNA 3ZDXF 3PGDB 3TNNA 3I2CL 3G5YA 5HHOE 3BO8B 1T03H 4IRJB 1DBAL 3MGOA 4XP6L 4L5FH 4R3SA 1A7BA 1NGZB 4QHLB 4K2UH 1INQA 3T0WA 1IMHC 4QXWA 1AGBA 1IC5L 4LLWB 2BNRD 4FZEH 4U0QB 5GGUA 3TCLA 1ZHBA 2HFGH 3FCTA 2JELL 4XI5D 2ATKA 1PKQB 1DFBH 3C6SB 4OZHB 2Q86A 3JV4A 2NXZD 3EFDL 4LSQH 3ZZ1A 3RZCA 4AMKH 5ID0A 4NQEE 3HMXH 3VD3A 3O2WL 1FYTA 1KCRL 3PP4L 3Q3GB 12E8L 3MNWB 1BVZA 3VXNB 5DYOA 3SDYL 3C9NB 4JE4B 1B2WH 3V7MA 3MUJA 2YPLE 3P4MA 4LSPH 3BKYH 5L7XL 4TSCL 4KK5C 5B38G 4Y8DC 4WUUE 3PWNB 4ZQKB 2H26B 4M43L 3KYAA 5ADOL 2PTVA 3SOBH 1M7IB 4QOKB 1BQUA 5ESAB 4HKZA 3WLWC 2EIDA 2OP4L 3KYNA 2M1KA 3QJHA 3VXMD 3LHPL 2QEJA 4PJ9A 4DN4L 4ORGB 1S7SB 5EBMA 3DETD 3VWKC 4RFEA 3STLA 4CUCA 3U6RB 3HNTL 4GG8A 3VA2C 2CLRA 2P24A 5IVZA 2VUYA 5C0EA 4Q9RH 5DFVC 5GS1C 3VXUA 4X5WA 3OB8A 1VEOA 1UENA 1I4FB 2EDLA 1FFQA 3FQUB 4POZD 2VDKL 4MD5B 3EOTL 4YXLL 4NZTH 1UG9A 3O3EB 4PFEA 3QHZL 2DM4A 5IV2B 3KPLB 3LD8C 5DUBA 1P4IL 4PRAA 1X5XA 3HE6D 1A6WH 2EC9U 1G7MA 2NTFB 4O00A 1G0XA 1Y18B 1U8MB 4LMQE 5JR1H 2NX5E 5C9JB 2EE2A 5C0CA 4L9LB 5HY9B 1R0AH 1Q9OA 2G75B 4UTBH 3QUYA 1FRGL 5EA0H 2EZ0C 3VFRB 1CL7I 5FHAL 4DKAA 3PQYE 4ZUUB 3SCMD 4GRLA 5LGHL 3GGWA 4OCWH 2F54E 2MCG1 4N9GA 1F4XL 3GMRB 5E5UB 1CDBA 2QLVB 5GRYA 2NY1B 4NM8H 5CZVL 5D1XA 5KANI 5GGSB 4Z7VA 1VACB 1DBBL 4MDIB 3TN0C 2J5LC 5FYKL 5IIEA 2APFA 2IBZY 3X12A 3GJFB 5F88A 3ESUF 4Q2ZA 5IMMA 1FBIH 2E9BA 4AM0A 2A6JB 3MBEC 4YWGH 1T0NB 4QRPE 5TQ0H 4OLYH 5EZLB 3ARTA 3M1BA 2HJLA 3BZDA 4XH2B 3QG7L 2EKJA 4MA1C 3MUZ1 1SVCP 2G60L 3S8WA 3CUPB 4DVRH 1A6AA 1IEAA 5C92A 1DANU 1NCBH 4RMTA 1H3PH 3ZE0E 2C3XA 3QCTL 4PRPE 5DQ9A 2QQKH 2V6HA 1RJYB 4NBZB 5ALBL 1E4JA 2ARJB 4NQUA 3QNYA 4LSRL 3HE7C 4RNRA 3ULVE 5HHOD 3QNZA 2AJUH 3DIFA 3O6LL 4OFYA 5E2VH 4F8QA 4RGOL 2P5EA 4YK4B 2WMPA 3OV6A 3QQ4B 1MCKA 4KXZI 4FQIH 2EC8A 4PJDA 3CSYB 5T3XH 5MHSE 3VJ6A 5E6ZA 4H0IA 4XP9L 3L3OB 5DD0H 1GGTA 5JQ6H 5FXCH 4PJ9C 5LXGL 4R7NA 1MFCH 2H8PA 4WI8A 5B8CB 3V5KA 3LOWA 4S2SA 3MZTA 4HG4K 3MRCB 4OI7A 1S3KL 4WGWB 3QEGL 1VADB 2R9HC 2AJZA 2JB5L 3CH1B 3QUZA 5CJQL 1BPVA 4IMLA 3IDJA 3MV8A 1VFUA 1X5ZA 4G5ZL 3DECA 4I3RL 3X11A 4JM2C 3P73B 4OCSH 1BQSA 3NBNA 4DGVL 3ZHDA 3A6CL 1BGXL 5LJYH 4YR6A 2HP4A 4LVOC 1WC7A 4GW4B 4O02H 5DA4A 2YA0A 3FT2A 2XT1B 1OARH 3B5TA 4HUXB 4MQTB 1P6AB 1F00I 2FCBA 1SQ2N 4MAYC 1VFBB 3EBAA 4JFDE 2R69L 4ODWB 4EXPX 1OTSC 4HD9A 3E3QE 3T0DA 3I75B 4QXGL 3LQAC 5IB1B 5F96L 5HDQH 3KXFA 2EDBA 3RY6C 5SX5H 1MCFA 3ET9F 5DC0A 5DURD 4Y5YB 4GG6F 1A3LH 1YNTA 2HFFA 5BXFA 1ZHNA 3QIBB 1QFOA 6FABH 1CDCA 4TTDD 2V7NB 4JANA 2E3VA 1IM3B 2JIXA 4GBXD 2NY0C 5IB3B 4OZIA 2W0PA 2OTUB 3D3VA 1G7LB 1ZA3B 1IFHL 4H1LH 3RGHA 1BM3H 2IPKA 1KT2B 3MLVL 2Z0BA 4ZUSB 3O2VH 1ZSDB 2FB4H 4M48L 1OGAB 3SPVA 3QPQD 3NIGE 1IC7L 1I9EA 2VABB 3EDFA 4HH9A 4IHOA 3P40A 1AKJD 1I9IH 1T3FB 5C09D 4V1DB 1QHOA 4HF5L 3WNMA 2MTPA 1KIRB 1NFKA 4W70A 4DGIL 3P30L 1NAKH 1JUFB 2XOTA 3G6AA 2JJSC 4G7VL 3CFDA 1U8NA 5HI3D 4WFFD 3G5XA 2J2ZA 5LBSH 4LNRA 3O4OB 4JRYD 1AGFA 1DN2A 1CE6A 3UAJD 1KEML 2NYYD 3GSUB 1FCCA 3D0LB 3LRSB 3OKMA 3UTZA 1HI6B 2J88L 4XNUL 4MA3B 4NQSA 3ZDYF 3D25B 4CDGC 1N5AA 2IADA 5HVHC 1QVOA 3S4SB 1JTPA 4X7SH 4PJAA 5JW5B 1Q1JL 1YEFH 3TVMC 4XTRC 5D71H 2O5XL 3S96B 5I1GH 1FORL 2DQIL 3HN3A 5SWZA 1MPAH 2R0ZH 3ARXA 1GPOL 4I9WD 2IPUK 1YJDC 3QDHA 3SBWC 2HYMA 3V5HB 4WEBH 2BNUB 4KMTH 1NLDH 1QA9B 3B2VL 1T83A 5DK2B 4NUJB 4M8VA 3EJYD 5CINH 4OLZH 2ZJSH 4F2MA 1D6EA 1MQ8A 1Q9LB 3UJJH 2ZUWA 2VAJA 4ETQB 4J4PD 3VRIA 4S1RH 4PRPD 4ZXBB 1G7PA 5DJ0A 2EH7H 4YXKL 4TOYH 1XGRA 5KSVA 1G7IB 2PW2A 2DLGA 3M8OH 5MP6L 4NNXB 4XNYL 5CKAA 1CDIA 5ANME 1AIFB 3QIUC 1A7RH 3KYMB 4Q74A 2D2OA 4WWID 3CXHK 2OZ4H 2BXYA 2DLFL 4I18A 1FVCA 1YZZA 1WWCA 4UT6L 4RDQF 5CJOL 3T4AA 2QADC 2R39A 2IEPA 4FFWC 3MRBB 4JQVA 3WKNA 4NIKB 1CR9H 4NZDA 1P4BL 1MCDA 5CIPA 4N8CL 4LQ1A 4JRXA 3PHQB 3VW3L 4YO0A 3NFNB 4NWUH 3MACH 2FDBP 5T1LA 3MRGB 3ARZA 4APQD 1U0QA 1MCQA 1RZ7H 5HVFB 4E0RA 2JJVA 4JLRB 4DKEH 1IGCH 1RHHA 5T5FL 2YEZA 5EDXA 1S78D 2V5TA 1G7HB 2DQTH 2HTKC 4LGPB 5CBAB 4MCYA 4KFZC 5HGHB 3IAGC 4G6JL 3BIKB 1S8DA 4UOW1 4P2RA 4JM4H 5KS9E 1E4XI 4M7LT 1ORSB 3ISWA 5KG9A 1X5YA 4YPGB 4HT1H 5DJAB 3FFDB 3I6LE 1GYAA 2DWDB 3MCKA 5IFJB 3W39B 4TVPL 5EIQA 4G6FB 3MRDA 1OD7A 3MCG1 1MRFH 1HZHH 2FEDC 1K6QL 5FM5M 3AGVA 2KL6A 3S36X 3I9GL 5TQ2H 1LNUA 1C12B 5MENB 4WGVB 3W5NA 4ODHL 4MDJB 3ME0A 1XH3A 5KVMC 2UY6A 2XTJB 5C2BH 2P45B 1JNHA 5SV3A 1OAYL 4GAFB 1U3HA 1BJMA 1CDUA 1DDHB 3DTXB 4YHZH 1U8OA 1VGEH 5FB8A 3S36H 3IJSA 3VXPB 3AXLB 4FFZH 5I1LB 5SX4H 1BECA 4PGCA 1FHGA 2EICA 3WUWG 1MHEB 5CEXA 2YD4A 3AAZA 3V2AR 4ELME 1AP2A 3ZL4L 3QH3A 1KLFA 4D9QD 5KAQF 1CDJA 2YD3A 1IAIL 1UXWB 3TYFB 3OXRA 4KQ3H 5FOJA 1BQLL 5EO0A 2LU4A 2DOCA 1BQHA 2M2DA 5D2LF 3O11B 1QR1A 1T83C 3MRKB 3QCUL 5J12B 1I8KB 4AG4L 2I25N 2R2EB 3ULVC 1HEZB 3K8LA 3WS6A 5A2KH 3IXTA 4ZNEA 1IAKA 2AQ1A 4PJIF 5DTFB 1TPXB 2Z35A 3RX7A 1JWMB 5DJZB 4WFED 4PP1D 4OF8A 3OXSA 4M1DL 3DROB 5DJ6B 2Z31A 1JZ4A 3QFJA 4LL9A 4POUB 4WHTB 5FOBB 4FA8A 1NCCH 1U92A 3MROA 1RJZA 3FQTA 3IDYB 2B7DT 3PWLA 3PIQB 5BS0E 3VFSB 5DJYB 4JFQA 1RZKL 1J87A 2HMID 1JWUA 2VDNL 4MWFA 4PBWD 4EN3C 4I18C 3LQAH 1XGUA 2R0WH 2CLZA 5KSAC 2RIKA 3IU4H 1IGTB 5IR1B 4TTGA 1JFQH 2IAMA 2D7PA 3UPRA 1YDPA 4JFFE 2D7NA 2VAAA 3TO4D 1CTOA 1QFPA 1WIOA 1J86A 2LU3A 3VFGH 1KLGB 2GFBA 4JHWL 3OB0K 4OZGA 1QSFA 5CD3A 1E4KA 1DUZA 4KKLC 3L5WB 5ESVB 4D0CB 1MHCB 4OZFH 3EO0A 2FBJL 1OVZA 1MVUA 4QHNA 1LE9A 3LVEA 1FL6A 3FOLB 3WHXA 2JK5B 2EDRA 1NMAH 4XZUA 4GQ9L 4D9LH 5J13B 4TRPL 3GJFK 3GSXA 3TBTA 2KDGA 4L29B 4EDXB 4LSUL 3SKMA 2YN3A 4X6CB 1N64H 1FYHB 2AJSL 3VFPB 1I7UB 2ATPA 1NGQL 1A7QH 1CLOH 1WZLA 1YY9D 4NN5C 1OHQA 3C6LD 4LKCB 3FJTA 2WIIB 5EB9A 5LGJB 2UZXB 4K3EH 3KPRA 3P9LB 35C8L 1EH9A 1FDLL 1MCIA 2R23B 2W0LA 3TIDB 4NKMA 2DF3A 4YHKH 3UX9B 1ZT1A 2A6DB 1GGBL 5TE7H 2ZCKH 1UXSB 3G04A 1AR1C 4GRWB 1T66D 2V2WB 2EYSB 1K8DA 3ALPA 3LEXA 1I9RH 1IJ9A 3E2HC 4UBDC 1H9VA 4U1LB 5C0AB 4KK6C 2ZG3A 5J1SC 1V5JA 2R2HB 3BUTA 3BUYB 4X9GA 3S37X 1QBML 1EHNA 3VGHA 3BRGC 1RZGB 5K9KA 3EYQD 1CL7L 1QSEB 2P7TA 3KJ4B 5EUOE 1C16B 1I1CA 4DUXA 5GZOD 2A9NL 3MRNA 5D1ZA 4O4YH 1A0QL 4MJ2A 1I8MB 1T1ZB 4FFYL 4L8CB 3GK8H 3EW3B 3P9MB 3QEHB 2NMSA 1JGVH 5EOTA 4O5LH 3WE6B 3LIZL 4QHMA 5F7FA 1D9KD 2JCCF 3B5GA 5DSCA 3KS0J 3BEWA 3RNQB 3QO1B 1A1NA 4PTUA 4KY1H 3IRZA 4MAUH 1U8KB 3SDXF 3KHQA 4KVNH 1R3KA 4PY8J 2I5YL 5FECB 4XB8A 5F9OL 1MCWW 4KGJA 5E5RB 5IVOA 3FB7B 3VRJB 3AREB 5IT2L 4M00A 1U3YA 4HSQA 1LP9B 4JR9H 2BX5A 3SDCD 3CLFH 4XBEH 4U7SA 2UZYB 2AJVH 2BVQA 3U1SL 1VKXB 1EIBA 3BP7B 3UYRL 4MB5A 4LBEA 2R56L 3LMJL 3O6KL 4HIJA 4X4YA 4KROC 2QTEA 3GSOA 2YK1H 3P0VL 3ZE2F 1F6AB 4ZS7H 5JNYB 3OJDA 3SGKA 1Z0NA 1T7XA 3U9UB 4J3UA 4XAWL 1NBVL 1YA5A 2DI9A 3J7HA 2P49B 1RUPH 4QTIH 1N26A 1RY7B 4JY5H 1OCWH 2E9JA 3LS4L 5EUKB 5BS0D 1NGWA 3QUXB 4NKDB 1K85A 3ARPA 3OL2A 2G2RB 1YUHB 4FNLL 4X99B 3QIWA 3D85D 5I8CA 3S34L 3MR9A 3HPLB 2R2BA 4JFPB 4MJ6B 4NDMA 1OAXH 1SEQH 5HHVL 1RIHH 5ISZB 2Z8RA 1A02N 1U8LB 3FQXA 4HPOH 5DFTA 2UWEB 4JFFD 4XXCA 4IRSB 4LFHG 4KTEL 5GJSH 4F9PC 5C0FB 1J1PH 4PP2B 1TZIB 1KCUH 5EO1B 2GUOA 4PJBA 4HAGA 3RWGB 4CN4A 4TPRL 4ZAKA 4XBPB 4G7YH 3RUGA 4ZS6D 2VE6B 1AI1H 2AK4A 1FNLA 2CDEB 2FX8H 1QLFB 3BQUB 3VXQB 1MJ8L 4WO4A 4HXBH 5C08A 4Z8FL 2EYRB 3GMOA 1UADC 5E7BA 1N8ZA 1QNZL 1UB6B 2EDNA 3S3SA 4QRQA 1MJUH 2P8LB 3ARFD 1R5WA 4OM1H 4XMLL 2CMRH 1JMZA 2EE3A 4RFNB 2GCYB 4PG2A 5IMKB 3ULVH 2GYSA 4XVTH 1RZIB 5FYKU 3S7GA 3ZKND 4I8DA 4QF1A 4P3CL 5ITBL 4M4PA 2VDLL 1KIQB 5I1CH 4RA0C 2X09A 4FQJL 2HLFC 1OAKL 1RURL 3HG1B 1SM3H 3WFEH 3HR6A 4KJPD 2ZSWB 1ZLUK 3LN9A 4GSDH 3MLXL 3UBXA 4XBGA 4Z6AT 4N0UE 3IXAA 4LP4A 1H5BA 5IKCB 2DQDL 2OJEB 5JO5B 1I7ZA 3T1WA 3NABL 1UEYA 4WW2A 4ONOA 5C6TL 3L5JA 3HNVH 1AGDB 2ED8A 4PG9A 2WANA 1WBYB 3TJEL 3CC5B 3BISA 2DQUH 1XF3A 5CIPH 1WT5C 2ITDA 4F37K 1HH6B 2PYEE 25C8H 4L8DB 4OGXH 1JPGB 2Z4QA 2C3VA 4LGSB 4YAQA 2HH0L 3QQ3B 5I0ZA 4K9EC 2XKNB 4GW1B 1DBML 3TJHC 1QYGH 5FKAB 3L3IA 2Y5EA 4XGZB 2AK1H 3OMZA 4K8RD 5IG7B 3SGKC 5MEOA 1MAML 5D2NA 2X5PA 4XNQA 4TUKL 4UOJA 3HC4H 5TDPB 4OV6F 3ARDB 3BIBX 4QRSB 3V95A 1CU4H 3D9AL 3ZTNL 2DQGH 5HTSA 1A4JB 1E6JH 2XQBL 5DJ2A 3BKCL 3FO1A 3IJHA 3Q1SL 5F1SA 3QDJB 4GXUN 5HI5C 1YEJH 3H3PH 1AGEB 1IQDB 1BLNB 4XC3H 1L9NA 4KJWD 3V6OE 3SDDC 2BK8A 4OI8A 2NLJB 4ZPVB 2HLAA 4G9DB 4G3YH 3PNWB 1BFTA 4G6KL 5MERA 4P4RA 3RWCB 1FN4B 3GI9H 1M71B 5JXEC 3H8NA 1JZ6A 4NN6B 3GNML 2OR8A 2QQLL 1ND0A 1N5YH 2MFNA 4TUJA 2OM5A 2XZAH 5M95B 3RKPA 4PJHF 3PWJB 2RBLA 1UM5L 3QJFB 5FYKE 5DK3A 5FM8A 1Q0XH 3QQNA 4EI5C 4WO4C 3HS0B 1NEZG 1TJGH 4WCYH 3PWPA 4PBXA 1IBGL 5C0ND 1GZQB 4MNHB 1SJEB 3IGAB 5T1MA 4ERSL 5IVXE 4KJYB 2DIJA 3V6FB 4YHNB 4OFIA 1FFOA 1KJVA 1HXMA 2XFXA 3TA3A 5KW9H 3P11H 5ITFB 2NY2D 3G5ZB 1YPZA 3UTTE 1OPGH 2VLRA 5TDOB 2PETA 1IARB 5DMKB 1IC1A 2PYFA 3L5HA 3L3JA 5DRZB 4HJGB 1QFWL 1PKQE 3GMNB 2ZNWA 5KVDH 1H5BC 1U8HA 3OKYA 2LTQC 4R26H 1Y6NR 1HINL 3CK0H 3O9WC 4A6YB 3S35L 4WW2C 1PG7W 2C1PB 4NRXB 4WVRA 2QKIB 1FNEB 2OJZH 1A7OH 4R4FL 2YXFA 4U1JB 1IGFL 5L88L 5GGTH 3U30C 4CJ0A 3NGBB 4JO4L 1EJOH 5ILTH 3ZYOA 1FNFA 1WUNT 1J11A 5DHXB 4G8IA 2A83A 2NY5C 4KAQH 4HK0B 3G9AB 2DQFA 1SJHB 3MLYL 2I07B 2W60B 1J8HA 1PJ9A 5KZCB 3OKOB 5IF0A 1J1XL 2CD0A 5DQDL 3RGVD 2QHRL 2BVYA 3C2SA 1RULL 3LB6D 5BMFL 1MWAB 2WINA 4PRHB 3DVFA 4WI9A 1V7NL 2AJ3B 1IAIM 2PO6B 3ROOA 4XP4L 5A3IC 1PW3A 5FO8B 5DWUL 4JO2L 4LASL 4E5XB 2DWEA 5JXAL 1TFHA 1PZ5B 2PYED 3T0EC 3GHBL 4LLVA 5L6YL 1HXYB 3B4NA 4FQQA 5DZNA 2FIKB 3RWFA 2NY4D 4P23D 4GJTB 3U4AA 5FO9B 3GIZH 2BNQA 2NZ9D 4OCXH 1ACYL 1H15B 1T1XB 5D1QC 1T2QL 5ID1B 4Y16C 2A73A 1XEDA 3FQWB 4K94H 1YEHH 3D39A 4OGAD 4H25B 2NY7H 5BV7C 4UQ2B 5D6CB 2I9TB 3O41B 5IQ9A 1ADQA 4H5SB 3HCVB 1HOCA 4OIIH 4P57B 1S5HB 4QT5B 3LH2H 4WHDA 2VC2L 3BZ4B 2W9LA 2Z8VC 3H9YA 1YMMA 2OYPA 3VXRA 4M1CD 4OD2A 4HK3J 3LKRB 5JORA 5H35B 1NC4B 4PUBL 4XCEA 4YDIH 3WLBB 1WCQA 2B1HH 3Q0HA 5E70A 2DD8H 4F7TB 2H6PA 3UO1L 5A16A 4KZDL 3IFPB 4KI5F 3L3DA 2Z91A 4ZFGH 5FO7B 2HFEA 1UEMA 1CVSC 4F33A 5EZJB 5DJ8B 3SE8H 1JPSL 1WTLA 2ORBH 2PTUA 2BMKB 4JREB 3EOYG 4LVEA 2WBJB 2VZVA 1PG7X 5HDLA 5I75B 3WIFB 2P1YA 5T1DL 4BKLB 2Q3AA 4X9FA 4C55A 1B88A 2HG5A 4LLQA 3B6SA 3PP3H 1T1WB 4QRRB 2AXFA 4K9EH 1QPXA 4PJ8B 1PG7H 2IALA 3MRHB 1VB9A 1YMHB 5F7EH 2DMBA 4AL8H 3LEVH 2BNRA 3SDAB 4HV8A 1H8OA 3CFJB 1N3NA 4JVUA 1RI8A 4OTXH 1WZ1L 4A6YL 4IRJD 4HS3B 2N7BA 1BFVH 1CT8B 4TSBH 5GS3A 3CX2A 3BW9B 5H94A 4AH2B 1NCTA 4Z7VF 3ES6A 5DZOA 1MI5B 1X5AA 4OZFG 3WSQH 1FIGH 9CGTA 4L9DA 1YYLH 4RBPK 4BUGA 3BP6A 2HTLC 3EYOA 2GI7A 3MLUH 3CVHH 3BDYL 2D31B 2FZ3B 1FL5A 3P3YA 5IM7B 1DVFC 3MJ9L 3SE9L 2RGSA 3O2DA 4I3SL 4EDWL 1MIEH 2DB8A 1G9NL 3T0BA 1LO4L 1CE1L 3CH8A 3LKPA 5ADPL 4JHBA 3UROR 3WIHL 1IC4H 4BZ1L 1ZGLB 4WY7H 3BP5A 3N1PC 5FYJL 3H9SA 4ZFOL 1QSVA 1A6ZA 3A6BH 5HBBA 3VXMA 2HT3D 5DMGC 1FFNA 5I1DB 1E28B 3QI9B 1K9TA 4P9MH 3T3MF 1IEHA 1NUFA 1ETZA 2D7QA 4QOKD 5MEPB 5DJDA 1JF1A 3OG6B 4C4KT 4RAVB 1JE6A 4RZCB 1F11A 3EO1B 4CVZA 3V6OC 1QKZH 4AY0A 4F15B 4P99A 1G84A 5JDSB 4ODXB 4PRBA 2A9MH 4LLUA 1MCRA 2A74B 3CXHJ 2ZKHH 1M7XA 1FH5H 3F7VB 3HMWH 4L4VD 4TVPE 2DS4A 2BSED 1MRCL 2E6QA 1IRAY 3HE6A 4LAJH 4PJ7A 3CPLB 4WW1B 2W9EL 5B3JF 4BSWB 1JNLL 1Z3GH 4LCUB 5F89B 3ARGB 5TE6L 1SYSA 1OGAE 3QDME 1RPQA 3CDGA 1C08A 4MQSB 3V6ZB 4CADA 5D7KD 3FRPG 3SCMA 5HHPA 2BVTA 2OL3B 1MCOL 4V1DE 4WHYH 4J3OC 1ZLWH 1U6AH 4NQCA 4RA3A 5GS0C 4NRYA 1CXHA 3CDCA 1UH2A 2CO6B 3TYGL 4B7IA 1T21B 4WFHE 1OOAA 2BRRL 3LSOB 4PYGA 4I1NB 5CZXD 2OI9C 3N50A 4OGYH 2NY1D 5IWLA 1OLLA 3NFPB 3WJLA 2UVFA 3MPCA 3MODL 2BOBA 4PJIB 4ZNCD 1BF8A 2D3VA 2ZCHH 1Z9LA 4G8FB 1HSAA 1WJ3A 2QR0B 5IGXH 2GITB 3L95A 4Z7QF 4FP8H 1MREH 4LVNC 4OZIF 3U4BH 5KOVC 5I19H 1CFTA 4PBVC 2XACC 5CAYB 3JVGA 5TH2B 2XQYG 4JPKH 4XWGL 5TPWH 4Y5XA 3S5LA 1ZS8B 3G6JF 3LCYA 3RTQB 4HEME 4Z77B 3W11D 3SGJA 3DXAB 1HCFX 4M61B 5HHOA 5DVNA 3T65A 3CU1A 1BZ7B 3ZHLA 3EDKA 3DBXA 4NWTH 4LSVL 1J0KA 1S7XB 5J3HD 1MCNA 2AI0L 1EEYA 3C60C 5DMIH 4RGNE 1A1OB 2BY3A 5CHNA 4QEGA 3EAKA 32C2A 1P2CA 1FG9C 5HD8C 1JGLL 4NO5B 1D5ZA 5D7JB 3MOBH 3VI4F 4R2GB 3EO9L 3KPOB 4XNXH 5KSUB 3TO2A 2NY6C 5F3BB 1QLRA 2C5DC 4M7KL 3UZVB 3FFCB 1A6TB 4PJAF 3KPSB 4XCCH 1AFVL 1NGYB 2VXTH 2VXUL 3AY4C 4DKDC 3N85L 5DVLA 4Z7NE 1FC1A 4AQOA 4POZC 1NCDH 4FZ8L 4BH8B 4FXLA 1EO8H 1VPOH 2FGWH 5JTWA 1MCPH 1U9KA 1ES0B 1O5DT 5GPRA 4DAGH 4OBRA 3CX5J 1YEDB 4XP6H 3ZLQC 5FA3A 3MXWH 5IROA 5BJTB 15C8L 4NC1E 2CH8A 4JFXA 2R1YB 1R3HB 2JE8A 1YN6B 3NZ8B 1WAAF 4AT6B 1KXVC 3TZVC 2DL9A 1DN0B 4KDTC 2QSCH 2DBLL 4J6RL 3MYJA 1AQDA 5IK3B 1BIIA 1I1AC 1H0DA 1T89A 4OLEA 4BK4A 1OQXA 3C8KB 3KLAB 5FA4B 3RNKB 2XWTA 1HHHB 1M05A 1PY9A 4FXGB 5IHZA 4Y4HC 1NUDA 5J0BA 4IOIA 4N90E 1KPUA 1RAMA 3WNKA 3MUY1 1QFHA 5MENE 3LKNA 3I3DA 2F74A 1I3UA 3HI1B 4J3SA 4XPAH 4QTHA 5LCVL 1XIWD 3NZHL 5DUML 3QIBD 5L7XH 5FGSA 2AEQL 4LCCA 2XG4A 4NJAL 2OL3L 4NKOB 5I1EL 2JCCB 5GRUH 4YDKH 1AKJA 1KNOB 5C09A 5F9JB 3RVXD 3C08L 5K9OB 2OP4H 1OT2A 5HGAB 4XXDB 2E8YA 1OGAD 4FQ2H 1J8KA 1TVBB 1RK1A 4G8EB 5E2JA 4DN4H 3JVGC 3MLRL 4V1DD 4JRYA 2X4PB 3GSVB 2YD7A 3L5XH 1CD1B 1P84J 4M6AA 4CN6A 3KJ6L 1DQDH 5DO2D 1KB5L 4X6EB 5C0BB 3X13B 5F6IC 5D4QA 3SGJC 2YC1B 5C3LD 4GAYA 2CKBA 4KK9D 3MXVL 2WM0A 4XC1L 2FRGP 3QCVH 4YBLC 5DD3H 1MRDH 1BOGA 5FKPA 1VGKA 1ZV5A 3BN9C 1SBSH 3DMMB 3GSRB 2YPKB 4N8VG 4C56B 1CCZA 2E6JA 3L6FB 3RWJB 1FLRL 5FUOL 3U7YH 4UT9L 3PWUB 4GW5B 4CGTA 4O9HH 4URTB 4F7EA 3MTRA 4G80B 4CVXA 1ADQH 1OSPL 4J4PA 4TULL 1FFPA 1IGYA 4XMPL 4AEFA 4YEEA 4PRPA 2AQ3A 2UZIL 2Q7YB 1FRGH 3GBNL 4GUPB 3VD5A 3CCHB 1N59A 2VDML 1GGCL 4W81A 3CSGA 2D7TL 4LCYB 3IVKA 4J12A 4KKBD 1F4XH 1RZJL 3E8UL 5DEZA 5CZVH 1BZQK 1FGVL 4NRZB 1IKNA 1CI5A 4CAGA 4ZXBD 1DBBH 1T03L 3BPLC 1F6FB 3WN5B 4KQ4H 1YEKH 5FYKH 4L5FL 2MPAH 3MOAH 4K2UL 2PCPB 3VGBA 3REVB 1FGNL 1T04B 4FZEL 1P69B 2HFGL 3CGTA 4MD4A 5ACLA 2KZWA 4QXTB 3EOBA 5LAXB 4ODSH 5GS0H 5ACZA 1DFBL 1MNUH 3ILQD 1U8PB 4X6DA 4X6CE 5SWQA 4OUUA 4APQA 1NAMB 3IFOB 4AMKL 1WQVT 1FL3A 3GMMA 2G60H 3HMXL 5DD6A 5I66B 2BY0A 4QRUB 1NCWL 3QCTH 2CGRL 2VYRE 2B1AL 5INCB 4TNVF 3B9KC 1W0WA 1FG2B 1ZHLB 2GTWB 4LSPL 4DCQB 1PSKL 2O93L 2HVJB 4GRWE 2VL5A 2W91A 1ROWA 7CGTA 2XA3A 3MA7B 3QA3B 2JLLA 4OZGF 2ENYA 2FSEA 1VHPA 1K8IA 2HT4D 2V2XB 4GRMB 3I6KA 3MMEB 5DRNB 5EG6C 2ADIA 4J23A 4GMSL 3QZWA 3KLHD 4MCZA 1FE8H 4KZEH 1FZOB 4Y2DA 1Z0MA 4X8JA 3H3BC 3O2DH 3FO2A 4PJFB 5C86A 3HZKA 1LMKA 2V9RA 4UUJB 5F3HB 4G6FD 3WJJC 3CXDH 4LF3B 4WDIA 5KBNC 5LQBH 2RFXA 2AJYH 3LPGA 2JB5H 3F7YB 5CJQH 5MEND 4G5ZH 4WTWA 4I3RH 2XTJD 2A2QT 2QV2A 1KG0A 4NZTL 1QOKA 1FZJA 3TBSA 2Q20A 3Q5OA 1DSFH 1A4KB 1H3TA 4M93C 3WO3B 2EYTB 2AXGB 3DV4A 1DQLL 5ESQB 3BH9B 1B0WA 1GGUA 5E9DE 2R69H 4F7MB 5DK0A 5C3TA 3V9FA 4ELKB 1H8SA 5JR1L 1R24A 2D0GA 2FWOA 1LP9E 1RZKC 4H1LB 3VU2A 5E2UL 4U1SB 2NNAB 1KIPA 2GHWB 1HYSC 3BWAB 5F96H 1GC1C 3FO0H 3NIFE 2M8XA 2CDGB 4MSWA 4OCWL 4OF0A 3N1GC 4Y1AB 3IFLL 4RGNC 4HUVB 4ZYKA 2JB6A 3MC0A 4ZO9A 3N0PB 4NM8L 1XGQB 1A6UH 3MFFA 2W0FB 3ZKXB 1LHZA 3DYPA 1JGEB 1IKNC 3UC0H 5F8RC 3O45B 4L8BB 3P4NA 4M48H 3LV3A 4WFGE 3K4ZA 4HIHA 1FBIL 4ESKA 1IC7H 1UJ3C 1BFOB 4YWGL 2I9LA 5TQ0L 1BVKA 1KLUB 3FB6B 3TO4A 2WUBL 4NSKA 4OLYL 4QY8B 2ARJQ 4H26A 4L3CA 1RJLB 3MRMA 4DFIA 2C4FT 4IDLA 4OCYL 5IQ7L 4JY4A 3RAJH 5ISZE 4APQC 3VE0B 5D5ME 2E5EA 4G7VH 1NEZB 2UWEE 3VWKB 1H3PL 1XZ0B 1KPRB 2HJKB 1NGPH 1A9BA 2C1OB 3EZJB 3ZDXE 4X7TB 1F45A 4U2YA 4OD3L 1J1OH 3W2DH 4NC1C 1JPTL 1KEMH 5GS1B 1D6VH 2F15A 4NQDA 3ARBD 2YR3A 5M7QA 3PGCB 1UWEH 1Q94A 3MRFA 1B3JA 5F1IB 1CGUA 1Q1JH 3N1FC 4LMQI 4FQIL 3C6LA 4QNPF 1FORH 4PRDB 5T3XL 4Q0XH 5A2JH 3LD8B 1K3IA 3QDGE 5EIIA 1QG3A 4Z7UB 5F6HI 5HGDB 5JQ6L 3DUSB 5TFSH 2RCSL 4Y2DC 2K7PA 4M8QB 3L3HA 4MMZC 3QWRD 3WFCH 4N5UA 1U2CA 2X70A 4HK3N 4RQQB 1CGXA 5EBLA 3SO5A 4TNWK 1KGCD 2MHAB 2G9HA 3TFKC 2WAHA 4HBCH 4XPBH 5MP6H 3OKDB 3D6GA 4YNYB 3PHOA 1XF4B 3HLAA 4O02L 3OF6D 2AV1B 2FECI 2ERJC 3IETA 4PJBF 2J5LB 3TN0B 5C0AD 5H2BB 3AS0A 3G5YB 2DLFH 3VFVB 4R3SB 3RUGF 4UT6H 1W8NA 5CJOH 4CRPA 1INQB 4ODUA 4WU7A 3MBEB 1P4BH 1WZKA 2PN5A 5D7LE 5HYFA 1QSED 4NYLA 3RI5K 5GGUB 3UJIH 1D9KA 1ZHBB 4YHPB 4N8CH 3CFCH 1IGIL 3DX6B 4MA1B 5HDQL 3BPCA 4NQXA 4X8XA 1YECH 1A3LL 1OT1A 2B8OT 2DLHA 2J6EA 1NANH 1PX3A 4EVNA 5KVEL 4U31A 2J8HA 5BOPA 3GMPB 5DYOB 4X0KB 4G6JH 4PJXA 3HE7B 3RFZC 1GGIH 3SQBA 4MNGB 3SDCA 3O2VL 4EI6A 3ARQA 4N0FB 3VFWB 1AHWA 4ZUTA 5GHWH 1PKOA 1NMBL 1I9IL 3T09A 4Q9QL 3DX7B 5FYJU 2YA2A 3QDJE 1NMCB 1AO7B 1NDGA 3ARED 4CW1B 1C8PA 1LVEA 4WHYG 1NAKL 1LDPL 4NJ9H 1CXKA 2BSSB 3QJHB 4PY7A 4PJ9B 2R4RL 2CSPA 1J0JA 2Y6SD 2VDQH 2CR6A 3ZSSA 4R4ND 4ODHH 5EBMB 3OKKA 2VIRA 3BP4A 4Z76B 1I1YA 1YNLL 4GG8B 1OAYH 4ZO8A 5BS0A 3WIIL 3NCMA 4L3EB 4NGHL 3RY5A 3JUYA 4HJ0C 3RWIA 2DQCH 3KR3H 3MRJB 1NKRA 2YD1A 5DVKA 1ZVYA 3D85A 4JM2B 4KMLB 3QHFL 2PXYC 4X4ME 1YEFL 5D71L 4LVOB 5HYJB 5AWNH 1MPAL 3QXDB 3ZL4H 5EOCJ 2R0ZL 5GSRA 4JFFA 4MJIE 1MLCA 1IAIH 1MJ7H 1T7WA 5IEKB 1CDGA 1FVEA 4KMTL 2R1WB 1NLDL 1S9VB 4MAYB 1BQLH 4PRAB 3FN3A 1EEQA 1BBDH 5DGQA 1XF2B 2GJJA 1RUML 5CINL 4OLZL 1QRNB 2PW1B 1KJMA 5ISZD 3QCUH 3VG9C 4QYOA 2CKBH 4AG4H 2JJWA 4IRSD 5CEYB 1JZ3A 4YHIB 4NHUA 4M1DH 5KJRL 4HWBA 4P2CG 3GGWB 3M8OL 3OPZL 5J7CC 5D70H 1A7RL 1J9CT 5H37G 2WUCH 1K5NA 2NY0B 3OAZH 4IDJH 2CXGA 5GZOC 3BQUD 1HIML 4JFZL 2OXHA 4JFOA 4W6WB 2VDNH 1LD9A 3M45A 4ZUVA 2X1PA 1GC1H 2WSKA 2ED7A 1FZMA 4OZFB 4Q2ZB 2EXYD 1CR9L 5HYQA 5CGTA 1D5XA 5MEQB 3VFOA 1OW0A 4UNUA 4B53A 3CVIL 4QCIB 1A6VH 5D6DA 1A2YA 3MNVA 3MACL 4YGVA 4JHWH 4LIQL 1DQQB 2XG5A 5CGYC 3S9DB 1SY6A 4HWZB 4DKEL 1A6AB 5IUSA 3HG1D 1ZWIB 4KK8D 2FBJH 3LPFA 2DQTL 4HGMA 2V7HA 5FYJE 43C9A 3T1FA 1YPZF 1CFNB 5EUOA 3MRQA 3OX8B 4UNTA 4KTDL 5CKGA 3SDCC 1TTGA 5DD5H 5HVHB 1NBZA 4JAMB 3TH3T 2VKWA 3DIFB 4LSUH 4N8PA 5E2WH 1EHLH 3EFFA 3TVMB 5TGBB 3ULUD 2H41A 3DJ9A 3N06B 4NQEB 1NEUA 2F53B 4PJDB 3U9PH 4FHBD 3VJ6B 2J4WH 4KDVA 2X05A 4X98B 1BJ1J 1P7KA 1SBBA 5TQ2L 4LCIL 4GG6E 3HUJF 4ZSOB 4R7DA 5JPMB 5J9PA 3FZUD 3MLTB 3I50L 5FF6A 5C2BL 4S2SB 5I1HL 4LHUA 2IQAA 4W4OA 1MLBB 3TBYA 4YHZL 3ZKMD 1CGWA 1P4LA 1VGEL 1AQKH 2WW8A 4M5YL 4CMHC 1HE7A 3MV8B 4YGAB 5B21A 3ARDD 3X11B 1PEZA 2CUIA 3QIUB 1PZUB 4YR6B 5E8OA 5FUCC 2A9NH 5HYEA 4KQ3L 2V5SA 3T0XA 1A0QH 4UU9A 2QADB 4IIQA 1DANT 3WHE0 5JPNA 5HGGS 3LKOB 3C8DA 4FQXC 1Y6MR 2Y5TA 3D2UA 4G42B 2BC4A 1BX2A 3CJJA 5DUPL 4NZUL 3FT4B 1WFOA 4RRPG 2ICCA 4OLWH 4HKJA 5EC2A 5SV4A 2HFFB 5I8OH 4G8GB 1ZHNB 1IEBB 1M7DA 4LRIC 1B4RA 1UYWH 4DTGH 1P9MA 5EU6E 2J8UF 4C57C 1G7QB 3RPIA 2UUDK 4JVWA 2ADJB 3D3VB 3LQAL 2R0WL 3MRPB 3QQ9D 2NX5B 5C07B 3IU4L 4I5BA 4M4RA 4QRRE 2W59A 4FFVC 4NBXB 4HH9B 2V17H 2BSTB 3KS0H 3PQYB 4IHOB 1OW0C 2R56H 2A1WL 1C5DA 1HKLH 3P0VH 5CBEB 2F54B 5HGBA 5GSVB 5D6DC 4XHJD 1MSPA 3TBWB 4HUWB 4N5ED 4XAWH 4D0DB 1NBVH 3Q6FA 4HC1A 3G5XB 4LNRB 4MD0A 1CE6B 5J11C 1NMAL 4D9LL 3QXTA 4QRPB 3OKMB 1EGJA 2VZTA 3QWOA 4FQHA 4NQSB 4XCYB 3HAEG 1EXUA 1QVOB 1N64L 2O61B 2K3TA 1JWSA 4XRCA 2FHBA 4PGBB 2DICA 3HB3D 1DEEB 3GB7A 4NT6A 3I84A 1A47A 3TNMA 1BD2A 1VENA 4ZDHB 2EIZA 1U91A 4YHKL 3RGVA 4AEEA 5F7DA 2ZCKL 4M7JL 4KPHL 2LABA 5F7WC 4R4BB 1D6EB 5BVJA 3DYOA 4EZMA 1DE4A 1NFDB 1N2RA 4U3HA 5KZCD 5JW4M 1JYXA 2ZCLH 5FYJD 5T3ZD 4Z8FH 3MJ8A 5C0DB 2PYEA 1DR9A 1T22A 3FTGB 4WI7A 4OSUH 4PRHD 5DRXA 1CXEA 2PO6D 3DVNA 4Z78A 4I0CC 4P23A 4O4YL 1T2XA 3BAEH 5DLMH 4EN3B 4I18B 1FVCB 3F12A 2CIIA 2VXSL 3DO7B 5ITBH 5KSAB 1MJJB 2VDLH 3TT1H 3GK8L 4IIQC 5FCUH 3K81A 2KUTA 3S6CA 1JGVL 1OGTB 4O5LL 5AZ2L 4RRPA 5IB5A 1OAKH 1RURH 3NAAL 5CIPB 2VH5H 1AD9B 1XAUA 4JRXB 3Q6GH 2ICWI 2XN9D 1N0XL 3FONA 1HQ4B 4Z7OE 4KY1L 3QISA 4NN7C 3RQ3A 4MAUL 4D2NA 3NABH 4KVNL 3OHXA 5C6TH 1GCFA 1ZTXL 1RHHB 1ZVSA 1CFSB 3MSPA 4U1NA 5IOPA 4LARH 2R1XA 1S7WA 5IJVA 4IS6A 4AYFA 1DUYA 1S8DB 1FO0A 4ZTOL 4JR9L 2ESVD 4XBEL 3KPQA 1RUKL 1HHJB 2AJVL 4UNVA 2X4NA 1KN4L 2CIKA 1BF2A 4U2ZA 4LDLB 1NC4D 4NN5B 3MCKB 2YK1L 3ZTJG 5FYLE 1P5UA 3VCLB 3EDEA 4ZS7L 3P4LA 4PJIE 4PLJC 3GO1H 5AD0A 2B2XH 1MAMH 3CSBA 5BZDB 5EU4A 4GXVH 4PJ7F 1E6OL 2EECA 1XH3B 3D9AH 4QTIL 4X6FA 2FNBA 2IGFH 5I71C 4X83A 1JNHB 3BJLA 2WBJD 4CN1A 3U82B 3DHJA 1OCWL 4I2XB 2XQBH 3E2HB 4CDHA 2QL1A 1U8OB 1MCBA 3R06B 3BKCH 5HJ3B 5JW4N 4XP1H 4PGCB 1G6RA 5CEXB 5L0QC 4QRRD 2X1OA 1OAXL 1RIHL 4QHLA 1LEIB 3ECBB 3NA9H 4NO0B 2Z92B 4PJ8D 4F7PB 4LLWA 4EOWH 4OQTA 5GJSL 3SDAD 1F4AA 2MMXA 1J1PL 2O5YH 1AGCB 1KCUL 1QR1B 4OZHA 1LO5B 5E0QA 3E0GA 3RGVC 2IFFL 4G7YL 1JF5A 2I60H 4WWKC 3AUVA 1H3GA 2QQLH 4DFHA 3I02A 1MI5D 1UM5H 5TF1L 4HXBL 1JYVA 3K8KA 3MNWA 3FFCE 2EDXA 3VXNA 1DLHB 3KPSE 5J6HB 2YWZA 4XPFL 3MROB 1JF6A 1MJUL 3C9NA 3FQTB 3JSSA 3SE4A 1BBJB 5F70A 4JPIA 4J1UB 2D9CA 4WNQA 3PWNA 4LEXL 2CRZA 4ZQKA 2H26A 4ERSH 4U1GC 5HDBE 1CD0A 1LO2H 2ADGB 5I1CL 1M7IA 3LS5L 4QOKA 3AFLA 5ESAA 1LK3L 4HWBH 3KPNB 2OR7A 3S35X 4KROB 2IFGA 5HPOA 1SM3L 5HDOA 4PRNA 5FV1L 4GSDL 2A38A 2GFBB 2BZDA 3QI9D 2AJXL 3U6RA 2B0SL 1ZK9A 1HINH 5GGRB 1WTGT 3HNVL 1MVUB 3MV7A 1I4FA 4L4VA 5HYIA 2IH1A 3WHXB 2DQUL 3FQUA 4MD5A 4XZUB 3LN4B 2F5BL 5I15L 25C8L 1NDMB 3RVUD 4LOUC 3O3EA 4P59H 4YHOH 4LDOB 1WBXB 3DURA 4KKAD 5IV2A 1SY6H 3FRUB 3L9RB 1AXSB 4HUMB 1P1ZA 2ATPB 1VEMA 2AVGA 3BI9X 2JCCE 2HFTA 4JZNB 1QYGL 3MJ7B 4Y0GA 1A9EA 1Y18A 3UTOA 1U8MA 3KPRB 5DD1H 4AIOA 2YUZA 5C9JA 3ZKQD 1WFNA 3ARGD 5HY9A 1J1XH 3HC4L 4X6BA 1ZT1B 5D7IA 1CU4L 5IBLD 5KS9B 5BMFH 4ZUUA 2DQGL 3G04B 3ZSTA 2DQEH 1OP3K 5D2LA 5CCKH 2P8PB 2WQRA 3P4OA 3GMRA 3OGCB 4JO2H 1U3JA 4LASH 1YEJL 3H3PL 4MDIA 5C0BE 4J3TA 4H0HB 3TIEB 3GJFA 1R6VA 5K9KB 2P7TB 3SKOA 4R0LA 2DQJL 4FQCH 2H32H 4G3YL 3ZE2E 2DJUA 4OJFH 5FYLD 1T0NA 3GI9L 1N6QL 2WBKA 1BP3B 4JFHE 5EZLA 1T80A 2MOVA 1T2QH 1HHKA 4XH2A 3ZE1E 5JW3L 4HWEL 1EJ6A 1SJVA 4HLZH 1N5YL 3RVWD 1EEZB 3CUPA 7FABL 3BEWB 5CLTA 4ELMB 4PJCA 1Q0XL 3E6FA 4PJEB 5DI8B 2XYCA 3KPMB 3I6GB 1JHLL 4HUKB 1RZ8B 1R3KB 3RTQD 4HUNB 3G08B 3SE4C 1Y6KR 1D7FA 4HULB 1BIHA 3DXAD 1B90A 2HT3C 4BQ6A 2IANE 4NM4L 3QQ4A 3UO1H 1ZT4B 2Z93A 5KW9L 4PJGA 1D5MB 3P11L 3IDNB 1I8LC 3IDGA 3QB7C 1RFDH 1T5XB 2BVQB 1MY7A 1UWGL 3L3OA 1OPGL 1CLCA 2GAZA 2BVEA 5D7JD 3ARWA 5B8CA 4JO3H 4WEUD 3BFOA 1ACZA 3MRCA 1VADA 3OWEA 5TDNB 4L4TE 3BEVB 3FFCD 3BX7C 3CH1A 43CAB 5KN5B 3KPSD 5IESL 4J3VA 3QYCA 1SYVA 3OAYH 5T3XE 5IB2B 3RIAF 3TF7C 4O58H 3ZE0F 1EJOL 5ILTL 4S1SL 1FLTX 3CVHB 3NH7H 1T5WB 2YS4A 2W07A 4KJQD 2XQYK 4LEOB 1A8JH 1MCEA 1OB1B 2R2BB 5BOZG 3SDDB 4HUXA 4KAQL 3DGGA 1VFBA 2EXWD 4HC1H 4ODWA 2CRYA 3OQ3B 1HSBB 3FQXB 1L0YA