3BYXA

Lactobacillus casei thymidylate synthase ternary complex with dump and the phtalimidic derivative c00 in multiple binding modes
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
315
structure length
313
Chain Sequence
MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFGHQMRFDLSKGFPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWHTSKGDTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQFYVNDGKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDFDMKDIKLLNYDPYPAIKAPVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of the binding modes of N-phenylphthalimides inhibiting bacterial thymidylate synthase through X-ray crystallography screening
pubmed doi rcsb
molecule keywords Thymidylate synthase
molecule tags Transferase
source organism Lactobacillus casei
total genus 99
structure length 313
sequence length 315
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 2008-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 3byxA00
1VZCA 2FTNA 2TSCA 1KZJA 4G6WX 1B02A 2G8AA 1JTQA 3UM8A 1BQ1A 2TSRA 1KCEA 1EVGA 1JMHA 4IQBA 1TRGA 4KYAA 1JU6A 3DL5A 1B5DA 4FOGA 3CL9A 1BSPA 3KJRA 1VZBA 4Q0EA 2FTOX 3INVA 1TSVA 3EHIX 1SEJA 1TSMA 1NJEA 1J3IC 3ED7A 3UM6A 1J3KC 4G2OX 4EILA 4LRRA 3GG5A 3IJZA 1JMGA 1F4GA 3NRRA 3UWLB 2ONBA 2KCEA 3DGAC 2G86A 4KPWA 1JMFA 3BGXA 4F2VA 3CLBA 1NCEA 4XSCA 1TDBA 2AAZA 3OB7A 1TDCA 3HB8A 2G8DA 4EB4A 1KZIA 1QQQA 2G8XA 1F4EA 2RD8B 3N5EB 1NJBA 4H1IA 1AJMA 1TLCA 1TSDA 4TMSA 4E28A 3EDWX 1I00A 1JUTA 1HZWA 1LCEA 3QG2A 4H0RA 4IQQA 2TDMA 1TSLA 1AOBA 1BKOA 3B5BA 1TDAA 1SYNA 1FFLA 2A9WA 2G89A 3K2HA 4DPDA 3IK1A 1JTUA 4E5OA 4ISKA 1THYA 1DDUA 1BPJA 2VETA 4H0UA 1VZDA 3B9HA 1NJDA 2FTQA 3IRMA 1TYSA 1TSWA 3GH0A 1TSYA 1HVYA 3BHRA 3EJLA 1TSNA 1ZPRA 1F4DA 2VF0A 5BY6A 3HBBA 4DQ1A 3IROA 4Q0DA 1BO8A 1B5EA 1TDUA 3DL6A 3TMSA 3BZ0A 1BIDA 1TSXA 4O1UA 2RDAA 1EV8A 3IRNA 3QJ7A 3N5GA 1BP6A 3DG8C 1CI7A 1LCAA 4GYHA 1TLSA 4DP3A 4KNZA 1TVVA 5J7WA 1B49A 1BQ2A 4PSGA 1TVUA 3V8HA 4O1XA 3BNZA 5H3AA 3KGBA 4JEFA 4XSDA 3QGTA 1EV5A 4FQSA 1VZEA 1F4FA 3EBUA 1TVWA 3C0AA 3BHLA 1TJSA 5H38A 5WRNA 3UWLA 1DNAA 1F4BA 1FWMA 1LCBA 1TSZA 4IRRA 3I3RA 4FOXA 1HW3A 1JMIA 4KY4A 1JUJA 5FCTA 1F4CA 3BYXA 1TISA 2OIPA 4GEVA 3KJSA 3IX6A 4ECKA 1HW4A 3BFIA 4KY8A 4UP1A 3GH2X 3EAWX 1AXWA 1F28A 1AIQA 2RD8A 3C06A 3N5EA 1VZAA 1J3JC 2BBQA 3IK0A 3EF9A 3JSUA 4ISWA 4DPHA 1JG0A 3HJ3A 1EVFA 3IHIA 1NJCA 1NJAA 1BSFA 3EGYX 3H9KA 1QZFA 5H39A 2TDDA 1RTSA 1BO7A 4FOAA 1BP0A 4O1XD 4FGTA 4EINA 4EZ8A 5HS3A 1BKPA 4O7UA 1BDUA 2H2QA 4GD7A 4XSEA 3UM5A 1YPVA 1AN5A 1BJGA
chains in the Genus database with same CATH superfamily
1VZCA 2FTNA 2TSCA 1KZJA 4G6WX 1B02A 2G8AA 1JTQA 3UM8A 1BQ1A 2TSRA 1KCEA 1EVGA 1JMHA 4IQBA 1TRGA 4KYAA 1JU6A 3DL5A 1B5DA 4FOGA 3CL9A 1BSPA 3KJRA 1VZBA 4Q0EA 2FTOX 3INVA 1TSVA 3EHIX 1SEJA 1TSMA 1NJEA 1J3IC 3ED7A 3UM6A 1J3KC 4G2OX 4EILA 4LRRA 3GG5A 3IJZA 1JMGA 1F4GA 3NRRA 3UWLB 2ONBA 2KCEA 3DGAC 2G86A 4KPWA 1JMFA 3BGXA 4F2VA 3CLBA 1NCEA 4XSCA 1TDBA 2AAZA 3OB7A 1TDCA 3HB8A 2G8DA 4EB4A 1KZIA 1QQQA 2G8XA 1F4EA 2RD8B 3N5EB 1NJBA 4H1IA 1AJMA 1TLCA 1TSDA 4TMSA 4E28A 3EDWX 1I00A 1JUTA 1HZWA 1LCEA 3QG2A 4H0RA 4IQQA 2TDMA 1TSLA 1AOBA 1BKOA 3B5BA 1TDAA 1SYNA 1FFLA 2A9WA 2G89A 3K2HA 4DPDA 3IK1A 1JTUA 4E5OA 4ISKA 1THYA 1DDUA 1BPJA 2VETA 4H0UA 1VZDA 3B9HA 1NJDA 2FTQA 3IRMA 1TYSA 1TSWA 3GH0A 1TSYA 1HVYA 3BHRA 3EJLA 1TSNA 1ZPRA 1F4DA 2VF0A 5BY6A 3HBBA 4DQ1A 3IROA 4Q0DA 1BO8A 1B5EA 1TDUA 3DL6A 3TMSA 3BZ0A 1BIDA 1TSXA 4O1UA 2RDAA 1EV8A 3IRNA 3QJ7A 3N5GA 1BP6A 3DG8C 1CI7A 1LCAA 4GYHA 1TLSA 4DP3A 4KNZA 1TVVA 5J7WA 1B49A 1BQ2A 4PSGA 1TVUA 3V8HA 4O1XA 3BNZA 5H3AA 3KGBA 4JEFA 4XSDA 3QGTA 1EV5A 4FQSA 1VZEA 1F4FA 3EBUA 1TVWA 3C0AA 3BHLA 1TJSA 5H38A 5WRNA 3UWLA 1DNAA 1F4BA 1FWMA 1LCBA 1TSZA 4IRRA 3I3RA 4FOXA 1HW3A 1JMIA 4KY4A 1JUJA 5FCTA 1F4CA 3BYXA 1TISA 2OIPA 4GEVA 3KJSA 3IX6A 4ECKA 1HW4A 3BFIA 4KY8A 4UP1A 3GH2X 3EAWX 1AXWA 1F28A 1AIQA 2RD8A 3C06A 3N5EA 1VZAA 1J3JC 2BBQA 3IK0A 3EF9A 3JSUA 4ISWA 4DPHA 1JG0A 3HJ3A 1EVFA 3IHIA 1NJCA 1NJAA 1BSFA 3EGYX 3H9KA 1QZFA 5H39A 2TDDA 1RTSA 1BO7A 4FOAA 1BP0A 4O1XD 4FGTA 4EINA 4EZ8A 5HS3A 1BKPA 4O7UA 1BDUA 2H2QA 4GD7A 4XSEA 3UM5A 1YPVA 1AN5A 1BJGA
chains in the Genus database with same CATH topology
1VZCA 2FTNA 2TSCA 1KZJA 4G6WX 1B02A 2G8AA 1JTQA 3UM8A 1BQ1A 2TSRA 1KCEA 1EVGA 1JMHA 4IQBA 1TRGA 4KYAA 1JU6A 3DL5A 1B5DA 4FOGA 3CL9A 1BSPA 3KJRA 1VZBA 4Q0EA 2FTOX 3INVA 1TSVA 3EHIX 1SEJA 1TSMA 1NJEA 1J3IC 3ED7A 3UM6A 1J3KC 4G2OX 4EILA 4LRRA 3GG5A 3IJZA 1JMGA 1F4GA 3NRRA 3UWLB 2ONBA 2KCEA 3DGAC 2G86A 4KPWA 1JMFA 3BGXA 4F2VA 3CLBA 1NCEA 4XSCA 1TDBA 2AAZA 3OB7A 1TDCA 3HB8A 2G8DA 4EB4A 1KZIA 1QQQA 2G8XA 1F4EA 2RD8B 3N5EB 1NJBA 4H1IA 1AJMA 1TLCA 1TSDA 4TMSA 4E28A 3EDWX 1I00A 1JUTA 1HZWA 1LCEA 3QG2A 4H0RA 4IQQA 2TDMA 1TSLA 1AOBA 1BKOA 3B5BA 1TDAA 1SYNA 1FFLA 2A9WA 2G89A 3K2HA 4DPDA 3IK1A 1JTUA 4E5OA 4ISKA 1THYA 1DDUA 1BPJA 2VETA 4H0UA 1VZDA 3B9HA 1NJDA 2FTQA 3IRMA 1TYSA 1TSWA 3GH0A 1TSYA 1HVYA 3BHRA 3EJLA 1TSNA 1ZPRA 1F4DA 2VF0A 5BY6A 3HBBA 4DQ1A 3IROA 4Q0DA 1BO8A 1B5EA 1TDUA 3DL6A 3TMSA 3BZ0A 1BIDA 1TSXA 4O1UA 2RDAA 1EV8A 3IRNA 3QJ7A 3N5GA 1BP6A 3DG8C 1CI7A 1LCAA 4GYHA 1TLSA 4DP3A 4KNZA 1TVVA 5J7WA 1B49A 1BQ2A 4PSGA 1TVUA 3V8HA 4O1XA 3BNZA 5H3AA 3KGBA 4JEFA 4XSDA 3QGTA 1EV5A 4FQSA 1VZEA 1F4FA 3EBUA 1TVWA 3C0AA 3BHLA 1TJSA 5H38A 5WRNA 3UWLA 1DNAA 1F4BA 1FWMA 1LCBA 1TSZA 4IRRA 3I3RA 4FOXA 1HW3A 1JMIA 4KY4A 1JUJA 5FCTA 1F4CA 3BYXA 1TISA 2OIPA 4GEVA 3KJSA 3IX6A 4ECKA 1HW4A 3BFIA 4KY8A 4UP1A 3GH2X 3EAWX 1AXWA 1F28A 1AIQA 2RD8A 3C06A 3N5EA 1VZAA 1J3JC 2BBQA 3IK0A 3EF9A 3JSUA 4ISWA 4DPHA 1JG0A 3HJ3A 1EVFA 3IHIA 1NJCA 1NJAA 1BSFA 3EGYX 3H9KA 1QZFA 5H39A 2TDDA 1RTSA 1BO7A 4FOAA 1BP0A 4O1XD 4FGTA 4EINA 4EZ8A 5HS3A 1BKPA 4O7UA 1BDUA 2H2QA 4GD7A 4XSEA 3UM5A 1YPVA 1AN5A 1BJGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VZC A;  2FTN A;  2TSC A;  1KZJ A;  4G6W X;  1B02 A;  2G8A A;  1JTQ A;  3UM8 A;  1BQ1 A;  2TSR A;  1KCE A;  1EVG A;  1JMH A;  4IQB A;  1TRG A;  4KYA A;  1JU6 A;  3DL5 A;  1B5D A;  4FOG A;  3CL9 A;  1BSP A;  3KJR A;  1VZB A;  4Q0E A;  2FTO X;  3INV A;  1TSV A;  3EHI X;  1SEJ A;  1TSM A;  1NJE A;  1J3I C;  3ED7 A;  3UM6 A;  1J3K C;  4G2O X;  4EIL A;  4LRR A;  3GG5 A;  3IJZ A;  1JMG A;  1F4G A;  3NRR A;  3UWL B;  2ONB A;  2KCE A;  3DGA C;  2G86 A;  4KPW A;  1JMF A;  3BGX A;  4F2V A;  3CLB A;  1NCE A;  4XSC A;  1TDB A;  2AAZ A;  3OB7 A;  1TDC A;  3HB8 A;  2G8D A;  4EB4 A;  1KZI A;  1QQQ A;  2G8X A;  1F4E A;  2RD8 B;  3N5E B;  1NJB A;  4H1I A;  1AJM A;  1TLC A;  1TSD A;  4TMS A;  4E28 A;  3EDW X;  1I00 A;  1JUT A;  1HZW A;  1LCE A;  3QG2 A;  4H0R A;  4IQQ A;  2TDM A;  1TSL A;  1AOB A;  1BKO A;  3B5B A;  1TDA A;  1SYN A;  1FFL A;  2A9W A;  2G89 A;  3K2H A;  4DPD A;  3IK1 A;  1JTU A;  4E5O A;  4ISK A;  1THY A;  1DDU A;  1BPJ A;  2VET A;  4H0U A;  1VZD A;  3B9H A;  1NJD A;  2FTQ A;  3IRM A;  1TYS A;  1TSW A;  3GH0 A;  1TSY A;  1HVY A;  3BHR A;  3EJL A;  1TSN A;  1ZPR A;  1F4D A;  2VF0 A;  5BY6 A;  3HBB A;  4DQ1 A;  3IRO A;  4Q0D A;  1BO8 A;  1B5E A;  1TDU A;  3DL6 A;  3TMS A;  3BZ0 A;  1BID A;  1TSX A;  4O1U A;  2RDA A;  1EV8 A;  3IRN A;  3QJ7 A;  3N5G A;  1BP6 A;  3DG8 C;  1CI7 A;  1LCA A;  4GYH A;  1TLS A;  4DP3 A;  4KNZ A;  1TVV A;  5J7W A;  1B49 A;  1BQ2 A;  4PSG A;  1TVU A;  3V8H A;  4O1X A;  3BNZ A;  5H3A A;  3KGB A;  4JEF A;  4XSD A;  3QGT A;  1EV5 A;  4FQS A;  1VZE A;  1F4F A;  3EBU A;  1TVW A;  3C0A A;  3BHL A;  1TJS A;  5H38 A;  5WRN A;  3UWL A;  1DNA A;  1F4B A;  1FWM A;  1LCB A;  1TSZ A;  4IRR A;  3I3R A;  4FOX A;  1HW3 A;  1JMI A;  4KY4 A;  1JUJ A;  5FCT A;  1F4C A;  3BYX A;  1TIS A;  2OIP A;  4GEV A;  3KJS A;  3IX6 A;  4ECK A;  1HW4 A;  3BFI A;  4KY8 A;  4UP1 A;  3GH2 X;  3EAW X;  1AXW A;  1F28 A;  1AIQ A;  2RD8 A;  3C06 A;  3N5E A;  1VZA A;  1J3J C;  2BBQ A;  3IK0 A;  3EF9 A;  3JSU A;  4ISW A;  4DPH A;  1JG0 A;  3HJ3 A;  1EVF A;  3IHI A;  1NJC A;  1NJA A;  1BSF A;  3EGY X;  3H9K A;  1QZF A;  5H39 A;  2TDD A;  1RTS A;  1BO7 A;  4FOA A;  1BP0 A;  4O1X D;  4FGT A;  4EIN A;  4EZ8 A;  5HS3 A;  1BKP A;  4O7U A;  1BDU A;  2H2Q A;  4GD7 A;  4XSE A;  3UM5 A;  1YPV A;  1AN5 A;  1BJG A; 
#chains in the Genus database with same CATH topology
 1VZC A;  2FTN A;  2TSC A;  1KZJ A;  4G6W X;  1B02 A;  2G8A A;  1JTQ A;  3UM8 A;  1BQ1 A;  2TSR A;  1KCE A;  1EVG A;  1JMH A;  4IQB A;  1TRG A;  4KYA A;  1JU6 A;  3DL5 A;  1B5D A;  4FOG A;  3CL9 A;  1BSP A;  3KJR A;  1VZB A;  4Q0E A;  2FTO X;  3INV A;  1TSV A;  3EHI X;  1SEJ A;  1TSM A;  1NJE A;  1J3I C;  3ED7 A;  3UM6 A;  1J3K C;  4G2O X;  4EIL A;  4LRR A;  3GG5 A;  3IJZ A;  1JMG A;  1F4G A;  3NRR A;  3UWL B;  2ONB A;  2KCE A;  3DGA C;  2G86 A;  4KPW A;  1JMF A;  3BGX A;  4F2V A;  3CLB A;  1NCE A;  4XSC A;  1TDB A;  2AAZ A;  3OB7 A;  1TDC A;  3HB8 A;  2G8D A;  4EB4 A;  1KZI A;  1QQQ A;  2G8X A;  1F4E A;  2RD8 B;  3N5E B;  1NJB A;  4H1I A;  1AJM A;  1TLC A;  1TSD A;  4TMS A;  4E28 A;  3EDW X;  1I00 A;  1JUT A;  1HZW A;  1LCE A;  3QG2 A;  4H0R A;  4IQQ A;  2TDM A;  1TSL A;  1AOB A;  1BKO A;  3B5B A;  1TDA A;  1SYN A;  1FFL A;  2A9W A;  2G89 A;  3K2H A;  4DPD A;  3IK1 A;  1JTU A;  4E5O A;  4ISK A;  1THY A;  1DDU A;  1BPJ A;  2VET A;  4H0U A;  1VZD A;  3B9H A;  1NJD A;  2FTQ A;  3IRM A;  1TYS A;  1TSW A;  3GH0 A;  1TSY A;  1HVY A;  3BHR A;  3EJL A;  1TSN A;  1ZPR A;  1F4D A;  2VF0 A;  5BY6 A;  3HBB A;  4DQ1 A;  3IRO A;  4Q0D A;  1BO8 A;  1B5E A;  1TDU A;  3DL6 A;  3TMS A;  3BZ0 A;  1BID A;  1TSX A;  4O1U A;  2RDA A;  1EV8 A;  3IRN A;  3QJ7 A;  3N5G A;  1BP6 A;  3DG8 C;  1CI7 A;  1LCA A;  4GYH A;  1TLS A;  4DP3 A;  4KNZ A;  1TVV A;  5J7W A;  1B49 A;  1BQ2 A;  4PSG A;  1TVU A;  3V8H A;  4O1X A;  3BNZ A;  5H3A A;  3KGB A;  4JEF A;  4XSD A;  3QGT A;  1EV5 A;  4FQS A;  1VZE A;  1F4F A;  3EBU A;  1TVW A;  3C0A A;  3BHL A;  1TJS A;  5H38 A;  5WRN A;  3UWL A;  1DNA A;  1F4B A;  1FWM A;  1LCB A;  1TSZ A;  4IRR A;  3I3R A;  4FOX A;  1HW3 A;  1JMI A;  4KY4 A;  1JUJ A;  5FCT A;  1F4C A;  3BYX A;  1TIS A;  2OIP A;  4GEV A;  3KJS A;  3IX6 A;  4ECK A;  1HW4 A;  3BFI A;  4KY8 A;  4UP1 A;  3GH2 X;  3EAW X;  1AXW A;  1F28 A;  1AIQ A;  2RD8 A;  3C06 A;  3N5E A;  1VZA A;  1J3J C;  2BBQ A;  3IK0 A;  3EF9 A;  3JSU A;  4ISW A;  4DPH A;  1JG0 A;  3HJ3 A;  1EVF A;  3IHI A;  1NJC A;  1NJA A;  1BSF A;  3EGY X;  3H9K A;  1QZF A;  5H39 A;  2TDD A;  1RTS A;  1BO7 A;  4FOA A;  1BP0 A;  4O1X D;  4FGT A;  4EIN A;  4EZ8 A;  5HS3 A;  1BKP A;  4O7U A;  1BDU A;  2H2Q A;  4GD7 A;  4XSE A;  3UM5 A;  1YPV A;  1AN5 A;  1BJG A; 
#chains in the Genus database with same CATH homology
 1VZC A;  2FTN A;  2TSC A;  1KZJ A;  4G6W X;  1B02 A;  2G8A A;  1JTQ A;  3UM8 A;  1BQ1 A;  2TSR A;  1KCE A;  1EVG A;  1JMH A;  4IQB A;  1TRG A;  4KYA A;  1JU6 A;  3DL5 A;  1B5D A;  4FOG A;  3CL9 A;  1BSP A;  3KJR A;  1VZB A;  4Q0E A;  2FTO X;  3INV A;  1TSV A;  3EHI X;  1SEJ A;  1TSM A;  1NJE A;  1J3I C;  3ED7 A;  3UM6 A;  1J3K C;  4G2O X;  4EIL A;  4LRR A;  3GG5 A;  3IJZ A;  1JMG A;  1F4G A;  3NRR A;  3UWL B;  2ONB A;  2KCE A;  3DGA C;  2G86 A;  4KPW A;  1JMF A;  3BGX A;  4F2V A;  3CLB A;  1NCE A;  4XSC A;  1TDB A;  2AAZ A;  3OB7 A;  1TDC A;  3HB8 A;  2G8D A;  4EB4 A;  1KZI A;  1QQQ A;  2G8X A;  1F4E A;  2RD8 B;  3N5E B;  1NJB A;  4H1I A;  1AJM A;  1TLC A;  1TSD A;  4TMS A;  4E28 A;  3EDW X;  1I00 A;  1JUT A;  1HZW A;  1LCE A;  3QG2 A;  4H0R A;  4IQQ A;  2TDM A;  1TSL A;  1AOB A;  1BKO A;  3B5B A;  1TDA A;  1SYN A;  1FFL A;  2A9W A;  2G89 A;  3K2H A;  4DPD A;  3IK1 A;  1JTU A;  4E5O A;  4ISK A;  1THY A;  1DDU A;  1BPJ A;  2VET A;  4H0U A;  1VZD A;  3B9H A;  1NJD A;  2FTQ A;  3IRM A;  1TYS A;  1TSW A;  3GH0 A;  1TSY A;  1HVY A;  3BHR A;  3EJL A;  1TSN A;  1ZPR A;  1F4D A;  2VF0 A;  5BY6 A;  3HBB A;  4DQ1 A;  3IRO A;  4Q0D A;  1BO8 A;  1B5E A;  1TDU A;  3DL6 A;  3TMS A;  3BZ0 A;  1BID A;  1TSX A;  4O1U A;  2RDA A;  1EV8 A;  3IRN A;  3QJ7 A;  3N5G A;  1BP6 A;  3DG8 C;  1CI7 A;  1LCA A;  4GYH A;  1TLS A;  4DP3 A;  4KNZ A;  1TVV A;  5J7W A;  1B49 A;  1BQ2 A;  4PSG A;  1TVU A;  3V8H A;  4O1X A;  3BNZ A;  5H3A A;  3KGB A;  4JEF A;  4XSD A;  3QGT A;  1EV5 A;  4FQS A;  1VZE A;  1F4F A;  3EBU A;  1TVW A;  3C0A A;  3BHL A;  1TJS A;  5H38 A;  5WRN A;  3UWL A;  1DNA A;  1F4B A;  1FWM A;  1LCB A;  1TSZ A;  4IRR A;  3I3R A;  4FOX A;  1HW3 A;  1JMI A;  4KY4 A;  1JUJ A;  5FCT A;  1F4C A;  3BYX A;  1TIS A;  2OIP A;  4GEV A;  3KJS A;  3IX6 A;  4ECK A;  1HW4 A;  3BFI A;  4KY8 A;  4UP1 A;  3GH2 X;  3EAW X;  1AXW A;  1F28 A;  1AIQ A;  2RD8 A;  3C06 A;  3N5E A;  1VZA A;  1J3J C;  2BBQ A;  3IK0 A;  3EF9 A;  3JSU A;  4ISW A;  4DPH A;  1JG0 A;  3HJ3 A;  1EVF A;  3IHI A;  1NJC A;  1NJA A;  1BSF A;  3EGY X;  3H9K A;  1QZF A;  5H39 A;  2TDD A;  1RTS A;  1BO7 A;  4FOA A;  1BP0 A;  4O1X D;  4FGT A;  4EIN A;  4EZ8 A;  5HS3 A;  1BKP A;  4O7U A;  1BDU A;  2H2Q A;  4GD7 A;  4XSE A;  3UM5 A;  1YPV A;  1AN5 A;  1BJG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...