3BYYA

Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
109
structure length
109
Chain Sequence
AAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
rcsb
source organism Mus musculus
molecule tags Toxin
molecule keywords T cell receptor beta chain 8.2
total genus 28
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2008-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3byyA00
1SJHB 3A6OA 3RTQD 2F5BL 1FO0H 3MRKB 2H45A 2JJSC 4Y4HA 2ICWI 3WDJA 4OJFH 1BEYL 3T65B 3RGHA 3F58L 2HVKA 1X5XA 1S7XA 2VRAA 5HGAB 1F4WL 4NOFA 5FHBL 4PJ8B 4L3EA 3QH3B 3G08B 4HBCH 4MDIA 5D6CB 2WIIB 4JQIL 3C6LC 2NNAA 1P1ZB 3IDXL 1OF2B 4HAFA 3O2DL 4H88L 4QY8A 1SY6L 5DR5H 3N85L 1HHIB 3KWWA 2OR9H 5LGHH 4MJ4A 5EPMB 4OLEA 4KZEH 4LSSH 2CIIA 4H1LH 2IMMA 3VRIB 3MV7D 1QNZH 1F90H 1DANT 5ICZB 3LKSA 4YDIL 5IFJA 5B39A 5FA3B 5IVOA 1H0DA 3SE4A 2Q8BH 2LVCA 4IRSD 4ZPTA 5BO1L 3EYVA 2NY0C 3BPCB 5H37G 4EDXB 3T3PF 4NFBA 1RZGB 4H1LB 1OPGH 4X7SH 3OXSA 2DWEB 5TQ0L 1G7LB 1G9NC 7FABL 1AIFA 1CD1A 4XC3H 1CE1L 1NGZA 2YD6A 4O2CA 3RTQB 1BHGA 3CUPA 3MLYL 4UU9B 1CICB 2IJ0C 4P57B 4JDZA 3MMEB 5SWSD 2BVTA 1OSZA 3WFBL 2YD2A 5HTSA 5D7SL 1F11B 4E5XA 2VXVH 2J8UF 1SVZA 4PJIB 3G6JF 5FXCH 3DMMD 1FORH 5JXED 3VXME 5DJDA 1M71A 2PTVA 2DQCH 3PHQA 1ZHLA 3LN9A 1KJVA 1A7QH 3MRPA 3UPCA 1FFPA 5CHNB 2LU3A 5E2JA 4NO2B 1TVDA 2F53A 2P44B 3FB6B 2HRPH 1NGXA 4PRPE 2VQ1B 1T1XA 1ES0A 1NBZA 3A67L 4EUPG 4XCNB 3OG6B 5D6DA 2HFFB 3ZE1F 3SDYL 4D9LL 4J12A 5IQ9B 1SJEB 4O58L 5DT1H 5C0AE 4Y19A 4YBHA 3BUYB 4QWWC 4HUXA 3QUZD 1A7PH 5ETUB 3SO3B 3EO9L 3BDYL 2XTJD 3N1FC 1YYML 4ZS7H 5I74C 4XGZB 3EGSA 4UDUA 5IG7B 1F8TL 5FYKU 4IBLT 4X8XA 1CQYA 4PRPA 1CGWA 4YR6A 4PJ9A 2V5RA 4FTVD 1MWAA 4EXKA 3H3BC 5BZDB 1KJ2A 4Z0BL 3GSQB 4JO1L 4ZFOA 1O7SA 3P40A 1MFAH 5TFSH 2VDNH 2CR6A 3GIVA 5L88L 5GRUH 4MB5A 3RVTC 4JY5H 4HSQA 3TFKD 5D5ME 2NR6D 4U1KB 1KCUL 3WKNA 1QLEH 4L5FL 1PSKL 1CFTB 4MAYA 5GJTL 4LLUB 3FQUA 3RDTC 1EJOH 3GM8A 2NCMA 1BLNA 4U6YA 5FF6A 5KSBA 4C4KT 3K2UH 4NSKB 4LSQH 3E8UL 4OZFH 2CUHA 5HYSG 4XBEH 5E5MB 4CDGC 4ZFFB 5EC1A 5HHXL 2B1AH 4PJFB 4JEGB 5F96H 4KDWA 4G9FA 4FABH 4G6KL 2AV1A 2HJKA 1DDHB 2BCKA 1YEJL 3KPSD 5C0ND 3SDCA 3GMNB 4K3JH 3QZWG 5GQBA 1QBBA 2XZZA 2OTWB 4MD0A 1OAZH 2VLJA 3CFBB 1FJ1B 1I9EA 5FGBA 3L9RA 4OIIH 4MXQC 1R5IA 4UUJB 4XAKE 5HVHC 4XPTL 1I1AA 5C0AB 1MCNA 3V4PL 4P4RA 4MQXD 1FH5L 4GKOA 5EU5A 1SY6A 3OAYK 4NKMB 3WD5L 5IR1B 1MIEL 5A16B 4ODXB 3QULB 4LEOA 1CFQA 5C0NC 5E8EB 5I66B 3GRWL 3SDDC 4EUPH 4K7PH 5LQBL 3OKEA 1T7ZA 3L3GA 5F1NA 4JG1L 4ZUWA 2B4CH 3EYOA 4MQTB 1MWAL 4GKSA 4KJWC 3V6OC 2W65A 3E6FA 4HUKB 3EAKA 3P4OA 1CL7L 5FIEA 3RDTA 5JW4Q 1RURH 3P4NA 5HHVL 1EX0A 1N4XH 3OKKA 3HC4H 3HPJB 5CBAA 4KGLA 3RDTD 4NNYA 4M8VA 4KK8D 5TDOB 4M00A 3TIDB 3QSKB 3NCEB 2FL5A 5CD5D 1U95A 3GNML 2NR6C 3H3PL 4RA3A 5D5MA 1ZLUH 4G9DA 1U3JA 3WN5C 1U8MB 1I8MA 3SO5A 4HIEB 3KDMB 3X3FL 1B4JL 5D7IF 4B0MM 5C0AD 5KVGL 1AXIB 2DYPD 4XCYB 1HH9A 3FFDA 4LASL 4OT1H 5GXBB 1IGJA 1K6QH 1GZQB 3CH1A 4WO4C 1FNLA 1QSED 2Q76B 2X7LA 1RVFL 2DD8H 4Z7OF 5FM4A 2F54B 5ANMA 5F3HB 1JK8A 1EGJH 1A9EA 4UIKH 3T1FB 4I3RL 4PG9A 4HIHA 3ARDB 1A6UL 3NZHH 3DI2B 1FN4A 1UVQA 2WW8A 2BHZA 1C12A 3MBXH 4QNPF 2P8LB 2WUCH 5D93B 5D1ZD 3GM0A 4YK4B 3AREA 4OV5B 1LGVA 4GRLB 4QRSB 4HK0B 2E7LC 5IQ7L 3SDAD 3PQYB 4D9RD 1WFNA 4UILH 2FECL 1MJ8H 1MJ7H 4P2RB 1BFOA 2JELL 4GOSA 5EBWB 3WJLC 4NGHH 2WV3A 2R1XA 1RIVH 1MSPA 4YUEL 4O9HL 4FQ2H 5HGGS 2R2EA 2APXA 3DMMC 3IAPA 5E4EC 4KK8C 4Y4KA 4Z5RB 2N7BA 2ZP0T 2XN9E 4G43A 4XP1L 3HLAB 4F37F 2ZZUT 3MNZA 4RMSA 3NGBC 2X1XR 5L6YH 5EBGA 3OJMB 5HYSB 2DIAA 1NCCL 1U8IA 5EORH 4XCCL 4IS6A 4ZOEA 3VXMB 1ZLWH 3D3VD 3LEXB 5EU6B 5BV7B 5D9SA 3SE9H 1L0YA 3IDMB 1F4YL 4WUUB 5DJ6B 3GJFH 4WFGE 3VGFA 1U92B 3CFDB 2ARJB 2VLME 1HXYA 3U30B 3BP7B 4YZFF 3QCUH 4HFUL 1P2CA 3MV9D 3S88L 3MRMB 1JRHH 2OJEA 4X5WA 1GHFL 4ELKB 1T0MA 2VITA 5I9QC 1FNGA 2Z4QA 2BNQD 2G9HB 4GUPA 4PJAF 1LO3L 1XGYH 4LLVA 4YXKL 1XF2B 4TQEH 5MHSE 2X4RA 4XPFH 4HMCA 3C60A 5DHVH 2ZCHH 5T3ZH 4X9HA 4MQ7B 3PXJA 1RPQA 1ONQB 1MF2L 5IMLB 5TE4L 4R0LC 3V4UL 2Y36L 3DECA 5C0CB 4M1GL 5DJ8A 1MCQA 1JMXA 2AGJL 4OFIA 2YC1A 1F3DJ 4PJDB 3CSBA 4NQCD 5MENE 3OZ9H 4PRBA 3C8DA 4QF1B 4ZFGL 3V52H 1HYRC 4IJ3C 1AFVL 4FQ1H 4EN3C 4KFZC 4YFEA 4MD5A 1W72A 1Q9KB 3STZB 2A6DB 4I2XA 4OBSA 1QZ1A 1WIUA 2DN7A 4MA1B 5SWZA 1W0WA 2XY1A 5ERWA 3L3OA 4FFYH 2G2RB 4JN2A 5CLWA 3DUHA 1I3RA 4JO3L 1ND0A 2IPTL 1QG3A 4K3JL 4PJBE 4M7JL 1C5BL 4DW2L 2E5EA 1FAIH 1D9KC 4E0RA 5SWZE 4X6DF 3U4EB 4OCNC 3T2NH 5DSCA 4BZ1L 1KEGL 1VERA 3VXUB 5I1GL 2B1HH 3V4PH 2V2XA 5F7EH 4YXHH 2A6JB 1LEIB 1RUQH 4RGOL 2XTJC 3VFVA 4TNWF 3SGDI 1Z6JT 5T5FH 3TBYB 4WTWA 2D7QA 4LLQB 1NUFA 3SPVA 3CVHL 3NZ8B 4XCFH 5IT2H 4EKXA 4L4VB 2L7UA 3N0PB 3I6LE 1QQDB 3UPRB 4EBQL 5ICYB 3F8UB 2ILLA 3GHEL 4Z9KB 2QR0A 5D2NA 4RMQA 3T77A 3L3HB 2Z8RA 1AQDB 4YX2L 3OR6A 2B8OT 5HYIA 3BD4A 4KKNA 2AK4E 4UAOB 3Q6FA 2RCSL 4PR5B 3OHXA 3H9ZA 5GRUL 5C0JA 5C08D 3SGDH 1F6AA 1NBYB 3VXSE 4G7VH 2P42B 5I1AA 3DX7B 3THMH 3UTSB 1SEBA 1Q38A 3WUWB 1H15A 4PJ7E 4XBGA 2DQHL 2BHUA 1N3NB 1ZLWK 3IDYC 5IB4B 2P45B 3L3KB 3NIFE 3FTGB 3EOBB 1X5GA 1C1EL 4M62L 4M6OH 3D3VB 2VYRE 1OAQL 2AJSH 4L29A 1GRWA 1EEZB 3C08H 3G5XA 2FATH 4JG0L 1PZ5B 3S34L 3VFSB 1X5ZA 3WDHA 5CKGA 4F9PC 4WW2C 1J0IA 3AMLA 3NABL 4PP1C 4DKFL 3V7AG 1XF1A 1C8PA 2IFFH 4OZFA 4XTRD 3BN9C 2IC2A 2VO5A 1F3JB 3LPWA 5HVWA 4OB5L 2LAGB 3RZCC 3W82A 3B2UC 4P46B 4RAVA 1WGOA 1NC2A 3AS0A 1LNUB 4Q0XL 3LEVH 5GGRA 2R2HB 3OAYH 3I02A 2EE9A 2IADB 2P46B 3HFML 4JPKL 5E70A 3LKPA 1CZ8L 3HE7D 3TCLA 3DURA 4JHAH 4UOW1 1MWAH 1KBGH 3HE7A 3BW9B 3RTQC 3CZJA 4GMTH 4XMPL 1RK0A 2DQGL 3O3EA 1O0VA 3RL2A 4ERSL 1A6ZA 4DAGL 3SE9L 1MQKH 3OKNA 3ARGA 3BO8B 2YKLL 3RWGA 1G7IB 2H1PL 3LKNB 3TJHD 3OKDA 1IC4H 1PX4A 2WZPD 3VXQB 3FCTA 5C9KA 1ZGLP 3RWCA 1NEZG 2VZUA 1NMCC 3U0TB 1KT2A 4GAFB 4ZQKA 1VSCA 1SBSL 1HKFA 4MCZB 1JJUA 1WITA 4QO1A 4HWEL 1XR9B 4OZIE 2NY3D 4OLVL 2HT3C 3LV3A 4KY1L 3IRPX 2GK0A 1CD0A 1EDQA 5J12B 4GW5B 2E7MA 4NC1E 5FA4B 4D9QE 4PJEF 3KHQA 2DD8L 5I1IL 1WJ3A 5EU4B 5D7LB 1XGPB 1RZKC 1ZVSB 3TVMB 5L8KB 5SX4H 5JHDA 2IEPA 5CSZA 2E8YA 1YNKH 3V0VB 4PPTA 4F3FA 5I1CH 2CDEB 4G3YH 4JFDA 1Q9WA 5E24E 1GCFA 4HKJA 3SKMB 1U36A 4KHXL 2NYYD 3I84A 4ZODA 3QCTH 4Z7WE 3IDJB 2NX5B 3O6FB 4WO4B 1TPXC 2PO6A 3D69A 4WHYG 3DX9A 1CICD 2GITA 1JZ2A 1CF8H 4YHPB 5C0CE 4KRPD 4HQQH 3DIFB 3MA7B 2EH7L 4PFEA 1JI2A 3O3AA 4DGVL 4P59H 5I0ZA 4G7YH 3LY6A 5DJ2B 2FB4L 1WIOA 2XKUA 3JWDC 1SEQL 3LKOA 4DQOH 1IKFH 4O9HH 1MI5B 3BPNB 4U0RB 3GBNH 4NQED 3RKPA 4D9RE 1QD0A 4CVWA 3OGCA 4L4TB 5E94A 3PJSB 1GH7A 3TT3L 4H1LG 1UWEL 4A6YB 1KB5B 4D0CA 1T7WA 5T3XH 3ARXA 1MCKA 4WEBH 1CGSH 5D7LD 2DBLH 4HCRH 4JDTL 1U0QA 5HY9A 1EHLH 3T3MF 1F4YH 2AV7B 4U1HA 2KQMA 2QADB 3QCUL 1PG7L 3U36B 4HK3N 3BZFA 5D96C 3QQ3A 2F5AL 3X13A 3MYZA 1IEBB 4TSBL 1KC5H 2BY1A 1TENA 4U1GB 3UTQB 4EDWH 3TH4T 4F9LA 4PJEA 4ZPVA 3SGJA 2R8SL 4JFFD 3ES6B 5F7WC 3V7MA 3IDGB 4OCRL 1EAPA 1T2QL 1IGFH 3QNZA 1DQLL 2WM0A 2YXFA 4WHDA 1J5OH 4R2GD 4JQXC 4R3SA 3WEXB 5AG8A 4R26H 3U0WL 4IRZH 1LK2B 3R0MA 1KNOB 1EVTC 1ZHKA 2AEWA 1QBLL 4N1HB 4Y5VA 4G6AD 4MD4B 1S3KL 3M17B 4ORGB 2V7HB 4HMEA 4NYLB 5F6IB 1H3WM 4GO6B 4FOMA 2R69H 1IGYB 4Y1AD 4M4PA 1RZFL 5JQ6H 2BY0A 1YYLL 3HKFA 2F53E 2R1YB 3BAEH 4G6JL 3QIUB 3RGVD 4RIRA 1IAIL 3CXDL 4DUVA 3MA9L 2XKNB 1XGRB 4JG0H 4ODBD 1LDSA 2K7PA 3GUTB 3TNNA 3QO0A 3VH8B 4N0CD 3OJDA 1UACL 5GGVY 4HJJL 1J1PH 3VXRE 4JB9L 4WW2F 3MRRB 3QIWB 3N1QC 1OQOA 2GTWB 4NT6B 2ZSWA 4LKXB 3CMGA 2OR8A 2J5LB 1G9NL 2HFEA 1AGBB 2VDKH 4KVNL 1S8DB 4RGOH 4Z78A 1CFVL 4LRNH 1L7TH 2D7OA 1A1NA 2V9QA 3C5SB 3QJFA 3O0RL 3VMOA 5DJCB 2Q8BL 1P4BL 1EO8L 4OCWL 3V6BR 1OTTC 3ULSB 4L9DA 1S7TA 2A6KA 1U8PB 2GTZB 4OLUH 2I25N 1KELL 1YMME 4P4KC 4PJGE 2Z8SA 5JPMB 1U8LA 4S2SB 1HIML 4G8GD 1MAKA 5E8NB 1FCGA 4YHLH 2F19L 2YD8A 1IZKA 3C9NB 4P2OA 5DC9B 2D9CA 4XC1H 5ENWA 4YBLC 5C07A 2XQYK 1I3VA 4Y4FC 1ZS8B 1WAAE 1QBML 2HTKD 2JJUA 3K81A 3DROB 3MUY1 1HQRB 3AXLB 4UNVA 3HUJA 4XZUA 2VAAA 2EXYD 3ZLQC 5H37H 3NH7L 3HMWL 3RWFA 1CL7I 4KQ3L 4IDJH 4ZOBA 1TCRA 3T0EE 3CFIC 4F2MA 1C1EH 3G6JA 4OJFL 2BK8A 1X6LA 1CVRA 1HNGA 3IGAB 5T33L 5ISZA 4BUGA 1OD7A 4AIXA 5IB2B 3C08L 1UQSB 1CXFA 5B38G 4ACPA 1I7RB 4JQIH 4F7PA 3DLQR 4JLRB 4HT1H 1KFAL 3L95B 3N85H 2DLEA 3MFGB 3CDGA 4NJ9H 4NO3B 2X05A 4ZS7L 3A6CH 1MAJA 3NFPB 3RVVC 4LK4A 1KCRH 3C6LB 5D7IB 3CLEH 4FTVA 2YEZB 5DUBA 2BNRB 5I1LA 5DA4A 1TZHB 2BSTA 4P2OC 1T04A 4DUXA 1GYAA 2VDOH 5EZJB 1JPGB 5J3HD 4P4KB 4G8GE 3ILPA 3S8WA 3LZFL 3OB0H 1NH6A 5DLMH 5FYKH 3QXDB 4RFEB 4DCQA 4CVZB 1YDPB 4M1CD 4GG6A 4LFHG 1FAKT 3OKOB 2P5WA 4HGWB 2VXSL 1IGTB 1A64A 4DFHA 1W8NA 2A77H 2FSEA 4FQIL 1HHIA 3QEQD 5E6IB 3O4OC 2NY6D 2ICWA 2ITCB 3P0GB 5HJ3B 2P5EA 5DEFA 5IFJB 2R4SL 3EJYC 4R6UA 3KPSA 4GAYA 2GSIA 3D1MC 3MRBA 2HVJB 3ESVF 4ZTPL 2BVUA 3V7AE 4XPTH 3VFPA 3HB3D 1QEWB 3SDXE 5T3ZE 5F9OH 1UJ3C 2SEBA 1E28A 3GHBH 3H0TB 4OLZH 4JKWA 2LQRA 1FZJA 4APQB 1CI5A 3PL6C 4AQOA 5C0EB 5CSBA 2GJ6E 2B7DT 4S11A 4JG1H 4XAWL 2WWMC 3B2VL 2OR7A 5LAXA 4KI1A 4CDHA 3MUZ1 5EZOL 3G6AA 4FFVC 2XIDA 2ENYA 2HH0L 5IW3A 3ARBC 5EUOE 3SN6N 1WBZB 4LOUC 5DJDB 2VLKB 4B7IA 2V2TB 2DQTL 1I9JH 3ALXA 2FIKA 3KPSE 4Z0XB 5CEXA 4KK5C 1AGEA 3C2AL 5C09A 2K9UA 4ZD3L 3VG0L 4AEHH 4OI7A 4N0YL 1FFPB 5EDXA 1MVUA 3O3UN 2F53B 4BM7A 4U6VH 3FJTA 3MJ7B 4HXBL 3T0EC 1ES0B 3MRNA 5C09E 1MCHA 5CCKH 2YPKB 4ALAH 3VWKB 5I2IA 5IJKC 2W91A 1Y18B 1IGML 5C0RH 1HYSC 3CU1A 1X5LA 4S0SD 3HE6B 5EUOA 5IUSA 1RVFH 1NGWA 3HAEH 5F7YC 3TT1L 1SJXA 3B9KB 4OT1L 3QEQE 1K6QL 1S7RA 1EGJL 3CXHJ 1VACB 1MIMH 4YE4L 3MGOB 4N0UA 3ILQD 2V5YA 1QLFA 4V1DE 1PG7H 2AXGA 3VD3A 2FGZA 5JXAH 2CQVA 1JBJA 1LDPH 1KENL 4YLQT 1J86A 1FDLH 5D1ZB 1TJHL 3IFOA 5DJAA 1OWWA 4YJZL 1JHTB 2ZUVA 2Q8AL 4AL8L 4BH7A 5HDOA 4YHLL 5CJBA 2H32A 1FH5H 2C3HA 4PJHE 1DQLH 1YN6B 4ZO7A 4OCXH 1S9VA 2E27H 4X4MA 2Z93B 4XVJH 1Q9OB 2ADFL 1JRHI 4JFYA 5HI4C 2JCCB 2UWEA 4XP1H 3O6FC 3MRJB 3UJTH 4GG6E 1H5BA 3GMLA 5DFVC 12E8H 4NN5C 3U4BH 1A5FL 5J7CC 3O41A 3PG2A 5HDBF 3CDCA 2Y5EA 5ABDE 2DKSA 4IDJL 4AEEA 5E9DD 3CFBA 1A7BA 1DQDL 2J6EL 5I6XC 2I5YH 1DBKL 2PETA 4LKCB 2NXZC 2ARWA 2GUOB 4NDMB 3U2SA 3MV9A 2LU7A 3BH8A 4JZOA 5AG9A 3Q6GL 5IFAH 1JGEB 3BKJH 5FV2A 1I4FB 2APTA 1XGYL 4KJYA 3T04D 4L9LA 5E8DH 1C16B 5JDSA 3BEVB 3EYOB 4LCCA 3P9MA 2VKXA 2AK4D 4QRUB 3MYJB 2GFBB 1OCWL 3O0RH 4GRWF 4WFEE 5LGJB 4AENB 5E03A 2YXMA 1QPXA 2YUWA 4S0TD 3UZEA 4IHOB 4RGNB 4N0UE 2DQIL 5B21A 4GW1A 3GI9L 4U1MA 1HZHL 1NAMA 3LMJL 2E7LA 2XN9B 5KG9A 4U6HB 2A0LD 1AO7B 4J3TA 5LG1A 1NANI 2RIKA 1WUNT 5EN2A 1GOFA 2J1KA 2Y6SD 1B0WA 3UPAA 1ZT1B 4FFYL 4FQ2L 4YDVB 4Y8DC 4CN1A 4HXAH 2VQUA 5DMYA 3ULVD 1XF3B 5SV4A 1FLTX 2UWEF 4KI5C 3TZVB 4ONOA 3MGTB 2PYEA 3UXFA 1T20A 1X7QB 5F3BB 4GKZA 4XVUD 1OP5K 3BGMB 5E8OA 3GMOB 1YEKL 5KAQF 5H8DA 4Y16D 2F54E 3BPLB 1J05B 4PJ9C 3B3IB 2XWBB 4MS8C 1AY1L 5KVMC 3PL6D 4WY7L 2BNQA 2N7AA 1LO0L 1SYSA 4PTUA 3CVHH 3OX8A 2YK1H 4FQXC 1A2YA 1P6FA 4WJ5A 2ESVB 3U48A 3LQAC 2MOVA 1V7ML 4YPJA 4J1UB 4C56A 2IH1B 5SWSB 4AH2B 4G6ML 5D7JA 1OVZA 4XPFL 3OAUH 4WFHD 4YDIH 5KTEL 5DQ9A 3GO1L 3H9YA 3MCKA 3HLAA 3HRZB 3SDDA 1AP2A 2W38A 4IIQC 5IHUL 4JGMA 1IILE 3EOAA 4ZO8A 5DD1H 3ARSA 3ULVF 1JZ8A 2YR3A 4TOYL 2AGJH 5C3LD 4NKIH 3BJLA 3QISA 1MFBH 5D9SB 4JFPB 5ISZE 3VU2A 3KLHD 2R29H 1G1YA 4XC3L 5IB3A 4P5TC 3UCRA 2BNUB 3PWPA 1FE8H 1F13A 1HEZA 2BVQA 3HI6H 3CK0H 4P23A 3BHBB 4HEPG 4G8GA 6FABL 2PYEE 3V5DB 3AB0C 3HA0A 1I9IH 1JPTH 3DRQB 5GZOD 4KKLC 3O6KH 1JP5A 4QT5A 3W39A 2C26A 3LS5H 5EG6C 2X4RB 4R4NC 4JAMB 5CJOL 4RNRA 3STLA 1EK3A 2VISB 3FFCD 5JA9A 5DC4B 1K4DA 3L3DA 3GJFA 4MA7L 4FQPA 3Q3GB 2FJFA 3DJ9A 4OB5H 3O81A 4L8DA 4V1DB 3Q5TA 5C0CA 5DO2C 5JUEH 2LFGA 3O4OB 4Q0XH 4MB3A 2WQ8A 5ESQA 1QFPA 1INQA 1U8NA 1BVLB 3PWUB 4LRIA 2MCPH 3D85B 5FUOL 2ICWJ 1MJJB 5AAWA 4L8CA 3LN4B 1FVEA 5DEGB 3V6ZB 2Q20A 5SWSE 5JO5B 2EDQA 1P69B 4H5SB 5F6IC 1OSPH 4XP9H 5J9PB 1KG0A 3T3ME 2EH8H 4E42B 4LNRA 1QO3B 43CAB 4XMPH 1A4JB 1BQLL 3VXOA 4LBEB 1ZT7A 4Y5XC 1I3RB 4KKBC 3WSQL 1QTYT 1LILA 1WWCA 2EXYC 1EO7A 4L3CB 2IAMC 3DGGB 4OD3H 2GSGB 5DJXB 5E2VH 2L0DA 5A43C 3T0DA 2FWOA 3RX8A 4JRXA 4PRAA 4XBPA 1XR8A 3VWJD 1P7QB 1DE4B 1RZKL 2ARJQ 4G80B 1GGTA 1PFCA 4NO0A 3V8CA 3FMGL 4YDKH 3GIZL 4PIRF 4JZNB 5ID0B 2Y5TB 4ELME 3CFEB 4FQQB 5I9QB 4JE4B 4QYOA 1G7MA 1YEIL 4HAGA 4QRRD 4YHOL 3QWOB 4NQXB 1Z3GH 1NGPL 5SWQB 3WBDA 1MLBB 3SEPA 1XGQA 2HFGL 1N59A 4PV8B 3SY0B 3T77B 2H9GA 1T7VA 3VJ6A 4S1QH 4NZUH 1WC7B 2KL6A 1UG9A 2EYTB 4U1LB 2FHCA 4Y19E 1N8ZB 4LIQL 4LVHB 3RL1A 2DIJA 5D71H 3EYUH 3U0PB 5JHLL 4OIIL 4BELD 3BN3B 3D0LB 2EYSA 4ISVA 1A6AA 2Q8AH 4DGVH 4G7YL 2DQDL 4LEXH 5I1AB 2Y72A 2UYLA 1SEQH 1U3HC 2FHBA 1H15B 4OSUH 3WS3B 1QVOB 4K07A 2ATKB 4JKLA 4NUJB 2I9LB 4N0CC 4RA0C 4J8RA 4LLYA 2VDNL 2XTJE 1V7NH 2ADJA 1IC1A 2P7TB 3IAQA 5KVEL 4N8CH 5IMOA 1RQ5A 5EWIL 3FTGA 2B4CL 2IAMA 2HLFC 4ODHL 1N0XH 4NQEA 1B2WL 1KTDB 3LB6D 5IW1B 4ONHA 5GISL 3RGVC 5GGSB 4OZIB 1JNLL 5FFLA 1EJOL 2P48B 2OS7A 4AEIL 5DEZA 1J8HE 1ZHBA 1CD9B 2V5TA 1UXSA 3QEHA 1OTSC 5E1HB 5JDJA 4KKAD 4PJ5D 3EYSL 2LVEA 1D6VL 3GBMH 1PKOA 4ENEC 2IAND 1FPTL 4LSUH 3S3SA 4ZXBA 5HXMA 1F45A 1FL6B 2QSTA 1NBVL 1F3JA 3P4MB 2Y07L 3SKNA 4X4YA 2KKQA 1NC2B 4PBWD 3QUZA 4TUJB 5D2LA 5FHAL 5DMKB 4JPWH 1CDYA 1TNMA 5F7DB 1AKJA 3IJYB 3QI9A 4N9GB 3MRDA 4GQ9L 1ED3A 3B8SA 1S5HA 3TBVA 4MQSB 3QDGD 3CMOH 3V0WH 2XFXB 1BX2B 5IHUH 1DP0A 4QHMB 2X4OB 5AD0B 1INDH 2XOTA 4PUBL 5DHYA 1RV6X 4BFEA 4GS7B 4HC1A 4UU9A 4KV5F 3QIUC 1E4KC 4TSAH 1AI1H 1OSZB 3W0WD 3HG1A 2ZNWA 1MNUH 3GI8L 1GGBL 3PWNB 4M8QB 3HMXA 3SGKA 4HZLB 3V4VL 1T83C 2BSSA 2FX9L 3SCMD 3BKCL 1CF8L 1KPRA 1A7RH 1KLGA 3KJ6H 3CXDH 3EKCA 4R4BA 4HWNA 1CL7H 2HMIC 3QDMB 1M71B 1H3UA 5HYEA 4XCEA 1VFBA 5DVOA 4N5EC 2H26B 4QOKE 3G5ZA 5JLZA 2Z31C 3DO7A 4JZJB 3TA3B 2N1KA 2FLBT 4RCAA 3FKUS 1PVHA 3H3PH 4D0BA 4FXGA 4JDVA 3VRJA 3ZL4H 4PRDB 4PJCA 5EIIB 3X12A 1T1XB 4PJDE 3RNKB 2LV4A 4XCNA 3RPKA 3DV4B 2YRPA 2BX5A 5IQ9A 2OSLB 4DKEL 5B8CC 1UXWB 4JGJA 2Z8WC 1CFVH 4LRNL 1Q9WB 1WZKA 4MCYB 1INEL 1LVEA 1ZLVK 1GZPA 1L7TL 3DUUB 3FAXA 4APQD 3NIGF 4OAWA 1QHPA 3D69B 2WWKT 1P7HL 2EDBA 1A6UH 3NZHL 2BJML 4UT7L 4UDTA 4K7FA 3VD7A 2J3SA 3WDIA 1V7MH 4QRPD 5DJ2A 2MQ0A 4LPWA 5FO8B 5C0BA 2YUXA 1QACA 5GJSH 3F7VB 4NC2B 4TVPH 2GJZA 1HHHB 4OCRH 1Q94B 2FBJH 4LDEB 1DEEA 3ARRA 4JFXB 4R7DB 4HWBA 5HPMB 4R26L 4DZBA 4MJ2A 3QRGL 4YHMH 3N9GH 3DYOA 1NSNH 2FZ3B 1A0QH 4O00A 2E6QA 3FB8A 1MHEB 4Z7WB 2DTSA 4IJ3B 2K3TA 3AM8C 2FEDC 4K9EL 4MJ6A 1D5MB 2OL3A 3BAEL 3QG6A 4J6RH 1UGNA 3KPQB 4P9HL 5I76A 2AABH 1KPVB 3OG4B 3LVEA 4NQSB 5D7JC 1H3XA 5JNYA 1QRND 2A73B 5C0DB 4RISH 3G5VA 1BBJA 4KMLB 1FJ1A 5MHSD 5DMIL 3WS6A 5E2UH 4ELMB 5CS7A 4G5ZL 2GW5A 3MLSL 5DRXB 5TH2A 5FB8B 5CFHA 2DLTA 3LEYL 5H35B 4NFDA 4IRJC 4IOIB 2WBJA 4U1NB 3UTZA 4N90E 2DQDH 2EYRB 2CKBH 2X1PA 2VB5A 1MCSA 1G9NH 1YECL 4HBQA 4JJ5A 2G60H 4XPBH 1FYTA 5F1NB 4QXGH 4LARL 1NMCB 1HI6B 2XPGA 4MA3A 4PP1D 1BGXL 3MREB 3UO1H 1UZ6E 1N0LA 4HV8A 1YQ2A 3MLTA 3VRLE 2HKHH 4KXZI 2OI9C 3OKKB 5CBAB 4KJPC 3GRWA 4KROC 3NCCB 4O51A 2N4IA 4X7CC 5B3JE 5IJVA 2XKNA 5HGHA 1AXSB 4U31A 2ZOLB 2ZKHL 5DZOA 2IPUG 2XACC 3OB8A 4G8IB 4ODWA 5IB5A 1JUFB 3BKMH 3PV7A 1LWRA 1NDGA 5HPOA 1OM3H 5ITFA 1I7ZB 1AXTL 4OKDA 4HW6A 3Q48A 5E08L 3RKDD 3LIZH 4FQIH 4Z76A 2ZOKA 3RX5A 4XPGL 3TJEL 1C5CH 2WBKA 3MRHA 1NANH 5IVXF 5F21B 1IM9D 1KCKA 2HFEB 2YMXH 3PWVB 4JPWL 3FQXA 5I15H 5F7UA 2A6IB 4LGSB 4I2XE 3B6SA 1FAIL 4KQ3H 1JTTA 3QFJA 3GSVA 4YNYA 5GGTA 4K23H 2AXHA 4FFWC 1TQBB 3PWPD 4LHUD 4NHUA 4PTTA 1ORSA 2CXGA 2VDPL 5DK3A 1U8OA 4PRNB 4WW2B 5IM7A 5DVLA 2FATL 5D7IE 4ZUVB 3WHE0 4JO4L 3PP4H 2X1QA 5JIKA 4YZFE 4FQCH 2HLAA 1D5IL 3PDOA 4Z7OE 5LVEA 4OLXH 3W11C 3C9NA 4R96B 1MOEA 3B2VH 3RWEA 4LSTH 1U42A 4O2EA 5I0DA 3VWKC 2OXHA 3BP6B 3JWOC 1MQ8A 3PHOB 4KVCH 3IDIB 1U2HA 4XMLH 5ITBH 1NAML 1QSEE 1D9KD 4UV4L 3IJSB 4IMLB 4PS4L 3BRGC 5C08E 1HWGB 4JPKH 4JPIA 2R4RL 5JTWA 3AY4C 2B0SL 4YK4C 1EHXA 4NWUL 1JI1A 1LP9E 1ZKAA 2DAVA 2EO1A 3LEXA 3V5HB 2H2PD 1N0XL 1RUKL 2IBBA 2Z92B 4NNXB 3NPZB 4ALAL 4WVRA 1B2WH 4HKXA 3TBWA 1JWSB 1I1FB 5ICXA 1CCZA 1JNLH 5K9JH 4NQVA 3SE4C 4X98B 5HHPA 2FCBA 1OGTB 1ZA6B 3KYKH 3QIBD 3HE6D 5C0RL 1R3KA 2ZSVB 3R06B 5D7SH 2BOBA 2EIBA 4JLRA 3VDAA 3ULUC 2OP4L 2DF3A 4RZCA 4N90D 5B22A 1YA5A 1XF4B 3RJDA 3BH9A 4DFIA 3H42H 1FL3A 1UJ3A 1HOCB 1ERNA 1QFHA 4KTDL 3WN5B 1HXMB 1TCMA 1ZGLA 4PY8J 3BPOB 4PG2A 5T3XD 1PJ9A 1SM3H 3NCJH 2GJ6B 1FYTE 1ONQA 5IB1A 2BNRA 3KHOA 3WS6C 1NFDB 4PJGA 8CGTA 4JFEE 4QRTB 3ULUH 3ZDYE 1HHKA 1ACYH 4QGTA 1GOGA 3O8XB 5C6WH 4OLZL 3TWCL 4W6YB 1BVKA 2KBGA 1INDL 4GQPH 3SDYH 3H6JA 1B0GB 4RDQG 2MJWA 2W0FA 4LHJB 4I4WA 3FONB 1I7TB 3BDYH 4ZFOL 4GG6B 2E7HA 3IJHA 1DSFL 4PV9B 2E3VA 4X4XB 5EOQH 2PF6A 1TETH 2Y7QB 3V4VH 3ZYJA 5KN5A 5AZEL 4AK1A 4WHYH 1FC2D 2F5BH 2XY2A 2EIDA 3PDDA 5ALCL 5ALBL 4X6CE 3U4BL 5I1EL 4RISL 1FFRA 4JCMA 4U0RC 5IEKA 1UEYA 2ORBH 1U41A 1P5UA 2GY5A 1P84J 1UJTA 4G42B 4JN1L 2V2XB 3F7YA 3ZL4L 3FRUA 2A1WL 2RFXB 2D0GA 2NY4D 3IF1A 5HGDA 3B9EA 5JOPE 2QADC 1A02N 2Z31B 5BXFB 1EH9A 4JFDD 4LLQA 3ROLA 4ZG1A 1KGCD 3CH8A 3DYPA 2P5ED 3SDAC 4OZHE 1CGSL 4KUZL 5DD6B 5J8OA 3DX6B 4O2FA 2DKMA 1BM3H 2D7TL 4YXLL 3O2WH 4P5TB 5TDNB 2AK4B 4FABL 1OB1B 1R0AL 3FOLB 2C9AA 4LVNB 2NX5E 2AJZA 2YPLB 3UC0H 2VABB 3BWUC 4OV6F 2GCYA 3L3JA 4Z8FH 4AG4H 2V7NB 1LO2L 3QUMA 3NFSH 1AGEB 4WO4D 1QSFE 5I18H 4WEUD 3QEUB 4WU5A 1PBYA 3CVIH 4FZEL 3EJZC 2CIKA 1DQMH 1P6AB 2AI0L 3KPPA 4P5MB 4X6BB 3JV6B 5DK2B 4LLMB 3MRNB 3QWRA 5BV7H 2BERA 1OQXA 5IB4A 3C5JB 4OLYH 4R7NA 4PREB 3UP1A 2VDLH 5AZ2L 4ZAKA 1OP3K 5IIEB 4JRWA 1P4IH 4ZSOE 2NZ9C 4WW1B 4MXVF 1BF8A 4L3EB 3S37H 5CP7A 1LEKA 3QIBC 12E8L 2WBJD 4LSRL 3ULUE 1YMHA 2P8PA 1TQBC 3QXUA 3MRGB 4H26A 4IM8A 4NZTL 2CLVB 3DXAD 3ZDXE 2I60H 2P8MB 1OAUH 4WV1A 3DYMA 5IMKB 5FKAA 2X44D 3HZYA 1ZOXA 5LCVH 2I9TA 2H2PC 5EC2A 3IETB 1MUJA 5FCUL 3LRSA 4WI4A 1FGVL 3D2UB 1KIUA 4WY7H 4MX7A 1K3IA 3BT2H 4ZNEA 5BRZA 1ZA3A 4X9FA 4V2BA 4XHJC 2VL4A 2DJ4A 1H5BC 3LN5A 1TFHA 3A6BL 3CDYA 3I75B 3TC9A 4XNMA 1JPST 3GKZA 3I50L 1FBIL 5E8DL 1MEXH 5GRVL 1KLUA 5IWLA 4Y19D 3GMRB 4MJ5B 5TE6L 1CBVL 3GSUB 2BOCA 4UT6H 3L5JA 2VZSA 3W11D 4BH8B 3IS1X 4RDQF 4JFYB 2YBRA 3HE7B 2DOCA 1J5OL 3MUHL 4NWUH 1KPUA 3C8KA 5L7XL 3K3QA 4JY5L 3S37X 1L7IH 4P2YA 3U0WH 2AEPH 2CKBB 5CEZE 3QFDA 5KJRH 3ULVL 1ZAGA 4LFHD 2JCCE 2F58L 3DSNA 3D0VB 1UB6A 3NIDE 5CEZL 4OI8A 1QLRA 1Z5LB 1DN0A 3VXTB 1KELH 1PG7X 1R3IL 5D6CA 3MV7E 3WFDL 4U7SA 3RZCB 1WFUA 4AM0B 2X4TB 4IRJB 4QY8B 3O6KL 2OMBA 2Q6WA 2VXUL 3X3GL 4F7TB 4X6EB 3VE0B 4NO2A 4LL9A 4D8PA 5D4QA 3VRIA 3QT2A 4WRLA 1S78D 3K4AA 2IALA 3BEVA 1NL0L 5B39B 4XH2A 1MCDA 2H8PA 1E6OL 1XGPA 4LCCB 2EICA 3P77A 4EDXA 4EUPB 2IH3B 2GAZA 4HUXB 4IHOA 5H94A 2OL3H 1H3PH 1JPFA 3E1F1 3MRIB 3IDYB 5C8JB 2NX5A 3O6FA 1AY1H 3ARZA 4KJPD 5FYJE 3ESUF 4U7KA 2ITDA 4NZRH 3REWA 2C3WA 3MMEA 5C2BH 3LDBB 1AO7A 4HDIA 1V05A 3WFCH 1MFNA 3B83A 4HIIB 1KCLA 1JCKA 2IBZX 4YEFA 1I8KA 3GIVB 4QHKI 2V17H 1MI5A 5GSRB 3HN3A 1DLHB 1EERB 3OKMA 3RUGE 3UTOA 1BQLH 3HC4L 1TZIA 2VAJA 2PNDA 5TGBA 3OGCB 2EC9U 3SE3C 3LPFA 4LAQH 5L9DH 1G7JA 2PYEB 4U6YB 4L4TD 2B0SH 5I8EA 1XGTB 2E6PA 3BPOC 4X5XB 5A40E 1G9MH 1NFDF 2Z9TA 1U3ZA 3T0BA 3U7WH 4DKDC 3JBG7 2M2DA 2PTTA 3EUUA 5ID1A 3S3JA 1I1AD 4MDJB 5E1AB 2NXYB 2AV7A 3WFZA 5FUCE 2YPLE 3TYGL 3EYFA 3HMWH 4RRPG 1T3FA 2NY7H 5HHQB 3QQNA 3KYMB 1TPXB 2C3VA 1U91B 5L8LB 2YN5A 4NNPH 4PJAB 2FEDD 3MRFA 2J4WL 1BJ1J 1R5VB 3DXAB 4MGXA 3T0EB 5IVXA 1LD9B 1S7WB 4PJ9B 2O61B 1W0YT 4NJAL 4UQ2A 4XXCA 5CEYB 4YHKH 4ZOAA 1QSEA 1BP3B 2R4SH 1H3GA 5DVNA 2AJ3B 2EECA 5A16A 3LD8B 2VZVA 3TBTA 4GKNA 4NPYA 5TQ2L 3QA3A 5J12C 2BXZA 4U7MA 4MA1C 4ZTPH 4DEPB 5GZNC 3B4NA 2VZ1A 4JREB 1NLBL 3E2HC 4L4JA 2Q1EA 4Y5VB 5FECB 1C5DB 3VCLA 1G6RB 3ZE2F 3C6LD 5K33A 1JGUH 3E6FB 5GRWA 3T3PE 2HYMA 4HFWB 1EO5A 5GS0L 4ODHH 5T1LA 1HEZB 3RWHA 4F7EA 4XI5C 4GSDL 4APQC 4GG8A 1KACB 3ZKNC 5E2WH 5EA0L 4RBPK 1TETL 4G9FB 3KPRB 3FRPG 3QCVL 5IKCA 4F8TA 3TH2T 3IKCB 1T80A 1HHJA 5FUCC 2XICA 5LCVL 4M6AA 3BEWA 4P49A 5BMFH 4BJLA 1ZHNB 3FO1B 3ZKMC 1LP9A 2X4NA 1T1ZB 2XZCH 3REVB 2O93L 4NCC2 4POZC 1D6VH 3I6KA 3GBML 1OAKL 4XCYA 4KRNA 1RZ8A 3MQIA 5E6IC 3THML 1BWWA 2EIZA 5IESL 1MCOH 3I9GL 1IQWL 1IM3A 4Z78B 1S5IH 4OIBA 1IE5A 4QRRA 2X89D 4LLWA 3SOBL 1CFQB 4EI6A 2OJZH 1JK8B 1AGFA 1ZT4B 5D1XA 1CVSC 4OQTL 3ARDA 4HHAB 1EMTH 1FN4B 4FP8L 4LHUB 1YEIH 1JNNL 4LU5H 3WXVL 2OM5A 3RY6A 1OAQH 3QO1B 4JRXD 2RAMA 3ARDC 4F33B 2HT4C 3DI3B 1S7TB 2A6KB 3QIUD 1LHZA 3EO0B 1G6RL 4K2UL 1RIUL 2FD6H 3HPJA 5KJRL 4M1GH 1WZ1H 2MQ3A 5HD8D 5HI3D 2A83B 4Z8FL 5C71A 3ECBA 3FL7A 5EBWA 4XB7A 3KJ6L 4PJGF 1PX3A 1FFNA 1N6QL 1Q9LA 4PRAB 1DBBH 4HS3A 1XR8B 3F62A 3AXLA 1RK1A 3JVGC 1FFOB 1NDMB 3GSOB 4N0YH 1U8IB 3MJ6A 4RGMC 3KXFA 5IBLC 2XWJB 3ROOB 3HZVB 2R2BA 1IL1A 4I0PA 3KNBA 2DMBA 1A9EB 3T2NL 4HS6B 4QHLA 5I6XB 3CFJA 4HIHB 4WUUA 5DJ6A 1FO0A 1QPPA 3VXSB 4ERSH 2CDFA 4OZ4A 4YXHL 1P2CB 4PRHE 5A2JH 3VJ6B 5IGXL 4JY6B 5EULV 2EYTA 2V5MA 3RQ3A 4ZSOA 1HILA 5LBSL 1AGCA 4RSVA 3VFTB 2DM4A 4OGAC 3HI1A 5F88B 3RPIA 2EYSB 4XRCB 1JZ4A 2VXQH 3BIKB 3BVNA 3Q2CA 5JIPA 2FHFA 3O2DH 4H88H 4JRYA 1DBMH 5D8JL 2I07A 3SE8H 5EZLA 4EBQH 1Y6MR 1RUAH 1N5YH 1N2RB 1FDLL 2ATKA 4NUJA 2ADJB 2P7TA 2J8OA 5IMOB 3LQAH 2IAMB 5IV2B 5LKNA 1D9KB 3ILPB 2YC1B 1U6AH 1KIQB 2E9BA 1A1MA 3H9SB 5DDHA 5GGSA 1IRAY 2QSQA 4GMSH 5KSUA 2IPKB 4OQ1A 1P7KB 2EXWC 3BQUC 3FN9A 5DJYB 2A6DA 3QEHB 1TITA 2MNUA 3BP7A 1X5IA 2HN7A 3BKCH 2V2WA 2EDEA 1FO0L 2AABL 3TV3H 4C4KO 4P59L 1GIGH 5AWNH 5EO0B 5HJ3A 4X4YB 1LO4H 1U58A 3PL6B 3QRFM 1JF1B 3FRPA 4L8BA 4U6XB 4GUPB 1XF5B 2DDQH 4TTGA 4YHNA 5HHOE 2X42A 3EDFA 3GSNL 3BDXA 3BP5A 2QQLH 4PGEA 3O45A 4WUKH 4F15C 3FQWB 4K94L 2SEBB 5IOPA 4L4VE 1KN2L 5IF0A 3ZYIA 3MV7A 1D6EA 4FXKB 4G8EB 5DHYB 4KZEL 2FJGA 3ZE0F 5GRJH 1T5WB 4QHNB 1YEKH 1VEPA 3MODH 3PWJB 1YECH 3SO3C 5I8KL 1FYTD 4YQXH 4W4OC 4LP4A 3T08A 5KS9E 3HFMH 3BZ4A 1A7PL 1YNTB 2H6PB 4X6CB 3L3HA 3MX0A 5EOCH 1EFQA 1XCQB 3VFOB 1KPRB 4MNHA 3UO1L 3ZTNL 3Q5OA 5IBTL 4UT7H 2HJFB 1I3GH 5CIPH 4G8FA 4RX4A 3QNYA 5L0QB 1MCBA 4CMMA 4K3EH 3QXTA 3QCVH 4BZYA 3CSPA 2IBGA 2MHAB 4ZFZB 3DO7B 5KSVB 2R0KH 4OKVA 1EZVX 3OAUL 1D5BB 3AMKA 4ZTOL 2E9WA 1DQJB 1T1YA 5DSCB 4PJCE 3VD9A 3SCMA 2Q3AA 5CJQL 1SJHA 1C7SA 1S7SA 1SBSH 4J3SA 3X11B 1CXKA 1NCNA 5C07E 1NEZA 2ZUQB 4QHKJ 3QUKB 5KSAC 3C6SB 5B4MC 1G9EA 3IXAB 1CTOA 1VB9A 2WUBL 3DUUA 3SGEH 3QUYD 2P24A 3ZHLA 2AXGB 3LCYA 3C60C 3CZFB 1T7XA 2PXYD 3ARFD 4EIZC 5HDBE 3PIQA 5DJZB 2CSPA 4U33A 2NNAB 1DLFL 4P5TD 1DVFD 4O4YH 4M5YL 1MCWM 1I85A 4Y88A 4BH7B 4KHTL 3V6FA 3OHXB 1DUZA 1YJDH 2COQA 4HF5H 3U46B 1LNUA 3G5YB 3VGAC 4A2LA 1MRFH 3SDXA 1CDGA 4HGKC 3L1OH 2G5RA 1GPOH 5HPMA 3DBXA 3OXRA 4GRWB 4DZBB 3AU1B 1V3LA 4OCSH 1FG2A 1DBJH 3CU7A 1BQHA 3UTSD 4JFQA 3CGTA 4RX4D 1CGXA 2CJUH 3JTTA 4M4RA 3QUXB 4O2CB 4J3VA 4FQXD 3VI4F 4PS4H 1SHMA 5EUKB 1CICA 3QG6B 5CJXC 3D3VA 4NQCB 5HYJA 1SYVA 4MS8D 1FIEA 2MWCA 3LKNA 3OL2A 1Y0LB 4YIQB 3QH3A 4TVPE 4WTXA 5BS0A 5I1KL 4Y1AA 4TNVF 3WSQH 1RU9L 4YWGH 5AYUH 4GXUM 1ZHLB 3KYKL 3OKLA 2Y06H 2KPNA 1XR9A 4MNGA 4OF0A 1K8IA 2D4DA 4PJDF 4KI5F 2RGSA 1C5CL 2X10A 4G6KH 5J1SC 1KXVC 1JNHA 4NKOB 4PRHB 1QBMH 1JZ5A 4D0DB 3T8XB 5DD5H 4U3XA 8FABB 1VA9A 2W9DH 3PNWB 4LHUG 2Z35A 3I02B 3PHSA 3WE6A 4Q7DA 3BPCA 4PJ8C 3K74B 5GHWH 3CLFL 2O5ZH 5EO1B 2XA8H 4JFFB 5AYQA 2IQAB 1WK0A 1FLRL 1CFNA 5JUEL 4EJ1C 2NMSA 1G6VK 1UZ8B 3VGDA 4HC1L 4RAUA 4WI2A 4UDUB 4U6HA 1VGKB 5IB5B 5MEQB 5EN2B 3QNXA 4PJIA 5C0GB 5I19H 3QQ9D 2HRLA 3WNMA 1QUNA 1UC6A 1GGCH 3UTSE 4I0PD 4UOJA 2ZOKB 1YN7A 1HCVA 1HH6A 4KK9D 3SQOL 4WUUD 3HNSH 3E2HB 2QBWA 1CU4H 4LEXL 4JREC 1KCRL 1ZLVH 4NQUA 4MAYB 1XF3A 3WJJA 2I27N 2R0WH 2DQEH 2ZUSA 3FQUB 3B6SB 4I0CC 3NN8B 4J3XA 2X1OA 2FX7H 2R2CA 4OUUB 1T0NB 1UM4L 5SX5K 1NKRA 3IB4A 3GMOA 4KKCD 5GS1B 1FSKB 1FVDA 1KIPA 1Z9MA 3IFNL 3TO2A 4ETYA 2HT2C 4FQLH 3NCMA 5GISH 5D70L 5IM7B 4JM4H 4KDTA 1A7NH 4JFDB 1PW3A 5FYKE 1JNJA 4JPVL 1DEDA 1NUGA 3ET9F 1QYGH 3OB0K 3B9KC 5C0CD 4PLKD 4QOKB 4XNQB 3VFRA 4TPRL 4XGZA 4KUZH 43C9B 2FLRT 1A4KB 32C2A 2JKXA 3M1BA 4I3RH 1AR1C 2HWZH 5GGUA 2D2OA 4HKBA 3H42L 2IH1A 5SWSA 5GS1C 5T1KA 1JHLL 5CINH 2ESVE 4LMQI 1UADC 1KEMH 1MFCH 3MNVB 4JY4A 4X99B 5IROC 1N5YL 2X89A 5DRWA 2EC8A 4OGYL 5CSGA 1LK2A 3ARBB 1BPVA 3LQAL 5FKPB 1HSBA 2ICEA 4YO0B 1K4CB 3V0WL 2IQ9L 3DWTA 3TBWB 1TVHA 2W65B 5DUMH 4NRZA 4HWBH 3MRLA 4BSJA 3GJEA 3SKJH 5BZWA 3QIUA 4M3JA 5ESVA 4OLYL 1XH3B 4NOBA 2BOBB 4PJFA 5GGVL 5AUMA 5FEBA 5J56B 4S1SH 4K8RC 4PJBB 3DVNA 3O6ML 4PLKC 2AKRB 3GUTA 3D25B 1EZVY 3QQ3B 3QO0B 4U2YA 2XTLA 1D5XA 3VG9C 3VH8A 3U6RA 5IW6B 1NGQL 3V95A 3TEUA 1ZGLB 2VLJB 5F93C 3L9RB 3DXAE 5MERA 4I13B 1U3YA 4PGBB 4KUCF 1R3HA 4KKCC 2FNBA 1W0VA 1YEFL 4LSUL 3NFNA 1JRHL 2Q76A 3UTTE 3G9AB 3PXHA 4ZOCA 1EEYB 4K94H 4HX1B 5CCKL 3U9UB 2Z91B 4PBXA 1BVKB 4L8CB 3T1FA 3K8LA 5I8CB 3LN4A 1WIPA 1MCPH 4XVTL 1XMWA 5JW4N 2PO6D 2VDQH 2D31A 2YRLA 3TVMD 4B41A 4AT6B 4D3CL 3KPMB 1T5XA 2UZXB 3OBAA 2KUTA 3DMMA 4QGYA 2OMNA 4GG6F 5FV1L 5HSFA 1L7IL 1IEAB 3ELAT 3L6FB 1EPFA 1ZT7B 4M9PA 5MEPB 3G9VA 2VLRB 2F74B 3IYLW 1KTLB 2ZCKH 4P2RA 2HKFH 7FABH 2FO1A 1NFKA 4G9FD 2R1XB 1W72H 3VW3H 5DQDH 2FBOJ 1MAML 3TVMC 4G9DB 5F7KC 3LS4L 3A0OA 1A7RL 1R24B 2WLZA 4JKKA 2Q87A 4QXTB 5HDQH 2LABA 3RHWF 4LLAA 3H2WA 5BV7L 1G1CA 4M1DH 1UEMA 4PJ5A 2BRRL 4OM1H 2DTMH 3QEQB 2Q86A 5C09D 1TCRB 3CD4A 3ETBF 1S8DA 1AD0A 3EYQD 2AAVA 5EFIA 1E6OH 3U30C 1RHHB 1OHQA 3HUJF 1NL0H 3QJFB 1KEGH 4DN3L 1JHKL 4UT9L 3KPNB 4NKDB 4J6RL 5J6HA 3L3IB 4W6WB 4P9HH 3ZDZE 2EZ0C 3QUMH 3AREB 4X80H 1T0MB 4OV5A 3CPLA 3MV8A 1A6VH 1JGVH 1M7DB 2Z4QB 4HBCL 4M5YH 3MR9B 4Y2DC 4J4PA 4H0IA 1OTUD 1XAUA 5M94B 3MV01 4CNIA 3WFCL 2V17L 3I3EA 1YEEH 1P53A 5FK9A 4LSSL 4FG6D 1FBIH 5I17B 4CADB 2OR9L 5C0BE 2HH0H 4JHZA 5C0FA 4X7TB 4P46C 1V8HA 4H8WC 3OR7B 4JM2A 1I9JL 2JE8A 3ARUA 5F1IB 5D93C 4HJGA 3JV0A 1FG9C 3P73A 3WUZA 5BO1H 3AAZA 1TTUA 3AM8A 3VI4E 5CUSL 4L5FH 4MD5B 3IFNH 3RA7L 4X7SL 5TQ0H 3STZA 4FQLL 4OM0H 3L5WB 1A0QL 3TYGH 5IMKA 3CC5B 2L7JA 4LDLB 5FGBC 1A6TA 1ND0B 2PXYC 3M07A 3ZSTA 1JMZA 1ZA3B 1FNGB 4RBPH 3QUZB 4TUJA 5D2LB 1JFQH 1TMCB 3S35L 2BC4A 2QTEA 4XWOD 1EUUA 5CMAB 4E41E 2HVJA 3UBXI 1A7QL 3HC0A 1Z0NA 4HIJB 1RY7B 2X9XA 1OAZL 5CGTA 4BH8A 1AHWA 2EKSA 1ZWIB 1FGNL 1WWAX 4QHMA 4ZNCD 3QQ4A 4ZMAT 2JB5L 3LQZA 5BRZD 1NCBH 4KK9C 3LHPH 4MAYC 1CK0H 1NCWL 1PYWB 3K7UA 2YSSB 3F5WB 1WBXB 5JW4R 5GS0H 2IFGA 3NIGE 1OTTD 1A47A 1IGIL 2QHRL 5IHBA 2YPLD 5DI8B 4I2XB 4AIOA 1JGDA 3BE1L 4BQ6A 5CGYD 4YBQD 4XVJL 4X0KB 3SJVD 3P0YL 2BVOB 3H7BB 2A9NL 4MHHG 1J87A 5GGSY 4GSDH 1IGTA 4IRJA 1ZMYA 5HHME 4LHQB 1NGQH 4LGPB 1MFAL 4U1GC 5TFSL 2IALB 3WHE1 5L88H 3MSPA 1HNFA 4K8RH 2XZQH 4R0LB 5DQJB 5F8QC 4I5BA 5C6TH 1P7QD 2ERJB 2I5YL 3MGAA 1LEIA 5EUOB 1QEWA 4LCCC 4FQXA 3FHQA 4LQ1A 3PUCA 1KB5H 4A6YH 3TBYA 1UB5A 2BRQA 3BKJL 5BW7C 1JPFB 1UA6H 1J8HA 4NQCE 1I7UA 3EO1A 2AW2A 3C8HA 2F54D 5DHXB 2J8HA 4LVOB 3RWJB 2D0FA 1BD2A 3KJ4C 1NFIA 4X6DB 2ICCA 3FB5B 2VH5H 4P2QE 2R0ZL 4WHTA 4K94C 5GSVB 4M5ZL 3G6AB 4Y5YC 3VGGA 3WJJC 4GJTB 5C0BD 3TZVC 1WBZA 5CJXA 3QG7L 3TPKA 3Q6FB 4FTVE 1DFBH 2Y9RT 4OZFG 1FNHA 2X9YA 5T1MA 5JOFA 5ECJE 1YZZA 3CCHA 3M8OH 3UBXG 5I8EB 2DJUA 3HNTL 4BSWB 3LKPB 3WUWA 1RFDL 5FM8A 1FNFA 1YQVL 4ONFH 1MI5D 4P5KB 3BW9A 3MLUH 4WWID 1CN4A 3U9PL 2J7LA 1QBLH 3HE6A 1AR2A 4KMTL 3KPQA 4OLWL 4Q9RL 2R69L 3LRGA 1J0JA 3MGOA 4N0UB 5HDLA 3HNVH 3S36H 1PY4A 3VI3E 4UINL 1WCBB 4S1SL 3G5VB 2W60B 3C60D 4MB4A 3LKRB 2V9RA 3U0TA 4ELMA 2UZIH 5ALBH 1VDGA 2OZ4H 5BS0E 5HHVH 1N4XL 4ODVL 1JGVL 1PQZB 5B4MD 1J1OL 1I4FA 4P2QD 4CVUA 1OAKH 3O3BA 2VXQL 2VWEC 5EZIH 4B7LA 5FDWA 5IBLD 5JDSB 1MCOL 3NCYS 3S96A 1H0DB 1F42A 3FMGH 4YDKL 4P46D 3V8OA 2APWA 2NXZB 1DBML 3QEGH 4MSWB 2VDKL 3X3FH 2X70B 3CIQA 1MCCA 2EDDA 2RBLA 1BIIA 4YXKH 2VN4A 1G7LA 4HFWA 1OARL 5T1LB 3WXVH 1AIFB 1CD1B 1IKNC 4HKJB 2RB8A 4AIZB 3O4LD 4MNQB 1NAMB 4XNXL 1CLYL 4ZNEE 1ZV5A 1A6ZB 3WL9A 3OKNB 1ADQA 1MHPL 3O41B 3BO8A 4LIQE 4C83B 2XXMB 3MA7A 3DIFA 3RA7H 1BOGB 3E3QC 5ACZB 2EZ0D 1HHJB 5D71L 4OGXL 3ARDD 5C07D 2W0LA 4Y5YB 4YC2C 1RMFH 4S10A 5JQ6L 3BUTA 3D9AH 4IOSD 3MLRL 2PW1B 2F19H 1AC0A 1UM5H 3VXNB 2FRGP 4K3GA 2Y25A 4XX1G 4ZXBC 1X9QA 3EFFB 2Y4SA 5HHNB 1D3CA 2W1NA 5D1XB 4NM8L 4BFGA 4HUUB 5BW7A 1RULH 4M7JH 1KN2H 4POZD 1MHCB 2NY1B 4QTHB 4MXWH 1IVLA 3WLBA 5LGJA 3BUYA 4UT9H 1K85A 3LHPL 4AMKL 1NCCH 3U36A 1SJVA 4F80A 1RUQL 3UJIH 3QUML 4OZIF 1MCWW 3PDOB 3EYSH 4U1SB 4DVRH 4KK6D 1FPTH 3ZKND 3O2WL 2WWKO 1NCAH 2CRIA 4X4ME 5JOPD 3GSNA 4WEMB 3TH3T 5D8JH 3MCKB 1KJMA 3HRZA 3SDDB 1N64H 2JIXB 1BJMA 3GGWB 3RZCD 4C56E 2A74B 1F58H 2C1PA 4FZEH 1CFTA 4R97B 1TLKA 3I85A 3JWNC 2YD4A 4NNXA 3O9WA 2Y36H 1RUPL 3UYOD 5IB3B 5DS8A 5K9QG 2DWDB 4XC1L 4NBZB 1QR1A 4QXWA 3PWPB 5E99H 3QI9D 2EEDA 1NGYA 1AI1L 4JY6A 3HPLB 2DQHH 3EFDL 4U1HB 4CVXB 2F8VA 1Q0XL 2ZWLT 2GT9B 4ZUUA 2K7QA 2XTJB 1OW0A 4K8RD 3BFOA 4WFGD 5IFHH 1K8DA 3WFHA 3HI1B 3RPIB 1XT5A 1BJ8A 2JLLA 3GMNA 4V2CB 1JWUB 3ARWA 1OT2A 2K1MA 5ACLA 2V9TA 2I60L 2HFGH 4BQCA 4AH2A 1I1AC 5E00B 4ZPVB 1FZKA 1NMBL 3GEWB 5DXWA 1RJZB 3P30L 1BREA 1JL8A 3IDGA 5EU5B 4EOWL 5L2JA 3SDCC 4AZ8A 3MTRA 1D7FA 3GKWL 4JM2D 2OXGA 5DR5L 1FVEB 3WO3B 2JB5H 4KDVA 1A1MB 3BMWA 3VFUA 2BSRA 3WUWG 1IZJA 1F90L 3MODL 5D7LE 4OCSL 3DX8B 5GRZA 2CMRH 5DA0B 1UM6L 3CLEL 2DM3A 4LNRB 4TSCH 5BQ7B 4YHYC 3F65A 4X83A 5A2KH 5JPMA 1BZ9A 4Q6IB 4K3DH 1TDQA 2H3NB 4L3CA 3GHEH 4U2ZA 4Y2DB 2W9EH 2A9NH 1JF1A 4HIXH 5C9JB 5ENWB 3QPQD 3TM6A 5DRZB 3TN0C 4YX2H 2M1KA 4ZTOH 2VISA 4J3OC 5B38B 4P48A 2YD3A 3GJFB 2RCSH 3C2SA 5L9DL 2R1WA 2VAAB 2ZSWB 4LKXA 2BMKB 4G7VL 1MRDH 2NY0B 1BOYA 4L8DB 2EDOA 4MWFA 5GS3A 3MO1B 5E6ID 3MV7B 3HC3L 1A1OB 2YUZA 1KLFA 4FXKA 2X7LB 2DQCL 1G7MB 1KJ2L 2QQKH 2I24N 4YH6A 3ZKMD 2FYYB 4MVBD 1U8KB 5DD5L 1GJIA 1MJJA 4M43L 2RHEA 1MLBA 2AJYH 1XGQB 2AK4A 1VHPA 4M62H 3MOBL 4E41B 4EN3D 5TF1H 4GQ9H 4GFTB 4ESKA 2ZUTA 3BESR 4Y16B 1ULVA 1QFWI 1WISA 2MTPA 5D2NE 5I1IH 3MRQB 4N8VG 1MCEA 4LLDB 2D7PA 4M7LL 3RL1B 2R23A 3ISWA 4FQJH 1FL5A 4M5ZH 3RGVB 4GBXA 4X4ZA 2B5IB 3CDGB 5FHBH 2CRMA 3S34H 4BYHA 5F7HA 2VDML 1XZ0A 4NWTL 5IHZA 2Q7NA 2BY2A 1NEUA 2G75B 4OZHA 4YBLB 4PJ8D 2VIRB 4P0DA 4FMFA 1FZMB 1P7QA 2MKWA 3GBLA 1MVFA 4R7NB 4HUMB 4Z0BH 2IANA 4M3KB 3HNSL 4ZUTA 1G7PA 2J88L 4P4KA 4NQEB 4P9MH 1PAMA 3CAFA 3OJVC 1CXEA 1BQSA 4JO2H 5H2BA 5HYSA 4S1DC 1A14H 4BSVA 2DQEL 3IXAA 4FXLA 4OLWH 3MRGA 5JZ7D 4Q9RH 4OD2B 3RI5F 1MY5A 3B5TA 3S36X 1A7NL 1HXYB 2P5WB 2G5BB 5GGTL 1J0ZA 5EC2B 4CAGA 4X6FA 3LRSB 4W4OA 1IC4L 3D2UA 2DI9A 4MX7B 1MQKL 2WINB 2VE6A 1EHLL 5HVFB 3G5YA 3KPSB 3KXFE 5CD3A 1I1YA 2CRZA 1RJCA 1QRNA 1C08B 1QA9A 3PGDA 1XF2A 3O4LA 3QIWC 1FVCB 4GW4A 4PGCA 1ED3B 2MQCA 5IFAL 1YEJH 5CIPB 1T89A 4AY0A 4Z77A 3IXTA 3UBXA 3QJHA 4DVBB 5I71B 5MENB 2HTLD 4WI7A 5GHWL 4FFZH 4W6XB 3FOMA 3KYOA 4NM4L 4GBXD 3RUGA 1KPUB 3BJ91 5TQ2H 3MXVL 4LU5L 4BQBA 3OMZA 2PYFB 4NFCA 3OAZH 5C0EA 2CKBA 1B0RB 1YNKL 4FMKA 3MOAH 5IW1A 3HG1B 5D1ZC 4YIQA 3IRZA 1CDUA 5KOVC 3CX2A 2E27L 5DT1L 1DQQB 1KLGB 4R4BB 1YEGH 3GI9H 5SWZB 3TNMA 3S97C 2E9JA 5T1DH 1A3LL 5SV3A 4Z0XA 4MNGB 5JLZB 4GH7B 5D1QC 1GGCL 4Q2ZB 1UYWH 4LSTL 2NY2B 3P3YA 5E2WL 1YYLH 4JZJA 1LE9A 3MLRH 4LRIC 4NN7B 4TUKH 4FXGB 4JDVB 3VRJB 1U8JA 5DMKA 1WWBX 5CZVH 1N5AA 1IC5H 4HLZG 1AKJB 3O2DA 3MRBB 4OFYD 1X44A 5EOCJ 4M61B 1NC4D 3CVHA 1X5HA 4BQ9A 4JZJC 1M7XA 2XFXA 3Q6GH 4DZ8A 3BXNB 5D96B 1CFNB 4DOHB 2X4OA 1UZ8A 4MXWL 3OQ3B 2CDGB 2X4UA 4TULH 3D39E 3RIFK 3VFGL 4PJFE 4JJHA 4OCLC 4WTZG 4HDIB 4HZAA 5ESAB 4TPRH 1G9MC 4KJWD 3WIHA 1XIWA 3T0VA 2QR0B 2OCFD 3EIFA 4KGJA 4N0FA 1BAFH 2CUMA 3UAJD 2ZCKL 1M05A 2FD6L 3MROA 3G5ZB 3SE8L 5BV7C 2OTUB 3GMMB 1CR9H 1TNNA 2E7CA 3KG5A 2NTSP 1HHGB 4JFHD 4P2RD 1F6AB 3FN0L 3PF2A 4MQXC 3MRCB 4UILL 4X5XA 1IGFL 5T5NG 1A9BB 4PJCB 4R4FH 2Q7YB 5J89A 3WXWL 4MJID 3X12B 1Q9OA 2BRRH 1FVDB 4OM1L 2DTML 4XPAH 1CE6A 4U3CA 5EBMA 4CKVX 3ZSSA 5CKAA 4S1RH 4POUB 5HDQL 3EOBA 1W8OA 4BKLA 3MUGB 1NFDE 2NY4B 4MCYA 3T65A 5HHQA 2P49B 2ZPKL 1S7XB 2R56L 4WWKB 3TIEB 3DRTA 4L29B 3T2QA 4QOKA 4DN3H 4O5LL 43C9A 1Q0XH 3MLXH 3CX5J 3M1BB 4QTIH 3T0EA 5IVXB 4YAQB 1AH1A 2AQ2A 4UDTB 2O61A 3S5LA 4K7FB 4XNYH 3QXVA 4X6DE 3EOYG 5IVNA 3MV9B 1AD9A 3VFNA 2EXWD 1JGEA 1X5JA 2VDRL 5DJAB 2ORBL 2AEIT 4JY4B 4GKNB 3C5ZD 4NPYB 1BFVL 1NMBH 1ADQH 2W59A 3D39B 4XMKL 2H32B 1ZLSH 5F8RC 2DKUA 3MRKA 3RVUC 4MA7H 5FKPA 3INUH 1YEEL 3P9MB 3D18B 4QRUA 2YA2A 4YGVB 1I8IA 3RY6C 2X4PB 4MDIB 1IARB 3VWKD 2DLFH 3FQNB 2MCPL 1BZ7A 3BX7C 4PJIE 2D7TH 2NPLX 4HG4J 3RTQA 1RK0B 1PKQA 1ZTXL 5EU6D 2VR4A 4P57A 5IEHA 3ARGB 3DTXB 1Q1JH 3MXWL 1WVZA 1KPVA 3NACL 2CIIB 1VADA 1JUFA 4LVHC 2ZG3A 4HEME 3KYNA 2R29L 3K80A 4RWYL 5FOBA 4DGIL 1KT2B 1WFTA 4ZPTB 3REVA 1L4IA 2VLJD 2XQBH 3GMQB 4XP5L 3WO4B 35C8L 2H32H 5E7FA 3BWAB 2DWEA 3CK0L 1JFQL 4PJ7F 1MJ7L 4YHIA 5KS9B 6FABH 3SDAB 2C4FT 2GK0B 2PCPA 5MI0B 3V5KA 1TJGL 1AQKL 1AGFB 5FA4A 2IPUK 1AKJD 1H3VA 1HINL 2VQ1A 3GSVB 3O9WD 4KI5E 5I8CA 5KSAA 5DMGD 5E8OB 4F9PA 4OCMC 4PTTB 3KLAB 1IAIM 1BBDH 4Y4FA 2IANE 4Z7VB 3TN0B 3GSWA 2GFBA 4Y19B 1CG9B 2F8XC 4HV8B 1EHNA 5FO9A 4C55A 5JW3L 1SYSB 3EO0A 5E6ZA 5T33H 2JCCF 2RQ8A 1WEJL 4GAGH 3PHQB 4N9OB 1VPOL 1KTLA 5D1QD 4Z7UB 1BVZA 4YHPA 3KR3H 5D1QA 4KROD 3BSZH 5EU6E 3RWEB 3BGFB 4LIQH 4MJIE 2HFTA 4XXCC 3ZE2E 4G6FD 3SJVB 1MHHA 3WNLA 5EZOH 3I3DA 3WNPA 5F9WB 1T1WA 1LO3H 3QPXL 3QR2A 2BNRE 3O8XC 2D7NA 2HAZA 3ZHDA 2A6IA 4OZGB 1VEMA 2EDXA 5DYOA 4HS6A 5FYLD 4PGDB 4X98A 5HHPB 2W0KA 4A6YL 4YR6B 1BWMA 4NHUB 2VC2L 4PRIB 2VDOL 1KJ2B 3HTLX 4MHHI 3ULUD 3DO3A 3GIZH 3K46A 1HILB 4RZCB 4OD1H 2HJKB 3VFTA 1Y6NR 4ZFGH 1A2YB 4M6OL 5GS2D 3CFCL 1WCQA 4C59B 2LTQC 4J1UA 4KRPB 1CTNA 5EZLB 4MMZC 3S35H 4UQ3A 2VXSH 4PLJD 1N2RA 5IJKA 4PJGB 5JZ7C 3QDJD 2R9HD 4K55A 5MEND 5DQ9B 1MRCH 2VLLB 1DL7H 3OR7A 3QDJA 5GS0C 1INQB 1U8NB 4S1DD 4KHTH 4JM2B 2Z0BA 3FN0H 5GZND 3NCYP 4M7KH 3CLFH 1J0KA 2MFNA 1AC6A 1NPUA 4AL8H 3RWIB 4JFEA 1ROWA 1IAOA 4NYLA 1KG0B 4LSDA 2EE6A 5GS0D 3MOAL 3QHFL 3I2CH 5F9OL 4S1RL 1RFDH 3L5WA 4DK6A 2O5XL 2JB6B 4M03A 1MCRA 5CJ8A 3AGVA 3WYRA 4NZRL 2DQUL 5C0AA 2YUVA 4NNYB 3BHBA 1CYGA 3R06A 2QLVB 1KB9K 3PABB 5T1DL 2C3XA 1U58B 2FX9H 3K8MA 3PL6A 4TNWK 4LCIH 3TNNB 5I66A 1XF5A 1UJ3B 4ZDHB 4LSRH 4G42A 1CU4L 4P3CH 4RNRB 3STLB 1K5NA 5TF0A 4PGEB 1DE4A 4H25B 4HIEA 3QIWA 2R0WL 2GTWA 4QRRE 4PJCF 4KV5E 2NY3B 3ROLB 1IGJB 3P4OB 4DN4H 4QYOB 1WLHA 1WWWX 5ESQB 3ZT7A 3PWUA 3O8XD 2V6HA 3QHTC 5F9DC 1YUHB 3TP4A 2I26N 2FL5B 3IFLH 1U95B 5D5MB 4ZUSA 3LKQA 5K9OA 3FONA 3MLVL 4KPHL 1FZOA 1J10A 1WC7A 3O11B 2FH8A 4P3DB 2QEJA 3TPUB 4MJIA 1H8NA 4ONGL 4RFOH 3T4AA 2W9LA 1Q1JL 1IKNA 3MXWH 5GGQL 4YGAB 1JHLH 4YDJB 2AJXL 2B20A 1J8HD 5JXAL 1QP1A 5KZCD 2UYLB 2OLDA 5JW5A 1JV5A 2F54A 3QZWA 5CBEA 5DK0A 5DUPL 2JJTA 35C8H 4DWHA 4OGYH 4WV1C 4Y4KB 3SBWC 4R4FL 4G80A 5I75C 1KGCE 3HUJB 4CU8A 3QIBA 1YQVH 4ONFL 3R8QA 3QUKA 2C7UA 4WCYH 3VXMA 3FO9A 3SDCD 3VMNA 5I16A 1UT9A 1YEHH 3QAZC 5SWQA 4LPTA 3QYCA 3O6LL 5IB2A 4X6DA 5F6HJ 4WV1B 2PW2A 1S9XA 3W5MA 4DTGL 1XFPA 2D3VA 5FGSA 5JA8B 1OTSD 5GIRB 3P4MA 3N06B 3SKNB 4G43B 1IBGL 2FJHA 1DUZB 3U46A 3FB7A 4R90H 4O58H 3LB6C 1YC8A 3QUXC 3MLSH 4L1HA 2GHWB 3FT3A 1LO0H 3C87A 4N9GA 4H8WH 3DUSA 1FG2B 2UUDK 1FP5A 4HWEH 1UH4A 4ZO6A 3T4YA 3F12B 1JPSH 5IMLA 3FN3A 4XPBL 3DNKA 5TDPA 1U3HD 4TVPL 4Y4KD 2GK2A 4FP8H 4G6MH 1PZUB 4PD4K 4PP2A 3W9DB 4ORZC 2VNCA 25C8H 1SYVB 1NJ9A 3KPOB 4WFHE 3D0VA 4LAQL 1AHWC 1CXIA 4PLJC 5CP7B 1EIBA 2G9HA 1RZ7H 5DD1L 1ODAA 4F37K 1ZHBB 3N9GL 1U93B 4L3EE 1S3KH 4KTYA 3RHWK 4LAJH 2DJSA 2DYPA 3LH2L 4HGWA 1AGDA 5ANME 2XG4A 2I9TB 4FNLL 3T0XA 3AC0A 5I8OL 4YPGB 4U1IB 1YY8B 4G6JH 2ICWB 2ITCA 4D8PB 3D48R 1UM5L 2EH7H 3GSXA 4JHWH 8FABA 3RVXC 2GSIB 3QFJD 3VXUA 4M1DL 2ESVD 1BZQK 3NTCH 5C7XH 2A6JA 2IG2L 1S5HB 3VFPB 4GXVL 1MRCL 3B9VA 1VFUA 3O3DA 5CJOH 3H0TA 2Z31D 4R2GB 5DZLA 1RSFA 3EJZD 1W0WB 4N5ED 3L3OB 1R5WB 2NQCA 1BD2D 4OAWB 5IMMB 2IAMD 4FS0A 3CNKA 4WEBL 5ACZA 5I30H 4DVRL 1A6VL 3QNXB 1YEDB 3MBED 4JO4H 4K7PL 3SGKC 2BSSB 1JIBA 1I8KB 5L8JB 2D4FA 2OQJB 1J0HA 3NPSC 3QWRD 3SKOA 3RNQA 1B88A 5SWZD 3MCLH 1MPAL 3PE9A 4AM0A 5CEXB 3QDMD 1YYMH 1T4KB 1RUAL 1A6WL 3KPRD 4X6EA 2AJUH 2CD0A 3VE0A 4Q6YA 5FUZL 1J7VR 1XGTA 5JIIA 2UY7A 3GO1H 5C3TA 4ETQA 4HUUA 3AS3A 4NP4H 2EDRA 2PTTB 5DMGC 5KTEH 3OF6A 4ZYKA 2VOTA 1Y18A 3RI5K 2XZCL 2JF1A 1G0XA 4NRXA 4DN4L 4NQDE 3CSGA 1QRNE 3MACH 5INCB 5I74B 2APBA 3S4SA 3R0NA 3PWLA 2GQHA 1KIRB 4TOYH 4ENED 3IVKA 3OSKA 5F9WC 3HZMB 3MCG1 4U4BA 3MRFB 5MP6H 3VFRB 3UTTB 5ISZD 4KKAC 1MLCB 5K9KA 3JXAA 4KPHH 3W0WB 3HR5A 3TV3L 4E41D 4EN3B 4HUNB 5DRXA 5FB8A 5IK3B 5KSBE 4CMHB 3TESA 5C0IB 3UTPD 2XNAA 4QHUA 1SEBB 2QL1A 2J8UA 1F2QA 3STBA 1UKTA 4P2QB 5CILH 1LEGB 2B1AL 5F96L 4HPOL 2XV6B 3UTZB 5DRWB 2EYRA 1DR9A 4NWTH 4P46A 4RAVB 4HUWA 1WZ1L 2C1PB 2MPAH 4QRQA 4Z7QE 1CLOH 5DD3L 4DOHE 3DETC 4NBYB 4OLXL 4JVUA 1G7JB 5HGAA 3GB7B 1RHFA 4IOFC 4UB0L 4XNZC 4NJ9L 1GL4B 4GBXC 2VERN 1MI5E 4HLZH 1QR1B 1BQHG 1QOKA 2HTLC 4Q97A 3RVUD 3V79C 3L7EB 4XMLL 2YZ1A 5ESVB 4AJ0A 1II4E 2D03L 1NAMH 1RJYA 5I1DA 5ITBL 1T03L 3QDAA 4NO0D 3C5ZC 3GRWH 1H5BB 3QIWD 5L2KA 3O4LE 1CIDA 3KPRA 5EOCL 1QSZA 5FGRA 4EVNB 2FR4A 4N8CL 1A14L 4NCDA 4M6NH 5EPMA 1G7IA 1CFSA 2C4XA 1JWUA 2F8OA 5IW6A 5DC0A 1NMAH 1R5VA 3DXAA 3QUYB 1WFOA 2Z8VC 2R2HA 3FO1A 3KAAA 5FYKL 4Z76B 4Z7NE 5E00A 2YHGA 4XX1E 4M7ZB 2QV2A 1RJZA 2XG5A 5MEOB 4AYFA 4K8RL 4RGMB 4C57C 1EEYA 4LLWB 4UIMB 5E2VL 1Z9OA 4U1NA 2OYPA 3SHSA 1TVBB 1FFQA 2PUQT 3QFJB 4TYUA 5CJQH 4EIGB 3CUPB 1I75A 4I0KA 4CN4A 5E4IA 4KTDH 3VCLB 4AT6A 7CGTA 3KPMA 5JHDB 5INDB 1MREH 3L5XH 4ODSH 4WHCA 2J2ZA 2WUBH 5BQ7A 5HHOB 3MLTB 3VWJB 5A2FA 4NQDD 5TF1L 3E6HB 3L6FA 1JF6A 5JXEA 3RU8H 2QSVA 5MEPA 2F74A 4NN6B 4M7LH 4Y5XA 4WO4A 1KJVB 3O2VL 1S7UB 4JRYD 5IROA 3ARVA 1GVIA 4RFOL 5DGQA 1TJIH 3OPZH 4S1QL 4KWUA 5E9DE 3ARGD 1CGVA 2AS5M 1MFDH 1ETZB 4NIKB 3RWDA 5D7LA 2OZ4A 1RZJL 2WK2A 3IJSA 1T1ZA 4HT1L 5DUPH 3WIFA 5BJTA 1KFAH 1RK1B 1L0QA 4JPIB 2BMKA 4MAYD 4GRLD 1DBJL 1AD0B 5J06A 5E6YA 3TZVA 1JZ7A 3JUYA 5F44A 2CJUL 4WCYL 2DI8A 4YNYB 3IU3B 1KCVH 3VD5A 2A1WH 4Y16A 4WUKL 1ZEAH 1NC4A 4OCYL 3C09B 2DMCA 4WW2A 1KB5L 3PV6B 2YA1A 3WIHH 3HAEA 3QPQC 2BSED 3AB0B 3F6LA 3B5GA 5AYUL 3T09A 4AEIH 4WGVB 3ECBB 1BM3L 4NC0B 3QBTB 4Z18A 4LCWA 2PXYA 4JQVA 3ALPA 1BLNB 3GSRB 1GAFH 1NFDA 3BP6A 3PHOA 1R0AH 4NSKA 3R1GH 1ZSDB 1WT5C 1E27B 2R15A 2Y07H 5IV2A 1IEHA 1B6DA 1VESA 4IIQA 1FFOA 5H2BB 3RY5A 3M8OL 3IT8D 3CMOL 1J88A 3IDNA 4JM2C 4ORGA 5CZXD 1SQ2N 3RZWA 1TTFA 4HKXB 1A3RL 4XNUH 4L1DA 4QHLB 4MD0B 5K93A 4E9LA 4XNXH 3CC5A 2BP3A 2G5BA 1ZA6A 4WIQA 5D2NC 4BFIB 1BIHA 4RMTA 5E2TL 2YD1A 4RIRB 3ARED 1A6TB 2YWZA 3GI8H 5D7JD 3VXRB 4O5LH 3ZE1E 2FIRT 1V3JA 3P0VH 2R56H 3FQTA 1XF4A 2YWYA 3MV11 4UINH 5F7MC 5JMRA 4KH2A 1J12A 2RFXA 2AJSL 4XP6H 1OWRM 4MD4A 4LCYB 2V7HA 2ZUXA 3X3GH 1R3JB 4QRPA 1AHWB 3QI9C 5DMIH 6CGTA 1T21A 3D3VE 1J1OH 2VUYA 5C7XL 4EEEA 5K59E 1OLLA 4GRMB 3AUVA 2MKLC 2A9ML 5JIHA 3LEYH 1D9KA 2CLZB 1S9WA 2IFFL 2JIXD 1FC1A 1YJDL 3KLSA 2B4CC 3BOVA 5TDOA 2VLMD 1QFOA 1E4XL 3H7LA 3Q0HA 2Y6SC 5E95B 3K2MC 3Q1SH 2W0FB 4WI5A 4X7DC 4AMKH 4TULL 2GY7B 2UY6A 3H9SE 1QYGL 3FHAA 3QXAB 4NQDB 3TBSA 3OJDB 4FFVD 4PV9A 2ZUYA 4X4XA 2EIEA 5KN5B 4MLSA 3MFFA 1OAYL 3KDMA 4LBEA 4JVPA 3MNWA 3P9LB 4XCFL 4JFZH 5E8NA 2XN9D 5ADOH 1NCDH 5KANI 5E0QA 1CE1H 1QSVA 3KXFD 4P2OB 1QRKA 5F3HA 2FDBP 5DK2A 3JTSA 5C07B 3S5LG 1TJHH 1KYOK 4L8SB 3RBGA 4R0LA 3HRPA 1QFWL 1MFEL 5GJSL 5AAMA 2XQYG 2FBJL 3O45B 3BKML 4MVBC 2AEQL 3JZ7A 2P8LA 2HJLA 1CGTA 3UEZA 4KTEL 2EDHA 5DJ0A 4QRSA 3MV9E 4HK0A 1ACZA 1KN4H 1IFHL 2AXFB 2OK0L 3SBWA 3PWJA 2X2YA 1ZE3C 2X41A 3CZFA 4O2FB 1TQCC 1NFIB 5ISZB 1KSRA 3L5XL 4ODSL 3PIQB 5DJZA 1QFUL 1BFOB 3TN0D 4KXZH 2BZDA 1ORQA 4JGUA 1KJ3H 1KXQE 1S9YA 3VFOA 1A22B 3N1GC 4HJ0D 5DFWH 2HJFA 3KS0J 2CKNA 3O2VH 4Z5RA 1MCLA 4LDOB 3DROA 4BA8A 4LQFL 3MROB 1V5JA 3AY4A 3LN5B 3GZKA 4I48B 1AO7D 3VFWB 2ADGB 1D5BA 4G5ZH 1FNAA 2YK1L 4MJ5A 4EOWH 3MLZL 3C6LA 5HHMB 4F2MB 1I8LA 4FTVB 3GSUA 3X17A 1L9NA 5LGKA 3HR6A 4WTZA 1T22A 1YPZB 3G6DH 3QPXH 5E9DB 4LSVL 3VGAB 1FNEB 2BVPB 5K9QI 4ELKA 4FN0A 1T66D 4DQOL 2VITB 1T03H 4UV4H 3C5ZA 3LD8C 2NZIA 5F7FA 2QSCH 1QLRB 5BS0B 1YDPA 5F1KC 5GJTH 4K3DL 4Z95H 5E5RB 3C60B 1YMMB 1KCUH 4PRID 4Q9BA 4FQHA 4RMUA 2X4TA 3VFNB 4FZ8H 2PKDA 4DGIH 4HIXL 4XHQA 2FO4A 3I6LD 1DVFB 2IBZY 1NAKH 3EFDH 1TZHA 5CP3A 4IEFB 1HYSD 3HI6L 4NNPL 2JJSA 3L7FB 5EZJA 3X14B 3DVGB 2DRUA 5F7DA 3I75A 4PJDA 1JVKA 3P77B 4MSWA 2EDNA 2CPCA 3ORJA 1GC1C 3TJEH 1X4YA 5KSBF 3P30H 3FQNA 1UKSA 1BZ7B 4I77L 4ODUB 1KEML 5ERWB 3MRIA 4PY8I 2VLRE 4LOUD 5F72S 4KQ4L 4JFOB 1V3MA 5FYLE 3V6OE 3QFDB 1IJ9A 1ACYL 3QHZL 4WU7B 4P23C 5DWUL 3W9EB 1UB6B 5J0BA 2WWMD 3WHXB 4E0RB 3HG1E 4HIIA 4MZ2A 1EBPA 4MYWB 4Y5YA 4OUOA 1XEDA 3KLDA 2C4FU 4KK6C 1M6OB 3ZYOA 2CLRA 3S98A 1DBAH 3VA6A 5DHVA 2P5WD 3BWAA 4JCLA 3WV0A 1Q72H 3W2DL 1HDMB 2X4QA 3QDGA 4ODTH 1RZFH 5JPNA 5FYLL 3MJ9A 3T8XA 4XH2B 1T0NA 5ALCH 2EDJA 2IGFL 2H8PB 3BD5A 1QQDA 3UPRA 4KVCL 5GS1A 4YDLB 5J1AB 2WMPA 2XRAL 4Z7VA 5C6PB 3UZQA 4UV7L 2NY6C 1DQTA 4JN1H 3GNMH 2IQAA 2CXKA 4ZXBD 2XYCA 4NRYB 2VMFA 2UV3A 5K9JL 5AEAA 1QLFB 4IDLA 4TUOA 2NY2C 4OD1L 5IGXH 5T3XL 4IRSB 4PB9L 2N56A 5MEQA 4LASH 4YHOH 2QKIB 3VRLF 2DBLL 3MLVH 3MJ7A 1LMKA 2ICES 4TVSa 1JYNA 4XBGB 1T6WA 5C0BB 2AJ3A 5IBUB 5IVZA 3MBXL 1YN7B 3GGWA 2VLRD 3D87B 2A74A 2WUCL 2F5AH 5TGBB 4YO0A 5FECA 4KDTC 1JYVA 2UVFA 3QXWA 1S9VB 4UMGA 2DWDA 3I6GA 2AVGA <