3BYZA

2-amino-1,3-thiazol-4(5h)-ones as potent and selective 11-hydroxysteroid dehydrogenase type 1 inhibitors
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
258
structure length
258
Chain Sequence
EEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2-amino-1,3-thiazol-4(5H)-ones as potent and selective 11beta-hydroxysteroid dehydrogenase type 1 inhibitors: enzyme-ligand co-crystal structure and demonstration of pharmacodynamic effects in C57Bl/6 mice.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
total genus 87
structure length 258
sequence length 258
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2008-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3byzA00
1WLYA 1B3RA 5TJ9A 1NR7A 4RJTA 1JVBA 4DC0A 1RKXA 2NUAA 1VJ1A 3K96A 3E9NA 1Z74A 3ZU2A 5BNTA 4LW8A 2DU8A 3DMTC 4BQPA 1PJSA 1ADGA 4WCFA 4DBVO 1EVZA 3VC7A 3BMQA 4MKXA 4H15A 2Y93A 2EWMA 3VPGA 3VOSA 3CIFA 4FGWA 2CDBA 4NR0A 3KVOA 4PIVA 3GZNB 1LU9A 1ZMOA 3HB5X 2IODA 1SCUA 1EDOA 2HMSA 4JLWA 5U1PA 3WBFA 3GC6A 2V6BA 3DZJA 2PD6A 1N7HA 2V65A 1T24A 3L9XA 2E6UX 3GK3A 4UAGA 3C7AA 4C7KA 1ZCJA 4QSMA 4GKVA 5B4UA 4HXYA 3ZNPA 3GUYA 4AFNA 4ZU3A 2GZ3A 3GEMA 1BW9B 2GN4A 4Y8VA 4ZQGA 2RHCA 2VT2A 4EITA 3F47A 2IZ1A 3ROMA 3FNFA 2AQKA 2BGKA 4NU6A 5ILGA 2VYVD 4J0FA 4GAEA 1X7HA 3DBHA 3WTCA 3L4BC 2FRDA 4EI2A 3GQVA 4BB5A 2BRUA 1DO8A 2E49A 2WD8A 1NYTA 5U9CA 3AY7A 3N7UA 4U0KA 4ND3A 4NIMA 5FWNA 2C5AA 1HSOA 2ZTVA 3DHNA 4UULA 4RPHA 1YRLA 1TXGA 2VZ8A 1F06A 3SLGA 2FZWA 4CODB 3IUSA 2GF2A 3GVHA 4PLGA 3ONFA 3D3WB 1SB8A 2X0RA 1KOLA 2LDBA 1A9YA 3E82A 4ZRMA 3S55A 1LSUA 1MG0A 4H16A 3AU9A 1GYRA 1DHTA 2Q50A 1LA2A 4Q3NA 4FFLA 5JMWA 5B4VA 1JDJA 1R16A 2PKQP 4BNYA 2O4CA 2FSSA 1FDSA 3B1FA 3OJLA 4BO0A 2VHXA 4BMVA 2YDYA 5CEEA 3IUPA 3OA0A 3L07A 2WTBA 2XOXA 4MOWA 4WE3A 2PFGA 1HE3A 4NBWA 3PGXA 4IJVA 4OXKA 1PJTA 4PVCA 2C59A 1A71A 3IMFA 4YT2A 4R51A 4RLHA 1U28A 1WW8A 1GEEA 4OMUA 4L9RA 4WCDA 3VPFA 1E7MA 4D3DA 2C7VA 2HU2A 1U2DA 3PHHA 1VKOA 3S1LA 1UH5A 2JHFA 1PS8A 1E77A 3AUTA 3M1AA 1H6AA 4EUHA 4BO6A 1MB4A 5F3RA 4TRJA 3M1LA 9LDTA 5EPOA 1Y9EA 1AGNA 1P74A 1HZZA 2HKIA 2VHZA 3EVTA 1YJ8A 3ORFA 6ADHA 5HRUA 3ASVA 3KLPX 3SEFA 3KEOA 2P4HX 3VHRA 1ONOA 2W2KA 4LRTB 3DHEA 4R68A 2IRWA 1ZSYA 4OIMA 5JLAA 4CQMD 3IOYA 1TT5A 1AXEA 4D41A 3JQFC 4FD3A 4URFA 5EJ2A 9LDBA 4XGIA 1LDBA 2PR2A 1NWHA 3R6DA 1EZ4A 4Z0PA 5AXDA 4BKUA 2Q1WA 5G0SA 1HE5A 1R12A 3HFGA 3AUAA 4Z0HO 5JDIC 1I8TA 4QFCA 3ZHYA 4FOOA 4XRGA 3JQ7B 2OBYA 1J6UA 3AOGA 4W4TA 4Y6SA 5G0UA 2ZB4A 1KC1A 3MTJA 5JAIA 4PG8A 1GZ4A 3KYDB 3UN1A 4EW6A 6LDHA 3F5SA 4YR9A 2OBNA 1CF2O 3OIFA 1HE4A 2J5RA 3D4PA 5CG1A 1ZO8A 3JQ8B 1GL3A 2I76A 4NZ9A 1ZXBA 3KXDA 1BHSA 4J1TA 1ZK2A 4GSLA 4E5MA 5B37A 4PCVA 4BQRA 4AJNA 1WZEA 2HK9A 2POQX 1PWXA 4DQVA 2I67A 3PPIA 2Y1DA 1UDCA 1NNUA 1W0CA 3GMSA 1QV6A 1R4MA 1U7HA 1HF3A 3FCOA 2VZ9A 4J49A 2QX7A 5CPFA 1AHHA 4R9RA 2G17A 1BMDA 4ZA2A 2DM6A 1H6CA 4FBGA 1UP4A 1Z75A 3OF2A 1HLPA 1GAEO 3M6IA 4OOEA 4R3NA 2OGUA 3G3EA 1DC6A 1JLLA 4Q39A 4BNUA 5J23A 1IZ9A 3UVEA 5ITWA 3FNEA 3PI7A 5I7VA 1P45A 2BHLA 1UZMA 1SZJG 1Y8RB 4BNHA 3INTA 4MINA 5AOVA 3WFIA 3I4CA 2PH5A 3I1JA 3MJTA 3UKOA 3B1JA 1HL3A 5KVSA 1A4IA 1CYDA 2VRBA 4BHTA 2JD0A 2ZTUA 2PGDA 2ZQYA 2C82A 2CVOA 2YW9A 1J4AA 1ZXLA 1E3IA 1C0KA 1WP4A 4WKGA 4WUVA 1HDCA 3GVPA 1LRLA 1HYGA 4TMFA 5DN9A 4OXYA 3VZQA 2I9PA 4MVJH 3ANLA 3DOCA 3WOHA 3JQAA 1G0NA 4UVGA 3RC7A 1NVGA 2YFQA 1JAYA 1ONNA 1M2WA 1PZFA 1EK6A 1B16A 1GV0A 3HWRA 3JQAB 3RC9A 3DDNA 3T7EA 3ZV6A 2AMFA 5BR7A 2OZPA 5L4LA 5T57A 1ZW1A 2CZCA 1NXQA 1OBFO 5L40A 4WPGA 3E8XA 2FR1A 3H8VA 2OUIA 3WBBA 1FDUA 3JYNA 4E32A 1LBEA 4YAIA 3EZLA 4WLUA 5GZ6A 3IJPA 4XQEA 2O3UA 1X0XA 1NAIA 4ND5A 4DC1A 1X1EA 1IB6A 4PRLA 1MGOA 3H2SA 4RQUA 1UDBA 1X14A 3ZH2A 4EBFA 3QW2A 3D0OA 4E12A 1DAOA 2D0IA 2UAGA 4YRAA 2HAEA 1J0XO 1BXKA 2NQTA 4R16A 2YZ7A 3DOOA 3LF1A 4RF5A 4CPDA 4DQUA 1SOVA 4PZCA 5ADHA 4Z0TA 1XWFA 4I5GA 3PQDA 3RBVA 1BRMA 2HUNA 5K6AC 1BVUA 1I36A 1S6YA 2DBRA 2Q45A 3D7LA 4EZBA 4XX0A 3O8QA 3FR7A 3GF4A 2DBVO 4P4NA 4DLLA 1VE9A 2Y05A 3T7CA 2VHYA 3PHLA 5A02A 2BFMA 4E0BA 3KHUA 1EBFA 2RCYA 1JKIA 3OH8A 3KO8A 4JGBA 3RAJA 3SLKA 3WJ7A 3QVXA 2EERA 2IEDA 4RF2A 1N9GB 2PNFA 4NBRA 4I08A 1PQWA 3ADOA 4CMGA 2NWQA 4IM7A 1Y8QA 1LJ8A 1UXGA 1UZNA 2X23A 1H2HA 4X54A 4D46A 3ETGA 1VL0A 4ONEA 4YCAA 3CXRA 3KSZO 2VCYA 3IP1A 4A10A 4CM8B 3LT4A 4CUJA 2CFCA 3GDOA 5DCYA 4HFRA 2WYVA 1ADCA 3L6EA 1TB4A 1M6HA 3V2HA 1F12A 3G1UA 1FDTA 3R1IA 3RUDA 4E5KA 4S1VA 2VTDA 4XR9A 4DMMA 3PZBA 1YXMA 1PL6A 3K92A 4W99A 4UUPA 1PSDA 4H7PA 2XXJA 2ZTLA 4NJMB 3AY3A 4YVFA 4QECA 4BMNA 2C2YA 3IJRA 3WGZA 2J3IA 3LLSA 3VZRA 1TEHA 5IZ4A 2NVWA 4XYMA 3LT1A 1QG6A 2P5YA 4O1MA 4Z3KA 1SC6A 3HSKA 4GSKA 1HLDA 2Y1EA 1LXCA 3GN1A 1A27A 3BAZA 1X7DA 5ENDA 1LDMA 5HTOA 3NRCA 1EE2A 1T2FA 1U7TA 3PWSA 3EY4A 1DIHA 2NU8A 1C0PA 1YOVA 1R37A 2QRJA 3IIEA 4GLOA 2UUPA 3DWFA 4EUFA 5ICMA 1JN0A 1M76A 3WIDA 1SAYA 3UCEA 1LSOA 1U3VA 4IINA 1N1GA 5DF1A 1O8CA 3TZQA 2ZCVA 1BDMA 1Z7EA 4JNKA 3LC1O 5DDIP 1HDYA 3UH1A 5FI3A 1DFIA 4NPCA 4OGWA 4PLYA 5HWSA 4BS9A 2J3HA 4GGOA 3TPCA 1T25A 2CD9A 3BHMA 4EJ6A 2JL1A 4D0SA 3ABIA 4DTIA 4WNCA 2GCGA 2ZKLA 3H9JA 1T2DA 1E7QA 3HFSA 2NQ8A 2ZK7A 1I3NA 2ZCUA 1P33A 1ZK3A 3WB9A 4BKQA 4CV3A 4D44A 1LLCA 1UXJA 2D8AA 3WQRA 1ML3A 2H6EA 3D3EA 4ITUA 3DXFA 3RCBA 2VWGA 4IMPA 4EJ0A 1ZMTA 2P68A 2PH3A 3ZGYA 3V8BA 3DBHB 3PXXA 5IDQA 3UOGA 1ULUA 1T2EA 3F4LA 3NX4A 4I9HA 3S2FA 1D3AA 1HDRA 1SO8A 4IDCA 2RIRA 5A9SB 4E2WA 4NBUA 4FC6A 3RQSA 1MC4A 1NAHA 1HEUA 4C4OA 1FDVA 1I0ZA 1WPQA 2J6IA 3L77A 3E48A 1K6XA 4O5OA 2VUTA 1R6DA 2JCXA 2CF6A 5JFOA 1YH3A 3NAQA 1YL6A 3Q0EA 2VWHA 4AJHA 4QO8A 4TRNA 2V7PA 3H9QA 5KJ1A 3IL2A 5BT9A 2O2YA 4QFDA 1ISGA 1GCUA 1AN9A 2Y99A 5HS4A 4I9UA 1R66A 3B6ZA 4BNMA 2DTDA 1DSSG 1YJQA 3BXXA 3KYBA 3DZGA 4MVJG 4CM6A 3JQBA 1S7CA 1E5QA 3RBXA 4DIFA 4MVJE 4JJGA 1ZNQO 3FN4A 4E6PA 4BNZA 4QX6A 4WLVA 4F46A 3NGLA 3TNLA 2R2GA 1P0FA 3A4VA 5JBIA 1PL8A 3HZZA 1PWZA 3PTZA 1IZ0A 4IGEA 2VNAA 3H6KA 3JQ9A 4Q3AA 1GY8A 4S3MA 3TZ6A 1B15A 5G4KA 4QUKA 1UXIA 2I65A 5AYVA 4N54A 2PZLA 4BO1A 4LN1A 3WIEA 4BNTA 2YV1A 3P2YA 4ALIA 1C1DA 5TX7A 4N5LA 2VUUA 4OM8A 3RKRA 3HQ4O 5F1KA 1AXGA 3TQHA 1I2BA 3H3FA 2X58A 2E37A 3MJEA 1WAMA 3JQFA 4Z6KA 3IP3A 2BFOA 3LC2O 5KJEA 4K6FA 1ID1A 1KVUA 4JJIA 3FSRA 4LMRA 4J4HA 1NPTO 3NJ8A 3DBVO 3QY9A 4KQXA 2B4TO 3ZWAA 2PGJA 3LZ6A 4KZPA 4RDIA 1TT5B 4YT5A 2J5KA 2HRZA 3PJGA 4HUJA 1YL7A 5AQ1A 1YBAA 4FPXA 1L7DA 1DXYA 5IFLA 1T2CA 4CMIB 3DZIA 1JAXA 1HWYA 3HB4X 3RC2A 2JKVA 3UHAA 3D5QA 4D43A 1DC5A 4M8SA 4GH5A 4RORA 3N58A 1B8UA 1T1SA 3JQAD 4GKBA 4UVEA 5B1YA 4DPLA 4L4RA 4PG7A 4CM4A 3JSAA 3COSA 3RU7A 1NM5A 1QYWA 2PD3A 4CMBA 2OMEA 1YKFA 3PIIA 4HV4A 1P0CA 4IS3A 5COQA 2WYWA 2TMDA 3JD0A 5TQVA 3MJVA 2R00A 1NVTA 1PIWA 3H5NA 4MIOA 4YJFA 5L45A 1OC4A 2OXIA 3W4KA 1QP8A 1Y6JA 3PHJA 3X2FA 2RAFA 2DUUA 5A06A 4HNHA 3IDSA 2H63A 4IBOA 1ZSVA 4HADA 1RYEA 4UEOA 1LDNA 1MXHA 3UCFA 2O50A 4DQXA 4DUPA 5DOZA 1QKIA 2GRAA 2LDXA 5G4LA 4BNFA 3PLRA 3KBOA 4UVDA 4WOKA 3KSDO 4CQLB 4DIOA 4MKZA 3ZWBA 4J9VA 1Q0HA 3UAGA 2C5EA 3ANMA 1YQGA 1QORA 3T4EA 3RUAA 3Q2KA 4GMFA 2Q2QA 3I6IA 1WDKA 1FK8A 3O8QB 4FW8A 1KVQA 2G0TA 3OQ1A 4KTVE 1QRRA 4NFSA 4GX5A 4CLOA 2X0NA 3FTNA 5L9AA 2O23A 5FFFA 1XA0A 1ZK0A 2Q4BA 2C54A 1O95A 2O48X 3WS7A 2P91A 4JBIA 3U09A 1VRWA 1E3SA 3DQPA 4UEKA 1Q0LA 4AJOA 2UV8A 4CM9A 4J16A 4A27A 2WYUA 3QP9A 1YO6A 3SX2A 1HDGO 4DLBA 2W2LA 1PU2A 5BSGA 3BMNA 2I3AA 4KUHA 1Y5RA 5A9SA 1ULSA 4YYZA 4MIYA 2W2KB 4RVUA 2R6JA 3VVCA 4GMGA 2ET6A 2WEKA 4ALKA 5C7LO 3ETDA 5IDWA 1E7YA 1ENYA 2GZ1A 3ROPA 1MX3A 3RVDA 3QVOA 5IZCC 1I2CA 3W8DA 4AJIA 5KNLA 3CINA 4YEDA 4M54A 4YT4A 1LEHA 3A14A 2VHWA 2CDAA 2HK7A 4DGSA 3GVIA 2JFGA 2VTEA 4CMJA 4N18A 3NT2A 1LTHR 4TZTA 4YAJA 3GGPA 3E1KA 1MLDA 2DAPA 3ZCXA 3VKUA 3DMYA 1I01A 2FMUA 4CMHA 4FS3A 4FIZA 3NTQA 2HDHA 1NHWA 3U62A 4E31A 3JD1A 4A03A 1PQPA 1RM3A 2GSDA 3L6DA 2GERA 3H9UA 1VI2A 1Y7TA 4O0LA 5TGDA 1IE3A 1RPNA 4AICA 4DIBA 2HJSA 5I9NA 4PLWA 3ZHZA 2VYVA 4MVJF 2FP4A 2JCYA 2Z1NA 4KUGA 2HCTA 2C0CA 3A28A 3RKUA 4Z9XA 3MEQA 3OP4A 1TT7A 1EK5A 2QQ5A 4HKTA 4PGFA 1IPEA 1R0LA 4NBVA 4Y9DA 3ZNOA 4A73A 3F6YA 4RPKA 3SJ7A 3DMTA 4PZEA 4B4UA 1NBOA 2DFDA 5A5EA 3L4BA 3GA0A 5TT0A 4J6FA 3ZV3A 5KTKA 1DBVO 2FY8A 3BTUA 1R4NB 2AQ8A 4IMRA 3IKTA 1YWGO 3LT2A 3HE3A 4MPDA 4XWYA 2IYOA 2VHVA 5FF9A 1WMAA 4UVHA 4TQGA 3FHLA 5JC1A 3DAGA 4IIVA 3CMCO 1B8PA 2I3GA 3NJ4A 4NNJA 3DFUA 5TC4A 3EVNA 3LVFO 1DEHA 4P38A 2G76A 4TROA 3FNGA 4P4LA 4LCEA 4J1SA 3V1YA 3VPHA 4J91A 3DBRB 4JK3A 1QXSA 4I8XA 4U6SA 4U5QA 4E4YA 3BA1A 3CEAA 5JNLA 1NQ5A 3CTMA 2QG4A 4W9NC 3DZFA 3GRKA 4NG5A 5FEUA 4R3WA 2FPPA 3I9OA 4QT0A 3I9KA 3GEDA 4INAA 1ENZA 3ROKA 2D4AA 4J3FA 1CRWG 5CHEA 4U0JA 1PZGA 2HQ1A 4FFOA 4AJ1A 3GR6A 1E1KA 4OKNA 3VH4A 2TMGA 2A92A 4ZVVA 4LK3A 4MVJA 1RYDA 3ONEA 4B8WA 2UDPA 1C1XA 3WGIA 5EERA 3JYLA 2IXBA 3I3OA 3MJSA 4R5MA 3ZZNA 5TSDA 4BKPA 2EP7A 3FNHA 4BNKA 4AJ4A 3M2TA 4YTEA 2Q4EA 3B20A 4WJZA 1E3LA 3WFJA 3JCZA 2PV7A 4MKRA 3G0OA 4PLHA 3D64A 4E2YA 1B14A 4PLZA 5F1PA 4B7UA 4BVAA 4TKMA 3FWNA 3GGOA 4Z9FA 3UFXA 1Y81A 5ITVA 5BNIA 2GR9A 3D4OA 1EFLA 4GL4A 2G1UA 5KVVA 2AE2A 3G49A 4TZKA 1UP6A 2B4RO 1DIBA 3AM5A 2V6MA 4D0RA 1SPXA 3AJRA 4IDAA 1ENPA 1X7GA 7MDHA 1WDLA 1J5PA 3E03A 1U2GA 3KLMX 4CLOB 1P1RA 5C5IA 1DRVA 1YDWA 2W98A 3QVTA 4OHUA 4XIYA 1T4BA 1OFGA 1H6DA 4W6ZA 1P3DA 4I5EA 1G6KA 1H93A 4LVCA 5L3ZA 4HBGA 2JAPA 3GN2A 1C0IA 4CMKA 3QWIA 4XDZA 3NV9A 3SVTA 4F3YA 1ZK4A 4P8RA 4Q3EA 1ZUD1 3K5PA 4IDGA 2WWRA 4GBJA 4Q3DA 2EW2A 5L7WA 1K6IA 3LF2A 1V0JA 2GLXA 3GVXA 1MV8A 3CUKA 1DIRA 3BMCB 2VT3A 3F46A 3LU1A 4MDHA 3E9MA 1KS9A 1JW9B 1T2AA 4IQGA 2GD1O 4ZJUA 4PFJA 1GZ3A 1SEPA 4BGEA 4O6VA 3ZWWA 3RWBA 1DJQA 2VOJA 2NU6A 1VM6A 5COAA 2W2LD 3C1OA 4CMAA 3LQFA 1Y9AA 5CFZA 4TRRA 2P5UA 4FQ8A 1R15A 1EUDA 1WDMA 1LQUA 3PWKA 3VDRA 4W82A 1VJTA 3ITDA 4CJXA 5HBRA 3RUEA 3SC6A 1DDOA 1PS9A 3IAHA 5DCUA 4YXFA 1NFRA 1DHRA 5JYDA 3BHJA 1IUKA 4PN3A 4XR4A 1T26A 4YQYA 1BXGA 4BNXA 5KJ6A 1EVIA 1K2WA 1PR9A 3F5QA 2BD0A 4W7HA 1KBZA 2G5CA 3H9GA 1U5AA 3U4CA 4MVJI 4CR7A 1F14A 4CR8A 3MOIA 4Y67A 1R0SA 2DQ4A 2QZ9A 4IXWA 3DHYA 3RSHA 3TZCA 1ZBQA 2ILTA 2CUKA 4OSOA 4L73A 1BXZA 1WWKA 1OOEA 3W6UA 4XYBA 4Y98A 3RC1A 2E48A 1PJBA 4YA6A 1E5LA 3H7AA 4WCFC 3F1LA 3VDQA 1D1TA 4XQGA 3G1TA 1F0YA 3JQGA 2O2SA 1HE2A 3OIDA 1P9LA 4JJFA 1SEVA 4J0EA 5IXSA 2AG8A 1Y8QB 1KETA 3QWBA 5GZ3A 4HFNA 3G17A 3PHGA 5ES3A 4DBZA 5C7OO 5MDHA 2YFHA 4OO3A 3W6ZA 2X8LA 3C7DB 2NU7A 3ENKA 4FFPA 5IN5A 4BO3A 3WYBA 3OJEA 2VNSA 3AM4A 4WLOA 4ZQEA 1GUFA 4OKIA 4J2HA 1OAAA 1EE9A 1DPGA 5I7SA 5A03A 2F00A 4WNIA 2QRLA 1U3UA 2NTNA 4R1UA 1ADBA 2YHIA 5TNXA 5CEJA 3I9LA 1H0KA 3PFFA 3RFTA 1E3WA 1LRKA 3CZRA 2PZKA 1UXHA 1PGJA 4CM4B 4CMEC 4GWKA 1NQTA 4NK5A 1B0AA 4B3HA 5TS3A 3KYDA 2FHSA 1O89A 1Q7BA 3HN7A 3INRA 4IDBA 5CDYA 2DT5A 2XF8A 4PZDA 4KOAA 4BGIA 1V9LA 3DZBA 3QRWA 2J8ZA 4JIGA 4XGKA 4CLHA 1EMDA 3GHYA 1VLLA 1ISHA 3PYXA 1W73A 4P4GA 2VUSA 4JP3A 3RUHA 1BW9A 2X4GA 3K9QO 4HP8A 5DP1A 4XQ9A 1EBUA 3KM0A 5TLSA 2I99A 3MOGA 2PWZA 4OQZA 1Z73A 4IZIA 1KC3A 2H9IA 3TWOA 1Q0QA 4BNJA 1BXGB 3U4IA 2IYPA 3C3XA 1DLJA 2FR8A 3GOHA 2X5OA 3ZWOA 2YJZA 2Z5LA 3DEYX 4DVJA 1XDWA 3P19A 2O3SA 1ZKMA 4NFYA 1U3WA 4FB5A 4ALJA 5GZ1A 5I9MA 5LCXA 1Y8RA 5L7TA 4GGPA 1B3BA 2WSBA 2DVMA 3VH2A 2WDZA 3BTVA 5IF3A 3QV1A 2G82A 3FWZA 3B1KA 5I8ZA 4UUMA 3VH1A 1V6AA 1NQAO 4FFMA 4JROA 4WLFA 5A04A 3PJFA 1U9JA 1UAGA 3IKVA 4MP8A 3ZV4A 2GZ2A 3TF5A 5L7YA 5KWEA 2EKPA 4ROSA 4J43A 2HMVA 3DTTA 3DO5A 1LNQA 4FJ1A 4CMCA 1KY4A 3TRIA 1O9BA 4BIIA 4A7PA 3TOZA 3EMKA 1DB3A 3QJ5A 3ANNA 2VN8A 3O9ZA 1I33A 4FCCA 3MTGA 4LMPA 4AJLA 3LT0A 2GO1A 2P4QA 1PQUA 3F4BA 3DR3A 1YQDA 2UYYA 2WM3A 2Z95A 2IZZA 3F1KA 4FSHA 1LDEA 3GAFA 3WTBA 4E30A 5DOVA 4KQWA 1ZIDA 3ST7A 5AXCA 3HDQA 1XGKA 3ZWMA 2NTJA 1GQYA 1C1XB 5JSFA 1NWCA 4B8ZA 3KETA 3WICA 2GDZA 3JQ7A 2AE1A 2O3JA 1LDYA 5IJZA 2X1HA 4KTTE 1J49A 3K30A 2P9CA 1LX6A 3UUWA 2C20A 2SCUA 5T6BA 3UF0A 4AJKA 3ZW8A 3EC7A 3GVCA 4NMHA 5AXBA 3FBTA 1GD1O 3CPSA 1JKJA 1QYDA 1Z45A 2VQ3A 3GH3A 4TSKA 4L76A 5JCJA 3ENNA 4RGBA 1VSVA 4M89A 4AVYA 1R4MB 4YB8A 1MP0A 3P7MA 4RQTA 3GNTA 5L4SA 1K5HA 4UUOA 5CPBA 3P2OA 3TJRA 3ZWXA 1N9GA 4TVBA 5B12A 1A7KA 4GPD1 5DBFA 4M86A 4CR6A 1GYPA 3QE3A 4DPKA 2Z1MA 5T8KC 5DBGA 4AJJA 1KERA 1XR3A 4D42A 3ETEA 2ZB7A 3H9EO 4RVHA 2JCVA 3GLQA 5BQFA 2QYSA 1BSVA 4IJWA 4GVXA 2Q1TA 3Q9NA 2P2SA 5I7EA 1KY5A 4XD2A 3VVBA 1E1LA 2F1KA 3TFOA 1V3VA 2EIHA 3AFMA 4B4OA 3PJDA 1V3TA 2IXAA 4L4XA 4XQCA 1HT0A 3WYEA 3KSUA 2EG9A 3Q9UA 3WQQA 2CY0A 4EGFA 1K0UA 1OC2A 4DPMA 1I5RA 2VZ0A 3RUFA 2DTEA 1DRWA 5G0TA 4CLRA 5K9ZA 1XU9A 4B7CA 1HXHA 1C0LA 3JYPA 3STHA 4IXTA 4JP2A 1YONA 5EQFA 3WLFA 4BGVA 1DOHA 2YDXA 5HS6A 5BSEA 4YJFB 4YWJA 4ZN6A 3GPIA 3ZWCA 2PD4A 4MP3A 3WMWA 1X1TA 3LK7A 3ADPA 4JQCA 2O3QA 4RDHA 4NU5A 1T1RA 4YDRA 3RROA 3HNPA 5GMOA 2D5CA 4IDFA 4DWVA 4R4JA 1XU7A 3VPXA 2ZJ0A 4AL4A 4WCFB 4CUZA 3UCXA 1CWUA 3X2EA 1N5DA 5MGBA 4BNWA 1MG5A 1PGNA 2EKLA 5DP2A 3TL3A 4PLTA 4IDEA 4KP7A 2GPTA 3OSUA 4MVJP 5EN4A 1TVEA 4ZD6A 3ZU4A 5CDGA 5LC1A 3DBLA 2NLOA 4YJHB 1I2ZA 4IS2A 4JXKA 1U3TA 3ONDA 4CV2A 1P1FA 2Y1OA 4OAQA 3W1VA 3SBOA 3AOEA 1N7GA 3JYQA 2BFAA 5A3JA 3PVZA 4AG3A 3ICPA 1E7WA 2IZ0A 4A26A 4JBGA 4FFNA 3L6OO 4NK4A 1U4SA 2OORA 1E6WA 1UAYA 3MWEB 3E5MA 3DC2A 2AXQA 3G79A 2D59A 1ZJZA 1JVSA 4YAGA 3CZMA 2EJWA 3O26A 3QA9A 4LVUA 3ZU3A 2AEJA 1HTBA 3NYWA 5F5NA 8LDHA 1O6ZA 1IPFA 3OA2A 1LLQA 2PK3A 2QRKA 3WG9A 2PA3A 3DONA 3AFNA 4B3IA 4CM8A 2B35A 2CVQA 4A2CA 4CLRB 4XRRA 1N1EA 1YE3A 3CE6A 5I7FA 2YQ5A 2HMWA 5CDTA 4LGVA 1ENOA 1U5CA 3RBZA 3S2IA 3V2GA 3H4VA 4BNIA 4KDEA 4L4SA 1ORRA 2Q2WA 1NPDA 2BKAA 4YJGB 3WX0A 1H5QA 2JFHA 5JC8A 3PDJA 4GLLA 4QXMA 4YJGA 1UZLA 4W7IA 3KOUA 3AOEC 1K3TA 5A05A 1BWSA 5TT1A 2O4UX 1M6WA 4R54A 2DPGA 1QSGA 1YL5A 4K9DA 3L9WA 3VZPA 2VRCD 3GRPA 4RLSA 1U1IA 1P31A 4FR5A 1SMKA 2B36A 1PGPA 2DLDA 5A9TA 2X9GA 3CSDA 4BO8A 4BNGA 3BTOA 5IDYA 2ZIZA 3I5MA 4E2ZA 5LDHA 4G2NA 4K26A 3OJOA 1DJNA 4RVDA 3GG2A 1PZEA 4YT8A 4QO7A 5DULA 2RHRA 4HX5A 1B26A 3PHIA 4IQ0A 4CQLA 3JTMA 3BHIA 3BTSA 4NI5A 3TZKA 3GY0A 3RFVA 2Q49A 3JYOA 2PKRA 3RJ9A 4EEXA 2EEZA 3I4FA 2AEFA 1PL7A 3AI3A 3K2EA 4MIEA 4EUEA 1JU9A 1L7EA 3WJAA 1C14A 5H81A 4EJMA 4BNVA 1NHGA 2J3KA 1F8FA 3PK0A 3WGYA 3ZDFA 4C7JA 1VC2A 4LRSB 4J9UE 2XPCA 3NUGA 3EAGA 4E5PA 5JDIA 2B69A 4HNGA 1P1JA 4RO0A 4E5YA 3M2PA 4YACA 4R1SA 1ISIA 1LI4A 1E1MA 3I52A 1G1AA 4W9NA 3RUCA 4E2XA 5KJCA 2BF7A 1KYQA 3K31A 3RASA 1N8KA 3JD3A 4IPTA 5U4QA 4E13A 4EEZA 3P5SA 4CLXA 1QYXA 3BMCA 1L1FA 5L95A 1WXDA 2HLPA 2DFVA 4P22A 1XSEA 4G5HA 3EW7A 2AQIA 4XIJA 3QQPA 2CNBA 1NASA 1EEHA 4ESOA 1KIFA 2NNLD 3PGJA 1GPJA 3R3SA 3WGOA 3V5NA 1ISJA 3HUDA 2PKQO 3U49A 2GN9A 3GZ4A 2NTVA 1WMBA 5G2OA 3JD4A 3D1LA 1EUCA 3JD2A 4YJDA 1QV7A 2VOEA 1ZEJA 1N2SA 4D45A 2HO5A 4XYGA 2DPHA 4XB1A 1FJHA 1FDWA 2HJRA 1IY8A 1U4OA 1E92A 3KTDA 4ALMA 1JKFA 1NPYA 4J2OA 1UDAA 4RPJA 1YQXA 1RWBA 4F6LA 4CM3A 5BNFA 2ZB3A 2I66A 4UUNA 5EL0A 1Q7GA 3DTYA 2X22A 1MFPA 2O7QA 4WLNA 2YV3A 2Q1UA 2Q3EA 2A4KA 3ZWNA 3WGTA 8ADHA 3K2BA 4NFHA 4D3FA 2EGGA 4CM9D 4CQMB 2A9FA 4O63O 5EESA 1H2BA 3AUSA 3B70A 3S8MA 1C1DB 2UUOA 3HDHA 3ZWYA 4A5OA 4B4VA 1XQ1A 3NT4A 1DFGA 4MJLA 2FPIA 1Z82A 3O4RA 3ZN2A 4XA8A 3KZVA 4OYRA 1M75A 1SB9A 1UP7A 4FDAA 4IY1A 4K1LA 5KKAA 1EUZA 2B4QA 3FRJA 3AUUA 5T64A 1GQ2A 4IUYA 1GQQA 3PWZA 3WWZA 4KUEA 1VKNA 2C07A 3PLNA 2PY6A 4ILKA 3TFQA 4D79A 2V6GA 3S2EA 1Y1PA 2Y68A 3ZW9A 4ZHSA 4II2A 3JQDA 3BZUA 4FJ0A 4RF4A 4U6QA 3DBRA 3EGOA 1AE1A 3KRTA 3KV3O 3PP8A 4II3A 3Q6IA 4J1NA 4WASA 2FR0A 4BO4A 3RU9A 1I30A 3H2ZA 3ZV5A 4CLEA 2Y66A 2GN8A 2AQHA 3BYZA 1E6UA 5TRTA 1B7GO 4FFRA 1OMOA 3AWDA 5LDGA 4AJ2A 3AM3A 3N74A 5H82A 4BL5A 4CL8A 5HA5A 5JDCA 3VZSA 2H1SA 2JD2A 3NDJA 3ON5A 3SXPA 2Q2VA 1LLDA 4NH4A 3GDFA 2RH8A 2WD7B 4IQ8A 3DOJA 1WZIA 3QVSA 5CP8A 1VL8A 5ENVA 2NU9A 2YQ4A 3A1NA 2VWPA 4TRMA 3QLJA 1GCOA 3ASUA 2B37A 2Q46A 3PDUA 2BH9A 4QEDA 1JWAB 1P1KA 4M55A 3OJFA 4DA9A 3L4SO 5BSHA 2BGMA 3MCVA 5K0ZA 2OP0A 1Y5MA 3GUCA 4Y6PA 1MC5A 4XZ3A 2AW5A 1KVSA 3IC5A 3JQ9C 1CJCA 3QVWA 2A35A 1HDXA 2JHGA 1WNTA 2BELA 4BNNA 5AVOA 4DRYA 2FSVA 2O7SA 2ZJ1A 1JWBB 2D5AA 3QHAA 3OFSA 1N92A 4OL9A 3FBGA 4YPOA 5JY1A 4G65A 5IDXA 5TJHA 1GUZA 1DRUA 3RI3A 4TKLA 2FOIA 1YOVB 1YVEI 3I23A 3PYMA 4MVJD 1PZHA 5L51A 2OOSA 3QWAA 2J3JA 1PJ4A 1LRJA 4BKOA 2YYYA 5ILOA 4XGNA 4KWHA 1KVRA 1XCBA 4FC7A 4L8VA 1HRDA 1XLTA 2YHIB 3Q2IA 3QWHA 5FYDA 1V3UA 3RIHA 2X5JO 2V6FA 5JYEA 1HDZA 2ZYAA 5AXAA 3Q3CA 3WNVA 4BMSA 4J90A 1E3WB 3AY6A 3WR5A 2YV2A 2CSUA 3E5RA 3BMNB 1P44A 4I1IA 4R9SA 4BUCA 2WE7A 1E3EA 3WDSA 7ADHA 4CV0A 2Y0CA 4I5DA 5C37A 2NM0A 2AHRA 3F3SA 4EYEA 3UXYA 1NFFA 4DLAA 1YDEA 1LUAA 2XAAA 3VTFA 3NDRA 2EJVA 1H9AA 2ZB8A 5JS6A 5JO0A 4RCVA 2VYND 1D7OA 3PQFA 4WK6A 4TWRA 3ZHXA 1G0OA 1OI7A 2UVDA 1DFHA 2E4AA 2EGHA 2IEBA 2QIOA 2QZZA 5CEFA 4BO5A 2QW8A 2YHUA 4GVLA 3GFBA 4WEQA 4WOJA 1D4FA 4LSWA 4JBHA 3EK2A 2FZEA 4BOYA 4R69A 3NGXA 1X0VA 1CERA 2D3TA 4GWGA 3W8EA 4PLPA 2OFPA 2X7HA 2YY7A 1QLHA 1NVMB 3PRJA 2Y1GA 4HFMA 2AG5A 3AU8A 2X5KO 2W8ZA 1UUFA 1MUUA 2OHXA 1XIVA 4JCOA 1R0KA 2O3RA 3V2UA 1FMCA 3JQCA 2NVBA 3UICA 1DLIA 2EW8A 1NR1A 4RVFA 2DC1A 1X15A 1PJ2A 4XKJA 2BI8A 1UXKA 1Q2XA 4PLVA 2HRBA 1KEWA 5GY7A 1EVYA 1PJ3A 1PR3A 4L0QA 3WGGA 2WMDA 5EQDA 2DKNA 2DBZA 2NV6A 1M66A 4J4TA 4DXHA 4Q3BA 4BO7A 1VJ0A 3I9MA 3KYCB 2B83A 4PLFA 4O59O 1YGYA 3PYLA 1H9BA 3OQBA 2EV9A 3NTRA 1O94A 3EZYA 3GDGA 1DAPA 4CUKA 2RBEA 1AUPA 1U8FO 1VL6A 1GADO 1I3KA 1JTVA 1PS0A 1QR6A 1QLJA 2BFPA 2EXXA 1BDBA 2P9GA 3GNQA 4U7WA 1RM4A 5DBIA 3TOXA 4RF3A 1TLTA 3WSVA 3VKVA 3PQEA 2CF5A 2OP1A 4ALNA 4PG5A 3T4XA 4OSPA 3H65A 5EINA 2X6TA 5G0VA 1ONPA 3LC7O 3TDKA 3NEPX 1ZK1A 4KWIA 3QIVA 2Q1SA 5TF4A 2WJPA 3BIOA 3OICA 3DAFA 3DL2A 3WYCA 4WGGA 3ZU5A 1MXFA 3KEQA 1EQUA 1KEVA 4WEOA 1FXSA 3WGHA 4D7AA 1LLUA 1VPDA 1K6JA 3LYLA 1ZEMA 1CDOA 1I3MA 2C2XA 5JO9A 1D8AA 3INGA 4Z9YA 3KB6A 1CQJA 3U0BA 1NFQA 2IDZA 1PEDA 2B5VA 2P9EA 2PZJA 3FPCA 3GNSA 5G0WA 5H83A 2Y67A 3QSGA 4Z3DA 3EHEA 1BGVA 2ZYGA 5KVCA 4XB2A 3U4DA 5IXYA 4DMLA 5G4KB 2HMTA 4XCVA 3ROQA 3FD8A 1ZJYA 3UGKA 3R3JA 5KKCA 4BV9A 3ICCA 1RJWA 4R01A 1CEQA 3QWFA 2GYYA 3OEYA 4Q9NA 3GPDG 4B4WA 3JQ8A 3DBLB 1DIGA 4LSMA 1DIAA 4D3SA 3NDIA 1RM0A 4E5NA 3RJ5A 1W8DA 4LISA 3TL2A 4ZQBA 4ZRNA 3HDJA 4CMEA 3DB2A 1MA0A 5JDCC 2CDCA 3U9LA 1ZFNA 3KUXA 4PLCA 2EP5A 3AI1A 4GX0A 5IN4A 3V1UA 4JN6B 4K28A 1TA4A 3C8MA 4N5NA 5I9LA 1DC4A 5JXWA 2D2IA 3BMOB 4AJEA 1P1HA 3OBBA 5IZCA 5T5QA 3KYCA 2GGSA 4L75A 4ND2A 2E82A 4F6CA 5A3VA 5JW6A 5TIIA 2JAHA 3OHSX 3E9QA 3C1TA 4PG4A 5F5LA 5CG2A 4QQRA 1IYZA 4CM1A 2HK8A 4BNLA 1GDHA 3GEGA 5CDUA 5JAZA 5L53A 1GU7A 2J5QA 3GAZA 5JAQA 3MWDB 4NJMA 1PGQA 1JA9A 1YB4A 3SJUA 3OJ0A 4MVJM 3DZHA 3O38A 4RV9A 5ER9A 5THQA 4RPLA 1EFKA 1LQTA 2EKQA 4YBZA 2A94A 5KCZA 4E21A 5C7IO 4YRDA 3NKLA 4UEJA 4FGSA 5B4TA 3K8ZA 3S2GA 3LSYA 1GUYA 4L74A 1IHXA 3EDMA 1PX0A 3WSWA 4EDFA 3W8FA 3K6JA 5CAEA 2CMDA 1C3VA 1PJQA 1E3JA 2YUTA 5EMHA 3OM9A 3DFZA 5F21A 4MO2A 2X9NA 4NHEA 5IG2A 2O3TA 4FOSA 3HN2A 3DZKA 4GX1A 2OL4A 1W4ZA 4GQAA 1ZVMA 5JCXA 4XYEA 3C85A 3H3JA 3HDYA 2IE0A 3O03A 4M87A 4WECA 5KIAA 1NP3A 3VAZA 3GMDA 4RPGA 1IL0A 4CQMA 4OOFA 3RD5A 3I83A 4XJTA 2H5LA 2GUGA 1GZ6A 1A4UA 1EDZA 4R41A 5DT9A 3MJCA 4DL9A 5DNAA 3FF4A 3W4JA 1YB1A 4R5HA 4YAKA 4RZIA 1GEGA 3R0IA 1IULA 1YBVA 1NX6A 1YS4A 3OMLA 3CKYA 4I5FA 1CETA 2FN7A 2DUWA 2NVUA 5A1TA 5IAAA 3GZNA 2VYNA 4IIUA 3IS3A 4HWKA 1P77A 1KEPA 1ZH8A 4PRKA 4K6CA 4ZQFA 1SBYA 3D4NA 3ITKA 3EYWA 1I3LA 3BMQB 3C24A 2BI7A 2W4QA 3OETA 1GYQA 1Q1NA 2NACA 4R1TA 4N7RA 2FPGA 1BTOA 2HSDA 4IJKA 2BMAA 1GPDG 1FF9A 2X0JA 2VWQA 4KMSA 4ND1A 1HSZA 1GFSA 4M49A 3ZWVA 1A7AA 4ID9A 4M1QA 3ZNQA 3ZWPA 3NTOA 1R4NA 3U4HA 4R1NA 1ZSNA 3FR8A 1E6EA 1ISFA 1KVTA 1LC0A 1E1NA 4ALLA 4E3ZA 1XHLA 3C7CB 5KJFA 4BV8A 2QYTA 5A4DA 4NBTA 2Y0EA 4NJOA 1XYGA 2VRCA 3CH6A 2I6TA 1SOWA 1HZJA 1TI7A 1PJCA 2B5WA 3Q11A 4Q3CA 1B8VA 4RL6A 3ZHBA 3GG9A 4J1QA 5T8KA 3F9IA 4OXNA 5L4NA 4CMIA 1I32A 2ZTMA 5K6AA 2NADA 1UR5A 1ADFA 1B2LA 2Q99A 4RVSA 5THKA 2BGLA 4ZICA 2X9VA 3K73O 3JQGB 1VSUA 1QMGA 4BKRA 3RFXA 1BVRA 4TVOA 2I5PO 4YJHA 3LDHA 3D5TA 1U8XX 3HJAA 1I24A 2GN6A 1YBMA 2RH4A 5JPIA 2DBQA 2R00C 4IZHA 1PJLA 4PG6A 3WMXA 1Z6ZA 3JQBC 4G81A 2WE8A 1ZZEA 4BO9A 4BO2A 1A5ZA 2B0JA 4OQYA 1IOLA 3VTZA 3PZRA 3AW9A 4YAEA 3OECA 5ER6A 3HHPA 1PTJA 4MP6A 3WLEA 3WWYA 4DYDA 2ZATA 1LSJA 4HFJA 2C29D 3E6AA 4E33A 3RUIA 1YB5A 1E0DA 2NVUB 3E18A 1CIVA 4PVDA 3U3XA 3OQ6A 1KEUA 1M67A 2X86A 5COBA 5JCJD 3LLVA 3L0DA 3V1TC 1P1IA 1LDGA 3FTPA 2AA3A 3ULKA 2FWMX 4N5MA 4DREA 3JV7A 3ZI0A 2X0IA 4XYLA 4CLDA 4J4BA 3FPLA 3MJ4A 4XJSA 3AK4A 4F45A 1GR0A 1EVJA 1K89A 4FJ2A 5ICSA 5DZSA 1ISMA 3MZ0A 4IDDA 4RVGA 3I6QA 3PFWO 2QHXA 2AEMA 2BLLA 4WLEA 5FI5A 1JQBA 3H5AA 3HADA 1RM5A 2JD1A 3JQ6A 5I8WA 3DAPA 2HMUA 2WD7A 4CV1A 4CM7A 5F1OA 5DCWA 4DYVA 3CMMA 5EIOA 2PZMA 1HDOA 1Z7BA 3Q1LA 2PTGA 5JAMA 3OEWA 3GGGA 2JFFA 4YRBA 3SC4A 1AHIA 5A9RA 3AI2A 4A0SA 1O0SA 1OZAA 4AJPA 4YQZA 2XXBA 2DTXA 4LCJA 2C7GA 4B3JA 4CL3A 1DC3A 2EHDA 1XELA 4OJNA 3C1AA 4KDFA 1EQ2A 1SNYA 4GI2A 4IGFA 3U5TA 5KVQA 1NTOA 3IQDB 3WQSB 4B79A 4XEHA 3I9JA 4B7XA 5BSFA 4Y6RA 2JJYA 1V35A 1ARZA 4GX2A 1HYHA 3WGQA 4I9NA 3W4IA 1NQOA 2Y1CA 4UVIA 1H94A 4JX8A 3UW3A 4ZQHA 3ZNNA 2GASA 5T67A 3A9WA 1H6BA 3GFGA 5CDSA 5JMPA 3A06A 3OIGA 1UJMA 4ND4A 2Y1FA 3BMOA 4J7CA 5JY6A 3GHHA 2ZYDA 1F8GA 1A9ZA 3EUWA 1W6UA 2OO5A 2CVZA 4J7XA 1E7SA 1I10A 4NQZA 5JE8A 4UREA 1O5IA 3VH3A 4OH1A 1F17A 1GV1A 5KOIA 4FN4A 4U8GA 1V8BA 1BG6A 1WVGA 4ZGWA 4H3VA 2Y0DA 2EF1A 3FI9A 1PGOA 2D1YA 3WXBA 2W90A 5C3MA 1XKQA 3WNQA 1HYEA 2NSDA 2PGLA 1LSSA 4BB6A 3PJEA 4NDNE 1HETA 1IHYA 1XEAA 3VPSA 5A5FA 3JQEA 1HKUA 1Q7CA 4BGUA 1GTMA 3HG7A 2ZQZA 1QYVA 1A72A 2PLAA 4QTZA 1E7RA 4HY3A 3TZHA 3I9NA 2GNAA 1X13A 1QYCA 1XQ6A 1XG5A 3TSCA 1T4DA 3TN7A 3PEFA 3NT5A 4RZHA 4IJUA 3GT0A 1D1SA 3H5RA 5HM8A 1LC3A 3D3WA 3PIDA 4CM5A 4J7UA 1MFZA 4XDYA 1CQIA
chains in the Genus database with same CATH superfamily
1L8AA 1W1IA 3EPPA 2WW8A 2RKBA 2CEKA 4KSBA 2FP4B 2J9GA 4E1BA 4NAVA 3E9NA 1Z74A 1ULBA 1EXMA 1OLUA 2W2QA 4DR6B 2B4YA 4RZ2A 2NUAB 2EU8A 1PJSA 4X8MA 4QJBA 2O8FA 1NXVA 3VI4B 2OKGA 3KOXA 3NM6B 4XD7D 4DBVO 3LWNA 1CFJA 1WZCA 4BWGA 4PEVA 1SXQA 4LF4B 3W9YA 1JXAA 4DTCA 1B6RA 3AWIA 3T7KA 4V39A 3L7AA 3VSEA 3ZQ6A 3NXKA 1ONSA 3KVOA 3D8SA 3IULA 1LU9A 2BT4A 2PUDA 4CKWA 3RYIB 3M6LA 1QHSA 1SCUA 2IODA 2Q4DA 3G59A 3HCOA 2FPRA 2Q4OA 4Z86A 5FR2A 3UMMA 4JI0B 5U1PA 1JHVA 2R2AA 5FO1A 2PJRA 2O0KA 3FTDA 4ZODA 1YNOA 3DZJA 3PDHA 4ZZ2A 5LIPA 4GC9A 1NVAA 3C7AA 4RMJA 1QH9A 1U98A 4MUIA 4N12A 1AUQA 4W1RA 5C80A 5B4UA 3T1YB 2XTMA 3GUYA 4AFNA 3GEMA 4XVRA 2FPWA 1BW9B 5TVGA 2RHCA 3HO1A 1Y6FA 3PS9A 4LG1A 4QREA 5JZBA 3O31A 4BBPA 2CNOA 3H5TA 5EP3A 4AWBA 1KZ6A 3DKRA 5AK6A 2HEGA 1QQ6A 2VYVD 1YASA 1H5NA 4MJ3A 3HPRA 2D54A 4JEHA 3DBHA 3AR9A 4RLFA 3WK8A 1I1OA 3G68A 5JCOC 2FRDA 5JJKA 4DMUB 2VBIA 4BB5A 2E49A 2WHRA 2GF0A 4CNBA 1U8ZA 2YS7A 2FX2A 2G5TA 3N7UA 2FPMA 1KOJA 1TQ8A 3TQIA 2HJWA 2GAFA 1JDBC 4DAEA 3SNHA 2ZDGA 5D6NA 6CHYA 1JDUA 5M3BA 3GDWA 2VP2A 1Q7RA 2X0RA 3VNVA 1KOLA 1Q7TA 1V45E 2ZPTX 1A9YA 4DHEA 1Z3IX 2JEYA 3S55A 1MG0A 1BMQA 5DYWA 4TTVA 5DTRA 3AU9A 1GYRA 1T2NA 1NSTA 1DHTA 2IHBA 5G02A 2EQBA 2YQZA 5HCUA 2O1EA 1W7AA 4OGFA 4Q3NA 3N6RA 3KOZA 4KE9A 5HF9A 5IM5A 2CL7X 2CNKA 1TO2E 4I1SA 4PWYA 2FSSA 1E96A 3B1FA 4BO0A 4O2BA 4BMVA 2B1QA 2JLCA 1YSCA 2NTEA 3QHQA 5BYJA 4ENRA 5CEEA 3IUPA 3U4AA 4ARSA 1HUQA 2NU9B 2XOXA 2VEDA 2UZ0A 1EEXB 1OGYA 2HV8A 2PFGA 2WPDA 2XVAA 3KDAA 4OI4A 4MR7B 5DRYA 2JGFA 5DNYB 2DYKA 3USCS 1JH8A 2O2GA 2OXCA 3IMFA 1IC6A 3M8KA 3VU1A 1U28A 2C3OA 1ZIXA 2XH8A 1KSHA 1X87A 3M5WA 5CDFE 3A10A 4U6NA 4C7OB 2NAPA 1H3FA 3TW8A 1E7MA 2HU2A 4PSCA 2R1TB 3S1LA 2YMQA 4L8WB 2ZJFA 3HWSA 1MIOB 1TQ4A 1WSDA 3M1AA 4GYYA 3WNCA 4BO6A 1MB4A 4TRJA 1NUQA 5EPOA 4Q01A 3U1TA 3D6TB 1S8FA 2P5TB 2PRJA 2VHZA 4AP5A 2OD7A 1MRZA 3DMRA 5EGNA 1NYLA 4Y6OA 2VSFA 1QBGA 2A57A 3ASVA 1U1DA 3KEOA 5FAKA 3M4ZA 5CCDA 4LAFA 4M36A 1Z2EA 4LRTB 3HTXA 2CD7A 3DHEA 4IOMA 1L5QA 4JZYA 1FFSA 1TZ2A 5K51A 2UYGA 4LYFA 1CRZA 5JT1A 3MYYA 4EQZA 3SMVA 1PZXA 1TT5A 2P3SA 3CR7A 4D41A 4K9QA 4UDXX 3U37A 2VDKB 3CR3C 1G5RA 4FYIA 1LDBA 1RXCA 1SIUA 4GBMA 5AXDA 4ZQCB 4ZKDA 4URUR 2G6BA 4BKUA 2BCJQ 4RQBA 2J9YB 1R12A 1H1TA 3AUAA 1MH1A 5ADWA 2JGJA 3FLAA 3W06A 1I8TA 1SR8A 1YCDA 2WNSA 2Y9MB 3G0IA 2C2BA 2CUNA 1PWEA 1UBJS 2EKBA 2GPAA 3I1FA 3JQ7B 5G0UA 2VEOA 5SZHB 3R5JA 2ZB2A 1QDLB 3TPFA 4ZOAA 1E2IA 1GZ4A 2CLLB 4J03A 1OILA 3UN1A 3F5SA 4JR2A 3PNPA 1ZC4A 4EVQA 1A8UA 1R5OA 2JI6A 4E14A 2J5RA 3O8CA 3X2SA 4FSDA 1GL3A 3UJAA 5HYVA 2CXSA 2QRZA 4NZ9A 3RRMA 5KOHB 2WNIA 1ZXBA 3E9CA 5CFRA 3KXDA 1BHSA 5IC6A 4H7DA 1ZK2A 3MD9A 1H8HA 2EZ9A 1GQSA 3QX9A 1LBTA 1WZEA 2HK9A 3DEIA 3DMDA 5CVUA 3ZC3A 4AJNA 1L5HB 1K75A 2I67A 3PPIA 5BORA 1NMSA 2XE6A 1I7NA 1J0BA 3RYCB 2RGNA 2O8DA 4OA5A 5FLYA 1W0CA 1CB0A 2VQDA 2OHGA 1QV6A 2JH9A 3GMSA 4OYHA 4XPIB 4MPJA 5G3YA 4MQ5A 3GGDA 1QNLA 1U7HA 1RPTA 2G6TA 5IKMA 4KDCA 1ZL0A 1DBWA 2BTOA 3JR3A 2IXTA 4KLRA 2HGZA 4ZA2A 2DM6A 5I7UA 4DARA 1KEEB 3SXUB 1XK6A 1UP4A 1Z75A 3TLBA 3LHKA 3R7NA 1UC5B 1RZVA 1ZVKA 3W5SA 2YRXA 3B2QA 4LZAA 4Q39A 5J23A 1N1DA 4V0QA 1N0HA 2X0KA 4PX2A 1FMTA 1CY6A 1CB7A 2W6IA 3FNEA 3Q10A 4UM9D 4EAAA 2LBPA 4G1UC 2P9YA 2GXQA 3L7DA 2QJWA 3INTA 1HYBA 2WR8A 1TFRA 3V8PA 4WW0A 2FLKA 3I4CA 2XSZA 1OFVA 2IQIA 4J07A 2RGWA 1I7SB 3CBGA 4DR4B 1XP8A 1W75A 2PMCA 4EB0A 4XFDA 2ZTUA 4RFVA 3VC3A 1LQ2A 5LQCA 1EJ6A 1HFEL 1WPRA 1E4EB 1SXJC 1OVMA 2WJJA 2ZREA 1BHQ1 4RKFA 2NO9A 2CK3D 1J4AA 1XNHA 1ZXLA 3ONVA 3QBJA 3SQWA 2YYZA 4WUVA 4RK0A 5DN9A 3CLUC 5JYCA 3VZQA 3A6LA 3WOHA 4UVGA 1OI3A 3VXKA 2I8LA 1NVGA 3MIZA 4QUDA 2WTAA 2RDMA 1RCUA 3CZAA 1JAYA 1R9GA 2RONA 4GE0A 1GV0A 3T7AA 3DDNA 3O1JC 1O0CA 1OBHA 1W48A 2ZSDA 3QVGA 5E6SA 3H0KA 4FCTA 2WMYA 2CZCA 1E2UA 4E1VA 1S01A 2KHZA 2FZ4A 3L01A 1KKMA 1YHZA 1ZLYA 3PRKE 4R98A 4EKIA 5L40A 2E7ZA 1JFSA 2OUIA 2H65A 3IO3A 3JYNA 4FNOA 3WBBA 2FFJA 5E3HA 3HJHA 1ICIA 1OKKA 4E32A 2FQXA 1CQIB 1NMQA 1NUHA 2KBEA 5BSMA 3VUEA 4LDJA 4GRIA 4HDRA 2TMKA 1GNRA 1X0XA 1NAIA 5HUHA 1KHTA 1E6KA 4Z99A 4AX8A 4YREA 4PRLA 3H84A 1Z2NX 2DR2A 3H2SA 2BBOA 5CBPB 1L5WA 1UDBA 1K7EB 3U4GA 4E12A 2C4UA 1J0XO 3ZHQA 4ZFNA 1L9XA 1KRWA 4B4KA 5CH3A 3WRYC 4G5FA 4RKQA 3BCUA 2OM2A 4PZCA 4ZT6A 5BP7A 5ADHA 1G5TA 2OFOA 4PQFA 5F2KA 1L1EA 3RBVA 2ZULA 3M6FA 3GAMA 2HUNA 3M3HA 3EXG2 1UKZA 3ZIUA 3V8NA 3TKLA 2DBRA 3N70A 3D7LA 2FDCA 1OZHA 1VKZA 3KSMA 2QROA 3B6KA 3V4VB 1NP6A 3DDZX 2DBVO 1PFWA 1VE9A 4J1TC 2Y05A 1LPBB 3KNZA 3P9CA 1YB7A 3OE1A 1L3BA 1Z4KA 4KAXA 3T7CA 4B31A 5A02A 5AVTA 2C94A 1GZ5A 2BFMA 2WIKA 3CW8X 3TTVA 2CK3A 2PZEA 3C3PA 1JKIA 3TAHA 4R0MA 2KQUA 1Z5UA 3A9SA 4MCHA 4QYIA 4C6TA 4ZI7F 4I08A 3LP8A 4BEWA 1W87A 1U2TA 3QFCA 3SICE 1NUAA 1XKTA 1XRRA 3ADOA 4RZUA 4WD3A 5ALZA 1DO0A 3BD7A 4IM7A 1VGQA 1XLUA 1ABBA 2YS6A 3K9WA 4RE6A 3NWEA 1H2HA 2MSLA 5CX1A 4D46A 1S5PA 3ETGA 3QZUA 4YCAA 1QDUA 4A8TA 3KSZO 3OQOA 3LT4A 1U31A 3R5HA 1VYTA 2AV6A 1EK2A 1DT5A 3PVCA 1SBTA 3N6XA 4PCLA 5EWMB 4Z2YA 2O2DA 3TIVA 1ZVVA 1VP3A 1FDTA 2OD9A 2UUCB 2IUYA 2ZQ5A 3ZLBA 4LHEA 4MW1A 4S1VA 1T0PA 4B82A 3EXHC 5C1IA 1JE0A 3VYSB 2P9HA 3PZBA 3BDAA 1YXMA 1PL6A 3GDHA 2FSIA 3HM2A 2QPTA 3M33A 3F9CA 1G2IA 1T9GS 1V5FA 1A76A 4A0QA 2AOUA 3DNMA 2YWRA 3LD9A 5EJ6A 1JIQA 1F0PA 1V4BA 3WK6A 4AS1A 1TEHA 4XYMA 3HR4A 2C8VA 2TS1A 4NJEA 4ENVA 2Q5JA 1SD1A 3Q8XB 1SC6A 3HSKA 1FQKA 2GZHA 2Y1EA 1LXCA 2ZRKA 3B9PA 3JX9A 4P0TA 2QPAA 4HAOA 1MEJA 3GN1A 3MK31 5LQKA 2CXRA 2IIQA 1KNQA 3OZRA 4MR9A 4MS4B 2ZG6A 4UNSA 2QQEA 5ENDA 3WQBA 4C78A 4Q4LA 1JIVA 5KYTA 4JJ8A 2B4KA 1B2RA 2D00A 4E5DA 2WQ7A 2X1VA 3EY4A 2EG5A 3NM4A 1EFAA 1C0PA 3HHEA 4UOZA 4PFSA 3IIEA 2QYOA 1OX5A 2UUPA 1EUCB 3ZWKA 4LBZA 4IH9A 5EKDA 3WIDA 4FYJA 5JD3A 5BOSB 2ZI7A 4EO4A 1GGEA 1R2QA 2JLAA 3ILVA 4A15A 4Q7KA 1Q1EA 1U3VA 1IOVA 3EDCA 3PFNA 4NL4H 4D4IA 3MCAA 1O94D 1YDMA 5FNVA 1AKYA 1G21B 2ZCVA 5DDIP 1HDYA 1OW3B 5KOJA 2XTZA 4BRSA 1NF3A 1OI2A 1TTHA 2PGNA 3OQVA 4IFTA 2NV0A 5FI3A 5IARA 4AZTA 4NPCA 1USIA 4OGWA 4PLYA 3KUCA 4ZWNA 4BS9A 2AN1A 5JROA 2J3HA 5K8JB 1BHJA 1R5JA 2AZ4A 4Z1MA 4YH1A 2O05A 4V02A 4V0MA 4X41A 3VU9A 4FI3F 2GJKA 5A1JA 2Q5IA 1SELA 4QAJA 1FCJA 3ABIA 4DTIA 2WUEA 3G7SA 3K8QA 4DDMA 2EYUA 4FCWA 5B2EA 3TG2A 1J0EA 2RCNA 3H9JA 4D9FA 1E7QA 4OQDA 3HFSA 4OTZA 1Y3CE 3FGOA 4D8TA 1Q3HA 3EARA 5K0EA 4DEXA 3SSAA 3FOFC 1ZQ9A 4CV3A 4ZVOA 3W2TA 2D8AA 5E1BA 1EJ0A 3WQRA 1EG7A 1ML3A 2H6EA 3SIRA 3SS7X 3UJ7A 1WETA 2JFZA 4FNAA 1J5EB 2FMTA 2YV5A 3PNYA 2P68A 1WY7A 4LRXA 2IIPA 3AF6A 3V8BA 1XPUA 3HDVA 2VXYA 4BAGA 1KZ9A 4PXYA 4WH0A 3HBLA 3UOGA 5IDQA 1ULUA 1KAHA 1T2EA 2JANA 3F4LA 1J25A 3NX4A 4PRZA 5A5DA 1D3AA 1JEOA 1I1QB 1RWNA 1SO8A 2X2FA 2XZDA 1IDN1 3BXPA 3N0WA 1G6HA 4KV9A 4N0QA 3T1NA 5A9SB 2EWWA 1XMSA 2VBCA 4TSRA 2CXQA 3KALA 4LX8A 3ROZA 4GR4A 3SI7A 1LX7A 2H7CA 4EG3A 3SHWA 2QMYA 1VA5A 1YC5A 3ESXA 4C4OA 4KN9S 2ICAA 3L5OA 3DEHA 1E1CA 2VUTA 1M8FA 4C22A 2SNIE 3DV0B 5HEKA 1FNMA 3K0FA 5FDFA 1JSLA 1ZI6A 4WWHA 4LHXA 1PK9A 2UU9B 2VHEA 3I28A 4QO8A 3I6ZA 1CD5A 3CZ5A 1M5RA 5ALSA 3Q5EA 3N2KB 5DWQA 1CNEA 4QFDA 4DJDC 3L0OA 3CIOA 2Y99A 3BE8A 4MA4A 5HS4A 1DSSG 5BVHB 1E9SA 3FPHA 3WWDA 1RAGA 3E61A 1N5OX 4MVJG 3SQNA 1LNSA 2CUTA 3JQBA 4WQMA 1XVIA 1B6TA 4IHJB 1YAJA 4UE6A 3RBXA 5HP4A 2QXUA 3NONA 4JJGA 4MVJE 2QUAA 1U7PA 2RBGA 1KR5A 4HNAA 3KOMA 4NX2A 1IN1A 3RGGA 1Y3FE 3NGLA 3SYLA 2I3DA 2R2GA 2SHKA 2B8EA 5K0BA 1PL8A 2L17A 1M34E 1PWZA 1WABA 2E4VA 3H5OA 4B83A 5FO0A 4EMUA 2ZRPA 2GK3A 5DM4A 4BBZA 2I65A 5AYVA 4X61A 1KJYA 1MAVA 2GWHA 2N1BA 4TKUB 1KOFA 4U9IS 3VR4D 3WIEA 3HCEA 4HH1A 2YV1A 4BO1A 3DV2A 3P2YA 1IQUA 4CIXA 2WP0A 3LT5A 4O8CA 5KYKA 2VUUA 1LBQA 2ZBUA 1FZQA 4DMKA 4OLAA 1P2TA 2OV6A 3UK1A 1E69A 1QO9A 4L85A 3CSSA 4E3WA 2WKWA 4IDQA 4M9QA 1HPLA 2YWJA 5F73A 3MM4A 3NHWA 4Z6KA 2A9QA 4WUTA 3IHWA 4EMTA 1CUFA 1I7QB 1N3IA 2BFOA 3LC2O 2GBLC 4JUDX 4N41A 1JPJA 1QAQA 4ILEA 3A6DA 2OQVA 6PFKA 4LMRA 3QU9A 3QU7A 5CB4B 2YYAA 4J4HA 3TMAA 3ZGXA 1XEWY 3QY9A 3OX4A 4QT4A 1C3OB 2GDJA 2V5AA 3O3CA 5JALA 2BM8A 1UBGA 1P3Y1 1VJDA 2PRIA 3PIRA 3ZBQA 4HUJA 1YL7A 1G4HA 3DWGA 1ZU5A 2O2CA 2EAUA 1KI1A 3JVDA 3P9PA 3C8HA 3EF3A 2IQ5A 4FR2A 3MXTA 3GJ5A 3FZGA 1GNQA 2OXFA 4C4PA 3F73A 1DXYA 3BGWA 5KQRA 1T2CA 3L2OB 4CMIB 2XYQA 3LX8A 3RC2A 1HWYA 4AO6A 1RLIA 2VAWA 1AT1A 4WFKA 3WRXA 1XTQA 1HNXB 1QK5A 3H8SA 3E58A 4MX8A 3SJZA 4JYAB 1FJXA 2IZOA 3SFVA 2BGRA 2VPYA 3JQAD 3IHKA 6REQA 4X6LA 3BWBA 3FPGA 1QV9A 3H17A 5DNWA 5AKLA 3OT4A 4P54A 1QYWA 1V7ZA 3G8YA 4G2TA 3V33A 1YKFA 1P8AA 3HCBA 4HV4A 3R9XB 5H4HA 4IS3A 3AVQA 3KQMA 4Y9TA 4OUDA 1W5EA 3X1DA 2R11A 3MJVA 4HZGA 1PIWA 3IDQA 4MIOA 4RK7A 3FOEC 2OXIA 1FYXA 2JFXA 1EI9A 1EQAA 4OQEA 3MS4A 4ZDWA 4RNCA 3WLLA 3X2FA 2ZS8A 2DUUA 5CM9C 1C7RA 1J5XA 2PRYA 3Q0IA 3WLMA 3PXUA 3KSBC 1NC3A 2A2ZA 2YN2A 4IBOA 1ZSVA 5C31A 3QLUC 1LDNA 4DQXA 3G2HA 1NI3A 1ODFA 2WG1A 5KU7A 3W2EA 4TV8F 3C45A 1NUUA 2LDXA 4H1HA 4BNFA 5EWJA 1IEXA 3HYNA 4WL0A 1P19A 4UVDA 4DIOA 4MKZA 3NEYA 1Q0HA 1ZRMA 2ZBRA 3KLBA 4LE0A 4I9GA 5KTTA 3UAGA 2RGYA 4D98A 3AF2A 4ZANA 1YACA 1OV6A 4N76A 1ND5A 1YQGA 1KAGA 1P6XA 4P7KA 1RCTE 2PQ6A 2RI0A 4GMFA 3MWDA 1L1QA 1SKQA 2Q2QA 2D7CA 4F04A 1RWPA 5D84A 4NONA 1QRUA 4R84A 1FU4A 1Y6ZA 1P7VA 2WF5A 1S3FA 3BXEA 4E15A 4EARA 4URVR 4CLOA 3OURA 3B5EA 3OC6A 3BJMA 2VSYA 1CHNA 4LSZA 3UAWA 1RLTA 1ZK0A 1Q2UA 2Q4BA 3ZD8A 5JAHA 1II8B 1KK2A 1LPSA 1ZN7A 4I3HA 4PSAA 1ZH0A 3WS7A 1JMVA 1DEAA 4K05A 3WA7A 1E3SA 1H69A 5MGNA 3GLIE 4LKOA 1KI4A 4GHWA 2UV8A 1JEQB 2P2ZA 1M8JA 1YO6A 5EUCA 2Z3VA 1F2TA 2V45A 5E9QA 5A3QA 1WCYA 5TPWA 4DV7B 4DA4A 2ZUEA 5BSGA 1LZLA 2I3AA 1AHPA 4QM6A 4CCAA 1XNGA 1P0MA 4L16A 4M0CA 5CLLA 1RAFA 3UV6A 5HOQA 1KQ3A 3LG2A 2EVWX 5AVKA 2AFHB 3R5FA 1DT3A 1VYUA 3DLCA 4RD6A 3ETDA 1W44A 4TSFA 1ILWA 1ZD4A 4HZUB 4UPEA 1IVYA 2GZ1A 1G64A 4DZZA 3QVOA 4EQ6B 1I2CA 3MJDA 4AJIA 5KNLA 3CINA 2GXSA 3K0FB 1QNFA 2P11A 4HPWA 4YT4A 1FDIA 3ZE0B 3P2JA 2PT5A 3ZCQA 5DNUA 1LPPA 1SG0A 4KB5A 1AKNA 4DM3A 1XRLA 5BRJA 2JFGA 1XPJA 1NXOA 4N18A 3CH7A 2HFKA 2J9FA 4YAJA 3T34A 1A9XA 1QO0D 4L0MA 1M2OA 2CW5A 3GJ7A 1UBSB 4AUKA 3IP7A 2G83A 3FLBA 2PT9A 3QVKA 3ZCXA 5BPHA 3VKUA 1TLLA 3NTUA 2O8DB 3DMYA 2QRPA 4Y1GA 2HB6A 1Z15A 1I01A 4CMHA 5B1HA 4FS3A 5ARDA 4RJLA 4JEMA 1QYRA 3GPLA 1Z47A 3U62A 10MHA 4UZFA 4IQFA 5BQOA 1RZ3A 3L6DA 2GERA 5JTTA 1Z68A 4TZ0A 1VI2A 1RPNA 4AICA 1OAKA 2HJSA 4PLWA 4W5WA 2B5OA 2V9CA 3ZHZA 4MVJF 4C29A 4KUGA 4G5OA 4M9RA 4CN8A 1U5BA 3HM9A 1E99A 3QENA 4B3BA 1VE6A 1BROA 5EUQB 4PGFA 3JTEA 3BE4A 2NYAA 5E1OA 4EB6A 4M9CA 1KPGA 1QYIA 2G77B 4Y9DA 2WKQA 5AMXA 3SJ7A 2XUZA 3OESA 4OHWA 1XRJA 4LQCA 4XWGA 2DFDA 2ZKIA 1JQ5A 1FTNA 1V16A 1YFKA 3P4YA 4UPVA 5A5EA 1HY3A 1KOGA 5JCOA 1DIOB 3JZFA 4RWEA 4QTYA 4KDRA 5TT0A 4L5JA 5B55A 2GEJA 4HVTA 4J6FA 4FE3A 5KTKA 2GK6A 4F1WA 4HPJB 1EJ2A 2H2HA 3NOOA 3LY9A 4Q9KA 3HE3A 2ONJA 2R1UA 3I6BA 3O4VA 3B6JA 3QELB 4B44A 3LBFA 3GLFA 3K6SA 2FE4A 5BXQC 4MWTA 1IJFA 3ICWA 3J7AC 4LOIA 1ODJA 3KLOA 3CMCO 5C8VA 3D8NA 4H59A 5CXQA 1WXXA 4K9NA 3DFUA 4Z4HA 2JEZA 3EVNA 1DEHA 1U3FA 1XXHA 2DBYA 3NEJA 4MI6A 4B81A 5MHTA 2P75A 5EXTA 1FU7A 3V1YA 3VPHA 3DBRB 2Q6LA 3MBOA 1QXSA 4I8XA 4C07A 4H1VA 3T5AA 1OCEA 2XCIA 5B64A 3BA1A 5HNKA 3BSYA 1N6IA 1NQ5A 1T9ZA 3DZFA 3HH8A 4MUFA 4NG5A 1E1CB 4Q1DA 3RFFA 5IUJC 2FPPA 1EFCA 1V7CA 5CH5A 2LW7A 4QT0A 2B6NA 3GEDA 4J3FA 5J1SB 2I8AA 4U0JA 4A0RA 3KOWA 3HACA 2XZPA 3SHVA 1DP4A 1DARA 4K9LA 2DG2A 4OKNA 3VH4A 4ZVVA 2A92A 3RIYA 3KV1A 1XCJA 1ZJJA 2CLKB 4I2NA 2G0NA 3N3BC 4B8WA 2X8BA 3RLFA 1YZYA 2R8PA 4QGSA 2VCEA 3L79A 1C1XA 4AZ3A 3H11A 2BDUA 3K15A 3JYLA 2YMMA 3U7QB 1E1RD 2XT6A 3UTCA 5TSDA 3I6MA 4MWCA 5IJ0B 5KNBD 1NVVQ 1P75A 1DPFA 1RMTA 3M2TA 1Z0KA 3K70B 3FCEA 5JFTA 2Q4EA 3B20A 4O4LB 2B9EA 2JARA 2VRNA 1TU3A 3QX3A 2GH1A 3D64A 3W5VA 1B14A 4B7UA 4XW2A 4OQFA 2C2KA 3L7KA 3M4YA 8AT1A 1K08A 3C5WP 3MN1A 3VBCA 2H2AA 3VSDA 5ITVA 5CT6A 5D3QA 2R8YA 3NWJA 3D4OA 4TVSA 5BNIA 3UKJA 3EPRA 2ZROA 1C30B 5DGTA 5D5QA 3TTTA 2X3YA 4LZZA 4DGQA 4EG4A 4D0RA 3BAFA 2KS6A 4G84A 3ZH9B 3BQ9A 3DMFA 1EUQA 1FFBA 4IDAA 4QU8A 4XWTA 3CVXA 3PGA1 3GLFE 1X7GA 1DUSA 4XVUA 1J5PA 3E03A 4CLOB 1T5HX 1ZG3A 3QVTA 4OHUA 4TMZA 1OFGA 1JHYA 4W6ZA 4LVCA 1FMLA 1H93A 3SVZA 3ZDDA 3GN2A 3IP6A 3O47A 5CNKA 5FUXA 4A0GA 3ZYZA 4CMKA 5REQA 3NV9A 4BRUA 5F35A 5AFSA 2PLFA 5EEHA 2FZGA 5HIAA 5GONB 1VDMA 3LE8A 2P2CA 4TQUS 3H6GA 4TMXA 4B09A 2FFQA 1UEIA 1FUKA 3O8LA 3VR1A 3CF2A 2G04A 2XADA 1QWSA 1W581 1CZOA 1MV8A 2AYYA 3PC7A 1BCSA 4KR0A 2H2DA 1Q15A 3BMCB 3H2BA 3A6GA 4JXXA 1NBMD 2BVNA 2IBTA 5D8DA 2OORC 3FDIA 2QYHA 4RZXA 1FNBA 4LYGA 3FB4A 4HRXA 3DXZA 1PT9A 3UHOA 1SEPA 2AOUB 2I6QA 3KT3A 4BGEA 4Q16A 1MHTA 1M8KA 3K35A 1DJQA 2NU6A 5BN3B 1VM6A 3OKAA 5LQRA 2W2LD 3VPBA 2G9ZA 5FBHA 5CFZA 5A2GA 4EO7A 2WT8A 4FQ8A 4Z4IA 3AINA 4NCXA 1KYXA 3WLQA 3AHIA 5HBRA 3OTHA 2QAIA 4YCJA 3RVSA 2AL7A 2ROQA 1N9KA 1O08A 5DCUA 2HJVA 2H3HA 2Y4OA 2Q3FA 1XAGA 1BS9A 1W9MA 2Q0XA 3NATA 1IUKA 2MYNA 5JYDA 1JXOA 1ZOIA 4ZXFA 3W05A 3MELA 4F06A 4XR4A 5ALIA 4KIUA 5KJ6A 2PRKA 1YR2A 4GZ3A 3GCDA 4KBGA 5AM3A 5ALLA 2QMOA 3DWEX 3U60B 2G5CA 2VS1A 3H9GA 1SOMA 3N2LA 5HILA 3I64A 4MVJI 1JR3D 4H7HA 1F14A 1FS6A 3B3JA 2OGSA 1A9PA 3AETB 2J0EA 4JNCA 421PA 2VQ6A 5CVVA 2QBYB 2O8CB 1XVVA 2VSOA 4NCBA 3EAFA 3ZY3A 4HS9A 5JNUA 2Q4TA 3DUFA 2NP7A 2HZ7A 1BXZA 2YWGA 1OOEA 3SZOA 4DJTA 2G7ZA 5EHXA 2E48A 1PJBA 5LIRA 1Z0UA 4WCFC 4DNPA 3RDPA 3VDQA 1BEZA 1QH0A 2WQ6A 2QRGA 2UZ1A 4MNTA 4XQGA 4AKHA 1T9GR 4YUYA 1SIWA 3ILYA 3QTBA 4DR3B 1GCAA 1HE2A 2XYRA 3DE0X 2JLRA 1CE8B 4I6EA 4J0EA 1SHKA 3KZCA 4GLFA 1VLJA 4NWIA 3WL7A 5IXSA 4WX2B 3UB2A 1N3LA 2XT0A 1Y8QB 1KETA 2ZSJA 3RVJA 2VDQB 1X74A 2H06A 4HFNA 5E95A 3G17A 2HI0A 4UTPA 5LKRA 5MFPA 1FLAA 2X1MA 4LF7B 3B3QA 2XCLA 1SK8A 4N7BA 5AR1A 1NVVR 3HKCA 4OO3A 1PI3A 4YP5A 2Q9CA 3W6ZA 2Q6VA 1KZ1A 4FFPA 3D5EA 4BO3A 4WLOA 5K6TA 2J30A 4JUIA 3JVEA 1OAAA 3T12A 1BKYA 3GU3A 1DXHA 5I7SA 3OPQA 4XWKA 4WNIA 2QRLA 4ZOEA 4QU9A 2YXNA 3M5DA 2N75A 1ADBA 1F4PA 4HQ6A 2FUKA 1K9VF 3OC0A 3OLQA 5CEJA 3PWTA 3KXKA 4H7IA 3ZK7A 3I9LA 1H0KA 2C2WA 3PFFA 1QIIA 2V8BA 3VU0A 2P7HA 5EHIA 2AKEA 1H2RS 3ABZA 4KX3A 2PLNA 1ACMA 3Q85A 1NRXA 3ZW7A 4RXTA 4DRXA 1EU1A 2P41A 3P45A 2YJ3A 1NQTA 4L28A 1B0AA 4I1YA 4YQEA 4CMEC 4IDBA 3HN7A 4P84A 1JDNA 5CDYA 1B8NA 1TCCA 3RS3A 2LP4Y 3LECA 1AZTA 4LJ4A 4XGKA 3ZWDA 4B45A 2LKDA 3TIXB 1ESCA 3HGTA 4EQ6A 1VLLA 1W4CA 1GKUB 3TUZC 1K9SA 2DULA 4EMBA 3IEPA 5EUMA 5ALDA 4D81A 2VUSA 3WJ2A 4TV9F 1BW9A 3K9QO 3LW8A 1E2GA 5FIUA 2VF4X 2HD4A 2QN9A 4B6EA 4OX9B 3KS9A 1TF2A 5EJGA 4XFJA 2I99A 4F21A 3LM8A 1T43A 1FTYA 2PWZA 1VE5A 1UPTA 3CY6A 4OAPA 4OQZA 1Y8AA 2CXHA 5CT8A 4C3VA 5CTJA 1WHTB 3H5LA 3K3PA 1X1QA 1Z2OX 3QUQA 1KC3A 4IO1A 4OGKA 3HLYA 3HWX1 2VRWA 4KMOA 2BI4A 2FR8A 4TMYA 2YWHA 2GCIA 3CWQA 1W9HA 3GBVA 2KMLA 4O2AF 4UQPA 1LFAA 4BDTA 4DMRA 2Z5LA 2E21A 3AL0C 2A0FA 4D99A 4B46A 4RDXA 3G2NA 1ORVA 1ZKMA 4NFYA 5IW8A 5AUOB 5SYMA 4FIDA 2CVPA 2C3UA 3C8UA 3NALA 3HCNA 2XQFA 3CEHA 3UMYA 1P8JA 2DHCA 2QD3A 1US8A 5LCXA 1E3QA 4NYJQ 2W9XA 3QYJA 3WIBA 4C4YA 2RHDA 1XA3A 4EI9A 5L7TA 2FWAA 1XQYA 1JG3A 3RU2A 2WDZA 3BTVA 3VH2A 3QV1A 5I8ZA 1PCXA 4B7AA 4EG8A 3T5GA 1M74A 1NQAO 3SJAA 3G82C 3BEOA 2MHCA 5CVEA 1WSBA 4GDMA 4M0EA 2BFWA 4R9UC 2DLNA 2QJRA 1RXWA 3BIWA 1ZGZA 3ZV4A 5I45A 5CIQA 4KAFA 3ORRA 4F8YA 4QG7A 1OJLA 4AMBA 3FCXA 1C2YA 4MRRA 1LNQA 4YN3A 3GWZA 5F78A 3SBXA 2BSAA 4GSYA 4EPVA 1M1ZA 3EMKA 3ZJTA 4G0VA 3EJ6A 2KM1A 2QTHA 3NVMB 4MTCA 3X3HA 5JH7B 1U0RA 4LMPA 4A36A 4QUEA 5JXIA 2BGNA 4MGKR 2GARA 4ZQIA 3F4BA 4Z8YA 2HHLA 4DNQA 4ZI3A 1MZPA 2EKZA 4KE6A 3F1KA 4M60A 2GAOA 1LDEA 2OCYC 3H2GA 5DOVA 3GBSA 4LYYA 4PE5B 1WA5A 1YKGA 3N0VA 3THYA 2B1RA 3QK7A 3STTA 1MKYA 4PZPA 2A1UA 4BFTA 1XGKA 4AF8A 1GQYA 2G07A 1IHPA 1NWCA 1EXNA 4TXMA 4XIGS 5F7ZA 5FXMA 2L82A 3OQHA 3ZLJA 1GKYA 3QBDA 5DYTA 3GUVA 1RJDA 2IP2A 2X1HA 2Y0BA 2Z2IA 4H6VA 1GFWA 1U0EA 4RIGA 2Z8ZA 2P9CA 1LX6A 2IEGA 2BYTA 4JFAA 4TWBA 3ZZTA 1O96B 1J70A 2FSFA 3G9QA 5T6BA 5C5DA 4H1UA 1XEFA 3QVLA 4Z49A 2CFRA 3H11B 3IAUA 2CYBA 4P0QB 3EC7A 4WZBA 3S3TA 3TQTA 3PNLA 5A6SB 3THSA 1JHZA 4WKPA 1IXYA 2FETA 1GD1O 2DOKA 1WB6A 1N9ZA 3JVIA 3NOXA 1UJ5A 3AXSA 3G0CA 4GVPA 1SCAA 4FNGA 1GGKA 1Y7LA 2PHZA 1Q6ZA 4ODIA 2QMZA 3PC4A 5IAJA 3T7JA 3C8ZA 3DVRX 3ENNA 2IGBA 1BE0A 1OBCA 4M89A 1R4MB 3TW8B 3N28A 3I9FA 1C9YA 5JWRA 1E1QD 3P7MA 5EMKA 4B3MB 1J9ZA 2JFQA 1YRWA 4Z0NA 5L4SA 3GQBB 3TGWA 3PD0A 2C1XA 5IBCA 3SWWA 2I7TA 1P2UA 2QW1A 2MJLA 4FLFA 1CUEA 3ZWXA 5HQTA 4P4SB 4DR1B 5DBFA 5SY4A 3SFTA 4DSZA 5TMEA 3TEJA 1XJCA 2ZTHA 5EZ6B 2VP5A 3WZ2A 1RLOA 4LBWA 4V3CA 4PFQA 5DBGA 5H1YA 3LQ1A 4P98A 1XR3A 3GGJA 3GOQA 1RYHA 2HHAA 3ETEA 3KKEA 5BMVB 2FUNB 1IAQA 5KS2A 2ZWOA 2VJLA 4YMUA 4K88A 4N01A 2QF7A 2G1KA 3SDBA 3QOFA 1MU0A 2MOKA 3Q9NA 3QE2A 3U61B 4DDUA 2NMVA 2E5FA 3OZBA 5F7JA 2W0SA 1K3FA 4RJIA 3VVBA 2NZ2A 4JGIA 3EQ9A 3AFMA 2C2HA 1V3TA 2GTIA 4XQCA 1A95A 1HT0A 3PV0A 3RTCA 2JJ8A 2XKAA 4U00A 2RHGB 3UXEA 3CEPB 2G80A 1CLUA 2IYUA 1HFWA 3Q88A 3GCGA 1NNLA 2M6KA 4B43A 4ZK6A 1OZ0A 3FFXA 1GO2A 2XCUA 3EGCA 3RUFA 3V1LA 4DM4A 4DC9A 4TTIA 2QLBA 3D8HA 4D9IA 1E5TA 1QP0A 3ZHTA 3CEMA 1XXLA 4HQRA 4IXTA 2JFNA 2PVCA 3CURA 2R7NA 4JP2A 3F6SA 4OB6A 5CNJA 1B93A 5EQFA 5BN5B 5L3VA 4Y7CA 1XOIA 3TKAA 5BSEA 1N3YA 1SKUA 3GRZA 2REOA 4IOKA 1CRQA 4P7GA 4UNPA 3DTVA 3GPIA 2HFJA 2ERCA 2CNDA 1UAAA 3AVTA 4AKIA 3OJXA 1UWKA 3ADPA 4JQCA 1V8PA 3WK9A 2PL9A 2O3QA 3EBLA 5H80A 1MAHA 5J5CA 5CAEB 4N3AA 3JRXA 2ZYWX 1T1RA 2QG9A 5JCZA 1IN6A 3AXTA 2D5IA 1K68A 3K53A 4FZVA 4UQLA 1UOQA 2C9YA 2O9JA 3ENWA 4JVLA 4CFZA 3GJ0A 2YVUA 5JVDA 1ORHA 3VPXA 1BQ3A 1PK8A 2GNPA 2WQZA 5CB6A 3EEIA 3L6UA 1TYCA 4H7KA 4M0UA 4XTCS 1HRKA 1ZHHA 5MGBA 3RTEA 1JILA 2ZS7A 1L7OA 2IYFA 3OF5A 5AVWA 4IDEA 2GPTA 2HQBA 2ONYA 2D1QA 3AETA 5HZMA 5CDGA 1GPAA 1QFSA 1M1YB 2NLOA 4A82A 5B2FA 2XUIA 2YJ6A 4BE7B 5EA2A 1P7PA 1V5WA 1P5JA 2WF6A 4OAQA 4GE3A 3WGLA 5IYZB 3JYQA 4BATA 3PVZA 3A32A 3TIFA 1E7WA 1TO1E 4IH4A 1NQVA 1EP1B 5HJ5A 1R6BX 1QIHA 3K9GA 1CSEE 3L6OO 2ZJ5A 4NK4A 4N3NA 1U4SA 2J0VA 2OORA 4U7DA 1E6WA 2HT1A 1DKLA 1RTKA 2R1VA 2RGGA 3ZPXA 1BA3A 3BEDA 3MWEB 1FSGA 4GI3A 2QRVA 4WY2A 3DC2A 3G79A 4RNDB 4J76A 1Q0SA 2D59A 1ZJZA 5LP6B 4QOEA 4REQB 5EJ9A 3UM9A 1N5RA 1VJRA 3LYUA 2FEAA 1FFXB 3O26A 1BVHA 4CG3A 4E11A 1F2UB 3A05A 2AEJA 3G8AA 3NYWA 4MVYA 2QM8A 3GH1A 3I5UA 1NLMA 3B7PA 4JQZA 5DXJA 2DUJA 3U44B 2PK3A 2RG1A 3KXIA 3C6YA 1PLJA 4CM8A 4A2CA 1DKPA 3GYGA 4XRRA 4EJSC 1N1EA 1ODSA 4PZLA 4HN9A 4DCTA 1YQQA 1MVNA 2R85A 3AJ9A 4NTZA 2FDXA 3P9ZA 3V3KA 1ONBA 1ENOA 1QZTA 1WUHS 2VK8A 3EIOA 5B1EA 5BY2A 1VJCA 4Z1OA 2ARKA 3V8VA 1CR4A 4YJGB 1B43A 4DY4A 5JARA 1H5QA 2JFHA 4B2LA 3CLSC 1FUIA 4IV8A 4GLLA 4CIBA 1B00A 1IMJA 4MLZA 3R0JA 3CF0A 4Q48A 3WMFA 1G8MA 4GI5A 2OYCA 4J0GA 1DC7A 2R44A 1OIWA 3ICEA 1ITZA 4Y2UA 1AQ6A 5A7FA 4QUGA 2C2GA 2W2VA 1BWSA 4KHPB 4IV5A 2I33A 4KX5A 4QEZA 3TLGA 3VR4A 4WK4B 3HEMA 4G1VA 3EPHA 4HDNB 2RIPA 3F6BX 4DCNA 1ZITA 2VRCD 3CVOA 2FOLA 4OK3A 2ZE7A 3MOSA 1PGPA 1YMQA 1Q0UA 3OF3A 2BGGA 1WCV1 5IHPA 5C1BA 3CSDA 4ZC1A 2ATEA 2GX6A 3CCBA 4OQMA 2XKKA 3F8SA 2YOFA 2ZIZA 4DZTA 2Q5FA 3I9V1 3V1KA 1QKKA 3DPSA 1AQUA 4K26A 4PPYA 4WXHA 1KAMA 1A5AB 3W7VA 3JAMA 1CF9A 4R3UC 5JJCA 1AKWA 1BN7A 1HFKA 3L46A 3ZDRA 3QE0A 5ALXA 2BMEA 3L82B 3O3NB 3QFRA 4W5JA 4JYMA 4YV7A 2ZVPX 3FROA 1B26A 3PHIA 1NN5A 1IWOA 3IESA 1X38A 3RFUA 1N2ZA 1M2GA 3EVDA 1HQYE 3G0DA 3GY0A 5EIFA 3RFVA 4JYPA 2JHAA 4BZQA 2EEZA 4ZK2A 2AEFA 5L8VA 4TV8B 2CLDX 3AI3A 1JLRA 1MZVA 3K2EA 4MIEA 4EUEA 1JHAA 4RE5A 4ESVA 1FS5A 3A70A 3J80A 1RXUA 2PAAA 4W5NA 3UENA 4EJMA 1F8FA 4LIPD 2IYEA 1UFKA 3WGYA 1PR2A