3BYZA

2-amino-1,3-thiazol-4(5h)-ones as potent and selective 11-hydroxysteroid dehydrogenase type 1 inhibitors
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
258
structure length
258
Chain Sequence
EEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2-amino-1,3-thiazol-4(5H)-ones as potent and selective 11beta-hydroxysteroid dehydrogenase type 1 inhibitors: enzyme-ligand co-crystal structure and demonstration of pharmacodynamic effects in C57Bl/6 mice.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
total genus 87
structure length 258
sequence length 258
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2008-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3byzA00
2OOSA 1Y7TA 3GPIA 3H5NA 3S55A 3PIIA 4YAJA 3WICA 1HL3A 1PR3A 2H63A 3FWNA 2ILTA 2V6BA 5G4LA 3VZSA 4GH5A 2WD7B 1LTHR 4E5KA 4ZRNA 3FTPA 1PGNA 3PJEA 1HE4A 5TSDA 4CQMD 1EVJA 2WJPA 3B1FA 4JCOA 4PLWA 4BNGA 5JYEA 4YJHA 2X7HA 2UUOA 1FDTA 2PNFA 4LN1A 1QR6A 3M2PA 1UUFA 3PHLA 4FC6A 2EKPA 2CF6A 3ROQA 3WGZA 4OOEA 3WGTA 1QV7A 4BNUA 1ISFA 1V3UA 3OJOA 1W73A 2WD8A 1R0SA 3ZGYA 3WGHA 2R2GA 5TJHA 4OKNA 3ZZNA 2D0IA 3CEAA 1WLYA 1ISIA 5HS4A 4BNNA 4DL9A 4XRGA 1OMOA 1GPDG 5F1PA 4EJ0A 2WYUA 4LRSB 5THKA 1PZGA 3DZJA 5G4KA 5JBIA 3R3JA 1PGJA 2VUTA 1UH5A 3JQAB 1SCUA 2IEDA 1DIAA 2DTEA 3SLKA 4M54A 5L51A 2C0CA 2Z1MA 1YOVA 3PFFA 4G5HA 4JBGA 4KUHA 3QV1A 3GUCA 3E9MA 1D1SA 3B20A 3TZ6A 4DYVA 3IJPA 4BNXA 2G0TA 4R5MA 2X1HA 4ZVVA 1WZEA 4OOFA 3S1LA 1E1NA 2HJSA 4CLEA 2BGLA 3IMFA 4FDAA 2ET6A 5TNXA 1GFSA 4A0SA 1WW8A 4E30A 1UP4A 1JDJA 5IF3A 1J49A 4PLHA 3M6IA 3FR8A 3TPCA 4CM1A 2HO5A 2JD2A 2PR2A 2RAFA 1N8KA 2JHGA 3ZW9A 5B4TA 1NR1A 4WOKA 9LDBA 1T2FA 1R4NB 4ALJA 3GFGA 3H3JA 1K6IA 4NK5A 2JCVA 3JCZA 3I9JA 1NPDA 3GNTA 2OXIA 5JLAA 4S3MA 1ZH8A 4ZICA 4NBWA 3UVEA 3DBHB 3F3SA 5COQA 2VYVA 2VWHA 1C3VA 3OF2A 1KC3A 5B4VA 1XA0A 4FFMA 4J90A 5ICSA 1PEDA 2YHIA 4U0KA 1GYQA 2AEMA 4Q9NA 1GYPA 4ID9A 1A72A 3W4IA 4BUCA 4I9NA 2FSVA 3NT2A 2OZPA 4RDHA 1F8GA 4E5YA 5G0UA 2Q49A 3AK4A 1E7WA 1ZNQO 4BS9A 4XKJA 3K8ZA 5T8KC 3E9NA 2FOIA 4TRJA 1LC3A 4RORA 3D4OA 1HZJA 4GLLA 1N5DA 2FPGA 2VRBA 1RYEA 1YQXA 4ZD6A 1PJ4A 5BNFA 5U4QA 1ZVMA 3RROA 4D43A 1M6HA 2B69A 3RKRA 1PSDA 2F00A 5BSGA 4AVYA 3RI3A 2BH9A 3EGOA 5A9TA 3UHAA 3ADPA 2C5AA 1IZ0A 4MPDA 4TKMA 2NNLD 1ZEJA 2JAHA 1WMBA 4KOAA 4IJVA 3E48A 3JQ8A 4YRAA 4GL4A 2J5QA 2PWZA 1NYTA 4YACA 4PLFA 3H9JA 1B3BA 5HM8A 3GZNB 2VT2A 1A27A 2XPCA 1ENYA 3FD8A 3JD2A 4XRRA 5TC4A 2ZTUA 5ENVA 2HCTA 1UZMA 4OGWA 3GMDA 4YJDA 2VUSA 2D5CA 3RD5A 2J5KA 4BNJA 4B3IA 4IZIA 1IYZA 1GEEA 2FPPA 2Q1WA 3DBRA 4PLVA 4YJFB 1H93A 3TOZA 2PZJA 1QG6A 3WQRA 4B7UA 4GSLA 4R41A 4U0JA 4XR4A 1E7SA 1I3NA 2E82A 3AW9A 4CR6A 3WLFA 4Y98A 1DDOA 5AXAA 4MVJH 5A9SA 5EN4A 4AJHA 1GZ6A 2X9NA 3D7LA 4XIYA 2EGHA 3RUEA 1Y8QB 5JSFA 2PZLA 1VSVA 1XGKA 1R4MA 4HV4A 4HFJA 3HZZA 1EMDA 3KTDA 1LDEA 1DIGA 2X5OA 1B2LA 1YGYA 5A03A 5C37A 1ZCJA 2OFPA 1B14A 1GQ2A 4BKOA 3U4HA 3L9WA 3L07A 2Z1NA 5GZ6A 4FFPA 3KEOA 3WJAA 3EK2A 1CEQA 3GVCA 1TLTA 3ICPA 4OH1A 4WKGA 5DCUA 1M2WA 5JC8A 2Y0DA 3UH1A 4R3NA 1V0JA 3PZBA 1PS8A 3H9EO 1UDBA 1YO6A 3W4JA 2R00A 3GEMA 3SBOA 1WZIA 1E3SA 4J2OA 3DTTA 4YRDA 1X1EA 1EDOA 2LDXA 5IJZA 3BMOA 4FCCA 4FR5A 4HBGA 5CEEA 4BO7A 1HDCA 4K1LA 4R54A 1YVEI 4P22A 4AJKA 1TA4A 5BNIA 4FB5A 3ZWXA 4XB2A 1U1IA 3BZUA 1QYCA 1P77A 3DAFA 3O4RA 2ZTVA 1NQAO 4D44A 5KKCA 4KQXA 1N1EA 3LYLA 1DC3A 3FNGA 4JQCA 1LLDA 4EUFA 1YJ8A 3A9WA 3RSHA 1ARZA 1VE9A 2AQKA 3OIDA 4CV0A 3W8DA 3F5QA 4PZCA 4BKPA 4AJ2A 3ZWNA 3U4CA 4J2HA 3MJVA 1RM3A 3SC6A 4IDAA 1X0XA 3UF0A 5BR7A 3HE3A 5A5EA 2AE1A 1C1DB 3AUAA 4P4LA 5G0WA 1IULA 1IY8A 1PJTA 4ESOA 4XQEA 1SPXA 4DQUA 3OETA 2HSDA 1YDEA 1ONPA 1SAYA 3RVDA 2EKLA 4F6LA 4CMEA 2RH4A 3S8MA 1ZK0A 1EE2A 4ZRMA 1DOHA 4J0EA 2JD1A 1VSUA 1T25A 1X7DA 2A4KA 3C7AA 4PVDA 4R51A 4MIOA 4WK6A 2QQ5A 3QWHA 3P7MA 3CXRA 3K2BA 3DBLB 3W6ZA 3VH2A 3RUIA 1JKFA 4KUEA 2NU6A 4J3FA 4RZHA 4U7WA 1EVYA 5DBIA 4PG6A 1IHXA 4QTZA 5C7LO 4IIUA 3UKOA 3UCEA 2C20A 4YXFA 3CH6A 3DBLA 2W98A 4PIVA 4UVDA 3RQSA 1WDLA 1XQ1A 4E12A 1LSSA 5KKAA 2DTXA 4NI5A 2VNSA 3RWBA 3NAQA 2NTVA 4IJUA 2ZB8A 1YQGA 4IMPA 4R69A 1IPFA 4WOJA 5IDYA 3RUDA 5CG2A 1PJBA 5AOVA 1OC2A 2HRZA 4NH4A 4E0BA 1BXGB 1LJ8A 4JBHA 3V1TC 2YHIB 3GVPA 4Z9FA 3FF4A 1PS0A 3ZWPA 4RF5A 5A06A 1E3EA 3OH8A 2PD4A 1KETA 4WNIA 3VOSA 5KVSA 5DBGA 1ZIDA 1VJ1A 3ZU4A 1O8CA 4KTTE 1U7TA 1U5CA 2V65A 2XOXA 1CYDA 2YHUA 3LC2O 7MDHA 1LXCA 3ZWVA 5IZCC 3L0DA 3QWAA 4XGNA 3NUGA 4B79A 1PGPA 1SC6A 2CFCA 1OI7A 5I9MA 1CIVA 4G2NA 4EJMA 4D0RA 3HNPA 4R68A 1RM4A 5GZ3A 4MKRA 2I99A 1EUDA 1MXFA 1PZHA 4IBOA 4IDFA 4BV8A 1I3MA 3UCXA 1O94A 2GN6A 1RJWA 1Z74A 4RZIA 1I8TA 4NJOA 1O9BA 2V6GA 1LEHA 1PJCA 2PA3A 1E1LA 3I52A 3ZU2A 1PL6A 1KEUA 1YONA 1VL6A 4DQXA 1RWBA 3GUYA 1K0UA 5C5IA 5KWEA 3JSAA 3DQPA 3S2IA 2Q1SA 5A3VA 4XR9A 5G4KB 4WEQA 1H2HA 3VZRA 1FF9A 3H9QA 4UUPA 3BTSA 4PRLA 4JP3A 2C2YA 4Q3EA 1LQUA 4RDIA 1N92A 2GPTA 1UP7A 4IDBA 1NPTO 2FY8A 5L53A 3AJRA 1EVZA 3ZWWA 4OQYA 3BMNB 1B8UA 1I32A 1E3LA 3DBRB 1KY5A 4E31A 8ADHA 1X7HA 3NKLA 4N5NA 1UAYA 4AJEA 1X13A 1EFLA 2GF2A 4AL4A 3DAPA 5KJ6A 3U5TA 2ZIZA 3BMNA 4UVGA 3DO5A 3ZWAA 4JLWA 5JS6A 3CUKA 3I83A 4DPMA 4MIYA 3GG9A 3KZVA 4MP3A 3OSUA 1GQYA 5JXWA 3IQDB 5H82A 2X8LA 5AYVA 3DMYA 5CDTA 3FHLA 2Q2VA 4IGEA 3F47A 3DC2A 1UR5A 3DZHA 4XCVA 3L4BC 4PLGA 2B83A 4P38A 1W0CA 3GMSA 4FJ1A 1C14A 5GY7A 4LK3A 2NVWA 4BO5A 3O38A 2O4CA 4BGEA 3C24A 3AU9A 1PJQA 4J1NA 1JA9A 5JE8A 4A73A 1KY4A 3D5TA 4MVJD 3JQ8B 4CR8A 4QQRA 3VH3A 3WMXA 2DTDA 1UXIA 5EERA 3KM0A 5A4DA 4ZQBA 3G17A 3D5QA 1ZXBA 3NT4A 2O3RA 3RU9A 1WMAA 2C82A 3VH1A 3I9LA 4PLTA 2ZK7A 3DDNA 4WLFA 1Z75A 1GL3A 1VKNA 3ZV5A 2I9PA 2O3SA 2VHYA 1HETA 1E3WA 3KYCB 4TVBA 1ENOA 4CMIB 3DOCA 3ASVA 1HF3A 2I3AA 2P9GA 4XWYA 4BO1A 4NNJA 4B4UA 1F17A 1P74A 1ZZEA 3DWFA 4E2WA 4E3ZA 1XQ6A 5FWNA 1DAPA 1U8FO 2UDPA 1VRWA 3CIFA 3IP3A 3CTMA 2O2YA 4DTIA 2P4HX 4QEDA 4K26A 1ISGA 4ALMA 1DLIA 2HMSA 2GO1A 4XEHA 4HFNA 3PDUA 3OMLA 2LDBA 3PHHA 1H6BA 1YBVA 3GAFA 3RFTA 1XYGA 3I9NA 5L4SA 4RJTA 5JCXA 1N9GA 2PZKA 4YWJA 2JFHA 4GX1A 1DJNA 2ZYAA 1R37A 4RL6A 3HFGA 2Y68A 4JN6B 3RFVA 4CM7A 4XQ9A 1I30A 2DM6A 4NIMA 3I4FA 2HMVA 3OJFA 3B6ZA 3VPFA 2PY6A 3OEYA 4YCAA 3SX2A 4IXTA 3GN1A 5C7OO 1DHRA 1R4NA 3C3XA 2BMAA 1K6JA 2OP0A 4I9UA 3ZWMA 3ZWBA 4EYEA 5IDXA 1NVTA 3RCBA 2WDZA 2ZJ0A 1OBFO 4PCVA 5TJ9A 2OGUA 1OAAA 3NYWA 4GI2A 3TZKA 1Z6ZA 4O6VA 1JQBA 3RC7A 1W4ZA 4JX8A 1HE2A 2YV3A 4WLUA 2HUNA 5CPFA 3AI3A 3DMTA 1BTOA 3GDFA 4QFCA 1GV1A 4D3FA 1U5AA 2HQ1A 1HLPA 2EXXA 4H3VA 5A9RA 3LT1A 4DQVA 3JYQA 3COSA 1KVRA 3KV3O 3DR3A 2GN8A 3JD1A 3T7EA 4NK4A 3V1YA 4RVUA 1TT5A 3ITKA 1HDOA 1PJ2A 4HFRA 5ENDA 4PLCA 2VN8A 1VJ0A 1IL0A 1PR9A 2VRCA 3A1NA 4RF4A 3VTZA 4CMGA 4D41A 4WASA 4K28A 3PP8A 3HB4X 3F46A 3L9XA 1WDKA 2QYSA 4DVJA 3WJ7A 5A05A 2A94A 2YDYA 3K73O 4H16A 4OHUA 5EMHA 5I8ZA 5KJ1A 4I5FA 3DHYA 1UZLA 1U2GA 3HHPA 1XELA 5EJ2A 4Z3KA 1ZK1A 1YJQA 4DIOA 5K9ZA 4U8GA 1T2EA 3VDRA 1NVMB 5DP1A 5TX7A 3KO8A 1H9BA 1Q1NA 1S7CA 1QSGA 4QO7A 1WNTA 2J6IA 3G1UA 1DBVO 3QP9A 4CUZA 4J9UE 3PHIA 4CQMA 2DBVO 2ZYDA 3D64A 2X22A 3ZNQA 5JW6A 4TZTA 1V3VA 4FQ8A 3PYLA 1IUKA 4D42A 4LRTB 3WGQA 1QP8A 3TL3A 3M1LA 5CDGA 5K6AA 5DZSA 3WFIA 2C54A 3MOIA 2P68A 1R16A 3G1TA 4MVJM 2AA3A 2O3TA 1U9JA 1P33A 4MP6A 3RBXA 2JCYA 2UYYA 3DTYA 1AXGA 2X58A 5DT9A 1DSSG 3T4XA 4A7PA 1EEHA 4MVJA 4YVFA 1I5RA 3K5PA 1WPQA 3FCOA 4OXNA 4ZA2A 4BNTA 3OECA 2DPHA 3NJ4A 1DXYA 3H65A 4BNHA 3OP4A 1UDCA 4U5QA 2RHCA 1JVBA 2W2LD 5KTKA 1LDNA 4AJOA 4CMHA 3WOHA 5T5QA 5ICMA 1EUZA 3FN4A 3QVWA 4L76A 1YBAA 3P19A 3V1UA 3AY6A 1XDWA 2EKQA 4FPXA 2CVOA 3NGLA 3HQ4O 3PVZA 1B16A 4F3YA 3GGPA 4ZQHA 3MOGA 4J1TA 2NQ8A 1XCBA 1VJTA 2EP7A 4BOYA 1PQPA 1SO8A 2YFHA 4TSKA 1DJQA 1DHTA 1Y5RA 4U6QA 2FMUA 1DFHA 4EGFA 2ZQZA 2Q4EA 2ZQYA 3OICA 1XWFA 5BQFA 4XDYA 1K3TA 2J3JA 4W99A 3LT4A 5HBRA 4EITA 5CDUA 2Z5LA 3UXYA 2NQTA 5KVCA 2X9VA 2C07A 3P2YA 1LLQA 2GDZA 4NPCA 5JY1A 3DZKA 4ZU3A 1ZSNA 1ONOA 1N1GA 3E8XA 2O2SA 1W6UA 3TFOA 5ER9A 1NHGA 5ILOA 1H5QA 4AJ4A 3IIEA 3PJDA 4PVCA 2IDZA 4BNYA 2QW8A 1VL8A 1I33A 5H81A 3TSCA 4BNVA 1NHWA 3GC6A 3Q2KA 4UUMA 1ID1A 1NTOA 5B1YA 4AG3A 4QUKA 1PX0A 4EW6A 2IE0A 5I7EA 4HADA 4YT4A 2YFQA 5T6BA 3ONDA 1ZKMA 1DRWA 2QX7A 2DFVA 2VWQA 1KBZA 1P1HA 1EE9A 4XJTA 2BI7A 4E4YA 2P2SA 2D3TA 4TZKA 5ER6A 3GFBA 3JQAA 1PIWA 2C7VA 1WDMA 1YL5A 1ZFNA 2DUWA 2OBYA 1MX3A 2JD0A 2FSSA 2DPGA 4EUEA 6LDHA 5T8KA 4X54A 1PTJA 4JP2A 3LLSA 5JO9A 3UFXA 8LDHA 2O3JA 4G65A 3CMMA 1P3DA 4WLNA 2OBNA 3Q1LA 4HNHA 4BO3A 4Q3AA 5ADHA 2HK8A 4WGGA 4RVGA 4PG8A 5FI3A 2GD1O 3VH4A 3SVTA 2VHZA 1CJCA 3RASA 4LSWA 3TZHA 1GV0A 3MTJA 3PJGA 4GKBA 1LUAA 3H5RA 4CQLA 4OQZA 1RYDA 1DIHA 1OOEA 4ZJUA 4WEOA 1ADFA 1I2BA 1WAMA 5AVOA 2AXQA 1JU9A 4RCVA 5DF1A 3K31A 4MDHA 3NJ8A 4NFYA 3CPSA 4S1VA 2D8AA 1ONNA 2ZB3A 5KCZA 2X5KO 3ST7A 4R3WA 4NBUA 1JWAB 1EDZA 2P5UA 4GGOA 4OMUA 1SNYA 2A92A 3WSVA 3FBTA 3LC1O 4EEZA 1BXGA 1VI2A 3KVOA 1M75A 4RPLA 1NWHA 1YRLA 3QQPA 1E1MA 1HYGA 1TT7A 2PGJA 3K2EA 3QWBA 1X0VA 2AQIA 4CM3A 4BNZA 3PFWO 4L4RA 2OUIA 1Y5MA 1O6ZA 5G0VA 1P1FA 1E3WB 3KYCA 4BMVA 4OJNA 2I76A 4FSHA 4O0LA 4XB1A 2P91A 5TRTA 2AW5A 3DAGA 1ML3A 1MP0A 4JROA 4OSOA 2J3HA 3INGA 5ITWA 2YQ5A 5TIIA 3EC7A 4Z0TA 5HRUA 1NFQA 1LC0A 1TXGA 1GUYA 1T1SA 1DIBA 1T4DA 5L95A 1JAXA 1G1AA 2NUAA 4Q3CA 1YL6A 3NDRA 3QVXA 3SEFA 1T26A 3AOGA 4CM9D 3EAGA 3NRCA 5DBFA 1BSVA 1C1DA 2HK9A 3JQ7A 3PIDA 4JJIA 3FR7A 1IPEA 1B8VA 1Y8QA 3LSYA 4BGVA 2O50A 1AXEA 4UULA 4XYMA 1N2SA 3QRWA 1Z45A 1U3UA 3I6QA 2EV9A 2PH3A 3Q0EA 4MVJF 1E7YA 2AQHA 2O7SA 1ISMA 1LDMA 3RUHA 3KYBA 4JXKA 4B7XA 1F0YA 3Q9UA 1V9LA 4LMRA 4DBZA 4OM8A 3HJAA 4AICA 3GOHA 3MWEB 1T2AA 4JJGA 2P9CA 4B8ZA 4YJGA 2NVUA 1YBMA 1FXSA 1HTBA 1W8DA 2E6UX 1HDRA 4FC7A 4H15A 1DC5A 1MFPA 3AM5A 3HFSA 2OO5A 4MVJE 4R01A 1C1XB 4M89A 1R66A 4CMAA 2ZTLA 3A4VA 3RC2A 2G76A 2VTEA 4XGKA 4YPOA 4C7KA 1HRDA 1MC4A 2P4QA 3EYWA 3V8BA 3E5MA 3BHMA 3TWOA 3C1OA 3JQ6A 3ENNA 4E13A 2CDCA 5IN4A 4WE3A 4YEDA 3TL2A 4YAEA 3WS7A 3R0IA 3UGKA 1HYEA 4KWHA 4OIMA 4BB5A 4KP7A 1FDSA 2BFAA 5DDIP 3LF1A 3TNLA 3I1JA 4ALNA 3GGGA 3H2SA 2HRBA 5ILGA 1UZNA 4ALKA 3ROMA 1LRJA 2FHSA 4GQAA 4I5EA 4WNCA 1NWCA 4YQYA 3PHJA 2IXAA 1ZJZA 3M1AA 3VC7A 1EQUA 2TMDA 4J43A 2AE2A 3RBVA 3B1JA 1GTMA 4DA9A 4KWIA 5K6AC 2CMDA 3V2UA 2B37A 3ZW8A 4J7UA 2VQ3A 3UN1A 2FZEA 3L77A 5L7YA 3WDSA 4EEXA 3BTOA 5B12A 1BW9B 1CETA 3LVFO 5IXYA 1YB1A 3KRTA 1KIFA 1H0KA 3EUWA 2HMWA 4ND3A 1C0PA 3JTMA 4NDNE 3WWYA 4W82A 2DU8A 3I23A 4B4VA 3O9ZA 1QYXA 1CWUA 3PHGA 1O89A 4NQZA 1K2WA 1PU2A 4XZ3A 2J3IA 1E6UA 3JQFC 4CUJA 1VPDA 2C2XA 5TQVA 4MO2A 3ZWOA 4JNKA 1K6XA 1BRMA 1R6DA 4HP8A 1DRUA 3ZU5A 2DC1A 3GRKA 5AXCA 4EZBA 3EHEA 1XU7A 2B4RO 2IZ1A 3JQ9A 4J4TA 4E5PA 3QVOA 2WD7A 5IXSA 5I7FA 3PQEA 3PLNA 3JQCA 3MJEA 5H83A 5J23A 3DBHA 4Z0PA 3ETGA 3LQFA 1LSOA 4AFNA 1PGOA 4CM8A 1HE5A 3QVSA 4IS3A 3IL2A 3U4IA 4QECA 3JQ7B 4CV3A 2PV7A 5EL0A 5BSEA 2DFDA 4XIJA 4YRBA 5BSFA 1UXKA 5A3JA 2DBRA 4II3A 1HDYA 3WWZA 1MLDA 1P44A 4A03A 2GSDA 2YW9A 1CF2O 2CZCA 3RU7A 2I3GA 4IDCA 1HKUA 1BVRA 2WYVA 4FFLA 4FFOA 2VUUA 3HB5X 2ZB4A 4JBIA 5ITVA 1XIVA 4BO6A 1PJSA 1VL0A 4OL9A 1A7KA 2YY7A 4R9RA 4IDGA 3GVHA 1HDGO 3AUSA 1UAGA 3WFJA 5DOVA 1OZAA 3WIEA 1DIRA 4BL5A 4E2XA 4D7AA 1UXJA 1H6CA 4MVJG 4Y9DA 4BIIA 3DZIA 4ND1A 2UUPA 3LU1A 2H5LA 3D3WA 3OJLA 1SEPA 4RPJA 4DIFA 1PWXA 1R4MB 3GEDA 2PKQO 1GCOA 4IJWA 2HLPA 1LDYA 3PPIA 1YWGO 4NR0A 4A5OA 3ANNA 5U9CA 1PQUA 1F12A 3H7AA 3ZH2A 3INRA 3GNQA 4BGUA 3IDSA 4NJMA 2TMGA 4NBRA 1KVSA 3EW7A 3AY7A 2O48X 2ZKLA 3NDJA 3WR5A 2C5EA 3JQFA 3MCVA 4DUPA 1JN0A 1C0IA 3FPCA 4FOSA 2CVZA 1PL7A 1RM5A 4WCFC 3FBGA 1YDWA 2Q45A 1H6DA 2EWMA 4NMHA 1KERA 1V35A 1BHSA 4O63O 4UEJA 2GZ3A 4OAQA 4BO2A 3VZQA 3WTCA 2RIRA 1JKIA 2NLOA 2PD3A 3WGIA 2D2IA 2O23A 3ZCXA 5LC1A 2GCGA 3V2HA 3Q2IA 1YH3A 3IP1A 4IDDA 4BB6A 3L4BA 2FR1A 1UXGA 1NQTA 1NAIA 5T67A 4IQGA 1V8BA 2XAAA 3BIOA 2EJWA 4E5NA 3RBZA 3FTNA 2HU2A 2GLXA 5LCXA 3K6JA 1Z73A 1HDZA 4M8SA 1D7OA 4DPKA 1Q0LA 1Q7GA 4DGSA 4IS2A 1Y8RA 3AI2A 4PFJA 1XR3A 4PGFA 2UAGA 3BAZA 5CHEA 4IIVA 3OA0A 5LDHA 1BWSA 4KUGA 4A10A 2Q1UA 4INAA 4YYZA 2QRKA 1DO8A 2DKNA 3G79A 4EDFA 4ZGWA 1OC4A 1I3KA 4CMCA 1GZ4A 2VHXA 4DBVO 3QW2A 3FPLA 1Y8RB 1E6EA 1U3WA 4E2ZA 1IB6A 5DNAA 3VHRA 5GMOA 4M87A 4BO9A 2HDHA 3KSDO 3QY9A 1Q0HA 3DONA 3I6IA 2XXBA 1ZBQA 1SOVA 4W7HA 1P0FA 3JD4A 1KVQA 2Y1CA 3D1LA 3G0OA 2CVQA 1YQDA 3E18A 3ZHYA 2FR8A 3WNVA 2OP1A 4R16A 3PTZA 4BKUA 3INTA 1YXMA 1G0OA 3IS3A 3ZV4A 3PGJA 2OHXA 3PRJA 5B4UA 3OM9A 2Q3EA 4RLHA 4ZQGA 2NSDA 1EUCA 4DLAA 3H4VA 3GEGA 4Y6RA 1MA0A 1DLJA 4TROA 5BNTA 2Y1DA 1I24A 1TI7A 4GMGA 3WXBA 1BDBA 1GCUA 2X0IA 4II2A 4W7IA 1NXQA 3CMCO 3ZN2A 1GAEO 4MINA 4I9HA 3WMWA 5A02A 1U3VA 4PN3A 2CDAA 1H6AA 5DCWA 2AHRA 4GWGA 4EUHA 3DZFA 4YQZA 4GVXA 3QJ5A 1I0ZA 5JFOA 1H2BA 3OA2A 1Q0QA 3CZMA 5IZCA 2VWPA 3JD3A 2FPIA 3SLGA 3KBOA 3OQ1A 1Y6JA 5L7TA 1XLTA 2D5AA 1NAHA 2GYYA 3K9QO 4R5HA 4TQGA 1Z7BA 2HJRA 1DRVA 4Q3BA 5A9SB 1O0SA 1Z82A 1XKQA 3OBBA 4W9NC 4E32A 3JYLA 4XQCA 1BVUA 2HAEA 1HWYA 1V6AA 3GLQA 3TRIA 3KETA 3HDYA 2NADA 3RC9A 4TWRA 5AQ1A 4XDZA 1FJHA 4TRMA 2J3KA 4RF3A 5IDWA 1QLJA 4YR9A 2X0NA 2DQ4A 2JFFA 4GMFA 1E77A 2IYPA 2PFGA 4PLPA 4J4HA 2JCXA 1U2DA 2VCYA 1GPJA 2ZJ1A 4ND2A 1ZEMA 5CFZA 5CEJA 3MJSA 4CODB 2BD0A 4R1UA 4AJNA 1LBEA 4I8XA 1EBUA 3G49A 2W2KB 3R6DA 3RFXA 2E37A 1J6UA 5COBA 3AOEC 3ZV3A 2UVDA 2GNAA 1M66A 2O7QA 1A5ZA 4BO4A 4RPHA 3BXXA 1LI4A 1S6YA 5JDIC 1KVUA 4TKLA 4XQGA 1KEPA 2ZCVA 3SJUA 3PJFA 3I3OA 2JFGA 2C29D 4IINA 1C1XA 1HEUA 1MFZA 4CL8A 2HKIA 4N7RA 4UREA 3WBBA 3CZRA 2BFMA 4HWKA 4O5OA 4BVAA 4H7PA 4OXKA 4WJZA 1D3AA 2GUGA 2Y1FA 4ND4A 5EINA 3GRPA 1PQWA 3VTFA 3KHUA 3PLRA 4PG5A 5L4LA 1MG0A 4CLRA 3QVTA 4YB8A 4B4OA 1D1TA 4FN4A 4YT8A 3HG7A 1DB3A 2EGGA 1XSEA 3ENKA 5MDHA 5IAAA 2V7PA 3H8VA 2PH5A 3TJRA 1B15A 2DAPA 4RV9A 4A2CA 1X1TA 2RCYA 4LGVA 3ZHBA 3EZYA 3T7CA 4PG4A 5T57A 1HDXA 2IZZA 2JKVA 3D3WB 1M6WA 2JHFA 5CEFA 3JQDA 1SB8A 5KVQA 4J6FA 2HMTA 3RC1A 3C85A 3DHNA 4TRRA 4FJ0A 2EW8A 1HYHA 2NM0A 3D3EA 1JVSA 4WLEA 2DBZA 3QIVA 1PWZA 3TF5A 4MVJP 2WE7A 3UICA 2IODA 4YAIA 1PZFA 2Y99A 3GHHA 1DC6A 1R15A 2EERA 3GR6A 4HX5A 1MB4A 4UAGA 3H5AA 1ORRA 4NBTA 2GZ1A 3GA0A 3DEYX 1R12A 1IE3A 4RVFA 1P1RA 2Q2WA 1L1FA 4ITUA 1BXZA 1JTVA 3W4KA 5G2OA 5DN9A 2W90A 1CERA 4CLRB 3ZNNA 1NNUA 4Z3DA 3VPHA 3VDQA 3EMKA 2QZZA 4Z9YA 3OFSA 4TMFA 3RIHA 2I6TA 6ADHA 3WIDA 1ZO8A 2W8ZA 1U7HA 1I01A 4N54A 4XGIA 1LNQA 4QT0A 1YB4A 1I2CA 4C7JA 4CV1A 4CMJA 3HDJA 5B37A 4WLVA 1TT5B 3BHJA 2UV8A 4NHEA 4CLOA 3GDOA 4LSMA 4AJJA 2CD9A 3HDQA 4R4JA 1C0LA 2VOEA 5JDIA 1NFFA 3NT5A 4WPGA 1P9LA 3CINA 3AFMA 3ZHXA 3GNSA 3TZCA 5L4NA 4CM4B 2XF8A 3ASUA 2WEKA 4CJXA 1TVEA 1SBYA 4ZHSA 3QWIA 4CL3A 1J0XO 2FP4A 4BNWA 2YZ7A 4P4GA 2YJZA 5DP2A 1N9GB 4L73A 4QO8A 3HUDA 4U6SA 1GEGA 1Y9EA 2PLAA 3ADOA 3PZRA 4CM4A 2RHRA 3CKYA 3NEPX 3OJ0A 1VLLA 3RUAA 1U3TA 4WUVA 2EHDA 1PL8A 4GBJA 2W2LA 3U9LA 4D0SA 3IUPA 1QRRA 4KTVE 2BFOA 4FBGA 3C1AA 2B36A 1MC5A 3F9IA 5CP8A 4DYDA 2E48A 2YV2A 4UUNA 2ZYGA 5I9NA 4IM7A 3PXXA 3DB2A 1Q2XA 4MJLA 2BKAA 3RJ9A 2X5JO 1RKXA 4JIGA 4L8VA 4N18A 5KIAA 3BMQA 4NU6A 1VC2A 5L40A 1ZW1A 3ONEA 4EJ6A 4PLZA 2QRJA 4AJLA 1DPGA 1LU9A 2C7GA 2NACA 2Z95A 1HE3A 3WSWA 5K0ZA 2PD6A 4Z9XA 4R9SA 4ND5A 3C8MA 2WSBA 2D59A 1E1KA 3PQDA 4FGSA 3AUUA 5F3RA 2X4GA 5TT0A 3SC4A 1AN9A 4B8WA 4L74A 1A9ZA 2G17A 4Z6KA 4UVIA 3V2GA 2VOJA 5F5LA 4MP8A 3UCFA 3DZGA 1BXKA 1E3JA 4RO0A 1G0NA 1JW9B 3ZHZA 2HK7A 2WWRA 4YJGB 3KYDB 4IUYA 1YOVB 2VTDA 4Y67A 3JQBC 3W6UA 4K6CA 3KLMX 1AUPA 2ZCUA 5CG1A 5HA5A 2GN4A 1SEVA 4EBFA 4E5MA 2F1KA 3VPXA 5HWSA 2ZB7A 3MJCA 4YJFA 2PZMA 2QRLA 4WECA 1F14A 1EZ4A 4L0QA 5TGDA 3ZI0A 3F4BA 4YTEA 5HTOA 3H9UA 2GRAA 1GUZA 1QYVA 3IKVA 5KJEA 1EK5A 1E5LA 3HDHA 4BKQA 3MEQA 1SB9A 1QV6A 4CQLB 3BMQB 4PLYA 5CDYA 4L4XA 1MXHA 2X6TA 4BNFA 5JO0A 1SZJG 1ULUA 2J8ZA 4KZPA 5I7VA 3L6OO 1I2ZA 2YYYA 1EBFA 1GUFA 3DZBA 5IDQA 4XYBA 2FZWA 1X15A 3HWRA 5G0TA 4CLOB 1AE1A 5IG2A 2JJYA 1ADBA 3AI1A 3A28A 3BA1A 2VHVA 4LMPA 1QYDA 4DRYA 2NWQA 3WGOA 2YDXA 2FN7A 5KJFA 2AEJA 2RH8A 3ROPA 4D3DA 2GZ2A 3GT0A 1Q7CA 3BHIA 1GYRA 4YJHB 4CQMB 2Q1TA 4XYGA 1Q7BA 3FSRA 3O8QB 4EI2A 3GPDG 4CLXA 1LSUA 3NTQA 4ZQFA 1ENPA 3P5SA 5EPOA 5TT1A 4RGBA 1DC4A 1BDMA 1ZMOA 2HMUA 1WP4A 4NU5A 3P2OA 4I5GA 3BTVA 3K30A 4DMMA 2O4UX 2NTNA 3D4PA 3NGXA 3N74A 2YV1A 1UDAA 1O5IA 3LC7O 4CPDA 4A27A 4RQTA 4DC1A 3JQGA 2EEZA 2WE8A 2B4TO 2VZ9A 4F46A 3ZU3A 1NQOA 3ULKA 4RPKA 5L3ZA 1QORA 2AG8A 3I4CA 3E1KA 2VWGA 3JYPA 3Q3CA 4DREA 2YQ4A 3C1TA 3K96A 5TS3A 5KOIA 2CSUA 3GF4A 3AM4A 3LDHA 3U4DA 4ALLA 4DC0A 1NASA 1YE3A 2BF7A 1QLHA 2R6JA 3AOEA 1J5PA 1NBOA 3GK3A 3HN2A 4DIBA 2IYOA 5FFFA 4DLLA 5JAMA 2PKRA 3MJTA 2Q2QA 2Y0EA 3IUSA 1J4AA 3PWKA 4WCFA 1ZSYA 3IC5A 4D45A 4YDRA 1YS4A 5F5NA 4OYRA 3U3XA 3WB9A 3MJ4A 1N7HA 3HADA 4J9VA 1K89A 2GGSA 4IPTA 3I9KA 4TVOA 3WTBA 2FR0A 1Y1PA 2EJVA 4HKTA 3CE6A 2DT5A 4GSKA 3H9GA 3LT2A 1EQ2A 2A9FA 2Q4BA 3KEQA 4HNGA 3KYDA 4QX6A 2NVBA 3VAZA 1ADCA 2GERA 1Z7EA 1HT0A 2BFPA 3ANMA 1KEWA 3OQ6A 2EW2A 1NQ5A 1B0AA 4E2YA 2FRDA 4XYLA 3R3SA 3DFUA 2IRWA 4Y6PA 3BMOB 3ICCA 2CUKA 3JYNA 4NG5A 2Y93A 3JV7A 1EFKA 1ISJA 3DOOA 3PK0A 4BHTA 4RF2A 2B5VA 5L7WA 2BI8A 5COAA 3WBFA 4B3HA 3OEWA 1NR7A 4YBZA 5F1KA 5JYDA 2W2KA 1ZSVA 2IXBA 3PDJA 4TRNA 4XJSA 3KSZO 1MG5A 3SXPA 4J91A 5C7IO 4YT2A 4QSMA 4QXMA 1DAOA 1FDUA 3QLJA 4IGFA 4KDFA 2D1YA 3AUTA 3U09A 2VZ8A 1NVGA 4J49A 3WYEA 4BV9A 1HLDA 4J7CA 4RVSA 3UUWA 2P9EA 4MIEA 5JNLA 4JJFA 4D79A 4LVUA 4G81A 4IZHA 4L75A 3WNQA 4NBVA 4XA8A 3I9OA 4M86A 4PRKA 3NDIA 4P4NA 2VNAA 4J1SA 3ORFA 1I36A 1E3IA 3TOXA 5KNLA 3MWDB 4FOOA 2WM3A 5G0SA 3GVXA 3O8QA 3S2FA 4CR7A 4DMLA 1T2DA 2V6MA 3ZV6A 5C3MA 1GQQA 3OIFA 2NV6A 1D4FA 3F4LA 5DCYA 2OORA 1OFGA 1SOWA 2VT3A 4AJ1A 2Q99A 3OJEA 5I8WA 9LDTA 1KVTA 4RQUA 3WYCA 7ADHA 4IQ0A 3HN7A 5I9LA 2CDBA 2G1UA 2Q50A 1LA2A 2Y0CA 1B26A 4IXWA 4W4TA 3WX0A 1PGQA 1RPNA 2R00C 1A4IA 4CMKA 4J0FA 1QMGA 2Y67A 2NU8A 3EVTA 3FI9A 1BMDA 3LF2A 4J1QA 2VYNA 2YUTA 5FYDA 3X2FA 2EP5A 2Y1EA 3W8EA 2OL4A 4BMNA 4MKZA 4BKRA 4R1SA 4CM6A 2O3UA 1X7GA 1IOLA 2FWMX 5DULA 2VHWA 3RUFA 1LSJA 1D8AA 1KOLA 2PGLA 4OXYA 1LRLA 1A9YA 1XHLA 4FFRA 4RPGA 3AFNA 4BO0A 2C59A 4RLSA 4F45A 1CRWG 4Y8VA 1K5HA 5JC1A 1N7GA 4XD2A 3U62A 1I10A 3E5RA 2P5YA 1ZK3A 4CUKA 5BSHA 1E0DA 3GGOA 5KVVA 1F06A 1WWKA 4M55A 3RJ5A 1Y81A 4LVCA 3SJ7A 1EK6A 1KEVA 4UVHA 3IJRA 3PEFA 1U8XX 2DVMA 3IAHA 1V3TA 1MGOA 3N7UA 2Q46A 4NJMB 2X9GA 3C7CB 5AXBA 5FEUA 4CLDA 2OMEA 2X23A 1NM5A 4J4BA 2X0RA 4OKIA 4Q3DA 5JCJA 1B7GO 1E6WA 3WGGA 2QZ9A 3K92A 3DFZA 2NVUB 4CMEC 2I67A 5ES3A 2BELA 1KYQA 2AG5A 3GH3A 3I5MA 2EG9A 3OHSX 1CQJA 2QYTA 3E6AA 3WLEA 5JAZA 1EVIA 4BNMA 1GZ3A 4MVJI 1PZEA 2DBQA 3U49A 5I7SA 4ROSA 3E82A 3GZ4A 4K6FA 2CNBA 3W1VA 5IZ4A 1GY8A 4FIZA 4JK3A 3D0OA 2ZATA 1F8FA 1AHIA 1LQTA 3OIGA 1YKFA 1T24A 2PK3A 2H1SA 2QHXA 1M67A 4L4SA 4DWVA 1R0LA 3WG9A 1DEHA 3IKTA 3GG2A 4BMSA 3L6DA 4BNIA 4OO3A 4B3JA 4AJPA 4B7CA 4BQRA 4CMIA 2BGMA 4AJIA 1JWBB 4B4WA 4CV2A 4BO8A 2CY0A 3DL2A 3F5SA 3S2GA 4GVLA 4GX2A 2CF5A 3NX4A 2PGDA 3NV9A 5A1TA 2IZ0A 2VRCD 1NPYA 4I1IA 2GR9A 1NP3A 2W4QA 5FF9A 1B3RA 4BNKA 2PTGA 4IJKA 4CLHA 4GKVA 3DMTC 1UP6A 5JY6A 2B5WA 1MUUA 1P31A 1ISHA 4GPD1 4CMBA 4IMRA 4NFHA 3CSDA 5TF4A 2DLDA 3L4SO 4YAKA 3MTGA 1SMKA 4HY3A 1HSOA 4K9DA 2H9IA 5CPBA 4RVDA 2J5RA 3FNFA 4R1TA 1E7RA 4PZDA 3QA9A 4HUJA 3DXFA 4WCFB 3B1KA 3E9QA 3M2TA 5U1PA 1H9AA 3VKUA 3Q9NA 3F6YA 4M49A 4HXYA 3UOGA 1CDOA 3BTUA 5EQDA 5FI5A 5F1OA 3IOYA 4LCEA 2BLLA 4MOWA 2WYWA 1E7MA 3E03A 3JYOA 2BRUA 3PGXA 1PS9A 1QXSA 1BGVA 1ZK2A 1E5QA 4CM5A 5A04A 3KSUA 2GN9A 3Q6IA 2AQ8A 4NFSA 5EQFA 4O59O 5L45A 4GAEA 4Z0HO 4BNLA 5AXDA 4E6PA 1C0KA 3A14A 3GAZA 4GWKA 4W9NA 4MKXA 2G82A 2RBEA 3BMCA 1UJMA 4FW8A 4I5DA 1NX6A 3TN7A 3EY4A 2XXJA 1A71A 2VYND 3ZNPA 4M1QA 2V6FA 3ETEA 3EZLA 5JMWA 3EDMA 5JPIA 1A7AA 3ZWCA 4NZ9A 3G3EA 3AWDA 5GZ1A 4J7XA 3KOUA 1XU9A 2POQX 4UEKA 3RAJA 1UXHA 4XYEA 2B35A 3JQ9C 3LZ6A 3RUCA 3KUXA 2WTBA 3PWZA 1NFRA 3QSGA 3QE3A 1GU7A 3GZNA 3ZNOA 1CQIA 1M76A 2NTJA 5CAEA 3VVCA 4URFA 5T64A 3S2EA 3WQSB 3VPSA 2VZ0A 3KB6A 1O95A 2EF1A 3BYZA 4N5LA 3ON5A 3ANLA 5EIOA 5BT9A 3OQBA 3B70A 5JMPA 2Y1GA 3TDKA 2GASA 4Y6SA 3AU8A 4YT5A 2DUUA 3DOJA 3FNHA 4I08A 1HSZA 3ABIA 1FMCA 3PQFA 3I9MA 4IY1A 3U0BA 1T2CA 1L7EA 1QYWA 2E4AA 4FJ2A 5F21A 5MGBA 5JDCC 3GY0A 3JQGB 3PYMA 4XX0A 3BMCB 1T4BA 2Y05A 1R0KA 2BGKA 4O1MA 1QKIA 3H2ZA 4FGWA 3RKUA 1ADGA 3KLPX 4DPLA 3H6KA 5IFLA 1BW9A 2Y66A 3O26A 5JCJD 3GQVA 3O03A 4LCJA 1G6KA 3LLVA 1LDGA 2QIOA 3AY3A 4JGBA 4QFDA 1GD1O 1P0CA 1VKOA 3STHA 1AGNA 1KC1A 3N58A 4N5MA 1TB4A 2A35A 2ZTMA 2QG4A 3D4NA 4D3SA 5IN5A 2E49A 1Y9AA 3C7DB 5JDCA 2B0JA 4UVEA 1P1IA 5JAQA 1PJ3A 3PI7A 3JQBA 2BHLA 3FRJA 4F6CA 1LRKA 1JKJA 3H3FA 1IZ9A 4GLOA 1H94A 2Y1OA 3JQAD 3NTRA 4Q3NA 4A26A 2I65A 1YL7A 4FS3A 4ONEA 4IDEA 1ZXLA 1FDWA 3X2EA 4BGIA 5KJCA 4E33A 2AEFA 1FK8A 3VKVA 1AHHA 1LDBA 2G5CA 3Q11A 1U28A 3MZ0A 1WVGA 2VYVD 1U4SA 3WYBA 4P8RA 3ITDA 1IHYA 1FDVA 1YB5A 3T4EA 3AM3A 4DXHA 1JAYA 1DFGA 4IQ8A 4DLBA 1HXHA 3QWFA 4KDEA 2D4AA 3JD0A 4PZEA 1GADO 3VVBA 1T1RA 5DOZA 1WXDA 3GN2A 4YAGA 3NTOA 4GGPA 5JAIA 4ZQEA 3FWZA 4KQWA 4J16A 3TQHA 4C4OA 4CM9A 3FNEA 5LDGA 3WQQA 4L9RA 1XEAA 3F1LA 4GX0A 2SCUA 4W6ZA 4LW8A 3R1IA 1A4UA 1ENZA 1P1JA 3GVIA 1KS9A 4Q39A 2AMFA 2NU9A 5CDSA 2WMDA 4FFNA 1HZZA 1E92A 1BG6A 2H6EA 4WCDA 1P1KA 4D46A 1RM0A 4UEOA 1P45A 3F1KA 1L7DA 3EVNA 1ULSA 1B8PA 5THQA 3UAGA 2X0JA 1LLCA 4CM8B 3LT0A 4ALIA 3DHEA 3LK7A 3TFQA 4ZN6A 4BQPA 1I3LA 5A5FA 4RVHA 4UUOA 1JLLA 1PJLA 2O3QA 4WLOA 3DBVO 4ILKA 3ONFA 5L9AA 3ROKA 1TEHA 3ZDFA 1ZMTA 3JQEA 4GX5A 3HSKA 2I5PO 3KXDA 3L6EA 3PYXA 3QHAA 2JAPA 4R1NA 3ETDA 3ZWYA 3GDGA 1VM6A 3WGYA 1GR0A 2JL1A 2X86A 3UW3A 4PG7A 5EESA 5HS6A 2NU7A 4FD3A 4LISA 2IEBA 4OSPA 1U4OA 3VPGA 1GDHA 1XG5A 4KMSA 3V5NA 1E7QA 3VZPA 1LLUA 2EIHA 2B4QA 4HFMA 4YA6A 2PKQP 3TZQA 3GHYA 3W8FA 3PWSA 1LX6A 4E21A 1ZJYA 1ZK4A 5TLSA 1ZUD1 2I66A 3A06A 1DFIA 1MV8A 1X14A
chains in the Genus database with same CATH superfamily
4JEMA 3CF2A 3NU1A 5JQGF 5C7YA 2NUAB 4EGQA 1RABA 1LBQA 1RHRA 5BURA 1HL3A 5JISA 2R47A 2HRRA 2R60A 2D1TA 1RP1A 2JBAB 3FWNA 2ILTA 3NI2A 2ZE6A 4E5KA 3EY9A 3N28A 1IIRA 1SY7A 4Q82A 1G8PA 1SXJA 3E5NA 3FTPA 3PUZA 3AR2A 4MNTA 1A76A 3C3WA 3ZLUA 1AF4A 4F71A 1A9PA 2CKMA 2VL7A 2ZJFA 3T38A 5F4BA 1YC5A 2WJPA 4JCOA 1ILEA 5JYEA 3DYVA 3T1TA 1W93A 2RGDA 2YBEA 4PGHA 3IQXA 4D0SA 5JQWA 2YWRA 3L84A 1UUFA 4KE6A 3WGTA 2EKPA 4BNUA 2EZTA 2OCYC 5K0NA 1FDIA 3FTDA 3ICEA 1MAHA 4LKRA 1WXIA 1OWOA 4QUIA 1ZHOA 3I04M 5TJHA 4ISCA 3ZZNA 2ATCA 4I5IA 2I29A 2D0IA 4NE9A 4YAWA 2QRUA 1ISIA 4OLFA 2ZRNA 3NHFA 5JVDB 1OMOA 4XRGA 3AHDA 4DB2A 3W9UA 4LRSB 5THKA 1RXYA 4ZALA 5CB6A 3GDWA 3DEKA 4CNQA 4EFLA 3EQ2A 2PS0A 2R7AA 4D92A 3KXKA 1DIAA 1E2QA 2VDWA 3EXG1 4L9SA 3QV1A 1P6QA 4UBJA 4G4JA 2BUBA 2MR5A 4AQYB 1P5JA 3TZ6A 1CQWA 2Y1LA 4DYVA 4QG3A 3LYHA 3ZLTA 2X1HA 4Y2PA 1NJSA 3SYTA 1WZEA 4OOFA 1GIAA 1X6VA 1GA6A 4FZVA 2ET6A 4EZEA 3OCUA 3EGIA 2HIAA 3M5WA 4AWXA 5K8TA 2R6FA 3T9CA 3K1ZA 3PPYA 4I1SA 1JDJA 5A0VA 5IF3A 5IC6A 1RLTA 1YAHA 4ZYVA 2HO5A 1C4XA 1CNEA 1XZQA 2CBXA 2RAFA 2JI8A 3CHYA 3D7KA 1U2DC 3HACA 1A9XA 2A1IA 2I4NA 5LBIA 2W0MA 1R4NB 1KXJA 3GFGA 1W87A 2DWPA 3MXTA 4FYKA 4EQ6B 5FO0A 3RTGA 3AFHA 4NK5A 1CS0A 4R1PA 5AUOB 1CY4A 2AX3A 3MILA 1J21A 1NPDA 2YIDA 3SMVA 5JLAA 5FRDA 4KXYA 3HPQA 3F3SA 5COQA 2PZ8A 4JC0A 4TSFD 5JFTA 1ZN2A 4QQFA 2PSFA 1K6EA 2B8JA 1BE8A 2PR7A 1T35A 3IQGX 3LNTA 2XUZA 4HS4A 1A7UA 4L2IB 1M2NA 2YH2A 2OGSA 2X15A 3ES9A 4I9NA 3A05A 5K6RA 2HHHB 2X2OA 2OZPA 4Q3LA 4MITA 1OVMA 4OJTA 3AF1A 3RV3A 3THRA 2ZI4A 4R8MA 3OM8A 4IXNA 3LUGA 4WDRA 3L05A 1BWPA 1QF9A 4I1YA 3K8ZA 5T8KC 1OGIA 2GAJA 4DW8A 4OEHA 4TLDA 3D4OA 1C7IA 1MX5A 1QB7A 1VECA 2H5IA 1KIMA 2I34A 3R44A 1UWCA 4HDKA 5H16A 1RPAA 4R2WA 3B3QA 1OJLA 2MYNA 4ADSG 2PZFA 4ZD6A 3RROA 4ZJZA 1FYXA 4BZXA 3RUDA 1P8JA 1UXOA 1YU6A 2C2KA 3RKRA 2XY4A 2F00A 5BSGA 3HU2A 5IVIA 1GZVA 1JYSA 3RVKA 2D1RA 2O0MA 1RT9A 3M6WA 5EHNA 3RI3A 3T94A 2ZJ6A 3ZEAA 5DNUA 1H1TA 2PTHA 4BATA 4ZCMA 1QS0B 5ARBA 2FX5A 2GCNA 4XYMA 3KWLA 1DG3A 3MB8A 2YRWA 1XMJA 4MPDA 4NPAA 4TKMA 1R8YA 2IXFA 3D2LA 5EJIA 5A4IS 2PZAA 2QRQA 4LHYA 2XCRB 4YRAA 3RRFA 4GL4A 5KYYA 2JLUA 2J5QA 1ZNWA 2C2MA 2UUCB 3B7WA 3QEMA 3WWEA 4WN9A 1YZYA 1N9KA 1W5BA 3I6MA 1IXYA 1HYBA 4C88A 2WSSD 4D5GA 2XNDD 1A27A 1BWRA 1GGHA 2XPCA 1SH7A 3OJWA 4EATA 1XZPA 1ENYA 1YVDA 3NM4A 1TYBE 3UC5A 4RVNA 4XRRA 1DC7A 2NZUG 3GLIB 1FFWA 2ZTUA 3VR5H 5ENVA 1UZMA 4OGWA 5KB3A 4B5LA 4YJDA 3ZJUA 4C3ZA 2GAOA 2OR3A 1FRVA 2D5CA 3EXHB 1QHEA 4ZEVA 3D6TB 3UBTA 4AZSA 4DUZB 3NHAA 3G0GA 3MGAA 1IYZA 3TRDA 5ED0A 1H2ZA 3U7EB 1J06A 3LGAA 1HY3A 3G5MA 5JH7A 2FPUA 2R96A 4YJFB 3X1XA 1KOGA 4NS1A 3WQRA 3G2LA 2ZREA 3D8TA 1E7SA 3DEFA 2YINC 3FNQA 2H4JA 5JRDS 3G8BA 1E1RA 5A0FA 3F97A 3M6MD 5AXAA 3X1WA 4OGGA 5JANA 1I13A 1FMJA 3C6BA 4AJHA 4A8TA 1G9TA 2C03A 2O8DB 4G24A 2VC2B 2E5WA 2I78A 5JSFA 3WK7A 1YZQA 4TMXA 5ALRA 1R4MA 4HV4A 1MHPA 2R6GA 4YRKA 1UQUA 3ND5A 4LZJA 5DM2A 4OLBA 2OBFA 2I80A 3PTLA 3B2EA 4GS5A 4X90A 1TM3E 1DRKA 1B2LA 3D31A 3IPLA 2JI7A 3WA6A 5A03A 5LUAA 2LPMA 4D8XA 4CEJB 4HWSA 2HH9A 2CYAA 3O1IC 2GWRA 1FMTA 4KO2S 2LCQA 4DIKA 4EVQA 1RAEA 2V58A 1LK5A 2Z1NA 3L9WA 3NASA 3KEOA 4JT2A 4M22A 3ZK9A 1CEQA 1TLTA 2PL3A 2D0OB 4G0VA 2CJFA 2HRDA 2J5BA 2AV6A 2HBYA 2Y0DA 5AHOA 2Q0QA 5HMLA 4FGKA 3C3CA 1SG9A 4AMGA 1N4DA 1UBFA 3QEBZ 2IUYA 4GC9A 1F0NA 1MIOA 1NUAA 4EAQA 1E8DA 3KB1A 2Z58A 4DEVA 4QM7A 5CIWA 5LU9A 10MHA 5FWXB 2YJ3A 3IDQA 3K0EA 5DU2A 5EE0A 1JEDA 3SXUA 4QC2A 3PTAA 4GBJA 2BP7B 3LQ2A 2R4QA 4EFKA 5AUQA 1UAAA 1CKEA 3VO9A 4FR5A 5CT4A 1CRZA 3N7AA 3LZCA 4HBGA 2NXEA 4GW3A 4LF4B 1T34A 3WYFA 1E1DA 2C2HA 1WG8A 4ER6A 3LHDA 2VLIA 1NMQA 2EL9A 5JAUA 4OP1A 3AUYA 1HTWA 1MORA 4O1IA 2ZOSA 2H7YA 3UYKA 1RQRA 2NPIA 2B8NA 3I39X 5J9FA 4D44A 2COEA 5IMSA 1N6NA 4DN6A 5KKCA 3IPAA 4HZUB 5AHRA 1RYYA 1RJEA 3BWYA 1M6VA 1MEJA 3HR7A 4LF9B 3L0IB 5GIOE 2ZUDA 2F1IA 2Y27A 1Z38A 4KHPB 5EZ5A 1QYRA 1APBA 3VI3B 3NP9A 4I4TB 4ZOLA 1A88A 3A9WA 3GT3A 1HR0B 2I55A 4NULA 3CN9A 1ODKA 5JSKA 3RSHA 1VE9A 2AQKA 4HGNA 3UV3A 4BU1A 1T0HB 4UTVA 5KYXA 1IK4A 2DETA 4MUJA 2QIPA 1WY7A 4A8JC 4AJ2A 4E70A 4K0KB 1YE5A 4LJKA 4FMDF 3MJVA 3SC6A 3FTFA 4LZPA 5ALGA 1OLSA 2GEVA 5BR7A 3D6FA 3HE3A 2PBRA 3UJHA 1GTJ1 4GBMA 3K1JA 2AE1A 2WNIA 5KQGA 4IIHA 3U7FB 2IUTA 1F20A 4TTSA 5G0WA 3I8XA 4XVHA 3OETA 1X1QA 1WBDA 1MJGA 4DLUA 5F23A 4CMEA 2ZWIA 3LPAA 1ZK0A 5HBGA 1JFRA 2H1IA 1DOHA 4ZRMA 3ZHOA 3C7AA 1VSUA 1H8HA 1G8SA 2QQ5A 3CNBA 4V24A 1G3QA 2FVXA 3CXRA 2NO6A 3EXIA 4R9VA 5FTMA 1KP3A 2NU8B 1RTTA 4BCBA 1BX0A 3HDGA 2CNOA 2W7TA 3GPCA 1GGMA 1BO6A 3F3YA 4WTOA 4CDGA 1L4YA 5T3UA 4IIUA 3RWMB 3NATA 1I2MA 2F9LA 1MC1A 4NABA 2REOA 4FDMA 1I2AA 4BUJA 3L7JA 1WDLA 2WU4A 4GKKB 1KK2A 4E12A 3PVSA 1LSSA 1FRFS 3Q3VA 2VNSA 3BFPA 4Y0AA 2QN1A 3C5VA 4MYCA 2OAGA 2DH6A 1IPFA 4R69A 3EIEA 3U3MA 5G1NA 4FFVA 1DZIA 1KEZA 2DXIA 1W94A 3F6PA 2WIAA 3I2YX 4KNVA 1GQOA 5FQNA 3ZI4A 1T3TA 2D1SA 1ZM2A 2FX3A 5C3UA 1M1NA 1V4NA 2XAUA 3V1TC 3FF4A 1MT3A 2WJVA 3QJYA 5EP2A 1Y7IA 3T3GA 5A06A 4EEKA 4FUQA 5K0SA 3T0IA 3OH8A 1CY7A 4YHBA 2PD4A 5J4HA 4WNIA 4RLFA 2AR9A 1LPAB 1A77A 4DZRA 4E07A 1EXDA 1NN5A 2JIRA 3FYUA 4L9AA 3TNFA 5IAJA 4G01B 3HN6A 2YXEA 4WH0A 4CI9A 2QMQA 4UM8B 1U2SA 3LC2O 1HEIA 2IUEA 1LXCA 4F97A 2WIJA 1V2HE 2BUAA 1B1AA 3L0DA 4FMCB 1HX7A 4B79A 1SD2A 2AFHB 2BFDB 1XEXB 1COZA 1OI7A 1SCUB 4EG7A 2FU5C 4P3KA 2F62A 4XWWA 1RRKA 3MQ2A 4YDSA 4LJAA 4MKRA 2Z1DA 1TZ2A 2ASEA 1W85B 3A31A 1PYGA 1ABBA 2CVFA 4ZU6X 3MTAA 2HUPA 1KY2A 3ACDA 5FFMA 5AUPB 1RJWA 1UBKS 1DOAA 4RZIA 1VIMA 2XMRA 4NJOA 4Y7DA 5ALDA 3PPVA 4KR3A 1LEHA 2HR1A 4TQAA 1LFDB 4UJ5A 3JQQA 3I52A 5ADUS 2JGDA 4HDNB 1XI2A 4FR2A 1G20E 3MT7A 4B44A 4DNQA 1KAHA 1EGVB 1YONA 4RK4A 3HUFA 1X1CA 3I30X 3CUYA 5IBRA 1RWBA 4K05A 1C2YA 4DCMA 5CVUA 4HAVA 1PLKA 2I03A 3QX8A 1J7KA 1TLFA 3G9XA 4E88A 4B32A 2VP9A 2FFQA 2Q1SA 2WAAA 4HDNA 2W71A 4IFBA 3VZRA 1C8BA 2EQ5A 1X1DA 4I4CA 2AT1A 3H9QA 1G2OA 3K2QA 3C39A 1LQUA 3VDNB 4RDIA 2GPTA 3LDAA 2C2WA 1UP7A 4IDBA 1BJTA 4LHSA 5LXTF 1OX4B 2E4VA 1OU0A 5HKAA 3P4UA 1K3UB 2E7ZA 3AJRA 1ESEA 2N47A 2QB5A 1QHYA 1R0RE 3DNFA 3NVAA 3HL4A 1AMOA 1J23A 4MICA 4CF6A 1UBOS 2HM7A 1B8UA 1ZC4A 3AHCA 3CZQA 1NVEA 1UFQA 3H2YA 4EHAA 4MJ7A 3GT4A 1T0BA 1T2VA 3D2BA 5CGZA 3Q9LA 4GOKA 4HNQA 2IHVA 2BGIA 4AJEA 3OPQA 2GF2A 4KXMA 1E6CA 4EG5A 1J8FA 2OZVA 4Y6QA 2MSWA 2F55A 1UOEA 2EJTA 3UJNA 2OLKA 3LBNA 3HKEB 1ZDMA 4OFWA 5AKLA 4QVGA 2Z3WA 2PSEA 3I28A 4JLWA 5JS6A 1QK5A 4YCDA 4TYWA 4Q1DA 1GZ7A 2DOKA 2JLVA 4DJEC 1L9XA 3C8UA 3BA6A 3GO4A 3DW1X 3OSUA 3N3AC 5JXWA 2X8LA 4NYJQ 1QNFA 4V03A 1GITA 1JFLA 2CXXA 1XCGB 3F47A 3DZHA 4XCVA 4KOEC 3ZUPA 4C4TA 4F38A 2HSWA 2BN4A 2IOHA 2WIKA 2QMUA 1VMDA 4FJ1A 1C0EA 5GY7A 3VU3A 1RLOA 3ZJTA 2QLBA 3PBKA 3DV0B 1K66A 2WJHA 3PRYA 4UE6A 3X43A 2WTUA 1JA9A 3EN0A 5FXMA 4AP5A 2AUMA 5FPKA 2JKYA 4URWR 5AJWA 3VH3A 3QPCA 1W1WA 1WHTA 4MPPA 1PZMA 2C5HA 4AMUA 3RRYA 4LQ4A 3I05A 2IYQA 5K0LA 4X91A 2VJYA 4ZQBA 2O8BA 1ZXBA 3RU9A 1EXMA 4WX2B 2V9ZA 2C82A 3C41J 5DTMA 3WLLA 4PLTA 4UM5A 4UM9D 2ZK7A 3DDNA 3IQWA 1EYZA 1Z75A 1XTBA 4IVRA 1ZIPA 2VJDA 4BN4A 2I9PA 4N8DA 5CB8A 3UOAB 4CMIB 3KYCB 3IOBA 3H8WA 3Q5EA 4IIJF 2IKQA 3WIUA 9GPBA 2O8BB 3WC4A 3HDTA 2P9GA 2FCAA 4QATA 3GDHA 1I7QB 2IW3A 5AI8A 3KAPA 1KRHA 1U0RA 3LWDA 5CNJA 1UM9B 1Z83A 2H7CA 4XSHA 4DQLA 4E2WA 5BN1A 1PZNA 4IRUB 5FWNA 5LQCA 5IWAB 2ZDHA 1DAPA 2XW6A 3PICA 4W5NA 1U8FO 2BV3A 2UDPA 2V0NA 1VRWA 5FBQB 4BZPA 3CIFA 1CBUA 3I0NA 3TM5A 3GZTB 3ZTTA 3ZHVA 3NIWA 2B30A 2O2YA 2P4HX 3ND6A 4NCKA 1RCFA 1ZINA 1YK0A 2LD4A 1XMQB 1V43A 2HMSA 2ZLBA 3GJQA 4ZCRA 2BCEA 3CEHA 4HH4A 4X8MA 1NMXA 5BYBA 3U7RA 4YJ2A 1N5RA 2LDBA 2HY7A 2CCKA 4FMDB 1IHDA 3I9NA 4DSAA 1Q57A 4RJTA 2R6CA 3VR6D 2HV8A 1ZJ6A 3RVBA 1IBSA 5BRJA 4YWJA 1FMFA 2JFHA 4M9UA 4GX1A 2CNNA 1R37A 3HFGA 3ZBPA 1AZSC 2XWPA 1PBNA 5D1NA 1OWPA 3DMFA 4QPNA 3I4FA 3OJFA 4YLYA 4BVEA 4BJHB 2D4HA 2PY6A 2QM3A 4M1WA 4UM7A 1VE6A 1ZWLA 1Z4MA 4YCAA 1T91A 4I9UA 3ZWMA 4BBJA 4IVNA 2HQSA 5IDXA 1OBFO 4ENQA 2VTBA 1T6XA 2OGUA 3CZ5A 3NORA 1AKVA 1JHXA 3G0HA 4O6VA 4OHPA 4V2IA 4D96A 3NEJA 1HE2A 4JI4B 5CPFA 2HUNA 2EFYA 4G9BA 4R6XA 1BTOA 4QAQA 3H83A 4D3FA 2ZTHA 4H3VA 1TZJA 2FN8A 2X40A 5LZ4A 4EG1A 1D2HA 3LT1A 4DQVA 2DJIA 3KV3O 4P58A 2GN8A 2G67A 3T7EA 3BPSA 3WKDA 3RFFA 4RVUA 5LNK1 1JYFA 1Z33A 4OHFA 1PJ2A 5K0TA 3T99A 3EZFA 3FCXA 4FX2A 3KLNA 4PLCA 4AZ3B 4RF4A 1PR9A 2GEFA 3IT2A 3VTZA 1ZGZA 4CMGA 1VJRA 2PGOA 3L8CA 3H0CA 3FPJA 4WGFA 3AHHA 2YICA 2ZJ7A 4KJZA 4AF7A 3AIOA 3KT3A 3HB0A 3HRIA 2QYSA 4L02A 3RRNA 4DVJA 4M53A 3WJ7A 5A05A 3L0SA 1RAHA 2A94A 3K73O 3B1XA 4KEAA 1Y80A 2PFKA 2O20A 3IAS1 2LCFA 2OKCA 4PANA 4Z7OB 2Q8PA 5KJ1A 4UOQA 4X6LA 4Y30A 4M6WB 2IXEA 4HB4A 1IB0A 3HHPA 3LGSA 1XELA 4DXDA 1LS6A 1ZK1A 5E6UB 5K9ZA 1IOVA 1T2EA 3OQVA 5DP1A 1YIDA 4FFDA 1H1DA 4MIKA 1WNTA 5BO5A 2J6IA 4JI5B 2B1QA 1WTAA 3W7AA 1U2RA 1OB5A 1KNXA 1NRIA 1T3LA 4DJAA 4J9UE 5C35A 4OHRA 3HTXA 1TQ2A 4V1CB 3EGXB 3X1MA 4FGUA 4F4JA 4MYUA 4TZTA 4B7AA 1WDWB 2X4LA 1T36A 3PYLA 2OUKA 4LRTB 1ZH4A 3WGQA 4BJ1A 1SCKA 4RHXA 5CDGA 3SC3A 2ZYWX 1YRWA 2P9TA 3TLYA 3FYCA 1ZOIA 3TKLA 3MOIA 2PMDA 1KKUA 2OEPA 1UBUS 4MVJM 2IA5A 2V7GA 3HJHA 1ULBA 4KO3S 4ABYA 2OVBA 4M36A 5BT8A 4F9FA 1Z17A 1HQCA 3DTYA 3H5LA 3R4VA 4PFSA 5E1OA 5FUMA 1N0UA 3R4CA 1N6PA 5HF9A 1DAEA 1F2DA 4DR2B 3GIDA 2YN0A 4KPFC 3K5PA 1TC1A 1EEXB 1ONSA 1U3GA 2N46A 4BNTA 1XTZA 2DPHA 1KZGB 1WS6A 2O2GA 2WNHA 1D0SA 1L5YA 1Z0FA 3DT8A 3H65A 3NAZA 4H59A 3D8HA 4D97A 2BJVA 4RIIA 1KL7A 3ICOA 2VXOA 4CYMA 3KXIA 4X7RA 5HFJA 5KYWB 3GLFA 1JVBA 3U48A 1WB9A 3HLTA 4P7KA 5KTKA 3OOJA 2C2BA 3AIKA 1A4XA 3MLAA 3QBJA 1L4HA 1SHJA 4KBFA 1TUIA 2RH9B 3QVWA 4L5JA 3I2JA 4B3CA 3KV1A 2EWWA 3ER8A 3WL7A 1G42A 1D04A 3L40A 2ZVPX 3P19A 4HLUC 2O5EA 2Z2YA 2QQEA 2EKQA 3AY6A 4L4ZA 2VK4A 1FP7A 1SUCA 1KYXA 1VYUA 1SD1A 2ANCA 3LUJA 4YMWA 2CVOA 1DTWA 3GCDA 3NGLA 3NHWA 4EG8A 1QV9A 3IX7A 4J1TA 1PF7E 2NQ8A 3O8LA 4Y6OA 5EPUA 4AD8A 4NDZA 1GFIA 3FIUA 1VJTA 2EP7A 2OC4A 4TSKA 3K0AA 3N05A 3OAAA 2ZJ2A 3TR0A 3WMGA 5DX0A 2YN4A 3OEEA 1H5UA 3GWZA 3RYIA 2IGTA 3AUFA 1B41A 1V3QE 1OI2A 5FOXA 5GM2A 1HM5A 4YALA 2C0PA 1TJ4A 3CG0A 2XXAB 4LJ9A 2JZCA 3JX9A 1GN9A 4PZLA 1GLGA 2J3JA 3AUJB 2XD9A 3L01A 3PKJA 4NVRA 1RJDA 3Q6MA 4W99A 4NYJR 4JUCA 5B58T 2HYDA 4EITA 5CDUA 5EGSA 5AVXA 1H8ED 3UXYA 4WXRA 3UPDA 3DVRX 3P2YA 4ZVNA 4B3FX 5JY1A 2YJNA 5JWHA 2Q41A 1UBLS 3SEQA 4KQ9A 2X0KA 3H4IA 1DPFA 1OD6A 1YZTA 4BQNA 2ZW9A 3E2MA 4DY6A 5ILOA 1NHGA 2IQIA 2GK7A 1KH3A 3R5FA 1VFNA 4K9MA 3LS2A 4DFDA 4G0NA 2AG1A 5F9MA 4BNYA 2QW8A 1VL8A 5JH7F 1T1GA 4LXYA 5H81A 2CL0X 3TSCA 1G59A 3GC6A 3IH5A 1NSTA 3KHKA 2CHQA 2ZIEA 5B1YA 5HNKA 1PX0A 4HMQA 1LK0A 2IE0A 3PC8A 1EHYA 2C9ZA 1UJ5A 5AVZA 1LPOA 4LGMA 1ZR4A 3IBFA 4M0FA 3ROFA 1AS0A 2ZRCA 1I7NA 1EE9A 3AIMA 2BI7A 3M3HA 4LRWA 1TVKB 3DBOB 4U2EA 5ESXA 3T34A 4C7VA 4I50F 2D3TA 4AI6A 5DLDA 1D2GA 1TKCA 1OFTA 1XJWA 1LNZA 1YL5A 1OTHA 1WMDA 1WX1A 3GQBA 3WQBA 2V59A 4MI9A 4TWAA 3SHQA 5BSTA 3K09A 1GTSA 4QLAA 1UMBB 4N3NA 1TA0A 5T8KA 3FA2A 5E4TA 2QAGC 4JP2A 4MQEA 3T61A 1PWHA 3FTQA 3PKIA 8LDHA 4GF5A 7YASA 1ZN8A 4MVWA 2XIQA 2WJ3A 1L5HA 2CN1A 2H8KA 3CMMA 3OE4A 3H1GA 1A04A 1N2XA 4OJYA 4HNHA 3FUXA 5ADHA 1A8QA 1TZCA 4KB5A 2HK8A 3TTXA 1FFGA 1TE2A 3SZGA 1V6CA 4DA0A 5A4JA 2RKWA 2Z5VA 3D3NA 1PN3A 4X41A 1Z6QA 4N0QA 4GKBA 4CQLA 3H5RA 4FKZA 1ICEA 2ENWA 3C7KA 5CXSA 4EG0A 3A4NA 3C4VA 3G9TA 4GKAA 1P1CA 1V37A 2XODA 3LAWA 4WEOA 4FYJA 1QBGA 4ECAA 5LKRA 2ZBDA 2I8AA 1ADFA 4X8LA 1RRFA 1I2BA 1S7GA 4L5IA 5CVEA 3C6ZA 1KDVA 3X1ZA 4HBZA 4RCVA 1J2TA 4WY8A 3JU3A 5DYNA 3UYLA 1F3OA 4ZIRB 4NFYA 3HBLA 3VUEA 1WPXA 4EL0A 2FWNA 3OQNA 2XKAA 3HZOA 4ZI7A 4R0MA 3EQZA 3NYIA 3KKOA 3UHPA 4CIYA 1LPNA 1TM2A 4FSDA 3HRHA 4NBUA 2GN0A 2WYHA 3BBLA 1EDZA 4OMUA 4GMDA 1A0OA 3WSVA 5EJ6A 3IESA 2HA2A 1NV9A 3IQFA 3LC1O 4EEZA 4D56A 3KVOA 1G17A 4Q6BA 4RSMA 4RPLA 1NWHA 3OE7A 3QQPA 4MWBA 4UCFA 1VFPA 5ABPA 1TT7A 1IQPA 3K2EA 1M2KA 5AK0A 5KI6A 2AQIA 3RDPA 2BEVB 1C8VB 1V16A 1THZA 5IXJA 4QA9A 1R8QA 4BNZA 4RAQA 1P1FA 4WJKB 1JSCA 3WWOA 2VJKA 4YP1A 4CN8A 3U6BA 2IBSA 1SA0A 4LYDA 3NKVA 3BGWA 1OX5A 2IOFA 1GILA 2XA9A 2VBGA 1ML3A 4FT2A 5KYUA 3LHSA 4JROA 3INGA 5AJHA 1KI8A 5J5AA 3RADC 3P71T 3DD1A 1TJNA 3GAMA 3K0BA 4Q47A 1JLLB 1NFQA 1LC0A 1Y89A 5K4HA 1YVPA 1T6YA 2FGKA 1L7VC 1CTQA 5FV4A 1U11A 3WNDA 1J07A 4BX3A 1JAXA 1G1AA 4Q3CA 1HEYA 4X1YA 4EZIA 3VMFA 1ZA2A 1REQB 3MLEA 2FXIA 1N0VC 3E2PA 3NDRA 5ILQA 3LW8A 1NC3A 1EI9A 1XU4A 2D8MA 3EAGA 3NRCA 5DBFA 3SK0A 2XLCA 4X3PA 221PA 3WP1B 2FW9A 1OT3A 3HP7A 4MRNA 3OX2A 2KE5A 1IPEA 1XPRA 3H5TA 2NXWA 1HOXA 4BGVA 2O50A 4U7HA 2FZCA 3DCNA 3V48A 5EZQA 3IOMA 3CONA 5CH3A 2HK6A 2F43B 2DHEA 2ZIFA 2L0XA 3HYTA 5AVWA 2PH3A 3Q0EA 3J80A 2AQHA 2O7SA 1ISMA 2RMKA 2WZQA 2FETA 3D3KA 3HYNA 4OPMA 1PVDA 3KYBA 4Q05A 1IBKB 2B1RA 4JKIA 2ATXA 3UTCA 2AN4A 2C42A 4C7MA 1ZJ5A 3DMDA 3GRFA 4R83A 1Q1ZA 2CBZA 3MWEB 4JJGA 3EEOA 4B8ZA 1EWKA 3O8NA 6AT1A 4LXGA 2H0AA 1ZL2A 1SQSA 4RXUA 4PO3X 3TNYA 4H15A 1DC5A 4A91A 2JIQA 3AM5A 2H4WA 2OO5A 2WT9A 4M89A 4CMAA 3EZ9A 4XX0B 5EZYB 3SYRA 1RADA 2O0LA 1C2TA 3GW8A 2P1RA 3DV9A 3PQ4A 2YIVX 3EPRA 2YY6A 5IYZB 2PGXA 4M3NA 1GCAA 2O1SA 2QRZA 1HRDA 1MC4A 1RJFA 2R751 4C7KA 5AI0A 1DDGA 1N2IA 3V8BA 3A70A 2IOYA 3E5MA 3ZCQA 3BHMA 4CL0A 4BLPA 4D1YA 3L0YA 3FLBA 5TPWA 4XIIA 5LXTB 3ETLA 2QL5A 3VQTA 3C1OA 3JQ6A 4TXJA 3ENNA 4XDGA 5KNBH 1ZVJA 3HV2A 3LPLA 5KTTA 2OQRA 3NM6B 4CDMA 2RD2A 1HYEA 2G80A 1JHUA 1GGJA 1Z5PA 2DMRA 2P5TB 3UQZA 2BFAA 1E79D 1ZP6A 1J5XA 3BCHA 3CUWA 1A5AB 2JJ2D 3GGGA 2BEKA 3JZAA 2E9SA 5IT0A 2CLSA 2OCPA 4YI3A 2A9JA 4RTMA 4C4RA 4F21A 3P0HA 2YHSA 1BOFA 4I5EA 2I2BA 4LTDA 1NWCA 1NVFA 3VRHA 2FSVC 1SKYB 2BMWA 3SF8A 2GRJA 1EQUA 1YCDA 4IW3B 1NE2A 3C3BA 4J43A 3ZTYA 5LD2B 5HFAA 2I22A 5IPFA 4MX8A 2X6QA 2B37A 4DNFA 4J7UA 2J7PA 2R1UA 3L77A 2O1XA 3WDSA 1WVIA 5B12A 4GPIB 5CCXA 3ELDA 1IBMB 4HX2A 2KI5A 2PYIA 1U7XA 3ZD7A 5KNCH 1P4RA 4K1XA 2G9NA 2PRZA 4GUAA 1X70A 3QUQA 1XDBA 5TQJA 2FG7C 3K0FB 3OURA 1CDEA 3VR1A 1HL7A 1QYXA 5GP1A 3TSYA 4BCDA 1O89A 1JQAA 2ZIUB 4YYEA 2GKOA 3HMKA 2JGDB 4GLJA 5IRCD 7ABPA 2YZKA 2VJQA 1H2YA 1TIKA 5TQVA 1R9MA 4N0MA 3ZWOA 1QJ4A 3D0RA 5P21A 1K6XA 1T1IA 4WZAB 1D2MA 2CE7A 3L92A 3ZU5A 1RLUA 2ZITA 3MCUA 3NYRA 3PQ2A 1NBMA 1B4DA 1Q11A 3CF4A 5T4HA 5BOSB 5LQDA 1WUYA 2B4RO 2WABA 2VQSA 3PR3A 4Y0NA 3DE1X 5E38A 1JEYB 2G04A 4E5PA 3QVOA 2WD7A 5IXSA 4C0SA 5I7FA 3PQEA 1BROA 4XTCS 2GF9A 3K71B 1E69A 1CR1A 4TUYB 3D6VA 3UMRA 1G64A 2HGZA 1TU3A 2DCUA 4JUBA 2BGGA 4H08A 1PR2A 1YTUA 1PGOA 2GCIA 2M98A 1E8MA 4JLNA 3U4IA 2HCRA 3BBPA 4OI0A 1NATA 2XTZA 4EYQA 1BDHA 3NIBA 5JD3A 2ON6A 4CV3A 2Z9BA 3UK7A 2FGJA 5GV7A 3DM9B 5C31A 1WB5A 1VCOA 4GU5A 2UXBB 1NW8A 2OM6A 4ESVA 4XIJA 2ZJ8A 4PX3A 4RAOA 5BSFA 1UXKA 3L7KA 1NR5A 3STTA 5C1BA 1EFVB 1AZLA 1P44A 3PQ5A 1ABFA 1CF2O 4L72A 4REOA 1JXAA 1OH6A 3AV0B 4LOAA 4OYHA 5AJUA 4PZPA 4JXJA 1JL3A 2I3GA 2NXNA 2AYZA 2WWVD 4QM6A 1XMSA 1BVRA 2OBBA 2XQGA 3PPWA 2R0QC 2VUUA 2YIJA 3PEUA 4IIJA 4JBIA 3G2NA 5ITVA 1O0CA 4LDAA 4JI0B 1PJSA 1SCDA 1VL0A 1A7KA 5F9HA 1JIIA 1FX0B 2YY7A 5DI3A 3ESCA 3KELA 3GVHA 4XSGA 5BUSA 3BWEA 3OG9A 1SZPA 1VKJA 3SR3A 4B9EA 1TAHA 4Q19A 1IN5A 3BQMB 5J2UB 1OZAA 3AVOA 4KNWA 4HDQB 1WBBA 1J20A 3BB1A 4BL5A 5KYGA 3UMBA 4P31A 1OU4A 1TQDA 1F2TA 3IGFA 4D7AA 2GBPA 1LPSA 3ANTA 3HY6A 2JGNA 3K9BA 4ND1A 4RGQA 2CXNA 3LU1A 4A8JB 1BMFA 5IJ9A 4G4SO 2JGAA 1SUAA 2RC5A 3AONB 3TQIA 2GVDC 5CBKA 3GLUA 3N2NA 4ZVTA 1M2GA 1CB7A 4EPXA 3EIWA 3FDXA 4ZQIA 3SN6A 3DD5A 4G8JA 4RZSA 2HLPA 2P3LA 1LDYA 2GI4A 5FBVB 2WJ6A 3GEIA 3LQKA 4RJJA 5CTAA 3E53A 1N5MA 2CNWD 3SZ3A 5ICGA 4FE3A 4BGUA 3ET5A 3IDSA 3LUKA 2TMGA 4KXQA 4ZK6A 5ICEA 1U0BB 2EFEB 3IERA 5LB4A 3EW7A 3BL8A 3JS5A 3C3DA 1CQZA 2O48X 2CVHA 3GGDA 1R5NA 2C5EA 3JQFA 1XC7A 3NDJA 4FHFA 2H9YA 4QOFA 4UBKA 1W36D 4FKMA 3H87A 4UCWA 5AOCA 3FPCA 4QYSA 1R0CA 2Q5QA 3FNBA 5H02A 3TMKA 4E11A 4MR7A 1PL7A 3IP8A 1RM5A 2VBCA 1GXSA 4OM7A 3EXHC 4FT4A 4E03A 4LOHA 3QM1A 4WCFC 4YQFA 5HOEA 3FBGA 2Q45A 4I8IA 3NB0A 4L5YA 3J7AC 1BHSA 2G1KA 4GZMA 3FAKA 5JECA 4AS3A 2GZ3A 2O8FB 1FOEB 1Z8FA 4HMPA 4QPZA 2EZ8A 4Y2VA 3IA7A 4TYQA 2H2AA 1BC5A 3QPAA 3W3AH 4J0HA 4F5ZA 1V9SA 4JDUA 1AGXA 1YH3A 2I4RA 1FC0A 3F3MA 1MOZA 2V8BA 3CRNA 1U9ZA 2FQQA 1CQIB 2V98A 5T67A 3DDCA 3AH8A 4RSHA 1V8BA 2IXGA 2XAAA 4Y9SA 3SM9A 4IGKA 4ZV4A 4E5NA 3RBZA 2OE2A 1U8TA 4F5EA 4O2AA 3T0GA 5LCXA 2CHGA 3BXZA 1I7PA 4QPJC 5TEWA 1HDZA 3KJXA 1G20B 3FI0A 3MBIA 4OQDA 3S1AA 1QK3A 1YR8A 4OQPA 1XKTA 4MB6A 4DGSA 3NS7A 5GINE 3HCEA 3WK6A 1JFSA 1Y8RA 5CHEA 4U7FA 1XR3A 3F5MA 2AH5A 3RYHB 4CFZA 3S29A 4UTOA 1MABA 2BKXA 3UENA 4A10A 3DUFB 4MWGA 1V7ZA 4WZZA 4INAA 5IK2A 1YS2X 4ETIA 2DKNA 1S4QA 4YYZA 4ZGWA 5CB0A 1OC4A 1QPBA 1I3KA 2G9UA 1P3JA 1FVFA 2VHXA 2ZRPA 3PD1A 2ZUVA 3FPLA 3S68A 4EI8A 3R6LA 3VXKA 1HNXB 5DNAA 1E79A 2RSLA 2BZGA 2FUEA 2W6NA 3GL9A 4RA6A 4Y6GB 4D3XA 3V1NA 4YXWD 4KNYA 3ND8A 4OQMA 2VAMA 1FS5A 4JEHA 1GRRA 3JD4A 4RCZA 4GWLA 4BIMA 1U3FA 2WM9B 5T4EA 4E4TA 2QAIA 4UNIA 4XW2A 5KVCA 4C0AC 2GFQA 3WO0A 4OHKA 1W25A 3V4FA 4Q03A 5HZGA 1Z5OA 4BKUA 3WMFA 2IY8A 5ECGC 2D2FA 1ULHA 4IKOA 3PRJA 1T4CB 1DAMA 3HVUA 4LI3X 3HC7A 4F2DA 4ZDKA 4PQGA 5JNSA 3IEKA 2ZU0C 2XRMA 2YFKA 4LHZA 1Z15A 4M98A 5B2FA 3J81k 2OCXA 3PS9A 3UGTA 1DLJA 3BH7A 5IJ0B 2Y1DA 4YR9A 1TI7A 1J00A 3RYHA 3N2ZB 4TXMA 1VDMA 4KKVA 1NBWB 5TVGA 4EYKA 3NMUF 3CB4A 4W7IA 3ZN2A 3ECCA 4KR9A 1GNTA 1SJ9A 4E14A 4BB0A 4MINA 3T15A 2O14A 5AI6A 4FOTA 4TLBA 1NONA 2VPIA 1L3IA 5DCWA 2FUG1 2H0QA 3DZFA 2I1LA 2JA1A 4E2FA 5C32A 2W42A 4OK5A 2NMVA 3QJ5A 4Q1BA 4RYDA 1Y3CE 5IZCA 3CZMA 3V46A 2UYQA 5ESDA 2I91A 1FFAA 2EP8A 3ACBA 5ALPA 5L7TA 4RS4A 3N2KB 1XLTA 3ZQUA 3QKUA 4IMJB 1NAHA 4F3CA 1YDHA 3IVAA 3TLAA 3GAAA 4DWJA 5C8YA 1DRVA 1UANA 1BA2A 5TMBA 4R6WA 1O0SA 4RABA 1RHQA 1XKQA 2W4MA 1EXWA 1SBHA 5ENZA 2ZSKA 3JYLA 2KSQA 2H07A 2HAEA 2BTOA 3GLQA 4MR9A 1QHGA 5CNKA 1L1QA 4MUFA 3NHLA 4LPSA 2AI3A 4F6LA 5AQ1A 3K1AB 4HAYA 2RG7A 2J3KA 4MGIR 3AR9A 3INNA 4IV5A 1LB1B 3Q9SA 5EXDA 1U5BA 4F5YA 5I7UA 3CX8A 2VEDA 5K0GA 2Q5FA 5KNDH 1XAGA 1UKVY 1JDBC 4RSRA 1U4NA 4GMFA 4JVLA 4R7TA 4J4HA 3ZQ4A 3H6GA 3ZPXA 1DEAA 4FB4A 2Q9BA 4JUIA 2AVNA 3NLLA 2GQ0A 5H8WA 4RKYA 2G28A 5CX1B 3NHJA 1KSGA 2W4IA 2ZVQX 3CSUA 3L7LA 1L3BA 1YR1A 4R31A 2I6FA 1DMRA 3G2JA 4R1UA 2PZEA 4OYYA 3GFRA 1FB5A 3R6DA 5HF8A 1X74A 2YOHA 3A3OA 3NNSA 2JGLA 2E37A 3IUNA 3Q7QA 4L50A 3PD7A 3DULA 3AOEC 3SP1A 4MLCA 2ZRKA 1CUWA 1RXUA 1GQFA 1JUDA 2QTCA 4EQ6A 5BORA 2TSYB 3M33A 3IKMB 3PPXA 1WUTA 2A9KA 3B52X 1E6KA 4DSUA 3A0RB 3Q88A 4EI7A 3I3OA 2UVPB 4YUYA 3DCIA 1KNQA 3ZDZB 1BCSA 1MFZA 3R09A 4IINA 3RNLA 3C98A 3T7SA 4N7RA 1JHMA 5D7BA 3RO7A 4E5VA 1QTQA 4IH9A 1PUJA 2ID9A 4HWKA 2G0NA 3OUZA 2V97A 2GUGA 2HHCA 2Y1FA 3CCCA 4X3OA 1PQWA 5EINA 4GOXA 4MRMB 5I9IA 1IZYA 2QTFA 1G55A 1RI1A 3L0ZA 4L8FA 1GFWA 1RI5A 4M7WA 2FPRA 4B4OA 3LTEA 4YT8A 3V4RA 2QVXX 5MDHA 2RHLA 4QZVA 2FPWA 1JDBB 1G63A 1N2ZA 2X2EA 3F8SA 3H8VA 1NLMA 2PH5A 2XEXA 1FQOA 3I8OA 2WWIA 4G6ZA 4YPFA 4A2CA 4LGVA 1R6TA 3U39A 4PG4A 2C8LA 5T57A 4N03A 4IHJF 1I1HA 1M5UA 2Q9AA 3T3IA 2H0RA 2GPYA 4TYPA 4ZI5A 2XUGA 4E46A 1UK7A 3LIPA 2R62A 2HMTA 3FZYA 4J6FA 3DHNA 3NOXA 1UBNA 3IAXA 3IV9A 1LCIA 3RYFB 4AY4A 2CNWA 2HA0A 1ZC3A 3Q3GE 3TF5A 2PUFA 4MVJP 2ZUEA 3LHFA 4YAIA 2VQ6A 1PZFA 5MGBA 3I34X 3TJMA 2EERA 1G21E 3TTSA 4UAGA 2H1FA 2Q5CA 3O90A 1BE0A 1ZZGA 2V96A 1Y7LA 3GRYA 4YIKA 4G84A 5JMTA 4NBTA 2GZ1A 2FQWA 4J1TC 3T35A 3WYGA 5E1DA 3DEYX 3P96A 1E2BA 1IE3A 4G5QA 2W6JD 4RVFA 1P1RA 4AY3A 1YSCA 1JTVA 4G97A 4V0MA 1X80A 5DN9A 4FN5A 4B3RB 1SCQA 2W90A 3HKCB 1AG9A 1CERA 4TKUA 2OXEA 1WUHS 3ZNNA 3OKAA