3BYZA

2-amino-1,3-thiazol-4(5h)-ones as potent and selective 11-hydroxysteroid dehydrogenase type 1 inhibitors
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
258
structure length
258
Chain Sequence
b'EEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYST'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
publication title 2-amino-1,3-thiazol-4(5H)-ones as potent and selective 11beta-hydroxysteroid dehydrogenase type 1 inhibitors: enzyme-ligand co-crystal structure and demonstration of pharmacodynamic effects in C57Bl/6 mice.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 87
structure length 258
sequence length 258
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2008-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3byzA00
1CQJA 2AQHA 2JHGA 3DMTC 4I5FA 4J4TA 2IEDA 5G4LA 4D3FA 1DJQA 4OXNA 1KOLA 1ZSYA 5JAZA 2C54A 3KXDA 4DWVA 2Y67A 1GUZA 1Y5MA 1IOLA 1G0NA 4K6CA 4UEKA 2Q99A 2NV6A 3ZWCA 1PGPA 4HV4A 1WDLA 2IZ0A 1ZMOA 4XQCA 1F17A 1PQPA 1T2EA 4Q3BA 5IDYA 3ETGA 4GX1A 1P0FA 1EQUA 2EJWA 4R41A 4EJ6A 3WFJA 1Z7EA 1P1RA 4DYVA 5JCXA 2X5OA 4N18A 4G81A 4JJIA 3GEMA 2OXIA 5JW6A 3JQ7A 4FJ2A 4B4OA 3GNSA 4RV9A 5KCZA 2YV2A 2B5WA 4RZHA 1OOEA 1ZFNA 3RUIA 5TSDA 3AM5A 1O0SA 3IKVA 2QZ9A 5I7EA 1ZH8A 4BNZA 1U7TA 1EQ2A 4D46A 4J0FA 3I9KA 3MWEB 2D5AA 1C0LA 3NJ4A 4J9VA 1OAAA 3H9EO 3GAZA 3VZSA 1QLJA 1PJCA 4F46A 1E0DA 3LT4A 3RJ9A 4U6SA 2NVBA 4NBUA 1Y8QB 1O94A 2GR9A 3QLJA 4E21A 3ASVA 2P4HX 1YL7A 3V2UA 4BB6A 3INTA 3VPGA 2HSDA 3WMXA 3D0OA 2AE2A 4L4RA 4XDYA 4GKVA 2TMDA 3Q2KA 1KC3A 3L6OO 4ITUA 1DC6A 1LLDA 2Q45A 1W8DA 5KWEA 1T4DA 1U8FO 3ASUA 1QXSA 3C1TA 3JSAA 3L9XA 3O03A 3IP1A 1H6CA 1I3KA 1RYDA 3JQAB 5CP8A 2QRLA 4DTIA 4GGOA 3RBZA 3STHA 4BGVA 1X1EA 1YQXA 4W4TA 1K5HA 3OIFA 3HNPA 4OKIA 1F12A 2FHSA 4TROA 4E31A 4FGWA 5JO0A 4WGGA 3RJ5A 4PLYA 1NAHA 3O9ZA 3GZNA 4FOSA 2G76A 4YAEA 1MB4A 3WICA 3AI3A 1IB6A 3VVBA 5EL0A 5JSFA 2JJYA 1NQ5A 3BXXA 2WWRA 4KQXA 2JD0A 1T4BA 4I9NA 3I1JA 3Q2IA 5KJFA 4HNGA 2WMDA 5CEEA 4W6ZA 3PJDA 4JK3A 4XGNA 3LT1A 2UVDA 4J4HA 2X0JA 3KYDA 2BRUA 2Q3EA 3FWNA 4BNWA 2D5CA 4FFNA 4R1UA 4D0RA 1KEWA 3F4BA 5L53A 1H9AA 4JP2A 1ZEJA 4RL6A 5KIAA 4OYRA 3KZVA 1GUFA 3RD5A 2ZQYA 3ROMA 2XOXA 4RVDA 3U4CA 4M86A 1A4IA 1A71A 1C0PA 3PP8A 4LMPA 2X4GA 4NJMA 4DYDA 5KKCA 3TRIA 3F5SA 2GN8A 2YQ5A 1BTOA 4KUEA 1CF2O 1NWCA 1YBMA 1HSOA 1H9BA 1PS0A 2PTGA 4R01A 1YS4A 4KMSA 1IYZA 4JXKA 1ZXBA 1H0KA 1UDCA 2Y0CA 5GMOA 1TVEA 2PWZA 4CQLA 3TZQA 3E9QA 3W4KA 3TPCA 1K6IA 5I9LA 4JBGA 2WJPA 4UEOA 3ZH2A 3F9IA 4MVJD 3ZWOA 3CXRA 4II3A 2W4QA 3GPDG 1VPDA 4A5OA 4CJXA 5KTKA 5JBIA 4QUKA 3NV9A 2PGLA 1DSSG 2PY6A 1IHXA 4DGSA 1E7RA 3FF4A 4J2OA 1E1LA 1XSEA 1X0XA 3B1JA 1E3WB 2W2LD 3I9OA 1F8FA 1VM6A 5F5LA 3EHEA 3KYBA 3IKTA 1MC4A 1K6XA 1XLTA 3PHLA 1U3WA 1YL6A 2IYOA 1SEVA 5IJZA 4ZJUA 3ETDA 2VHWA 5IDXA 2NVUA 1M6WA 4GMFA 2EJVA 4FW8A 3UVEA 4RF3A 5COAA 2X86A 3Q3CA 4FFOA 5DT9A 1UZLA 3H5AA 2BFMA 4I5DA 3GDOA 2C2YA 3SLKA 1ZK2A 3FPCA 2BFPA 4LVCA 4YEDA 3PJGA 3FR7A 1HYEA 1FDUA 4U6QA 2FR0A 4L0QA 4D3DA 1V3VA 4BQRA 1KETA 1XU9A 4GWKA 4NBWA 4PLZA 5A05A 1HETA 1U5AA 3ZHXA 4BMNA 4GGPA 1NPDA 1P33A 4YRAA 5A5FA 5H81A 4UVIA 3GUCA 2Y1FA 1H93A 2O23A 4MIOA 2TMGA 1YBVA 3EYWA 1SBYA 3P2OA 5K9ZA 3A06A 3FNHA 4J90A 5LDGA 4CM9D 4NR0A 2B69A 2VRCD 2EKQA 1XEAA 4XIJA 3PZBA 3QV1A 2DBZA 4FS3A 5BNTA 3INGA 4QX6A 4CM8A 1P1HA 2Q2WA 2O2YA 3QP9A 3GDFA 1V9LA 2IE0A 3RUDA 4AJIA 2GN9A 2GASA 4YJGB 2JL1A 2GLXA 2GD1O 4PG5A 4U0KA 4Z3DA 4IDFA 1LSJA 4P4LA 3UCFA 1M2WA 1PL7A 4IDCA 5TF4A 2CVQA 2W2KB 3LDHA 3HUDA 3DHYA 1H6BA 4EDFA 1YVEI 4AICA 3NTRA 5CDYA 5I9NA 3B1KA 3ZHZA 2WD7B 1M6HA 1HF3A 5T67A 1TT5A 1N1EA 4NK4A 3K30A 2HMWA 3G17A 2Q50A 3QWIA 4MVJH 1UXKA 4PVCA 5EESA 3ABIA 3JYPA 1VKNA 2CSUA 2J3HA 3I9NA 1AHIA 2VYND 2WSBA 4GX2A 2NQ8A 1PJQA 3PFFA 4E2WA 5L4SA 1PJLA 1F0YA 4JLWA 4LN1A 5GZ6A 4XJSA 3F1LA 1LC3A 4DPKA 1PEDA 2J6IA 2PD4A 3TSCA 1O6ZA 2HMVA 2PK3A 4J9UE 2CY0A 1QYVA 4H3VA 4WLFA 3SBOA 2AG5A 1I36A 4WOJA 5CHEA 1DRUA 4XYMA 2EF1A 1RM4A 4XA8A 5T8KA 3H3JA 2PZMA 3QA9A 3FCOA 4MP3A 2X9GA 4RF4A 1VJ0A 2EKLA 1ZO8A 3OH8A 4C4OA 1ISMA 3LU1A 4H16A 1D3AA 4OXKA 3TWOA 1HE5A 1UH5A 4PLFA 2P5UA 4IZIA 3WG9A 2IZZA 1DIAA 2X0NA 2C29D 1YKFA 1ZK0A 3BAZA 4KDEA 2Y1CA 2IYPA 3K73O 3F4LA 4GAEA 5TRTA 4ESOA 4DIOA 4KQWA 5JY6A 5BSHA 3ZWYA 2W98A 1DJNA 5ENDA 3INRA 4BNHA 1YOVB 4NI5A 1PS9A 3I52A 1I32A 3O8QA 4CLDA 1TI7A 2D2IA 4OL9A 4RQUA 1XA0A 2B37A 3IIEA 4URFA 1Y1PA 2BF7A 3WWZA 4J6FA 4EJMA 3NYWA 3KEOA 2ZTVA 1JA9A 5JPIA 2C82A 3CPSA 1A9ZA 3F3SA 2CZCA 4E30A 1GCUA 2VQ3A 5JMPA 3V1UA 4PLVA 3FR8A 4YA6A 2VTEA 3TZCA 3RU7A 2VWHA 3GVHA 2DQ4A 1I01A 3CMMA 1UXGA 4K28A 3OETA 4TRRA 1BGVA 1X15A 2BGLA 4G65A 3T4EA 3WB9A 5JAIA 1DIHA 1P1JA 1GR0A 4YQZA 2PH3A 4UEJA 3RQSA 1I3MA 2OGUA 4MVJA 4ZICA 2POQX 4PLGA 5L7YA 1MFPA 2DBQA 3H2SA 3WYEA 2I66A 1NPYA 5JNLA 4DVJA 5K6AC 1HEUA 2D1YA 1XYGA 5HWSA 2GZ1A 4PVDA 1W4ZA 2W2LA 4OHUA 2VHVA 3PDUA 4K1LA 4ALLA 4O1MA 4ZRNA 3PWSA 1PZFA 3H9JA 3K31A 1YQGA 4HP8A 5L51A 4D45A 1A27A 2QW8A 2AXQA 2YFQA 3B1FA 4CMGA 2DAPA 1DLJA 1DC3A 3MJTA 5CPBA 1E7QA 1XR3A 5LDHA 1ULUA 1WDKA 3WSVA 3PHJA 5IFLA 4A26A 4BO4A 3QW2A 3VPHA 2PZKA 1AUPA 3ONDA 2R6JA 5CEJA 4PLWA 1P77A 2JAHA 1Q2XA 4J49A 4WASA 1I8TA 1ID1A 4W99A 4BV8A 3H7AA 3FTPA 2PKQP 3AUSA 3K8ZA 2NLOA 1PSDA 3JQGA 5DOVA 4J43A 3ZU2A 5CAEA 4AJPA 3WOHA 1KC1A 2JD2A 4I8XA 1QMGA 2YUTA 3ULKA 1HL3A 4RLSA 1ARZA 2VNSA 5JLAA 3LF2A 4PLCA 5A9RA 4DA9A 3DDNA 1I3LA 1ENYA 1XKQA 1NQAO 3QWAA 3QVOA 1R4MB 3G0OA 1T24A 1I2BA 4NG5A 4E5PA 1AXEA 1LDBA 4CM9A 3IC5A 2J5RA 5LC1A 4BB5A 2XAAA 2Q1UA 1HDXA 2VRCA 1O89A 3JYNA 3ZCXA 5GZ3A 3WYBA 5B4TA 4XQEA 4A27A 1KVUA 1A7KA 4E3ZA 1OZAA 2LDXA 3HDJA 1U28A 2BELA 4FJ1A 2DTXA 2CF5A 3TOZA 4C7JA 1YE3A 3CUKA 2VUSA 3A28A 4OMUA 3ENNA 1G0OA 4FJ0A 1ADCA 1PWXA 3D3WB 4HBGA 1QYXA 1Z7BA 5DZSA 3EAGA 4RPKA 4ZU3A 4U5QA 1CDOA 2AQ8A 3ICPA 1C14A 5JE8A 2Y99A 4IUYA 2UDPA 1JAXA 1NM5A 3PJEA 2O3TA 3RKRA 3ZWPA 5KVQA 4CMAA 3OEYA 4XB2A 1GYQA 1E92A 4N5LA 1C0KA 2VTDA 2HU2A 2C0CA 2XPCA 4YJHA 1ZCJA 2HMSA 4XD2A 4PLTA 2VYNA 3IQDB 4R1NA 1D4FA 4RVSA 4IJKA 2O7SA 1LSOA 2I5PO 4IDEA 1PU2A 2FZEA 5AVOA 4JX8A 1PJ3A 3NEPX 3C85A 5JDCC 5A06A 4JNKA 1EUZA 3RKUA 2E4AA 1LI4A 5TT1A 3HN2A 4BNYA 3NT5A 3AY6A 3DO5A 2GZ3A 4BGUA 2HK7A 3ZWXA 6ADHA 1VKOA 1CQIA 3VH4A 4DBZA 3RIHA 2G17A 5IG2A 2NADA 1E7SA 4WOKA 3OJEA 3OA0A 5TJ9A 2QX7A 3AI2A 3JQBC 3RASA 4L75A 5JFOA 3ADPA 2PH5A 2XXBA 1DFGA 1IL0A 1ZK1A 2EIHA 3SJ7A 4Z0PA 1L7DA 2I99A 1GFSA 2YHIB 2FSSA 8LDHA 1EMDA 2G0TA 3I4CA 1BG6A 5T57A 4TRMA 3DFUA 4UUPA 3WLFA 4CLXA 2WTBA 2YY7A 5IXSA 3IOYA 3IUPA 2JCVA 3FBTA 4L8VA 3UGKA 2GERA 3OJOA 4ZN6A 4BNUA 3NTOA 4ZQHA 4R51A 3PZRA 4UREA 2H5LA 4PCVA 3O4RA 3ZW9A 4OQZA 2I3AA 5C7LO 3ONEA 2VNAA 4KTTE 4K6FA 4B4WA 2HRBA 2IXBA 3W1VA 4CLOB 1HLDA 4BKRA 2AQKA 1YRLA 2I6TA 4BKQA 5F5NA 1ULSA 4L9RA 2Y1EA 1C0IA 4YVFA 2O4CA 1LQUA 2CDBA 3UF0A 3S2FA 4M54A 4I08A 4JP3A 3JQ9C 1YDEA 3DAFA 3D1LA 3KTDA 1IZ9A 2NNLD 1CYDA 1A5ZA 1MX3A 3PWZA 1DIGA 5FYDA 5JAMA 4GH5A 2RCYA 1LRJA 4AJOA 1VRWA 3BMOA 4RGBA 4YJFA 2GSDA 2PD6A 3DBRB 1U2GA 1N9GB 2JFFA 5DCUA 3T4XA 1PQUA 2B4QA 1KIFA 1HDZA 4ALIA 5THKA 5FI3A 4FCCA 4GX5A 5G0UA 2BI7A 3OIDA 4QECA 4HKTA 3H9QA 3IS3A 4E5NA 4CUZA 4D7AA 3CZRA 1EDZA 2BGKA 3KETA 1ZIDA 1HKUA 1NVGA 2QQ5A 4JGBA 1TT7A 1BSVA 2VWQA 5G0VA 4WKGA 1BW9B 1JKIA 2FP4A 2HK8A 3AY3A 3DOJA 1DDOA 4AFNA 3ZU5A 5EPOA 4CM4B 2WYWA 3QHAA 5I8ZA 3DOOA 5IN5A 1HZJA 2PA3A 5I7FA 4FB5A 2NTVA 4IDDA 1T2FA 4FN4A 3RFVA 1L1FA 2DC1A 1PWZA 2VHXA 4Y8VA 3ZWMA 3GRKA 5B12A 4MPDA 2PZJA 4XYGA 1FMCA 3JD2A 4OGWA 3H8VA 1KY4A 1R4NB 1SB9A 3OFSA 2C20A 3V2HA 3UUWA 3PJFA 3PQDA 5T6BA 9LDTA 3AU8A 1AE1A 1M75A 5COBA 5B4VA 3KOUA 2VN8A 3D64A 5TS3A 1UAGA 4B3IA 1PJ4A 3RVDA 3WGHA 2X9VA 2HQ1A 5ER6A 4E2ZA 1DHTA 3MWDB 1E5QA 4RPJA 4U0JA 2DPGA 1QORA 3WGGA 1QRRA 3DXFA 1R6DA 4AJ1A 3CE6A 3JQ6A 2V6FA 2VUTA 1O8CA 2PFGA 3DHEA 1HLPA 3HG7A 3VTZA 2Q49A 4RPGA 2HO5A 2NU8A 1QKIA 3AU9A 3VH3A 4E5YA 1NQOA 3EMKA 4ALJA 4BUCA 2ZKLA 1DRWA 1D1SA 2OFPA 3D5TA 4R69A 5ILOA 1A72A 2AQIA 4B3JA 2W90A 1UP7A 4BNLA 3DTYA 5KJEA 5A5EA 1PIWA 3WLEA 1K2WA 4BS9A 5B37A 2YHUA 3AFMA 3ZV5A 1ZXLA 3ITDA 3GN1A 2P4QA 1P31A 2PLAA 1YXMA 3DBVO 1PQWA 1C1DA 1UJMA 5H82A 1JAYA 2RH8A 4BQPA 4QXMA 3PHHA 5THQA 2IXAA 4GMGA 5JC1A 4OJNA 1XU7A 3K92A 4A03A 2B0JA 1RPNA 4CL8A 2AEJA 3DMYA 2BI8A 1ZNQO 1PGOA 1PJTA 1ML3A 5DULA 1HE2A 3S8MA 1UR5A 3JTMA 4MKXA 4R9RA 5I7VA 1K89A 2NWQA 5F1PA 3DBLA 4DPLA 1E7MA 5AXDA 4J7XA 5JYDA 5EMHA 4IJVA 3S2GA 3SVTA 3GH3A 5G4KA 1LDNA 3GLQA 3M1LA 3HB4X 3SC6A 4W9NA 3W6ZA 3UH1A 1FXSA 4LMRA 2D4AA 2J5QA 3N58A 1P1IA 1GQYA 1V0JA 2NACA 1IHYA 2UAGA 1LSSA 3JD3A 4BGIA 3FHLA 1B15A 1E6UA 5AXCA 3VDRA 1GPJA 2QRKA 4NZ9A 1U1IA 5FFFA 4YB8A 4TKMA 3WJAA 3DZBA 5I9MA 5HTOA 1Q0LA 3HFSA 3S2IA 1MLDA 3IJRA 3P5SA 5C7OO 3JD0A 1DLIA 4RF2A 4N7RA 5JS6A 3GR6A 1B3BA 3N7UA 3I9LA 1P9LA 5C37A 1Y9AA 4PRKA 4RO0A 3PHIA 4OSPA 4QO8A 1LTHR 4MKZA 2ZYDA 3MJVA 5EQDA 2A94A 4RLHA 3DR3A 4AJ2A 5F1OA 5DOZA 1VJTA 1ZK4A 1OMOA 3TNLA 4NU6A 3D7LA 3DBHA 3EUWA 2WD8A 4Q9NA 4QFDA 3AK4A 2OORA 1DEHA 3SX2A 2HKIA 2CNBA 3M1AA 1QG6A 3MZ0A 4TZTA 3WFIA 2OO5A 5K6AA 3S55A 3CH6A 3QE3A 4BO0A 3BMQB 4WLNA 4WJZA 3AUUA 4TQGA 2NU6A 1MXHA 4ZQEA 4BV9A 3UAGA 3G49A 3UICA 4FBGA 1GYPA 4FQ8A 4BGEA 4YT4A 1CERA 2GNAA 3NGXA 4IQ8A 1SEPA 2CVOA 4E33A 1XWFA 1PL6A 4JCOA 3SEFA 2I3GA 2PV7A 5A9TA 4NFHA 4BMVA 4WLUA 3GHYA 3ZU3A 4A7PA 1J0XO 4G2NA 4XWYA 1J6UA 2FWMX 3I4FA 1N92A 2G1UA 1E3LA 4MVJF 1Z73A 3R3JA 4CV2A 4CQMB 1SOWA 4RQTA 3OA2A 1W0CA 3WIDA 3SJUA 2O2SA 1Y6JA 4NFSA 1QLHA 3L0DA 3RBVA 2OP0A 1E6WA 3WGYA 4BHTA 2Q4BA 4P4GA 4UUOA 4O59O 1IPEA 3RAJA 2HRZA 2UYYA 1XG5A 1KVTA 5A3VA 3E9NA 3VZPA 1YH3A 4FC7A 3W4JA 1XQ1A 1VL6A 2EG9A 4FIZA 3DWFA 4RVFA 1HRDA 4R16A 1QP8A 1C3VA 3OQ1A 4YT5A 4IINA 3RFTA 5F1KA 4GI2A 1T25A 2RAFA 1DHRA 2YV1A 4WCDA 5A9SA 4BO9A 2WDZA 4A10A 2X0RA 1DOHA 1FF9A 4BIIA 3LLVA 4PG7A 4A73A 2X7HA 4WNCA 1NTOA 4R4JA 1V3TA 4IGEA 2AE1A 3ON5A 3GVCA 1KEVA 3W8DA 2BMAA 3PFWO 1R15A 3HFGA 1DXYA 3KSDO 5TJHA 5BNIA 3PQEA 4HX5A 4AJ4A 3PK0A 4WCFB 4YPOA 2YW9A 3L4BA 1E3IA 4TRNA 3BTUA 4PZEA 3C1OA 3EW7A 4ONEA 3PIIA 4UULA 4R3WA 4D79A 1LC0A 3ST7A 1WMBA 1E7YA 1P3DA 2F1KA 1DBVO 3UHAA 1KYQA 4XB1A 2JAPA 3U4HA 1N5DA 3FTNA 1RWBA 2V6GA 3GA0A 3FBGA 3H9GA 2BGMA 5A04A 1NWHA 3D3EA 1NBOA 5ADHA 1VJ1A 4IDAA 1OBFO 2Q1SA 4LISA 1VC2A 1B8PA 4EW6A 1RYEA 2E82A 1GUYA 1ISJA 4FOOA 2E37A 1IUKA 1EEHA 5HRUA 4PIVA 3AOEA 4ND5A 1HYGA 3WNVA 4KUGA 3HB5X 3AUAA 4DRYA 2JCYA 3IAHA 1ENPA 1QV7A 2O7QA 1B14A 1EK6A 3W4IA 4OKNA 4NDNE 5JDCA 3PYXA 3RU9A 2X22A 3JQAD 1C1XB 3KEQA 2EXXA 3WX0A 1YQDA 1PGNA 1VSUA 4B79A 4Z9XA 1RM5A 1BDMA 3IP3A 1PR3A 5I7SA 4Q3CA 3E9MA 4AG3A 1DAPA 4P22A 5CDSA 4Y98A 4YWJA 1A9YA 1I33A 2BHLA 3EC7A 3CZMA 5BQFA 5KJCA 4LGVA 2PGJA 4BVAA 1UXIA 3PXXA 4UVGA 2R00C 5MDHA 2QHXA 3JQBA 4J7UA 1P44A 3BMCB 4YR9A 5JYEA 1GZ6A 1ONPA 4WUVA 4KUHA 4NHEA 4DC0A 4F3YA 4XZ3A 1H6AA 4IZHA 1SMKA 4BNFA 4IPTA 4CL3A 1M76A 4MIYA 2X1HA 1T1RA 1MUUA 3JD1A 2EEZA 1F14A 4CLOA 3NDRA 4B8ZA 3WBBA 2DBVO 3ZDFA 2V7PA 2PGDA 3GZ4A 4YT8A 3WQSB 5EIOA 1T1SA 1XHLA 2C59A 1GY8A 3TZKA 3MJEA 2I9PA 1DIBA 1UXHA 4OM8A 1RM0A 3GQVA 3VPFA 4IIUA 3WIEA 3E18A 3V1TC 4ALKA 1MFZA 1E77A 1JQBA 3FN4A 4D41A 4L73A 3NT2A 3EY4A 5TGDA 3IMFA 2B4RO 3LF1A 3JQ9A 4Z9FA 1QYWA 3NUGA 2EGHA 1WZEA 4LCJA 3KUXA 4NQZA 4CMJA 4PZCA 4CM6A 2I67A 5DNAA 1H94A 2GCGA 3MJSA 5KVCA 2YDYA 3FSRA 1FDSA 1HDYA 2ZB7A 3WJ7A 1U3VA 3GC6A 5AYVA 2Q1WA 2VT3A 1K3TA 3GN2A 5B4UA 3ZWAA 4GX0A 3C3XA 2BFOA 3GVXA 1E3EA 2DLDA 1NFQA 3R3SA 4RCVA 3C7DB 4W7IA 3D5QA 2UV8A 1LQTA 4XR9A 2RH4A 5G0TA 1HTBA 2C7VA 2OP1A 1NVMB 1JTVA 2ZTLA 3Q1LA 3ANMA 4HXYA 3I5MA 4W9NC 4MVJE 2X5KO 3PIDA 4YT2A 4Y6SA 3JYOA 1NAIA 3U4IA 3JQ8B 3PDJA 4YXFA 3W8EA 4DL9A 4CLRA 3JQCA 3JQ7B 1CJCA 3GFBA 3GDGA 1PJBA 2ZJ0A 1LDGA 3KM0A 3E5RA 4RVGA 5C7IO 3DL2A 5IAAA 3KLPX 3TZHA 4BNTA 3GGOA 1WAMA 4GLOA 3ROPA 1WXDA 3NDJA 3H5RA 1ISHA 1RJWA 5FF9A 2JCXA 4L74A 1PS8A 2VOJA 3CSDA 1EE9A 4MIEA 1D7OA 4R54A 3VC7A 3NTQA 5DF1A 3NDIA 3P7MA 1TLTA 1DPGA 3GHHA 3BMNA 3DZHA 4LSMA 1GQ2A 2JD1A 4B4VA 5JC8A 1WLYA 2J3JA 2IRWA 1YB5A 2Z5LA 3QIVA 1ZW1A 4HFRA 1JKJA 1XELA 2EV9A 4HFNA 2AW5A 1NVTA 3HWRA 5COQA 5ENVA 4EI2A 4QSMA 4YAKA 3ZNQA 2P91A 4CV3A 2X6TA 4MOWA 2GPTA 2HDHA 4UUNA 4Z0TA 3RFXA 4NBRA 3ONFA 5ITVA 3LZ6A 2YYYA 3RC1A 3VOSA 5IN4A 4XRRA 1IE3A 5A3JA 1E6EA 1EVIA 2Y1DA 5J23A 5A4DA 4E13A 1KY5A 4BL5A 4PRLA 1Q0HA 1Y7TA 1WPQA 4KWIA 4W7HA 1DFIA 3GZNB 4XJTA 4CMCA 4GBJA 1I3NA 3PWKA 4IBOA 2CVZA 3QVSA 4I5EA 4MO2A 1DC4A 4CPDA 3GRPA 1Z82A 4DQXA 3LT2A 4YAGA 1N8KA 3DTTA 3NKLA 2Q2QA 1R0SA 2RIRA 1LDYA 1EDOA 1S6YA 1UDAA 1UXJA 5U9CA 4P38A 3JYQA 4A2CA 1JKFA 2BH9A 1OFGA 3KYDB 4IXWA 1LRKA 1EVZA 4LRTB 4KOAA 4YDRA 4PG8A 5H83A 5JY1A 4O5OA 1SC6A 1Y8QA 2DTDA 2SCUA 2VT2A 3E5MA 2OUIA 4D0SA 5TLSA 3WYCA 1U8XX 5L4LA 1R16A 3WMWA 1BXGB 3WS7A 4NJMB 5DBGA 4Z9YA 4FPXA 1A4UA 1NQTA 4J1NA 5CG2A 2ZYAA 1U9JA 4Y67A 1MG0A 2PD3A 3A14A 4BNNA 5HS4A 5JDIC 1O9BA 3Q9UA 4D3SA 1U7HA 3JQAA 4IM7A 1LLQA 1ZJZA 4DQUA 4P8RA 1BXZA 4CQLB 3TQHA 4MDHA 2EHDA 4NU5A 1T2CA 3L4BC 1QYDA 3GEGA 2G5CA 1H2BA 4MJLA 3DZGA 4NK5A 4BO8A 1KERA 2CMDA 2H63A 5IF3A 5CDTA 3JQEA 1ZSVA 3GG2A 1X7HA 2IODA 3F46A 2Q2VA 1H2HA 5FI5A 4N5MA 1EBUA 2GO1A 4CMIB 1X14A 1GV0A 4OOFA 3F5QA 4BNXA 2FZWA 4RORA 1J49A 1ZSNA 3NX4A 3U62A 3OM9A 3UXYA 5BR7A 2WYUA 3H5NA 3PGXA 4LCEA 3D4OA 1JU9A 1VSVA 2ZTMA 4ND3A 3UW3A 3AOEC 3KHUA 1UDBA 2BLLA 3RCBA 1XGKA 5HA5A 2W8ZA 1B7GO 4MP6A 4E2YA 1NASA 2HMUA 1PX0A 4DQVA 3KV3O 3ZU4A 4ND2A 2C7GA 2D8AA 1JDJA 1D8AA 2YDXA 4HWKA 5ILGA 5BSEA 1EFLA 4IMPA 3NRCA 1EUDA 3DEYX 4PG6A 4DLLA 1EUCA 3CINA 1NHGA 1LDEA 2EERA 4YTEA 4B3HA 4ZHSA 3OQ6A 1YJ8A 1HDRA 1Z45A 3GF4A 1GU7A 3TF5A 1S7CA 2GF2A 4D43A 2A35A 2DKNA 4KTVE 3ZWWA 3OBBA 3RC2A 3KO8A 1CRWG 1HWYA 4FFLA 3OF2A 1E5LA 1KVQA 5AOVA 1HE4A 3MTJA 1NYTA 2V65A 2GZ2A 2EP5A 1VI2A 5TQVA 4TWRA 2NU9A 4AJEA 1BVUA 1YONA 1LBEA 2O3RA 1LNQA 1AGNA 4DLAA 3PQFA 3VH1A 1E1MA 4LSWA 3ZNNA 3WBFA 4CM8B 3HDQA 2AG8A 4GSKA 2V6BA 2IDZA 2O48X 2CUKA 1E3WA 3OJ0A 4HADA 5F21A 2HUNA 5L3ZA 4EBFA 3AW9A 2DTEA 4LK3A 4ND4A 1SOVA 1XDWA 2NSDA 4PLHA 4JJFA 2CFCA 3GGGA 4YQYA 3GPIA 3SXPA 2CDAA 4MKRA 2ZJ1A 4QQRA 4MVJM 4XGIA 5T64A 1ISIA 2QYSA 3BTVA 4FFPA 4U8GA 5AXBA 2FN7A 4R68A 4XYLA 5BSGA 3TDKA 4E5MA 1I24A 1MGOA 1TT5B 2C5EA 4JJGA 1I30A 4RDHA 4BO6A 2VRBA 1G6KA 4HY3A 4DMLA 1GADO 1E3JA 3VZRA 4AL4A 4UVDA 3MTGA 4Z6KA 1YGYA 4OXYA 1H5QA 1PZEA 2ZK7A 2J3KA 1ZKMA 2NUAA 5KVSA 1GEGA 1WP4A 3F6YA 5DBFA 4QTZA 5TX7A 3ZV6A 3ZZNA 3G79A 3TJRA 3GNQA 1HDGO 1UUFA 4HFJA 4YACA 2P5YA 2J3IA 3GMSA 1I2ZA 3EK2A 3Q9NA 3KBOA 3QVXA 1SCUA 2FR1A 2HCTA 2DFDA 4AJHA 4MVJP 2Y1OA 4CMEA 1WWKA 4U7WA 4R5MA 4FSHA 1VL8A 4XQ9A 3DONA 1B2LA 5C3MA 2DBRA 4KP7A 3CMCO 1JWAB 1NP3A 1U3UA 2WM3A 4IQ0A 4YJGA 1JW9B 3MJ4A 1AHHA 1R0KA 4LW8A 3ZW8A 3JQFA 4BNMA 4EGFA 4XKJA 3GMDA 2EWMA 1J5PA 1X0VA 1IY8A 2D0IA 3ZWBA 3C7CB 4XX0A 1WMAA 1B8UA 2Q1TA 4BNKA 1TXGA 2YJZA 5IZCA 1BRMA 3BMCA 2W2KA 3LLSA 4FC6A 5L7WA 2RHRA 1VL0A 5IDQA 4DREA 4J7CA 1MA0A 3L6EA 3WGTA 2R00A 1LJ8A 1JVBA 1B16A 2WD7A 3O8QB 4IQGA 1UP6A 3GFGA 3ITKA 2FOIA 5T5QA 1UZNA 2AEFA 1R66A 1LUAA 3C8MA 3UKOA 4CR7A 4B7CA 2OBYA 1NFFA 3PRJA 5HM8A 1FK8A 3WGIA 4ALMA 3AWDA 4CLEA 3U5TA 4J3FA 1RKXA 5AXAA 3U09A 4JBIA 4IS3A 1V3UA 3PI7A 3F1KA 3WNQA 3GG9A 4OOEA 3TOXA 3HN7A 2DM6A 4YCAA 4CUJA 2PKRA 3QRWA 2J8ZA 4TKLA 4M89A 4P4NA 1LU9A 4WLVA 4IGFA 3DB2A 4TRJA 4CM5A 1NPTO 4JBHA 1FDWA 1Z74A 3E1KA 1Q1NA 1WNTA 4D42A 2NTNA 4CM3A 4E6PA 4XEHA 4FFRA 3MOGA 5FWNA 2VWPA 3H9UA 2LDBA 5LCXA 4FFMA 1N1GA 4BKOA 4EEXA 5CDGA 3BHIA 3A1NA 2XF8A 1YOVA 3JQ8A 2DUWA 4XQGA 5BSFA 2QRJA 5CG1A 1HE3A 3AM3A 5CEFA 2P9EA 3Q6IA 1ZK3A 2ZQZA 3WQRA 5DP2A 1PGJA 3P2YA 1N7HA 4I9UA 2Z1NA 2P2SA 2NTJA 1MC5A 5HS6A 3UFXA 3VTFA 1O5IA 3ORFA 3JQGB 3HADA 4UVHA 1GV1A 2OBNA 4J4BA 1P45A 3NT4A 4ALNA 4B7UA 4FR5A 4S3MA 3GUYA 3DAPA 4E0BA 4WEOA 3L6DA 2O3UA 5L9AA 4JN6B 1KS9A 1RM3A 5CDUA 3BHJA 1BVRA 1NXQA 3VPXA 1T2AA 4WECA 3COSA 5TNXA 3CIFA 3G1TA 4WLOA 4LVUA 3S2EA 1X7GA 3I3OA 1JLLA 1EE2A 1M66A 2E49A 3MOIA 1Q7CA 1W6UA 3VHRA 2FPPA 5DN9A 3HSKA 2CF6A 5DDIP 5I8WA 3E82A 3RUAA 3S1LA 4OSOA 3Q11A 4NFYA 3KLMX 4E32A 3QJ5A 1L7EA 2C5AA 1U2DA 2A9FA 1DIRA 3ADOA 2X58A 3WWYA 3EVTA 9LDBA 1V35A 4TVOA 1EVYA 1LLCA 2Z1MA 3LT0A 3M2PA 4BO7A 3GNTA 3V5NA 5L45A 3RC7A 2HJRA 2VZ9A 3DQPA 2OL4A 4KDFA 3VVCA 3ROKA 1ZEMA 1Y8RB 1HXHA 4AJLA 4RVUA 4Q3DA 2ZB3A 2QG4A 3DOCA 2C2XA 3HQ4O 4Q3EA 4J2HA 1I0ZA 1PJ2A 4QFCA 3X2FA 3JYLA 3PYLA 4YJHB 2O3QA 4NBVA 3DZJA 5CFZA 2CDCA 1W73A 3UN1A 1V6AA 3K6JA 3CEAA 3OEWA 1OI7A 1I10A 2WYVA 5ER9A 4DMMA 3Q0EA 2E48A 1K6JA 4HFMA 4JIGA 1ISFA 3BTSA 4MP8A 2JHFA 1LA2A 4DIFA 4HUJA 1OC4A 1BDBA 1B0AA 1BXGA 2XXJA 4HNHA 1N2SA 4YAJA 1R4MA 2BKAA 5IXYA 4UVEA 4DBVO 5L4NA 3PTZA 4UUMA 2GN4A 3FNEA 2Y05A 4RJTA 3GT0A 5IZ4A 2HK9A 4WE3A 3SC4A 4QT0A 4GLLA 4JROA 2ILTA 3W8FA 3L77A 5KVVA 3OMLA 5ES3A 2P9GA 4WCFC 2ZCVA 5JDIA 1SNYA 2I76A 1FDTA 1YDWA 3BA1A 3V8BA 3KYCB 3WSWA 1GQQA 2FMUA 2IZ1A 3D3WA 4CV1A 2YZ7A 5KOIA 2BD0A 5ICSA 2QIOA 1A7AA 2WE7A 3I9MA 1R0LA 3V1YA 3ZWNA 4WPGA 3ZNPA 2I65A 4CODB 3I9JA 3ANNA 1HZZA 3LSYA 4E2XA 4CMIA 4O63O 3GVPA 1OC2A 4S1VA 1HT0A 4BKUA 1J4AA 4L4XA 1SPXA 4Y6RA 3QWFA 5EERA 4MVJG 2B5VA 1KEPA 3OP4A 5ITWA 3DZKA 5U4QA 3RUFA 3LK7A 2Z95A 1YO6A 1YL5A 4R1SA 3QSGA 1KEUA 1P1FA 4CMEC 3H2ZA 2ZCUA 3E8XA 1I5RA 3VPSA 3QWHA 1YWGO 1ZZEA 3BMOB 4YJFB 4ROSA 1ZJYA 3T7CA 4E4YA 3I6QA 4DIBA 1Q0QA 4EITA 2Y66A 1ONNA 1F06A 3PVZA 3SLGA 3JQFC 3QY9A 2ZATA 3FD8A 3VKVA 5JO9A 3ZN2A 1WDMA 1PJSA 1ONOA 1PTJA 1VE9A 4CR8A 3HZZA 4AJKA 1ADGA 3C7AA 1G1AA 4BO3A 2AEMA 2P68A 5IZCC 1PGQA 4MVJI 4WK6A 3ENKA 2JKVA 2Y68A 3JD4A 1U4SA 3MEQA 2EKPA 2PNFA 2YHIA 2GDZA 2H6EA 1NHWA 1XCBA 4Z3KA 3E03A 1NNUA 1GTMA 4XYEA 1CWUA 1EBFA 1GCOA 3UCEA 4IY1A 4BNGA 4J1SA 4H15A 5JAQA 4K26A 4GVLA 3RSHA 3RUHA 5EN4A 3QVTA 4BOYA 1BXKA 5F3RA 1TB4A 3JQDA 4TZKA 3DHNA 1E3SA 1K0UA 1GAEO 2ZYGA 3B70A 3PLNA 4JQCA 4ZQBA 1TA4A 3DFZA 1T2DA 4BNIA 1LSUA 4NH4A 4PLPA 4AJJA 1QV6A 8ADHA 4DC1A 5A02A 2O3JA 1ZUD1 3HE3A 2Y0EA 3LVFO 4YJDA 4I5GA 4BO1A 3K2EA 3NAQA 5GY7A 5KJ6A 2NM0A 4XRGA 4J1TA 2VUUA 1E1NA 5DCYA 4GSLA 3G3EA 2PKQO 1MP0A 2DT5A 1X1TA 2B4TO 3VKUA 3IUSA 3RC9A 4CQMD 3DBRA 5EINA 3TN7A 5KNLA 1N9GA 1PR9A 1NR7A 3NJ8A 1UAYA 3AY7A 2H1SA 4EZBA 4Z0HO 3K2BA 1Y5RA 2VYVD 4PGFA 2ZB8A 3PLRA 3M2TA 4WLEA 4PN3A 4FDAA 3I83A 5TIIA 3HDYA 4RPHA 4IJWA 1LX6A 4M55A 1NX6A 4QEDA 4BO2A 2NQTA 4J16A 1BW9A 3GAFA 1AXGA 1FDVA 1LXCA 4NPCA 4PZDA 2GGSA 3JCZA 3P19A 4INAA 2O3SA 2FRDA 2Q46A 4ZVVA 1C1DB 3UOGA 4XYBA 2VWGA 3VDQA 4CM4A 1U5CA 2HMTA 1DAOA 3K9QO 1NFRA 3WGZA 4EJ0A 4IDGA 1BHSA 2HAEA 4AJNA 3H3FA 3FI9A 2QYTA 5KKAA 5G0WA 4NBTA 4F6CA 1YJQA 3GGPA 2RBEA 2DVMA 1NR1A 2VCYA 1SB8A 2X9NA 1H6DA 1R4NA 1KVSA 3TFOA 3TFQA 3DBLB 2WEKA 2AA3A 4TMFA 2FR8A 4GL4A 4J0EA 1CEQA 3H6KA 4IS2A 1SZJG 5EJ2A 3T7EA 5G4KB 3PYMA 3BIOA 5DBIA 4BMSA 4Y6PA 3LC1O 3ZV3A 3B20A 2GUGA 4NJOA 1B3RA 1QR6A 1E1KA 3TZ6A 3F47A 4XCVA 5L95A 1PL8A 5JCJD 3FWZA 2DUUA 2JFGA 2PZLA 2GRAA 4D44A 1V8BA 2VZ8A 4R3NA 3U3XA 1MG5A 5L7TA 5HBRA 4CMKA 3A9WA 1DO8A 2F00A 3TL3A 1ADFA 1PZGA 2EGGA 5DCWA 5AQ1A 1MXFA 3C1AA 5MGBA 1B8VA 3E48A 3AFNA 3WTCA 1BWSA 3KB6A 2PR2A 4RVHA 1ADBA 5A03A 5C5IA 1P0CA 1R12A 4R1TA 3EZLA 4CR6A 1XIVA 2FPGA 1IPFA 2A4KA 1ENOA 2R2GA 1X7DA 1GDHA 2AHRA 2Y0DA 1MV8A 2DPHA 4J1QA 1KBZA 3RWBA 3DMTA 3DBHB 4Q39A 5FEUA 3CTMA 2WE8A 3D4PA 3RBXA 4K9DA 5K0ZA 4YYZA 1CIVA 4NNJA 3VH2A 3FNGA 2G82A 3GVIA 3KSUA 1CETA 4BKPA 4XR4A 1GZ4A 1EVJA 1AN9A 3NGLA 2OOSA 4BNJA 1GD1O 2EP7A 2YV3A 4ILKA 3AJRA 4NIMA 3ZNOA 1IZ0A 3WGOA 1Z6ZA 4TSKA 5JXWA 3HJAA 2RHCA 4MINA 3CKYA 3BHMA 4Q3AA 1LDMA 2O50A 1YB4A 3L4SO 3MCVA 4L76A 1B26A 4IXTA 1ORRA 1HYHA 1ZBQA 2ZB4A 4O0LA 3OJFA 4IIVA 3EZYA 3JV7A 1U4OA 4B7XA 4ID9A 1M67A 1LRLA 7ADHA 4X54A 1ENZA 5IDWA 2YFHA 3U0BA 4DXHA 1LEHA 1SAYA 4E5KA 1QYCA 5GZ1A 4YRDA 3QWBA 3D4NA 4L4SA 4RF5A 4R5HA 4CMHA 4F45A 2GYYA 2EW8A 4NMHA 3DAGA 2IEBA 1Y81A 1R37A 2ZTUA 3GK3A 1D1TA 3L9WA 3HDHA 2P9CA 4CM1A 5A9SB 2X23A 1EZ4A 3AUTA 2OZPA 1P1KA 4EEZA 1ISGA 5TT0A 1E7WA 3B6ZA 2NVUB 3OJLA 3H65A 1YB1A 3BMQA 4Y9DA 3U4DA 3C24A 1I2CA 4W82A 3WR5A 2B83A 2DFVA 5TC4A 3H4VA 2Q4EA 4G5HA 3EGOA 4KWHA 2X0IA 4O6VA 1Y8RA 4CM7A 1TEHA 3EVNA 4EUEA 3QVWA 4XDZA 1ZVMA 4IMRA 1Z75A 1GYRA 4XGKA 3RROA 3RUEA 3EDMA 4EYEA 5A1TA 2E6UX 5KJ1A 4KZPA 1JWBB 2NVWA 1X13A 5DP1A 4CV0A 1FJHA 3KSZO 4DLBA 7MDHA 4CQMA 2D59A 3BYZA 1GPDG 1T26A 5B1YA 1BMDA 2A92A 5G0SA 2VYVA 3BTOA 2FY8A 1HDCA 4OIMA 1IULA 4Q3NA 4IJUA 3PPIA 1P74A 4H7PA 4I1IA 1U3TA 2VHYA 3RUCA 4CLHA 4C7KA 4EUHA 4II2A 4TVBA 2X8LA 3X2EA 5L40A 3BZUA 4OO3A 3ZHBA 3PHGA 3WXBA 3PGJA 3ZWVA 3ANLA 3WQQA 2YQ4A 1UZMA 2B36A 3WDSA 1UP4A 4UAGA 1GEEA 3GOHA 3IJPA 3LYLA 2UUOA 4FD3A 1GZ3A 2VOEA 3ROQA 3KVOA 5ICMA 1QSGA 4I9HA 5EQFA 2X5JO 3ZHYA 3AI1A 4BNVA 4F6LA 2V6MA 4A0SA 2B35A 3W6UA 2O4UX 3V2GA 1O95A 3LC2O 3LQFA 3GY0A 3OECA 2BFAA 3KYCA 1EFKA 3O26A 5BNFA 4WCFA 3QQPA 3WGQA 2EW2A 2HLPA 5G2OA 3K5PA 1PZHA 2H9IA 2VZ0A 3KRTA 3AOGA 4ZQGA 4YBZA 3ZGYA 1F8GA 4FGSA 4LRSB 1YBAA 2FSVA 2JFHA 4GKBA 3ICCA 1WZIA 4E12A 4R9SA 2GN6A 2C07A 3VAZA 4B4UA 4PFJA 3OQBA 3OIGA 4OAQA 3ETEA 2QZZA 2Y1GA 3AM4A 3OSUA 2D3TA 1HDOA 2HJSA 5JCJA 3E6AA 4YRBA 3O38A 4B8WA 5T8KC 1Q7BA 1Y9EA 4CUKA 1SO8A 4ZRMA 3U49A 3ZV4A 4ND1A 1DFHA 4GQAA 1JN0A 3VZQA 3TL2A 6LDHA 3DC2A 3FPLA 4DPMA 4GVXA 3UCXA 4N5NA 1C1XA 3M6IA 2ZIZA 4ZGWA 2AMFA 4M1QA 2DU8A 4PG4A 2ET6A 3K96A 4BO5A 3FRJA 3LC7O 2VHZA 1JVSA 4M87A 3R1IA 4GWGA 2J5KA 4ZQFA 4RPLA 3N74A 4QO7A 4ZD6A 3G1UA 1KVRA 3R0IA 1EK5A 5CPFA 3HHPA 4OH1A 3IL2A 4OQYA 4RDIA 3OHSX 4WEQA 4CMBA 3RI3A 1HSZA 4ZA2A 1Q7GA 3R6DA 2OHXA 4CLRB 1GL3A 4DUPA 4YAIA 4M49A 3FNFA 5U1PA 1ZMTA 2Y93A 1WVGA 3IDSA 4WNIA 4AVYA 1N7GA 2FPIA 3GEDA 4RZIA 3OICA 4M8SA 1LLUA 3I6IA 3PEFA 3A4VA 3I23A 3U9LA 3DZFA 4J91A 1XQ6A 3ZI0A 1VLLA 3DZIA 4GPD1 4IDBA 4XIYA 1WW8A 4EUFA 3MJCA 1DB3A 1DC5A 5BT9A 5JMWA 2UUPA 1DRVA 3BMNB 3WTBA 2OMEA 2CD9A 2NU7A 3L07A 4N54A
chains in the Genus database with same CATH superfamily
1CQJA 2AQHA 2JHGA 1DELA 3TQTA 4RTNA 2DPMA 2IEDA 3AHDA 4QDXA 4D3FA 3W5UA 3UH0A 3REFA 3NEYA 3T7IA 4X9XA 4JLPA 4AUKA 5JAZA 3HZRA 1JQDA 1RJFA 1WRBA 2Y67A 3EGIA 4KXFB 1IOLA 1F6DA 1G0NA 4KW7A 4AC9A 3IAS6 3K9NA 3HEMA 2IUTA 3PD1A 2Q99A 4KN5A 4EY6A 3I39X 3ZWCA 4FEAA 3OI7A 4WVFA 2ECKA 1SCIA 3FZYA 3L8GA 4TSRA 1WDLA 2ZE5A 1F17A 5LU8A 1V8OA 4KPFC 3EVCA 1OASA 1T9KA 4YMWA 1ID8A 1AF7A 4GX1A 2Z56A 1HTTA 1P0FA 3I5UA 4RFVA 4LX8A 4R41A 5DGCA 3YASA 1YAHA 2BZ0A 2AYZA 1Z7EA 1Q1BA 4ZVKA 2H7YA 5J4YA 3EZGA 4N18A 1OZHA 2Z3VA 2BGJA 3PFGA 4JOCA 4R0VA 4ZXFA 2Z3WA 2AJCA 5DLEA 4URXR 4JKYA 5JBQA 4ETWA 4OJKA 3RABA 3MCZA 1E2BA 1J2EA 5BN5A 5JCJD 2IUUA 5KSOA 4B4OA 5D7BA 5LYJF 1JH8A 1Z17A 2WPDD 3NV7A 4JI7B 2GXAA 2DSTA 4LHWA 5TSDA 3RUIA 1CTQA 3DKVA 1O0SA 4Q21A 5I7EA 1ZH8A 3M6AA 2C61A 5FAKA 1WBJB 3I9KA 2GHTA 1LWNA 2D5AA 2V4MA 3CUTA 3AUXA 4J9VA 3W5DA 1N3IA 1GPUA 1QC5B 2P2ZA 2QW0X 2WJJA 3GAZA 3VZSA 3KQMA 1DOAA 3TEJA 2DWPA 2ZR8A 3I32A 3EGDB 3FLAA 3ROTA 4U6SA 2HSJA 5BO5A 4EUNA 3L06A 4F4DA 1Y8QB 1O94A 2SCUB 2PFKA 1LTQA 5C1DA 1IM2A 1EXMA 4IXNA 4HLUA 5FFMA 5GONF 3RU3A 4UE6A 5AVZA 2YC2C 3T1OA 5HX7A 1ZN7A 3OF5A 1GGEA 3INTA 4G0XA 4HOYA 2HSDA 2WB2A 4AI6A 1FE8A 1L8LA 1LPNA 2DLCX 3D0OA 5DLYA 4XDYA 3TSOA 2TMDA 1AMUA 2ZBFA 4Y2YA 3NIBA 4OBBA 2M6KA 5KWEA 4EO7A 2ERCA 2EZ9A 1T4DA 1U8FO 2E89A 2PEZA 2X4LA 3C1TA 3JSAA 3OHPA 3IP1A 4ND6A 1H6CA 5CK5A 3Q3HA 1EFAA 1IRIA 4CKBA 2GLUA 1ZRNA 2Z08A 3RBZA 1S4MA 3IUQA 4QGGA 1S1MA 3D2CA 1MORA 1FSSA 1G8YA 4HNRA 4IHAA 2WA1A 3W2EA 4BEJA 3LK6A 2VDWB 1F12A 4TROA 5KWSA 4F8YA 4O2LA 1BGXT 4WGGA 4XVCA 5CYFA 1NAHA 4I50F 3Q1KA 3QVKA 4N9WA 3GLGB 3AXTA 3I04M 1UBSB 2ACEA 4NZZA 3QF7A 1FFBA 5KEIA 4YAEA 3USCS 3DDHA 5L3VA 1N2CB 1EK2A 3HA7A 1GSHA 1OKKD 4FR2A 2JJYA 1NULA 2P4UA 3MJHA 1NI5A 2A5JA 2ZB2A 2Y71A 4I4CA 4I9NA 1D7AA 2F43B 3R0ZA 4RLFA 5DK4A 5KJFA 1DWOA 3FWPA 1NQVA 4DM7A 1NVKA 3O4HA 5CEEA 3H1BA 2AK3A 3NHYA 4JK3A 5ALEA 1XMOB 2O54A 1XCLA 4J4HA 1L7XA 2X0JA 4GWLA 4I1UA 1ZD5A 4H7DA 4Q37A 4E4TA 1N2EA 4KQKA 3LY8A 4RBNA 1LX7A 2WHEA 3F4BA 1BAPA 5HE8A 5L53A 2VP0A 2VDOB 4F85A 4JLOA 1ZEJA 1OYVA 2ZBUA 3RD5A 2CYCA 2Q4TA 2W7TA 4XW2A 5DNDA 3MFYA 3L41A 4XEUA 2YXLA 1YDMA 3L1UA 4KE6A 4EA9A 1ZIXA 3CG4A 3GEIA 3LO8A 5KKCA 5KYTA 1RYHA 1QVWA 3U3MA 2E4YA 2GN8A 2YQ5A 4L08A 5SYNA 3L01A 4CCYA 1NUAA 1HSOA 2J3MA 2PTGA 5AOCA 1KIAA 1YS4A 1FYWA 2ONCA 4KMSA 1OFUA 5EAIA 3UMJA 1TVMA 1EXDA 1X8KA 1O95C 1ZXBA 1V16A 2FWJA 2H52A 2Y0CA 3AF2A 2IU6A 1WCIB 2ONYA 3IAEA 3W4KA 4OXQA 3EN0A 3OOHA 1D2EA 2UU9B 2GWHA 4A2PA 3O3NB 1JG7A 1DAMA 3P94A 3REQB 4QNMA 3RT1A 2NU9B 2W4QA 4A5OA 3GBSA 5KTKA 1C3OB 3E15A 1G3IA 4HK4A 4US0R 4QUKA 3NV9A 1XRSB 3U5ZB 3K09C 2PY6A 1M83A 1QO0D 1ORDA 1IZ8A 4N1AA 4DLPA 3FF4A 4NPAA 5CT6A 1XSEA 2ZRCA 2PUBA 3B1JA 3ZTYA 1RHUA 1XRLA 5LA6F 4GKJB 1T3ZA 2B7LA 2F64A 2FX3A 4JGGA 3VISA 3W8RA 4I1OA 3ZCUA 2BV3A 3IKTA 1HNXB 3I01M 3EZ9A 3U1TA 3PHLA 3G0HA 1YL6A 1T5BA 4WINA 1YIAA 1SEVA 3S7ZA 3ONVA 5IJZA 3VDMA 4PR3A 4ZJUA 3HY6A 1BVYF 2ZLBA 3ETDA 1F3LA 3IAXA 4KVAA 4P82A 3ZDXB 4RHCA 5IDXA 1XTZA 3HU5A 3UQYS 4GMFA 4RSMA 5AVXA 1KQFA 3LY7A 4DUYB 4ARIA 4JDUA 3TQFA 3UVEA 4QPJC 5EKDA 3ITEA 4FK8A 3MINB 5DM4A 1TYEB 4I19A 4I5DA 3GDOA 3LI2A 3ZDZB 1ZK2A 3FPCA 3TX6A 1EB8A 3OBIA 3E61A 3OD5A 1SY7A 3PEVA 2ZWVA 1F6BA 2EP8A 1P4SA 1FDUA 1Y0BA 1KYVA 2JI9A 4U6QA 5DM60 1BS9A 2VCEA 3A9TA 3QTLA 1CY8A 3E9CA 4UNPA 1RTTA 2CXHA 2RDMA 4TYWA 2O19A 1YZFA 4L7QA 5KTPA 1XU9A 4PO9A 1U5AA 1GG2A 3BXHA 2QLNA 3OCJA 4LE1A 4NOKA 3NXSA 1P33A 5A5FA 4YRAA 2VG8A 4UEWA 1GL7A 1DBIA 2FZ5A 4I4TA 4HXEB 4RY8A 4N8DA 3AL0C 4EBBA 2Y1FA 2O23A 2OHJA 2JLVA 3NTXA 3UWPA 3Q10A 3NOXA 3P2OA 3ROXA 2ZE7A 2H0RA 3GIDA 4J90A 2YVKA 4QASA 4OA8A 4NR0A 3ZGVA 2B69A 2J4DA 5DKFA 3E9YA 1PD1A 5F2KA 1E2IA 1GNSA 5DSTA 4ZQCB 4JV5B 1UKYA 3MWYW 4FS3A 2IZ6A 4G25A 4HQKA 4IIDA 4BZPA 2VA9A 4QX6A 5BR1A 1A50B 4IKEA 2IE0A 4AJIA 1XEXB 2PX8A 1PFGA 2GN1A 4M1OA 4YJGB 1Z8NA 5IK2D 2PQ0A 1E59A 2GD1O 3EH1A 3ID6C 4IDFA 2WPDA 4L85A 2P11A 1T6XA 4GR4A 4IHJB 4RMHA 1UM9A 4BDSA 1EDEA 4FT2A 5BWMA 2C2BA 2GEKA 4RCYA 1UJ4A 821PA 1HR0B 4JLVA 3STWA 2FDXA 4EDFA 3NTRA 3KQYA 1U04A 4V3BA 5IWAB 3B1KA 4MQBA 3LQYA 3DKKA 1U98A 1WD7A 4JC4A 4JEIA 2LIPA 1WSDA 2CNOA 2CSUA 1DT5A 2J3HA 1AHIA 1JECA 4AWAA 4EG8A 1BA3A 3BWYA 1ATZA 3CPEA 3CVVA 5AK3A 1PJQA 3PFFA 2P30A 2SHKA 1PJLA 3RVRA 5J1SB 4UBKA 2ZETA 2X76A 4UPEA 5HQTA 3D3NA 3F1LA 2XUAA 3B8HA 1V4NA 4HH0A 2WG0A 4KXWA 5E2IA 1PEDA 3LNTA 3C43A 5A3QA 2IY9A 2WFAA 4WRRA 1KDYA 5E9JA 2Q3MA 2PK3A 4J9UE 4HTFA 3MPOA 1HG1A 3IPXA 1NOJA 4UM7A 3W5AA 3BB1A 4L5IA 1M0WA 2Y1WA 3W6OA 2ZSJA 2DECA 4B3GA 4ZANA 2OHOA 3FCOA 5C9ZA 3RF6A 2PUDA 4CT5A 3SDSA 4QPCA 4AZ3B 3R7BA 4F9FA 4BVFA 1ISMA 3LU1A 3QA3E 1NW3A 1SCDA 4DG5A 5JADA 3OUUA 4I3GA 4ZHQA 3MMNA 3H86A 1L5RA 1YD7A 1ZIPA 2XRMA 3DOFA 2P27A 4AG5A 2IZZA 4C3VA 5I7HA 1DIAA 1YKFA 3BAZA 1OKKA 4KDEA 4ODIA 4INJA 2XT9A 3F4LA 2VHEA 3ZG6A 4KQWA 5KHOC 5BSHA 3P9XA 4Z4IA 4EY8A 1RWNA 3OPYB 1E2JA 1DJNA 3QF4A 3O82A 4NFLA 2JGMA 3K72B 3QPAA 3I52A 2CFIA 2QA5A 4WESB 2D2IA 3OPQA 1D8TA 2QL5A 5CVVA 1XA0A 4JVOA 1IQPA 4XPZA 3UKJA 2D5IA 3MTAA 1VCOA 2RAUA 3EEQA 4J6FA 2QSYA 4EJMA 1OH8A 3OOJA 1CLUA 2C4UA 3EVEA 2C82A 1LI7A 1A9ZA 1AO0A 1IM5A 1X8LA 2O2XA 4KODA 4PU0A 1DADA 3C6BA 2AC2A 3UMRA 4EY5A 2P0EA 1U9CA 4ZI2A 2VTEA 2RSLA 2W9XA 3SDBA 2J3EA 3TZCA 5DNYB 2VWHA 5LP6F 1L5VA 1RHMA 3Q6NA 1I01A 2AR9A 2BP7A 4G0PA 1ZGAA 5B6PA 4B71A 2Q5EA 3LO5A 1N2OA 1VJGA 2G5PA 3C48A 5BYKA 1JLLB 3MGKA 5IAJA 1WD5A 4PAGA 2P5TB 1IWPB 4L8FA 4YQZA 4BVJA 5FPSA 4J94A 1QO7A 3L0ZA 3Q3JB 2BKUA 3OX4A 4TTIA 4F93B 1QCCA 6AT1A 1SG6A 1HEUA 1PUIA 4KMMA 3LBYA 2D1YA 1DPFA 4MGHA 1QO0A 5BORA 3TUIC 2O06A 2Q5QA 4BVEA 4PVDA 5C7YA 2CBGA 3PCRB 3PBKA 1CU1A 3W06A 1WA5A 2R44A 1V37A 4HH1A 4MKIA 4QJ5A 2AKAB 5CD1A 2I1LA 3AEXA 2PPVA 1J8VA 3BM5A 3G8CA 1QGOA 4ALLA 4G0QA 4O1MA 2M32A 1T8UA 3PWSA 1J0CA 3H9JA 1JILA 3K31A 2GJ9A 4EJSA 3I2FA 3SE7A 1A27A 1SXJB 2PZGA 2AOTA 2AXQA 1TMGE 3BCUA 1F3OA 1YDFA 1JR6A 3BKWA 3B1FA 5ALZA 1DLJA 1DC3A 1N6PA 2J46A 4ZO4A 1RABA 2C5FA 4FONA 5LDHA 1ULUA 2DY1A 1X39A 5BQPA 5AK6A 4BO4A 3ESYA 3PC2A 1AUPA 3MT8A 4QODA 2FZKA 5IX8A 4DTCA 1B8OA 1P77A 1EWKA 3RVPA 1I8TA 4G0NA 2FW6A 4UAJA 1K98A 3H7AA 3LJKA 5ALKA 2BONA 5JUWA 1AUQA 2YICA 2H1VA 1II9A 4QG3A 3KOYA 5HF5A 5CAEA 4CCAA 4KAAA 5CR9A 4RY2A 1CUVA 1PBTA 3HXLA 1ZPDA 4LWOA 4Q19A 5AKZA 3ULKA 4EB8A 4BLPA 1DQPA 2VNSA 3DBIA 3L2OB 4N8SA 5JLAA 5IRCD 1S2IA 1GPLA 2PZBA 3S70A 5LLSA 3R0JA 1U8AA 1I3LA 1ENYA 1HDIA 1NQAO 1R4ZA 3BQMB 5HBGA 2XXAB 3TCNA 4CTOA 1P2BA 1T24A 2NYVA 4NG5A 5CA0B 5JZVA 1H9CA 1LDBA 2FMIA 4Y7CA 3EBLA 4OKSA 3QVJA 2J5RA 5EWLA 3VOBA 4BB5A 2GPYA 4OQ4A 4BVHA 1G3RA 5EMLA 4CZ2A 1O89A 1VI6A 2W2OA 1E2MA 3WYBA 5B4TA 2Q4RA 3S6JA 3T38A 1RXIA 2ZE8A 5IANA 1FP4A 4QOIA 2QAIA 1WMEA 3B36A 4JT8A 1Z4KA 2DTXA 4FJ1A 3RKSA 3RLFA 3RSGA 4XWWA 3VX4A 1YE3A 3CUKA 4Q1CA 1SU8A 3T0IA 1SD5A 4ARZB 1KGDA 5IK2A 3PQ5A 1KH1A 5FR1A 5LYYA 5CRIA 2ZROA 4ZMRA 3RFUA 3K4QA 3TQIA 4G3XA 1AS0A 1A2BA 2F90A 3MQFA 4JHLA 1F1JA 1Z4IA 2JAWA 3MBOA 3SX4A 5LR6A 4ZU3A 1BE6A 3FOCA 2YHSA 2LPMA 4G89A 2CJFA 2QV0A 2AQ8A 1YDGA 1C14A 3FYUB 4QZVA 3IERA 4TV8B 4Z8XA 2H85A 1NM5A 3RKRA 4E08A 3AF0A 5B7GA 4CMAA 5IP5A 4YNBA 4XB2A 2K2WA 5KVQA 2HQSA 1E92A 1XWWA 1C0KA 5DGHA 3IEXA 4FYHA 4XVUA 1TYZA 1MT3A 2I3BA 3CISA 1KI3A 2P0YA 4M0EA 2J6HA 4BVKA 1FW6A 2O7SA 2NV2B 2PL9A 3EOBI 4EK9A 4IDEA 1PEKE 4UMFA 2FZEA 3VU3A 1KMQA 1JG2A 1T5HX 3CB4A 4FMPA 3KQVA 2R4TA 5CLHA 4JNKA 3RKUA 2XHEA 3PDCA 2D13A 1CJSA 4QPZA 2P41A 2NYAA 4BNYA 4D4LA 2QK4A 3NT5A 4GZMA 4KXXA 4OK6A 4TKUA 3AY6A 3R8CA 3WLHA 3AJDA 5KVAA 2G6BA 2GJKA 3LAWA 1V45E 1W5EA 2V55B 1N0HA 1HT2E 2NGRA 4FOLA 3VH4A 2RMKA 4FFSA 1FTSA 1HQCA 4BFYA 3IVAA 3DEAA 2OAEA 2Z9DA 3WK6A 1NBAA 4PC3A 3IEMA 1L1QA 1NYLA 3BFJA 1TW2A 4EIWA 1O54A 5CFLA 3OJEA 3LFTA 3LDUA 5C1PA 4JP5A 4TT8A 1JEYA 1Q0ZA 1QYIA 3ZD8A 3WAKA 5JFOA 2QQFA 4CTMA 4JB2A 1SBNE 2J5BA 1DFGA 1E3MA 3B3JA 2NO9A 4U5XA 3S4YA 1ZK1A 4FYYA 3SJ7A 3UG6A 1D9XA 2GILA 2ZTSA 3CX6A 1CC1S 3B6KA 3D4IA 5FLYA 5KAPA 1QP7A 3I4CA 1UPFA 1BG6A 5T57A 4EDHA 1H85A 3DFUA 1LJUA 3WLFA 5IXSA 2WTBA 2KE5A 5HJEA 3IOYA 3K35A 2R8RA 1UFRA 4OQFA 1SC1A 4BNUA 1CUDA 3NKVA 4TM8A 3I9V1 3LD9A 4PCVA 4UREA 4UCXA 3ZW9A 4DAEA 2I3AA 2M6RA 1XTSA 2VNAA 3SC3A 4BUJA 2DR3A 2VKTA 4K6FA 4MWBA 1SRQA 1YMUA 3Q7EA 2PSFA 1MZVA 3SF8A 1RMTA 1J9EA 2FW9A 3PVSA 4KLRA 3AGQA 1YRLA 4XGRA 3NUQA 5EIFA 3W2FA 1ULSA 4BV3A 2WDPA 2Y1EA 1C0IA 4YVFA 1K6EA 5G41A 2CMKA 3ZX4A 1NLFA 4EPWA 4IIXA 5CXSA 4U1RA 4D9CA 2RKWA 2CDBA 1N5KA 3IP6A 3S2FA 5TMDA 2EKZA 3JQ9C 1YDEA 1DU4A 3DAFA 3B5IA 1IZ9A 5G40A 1A5ZA 3B85A 3PNPA 1MX3A 3KC2A 5AD1A 2YBEA 2HJWA 5FYDA 1I0IA 2V1UA 3KAQA 4TQUS 5DX1A 1U0NA 4HRAA 4PO3X 3ZY2A 1VRWA 1GLNA 4YJFA 2GSDA 1LB1B 2PD6A 4X1YA 4MDFA 1WS6A 1N9GB 5DTIA 3T35A 3ZWDA 4ZOEA 5D2CA 1MIOA 2ZBGA 3CKMA 4TTTS 5CNMA 3GLIB 2B4QA 3TIGA 3TNYA 4RAOA 3ES9A 2ANBA 4GX5A 3OIDA 4QECA 3GJRA 2UXBB 1LF5A 1G21A 1MNAA 1RYBA 4Z99A 3U7IA 3IP9A 2YOGA 1SIUA 4K03A 5DTRA 1B23P 1RCTE 1QFZA 5E4FA 1CR0A 3Q9LA 1PFQA 2MJLA 4D4KA 1HKUA 3KJHA 3KFLA 4JGBA 4WDRA 3KETA 1TT7A 2VWQA 5G0VA 5IJAA 1ETUA 1LVHA 1E6LA 4HDSB 3ZU6A 2CXOA 3C4VA 1TOAA 1RHRA 1NW8A 2HK8A 3AY3A 1Q7RA 3M9XA 5A6SB 3WIVA 5C8ZA 3EXHC 3DOJA 2WHPB 5EPOA 1OBOA 3DOOA 1WB6A 2VSQA 4IMIB 5I3ZA 4M9SA 2NTVA 1E96A 3I1FA 2XV1A 4O3FA 4FNMA 4WNAA 5B12A 3GRKA 3KQKA 1FMCA 3JD2A 1G6OA 2VTBB 4OGWA 5LL6P 1QOPB 4F5YA 3OFSA 1VHLA 3LCMA 2XCRB 2WUWE 1BE0A 3FTDA 3N75A 1ECPA 2WF6A 3T5GA 5LQKA 3FJOA 4I50B 2Z1DA 2I3ZA 3LP6A 3E3NA 4RTKA 2W22A 4JR1A 4XWOA 9LDTA 3AU8A 1AE1A 1M75A 1YZVA 3L7IA 4I4TF 4C04A 5B2FA 2VN8A 2GF9A 1UAGA 4B3IA 1U90A 4QOGA 3RVDA 2X9VA 2G5TA 3I6BA 1B73A 1SVLA 2QXUA 2ZJ8A 4XFKA 1KJWA 4L57A 4MR8B 2P9TA 1XZLA 1ZR4A 2NN3C 1IEVA 4FWIB 2W6ID 5ETJA 4RPJA 1N3YA 4U0JA 2AB0A 2XBMA 1NTRA 4UU7A 1IBRA 1GLVA 4BVBA 4EGJA 1VPWA 4AJ1A 4AN0A 2XB4A 3VTZA 2AZXA 4QDZA 4E5YA 1XFDA 1KEKA 7REQA 1P4AA 3MG9A 1H1LA 4G67A 4WBNB 3I61A 1TEZA 1NQOA 3ZGOA 4BUCA 1X77A 2ZKLA 1D1SA 1NJ6A 1QAOA 1E99A 2CLHB 3TAHA 1SFRA 1TEXA 3F71A 4A0RA 1UP7A 1HX7A 1YCGA 2I2AA 1PIWA 1MB9A 4Q24A 4D0GA 3MCWA 2O5EA 4CU5A 3AFMA 3ITDA 3GN1A 3RYFB 1G20A 1P31A 2PLAA 3OZIA 1BCSA 2E4VA 2EATA 3DBVO 3HBNA 1PQWA 1C1DA 1DARA 2DYKA 2GM4A 3CLKA 3GT3A 4BQPA 2BGTA 2QB5A 3UANA 1RDFA 1QV9A 2B20A 2UKDA 1SHZA 3KEMA 1XU7A 3K92A 4A03A 4CL8A 2XE6A 4DLRA 3LSTA 1VGQA 1D4AA 1PJTA 1WPGA 3THSA 4KHPB 2QSUA 2R1VA 2FOXA 1QM5A 5D3KA 4TXJA 2QJRA 4GYKA 1KJJA 4W5TA 2XNDD 2OFOA 1HE2A 4MGIR 4U9IS 4DYHA 1YZQA 3LPMA 1BEEA 1V8FA 2ZWPA 2B25A 3SKYA 3DKRA 5I7VA 1K89A 2D1QA 2NWQA 2R7KA 5F1PA 4Y0NA 2BJWA 2IEIA 2XNKA 4DPLA 1WB9A 1BN6A 2ZWIA 4X71A 3MBKA 2JPDA 5FTWA 3QYJA 1M2GA 5EMHA 1Q1AA 3S2GA 2WWIA 2WIDA 5BRAA 2WIAA 2XYQA 4IEIA 5LA6B 3GH3A 4C14A 4AQDA 1LDNA 3C3YA 4EUKA 1POXA 2JH3A 5HZHA 1CV2A 1JAZA 3GLQA 3THWA 1XZBA 3QOYA 3AVXA 2XIJA 3IQEA 3NVAA 3G0GA 1J1IA 3FUXA 4UXHA 3UH1A 1SUPA 4LMRA 1XTRA 2VJBA 2EGUA 4KAJA 3R9KA 2C0PA 3VC2A 3BS4A 2CW5A 4J03A 5JT1A 1U28C 1T43A 3JD3A 4LJSA 3FHLA 1JIVA 1B15A 1VG1A 4YONB 4XCQA 3QUBA 1WMSA 4PX9A 5AXCA 4NZ9A 4CQJA 1U1IA 5FFFA 1XP5A 4DA0A 5K8TA 4WKOA 1CIJA 3DZBA 3QXGA 4ZZ0A 1EA7A 3HFSA 1B4DA 3ODPA 4RHXA 3VYVA 1R64A 4R1PA 4ZHQF 4V2IA 4KQ9A 4RF2A 2PKXA 3A9RA 1X92A 3GR6A 3LUHA 1DBSA 1DJMA 4NULA 3QFCA 3V1LA 4Q7QA 4QO8A 2PJUA 4MKZA 2ZYDA 4H59A 3LBHA 3N0RA 1XMJA 2XTZA 5K3DA 4ZOCA 1WABA 2NXCA 2VDQB 4QTYA 1NMYA 1XXLA 4LI0A 5F1OA 4AJ2A 1N6OA 1VJTA 1L7NA 1MH1A 1OMOA 1N34B 4HWGA 1E66A 2E4UA 1GHTA 5JISA 3UJCA 3QKUA 1Y80A 2IPMA 3PUIA 4FKMA 3DEKA 4Q9NA 5CH3A 2OORA 1J5XA 3NETA 1NY5A 3A1SA 3COJA 2AG1A 2O9JA 3BMQB 3AUUA 4TQGA 4BLSA 6PFKA 5ITZB 4HNVA 3QIAA 3QKRA 3IMKA 2O14A 1JLHA 3VZDA 1GYPA 2PQ6A 4HAZA 4M99A 3WP1B 4YT4A 2JLXA 3ET5A 1IU9A 5CVTA 3N7AA 4OX9B 3ZE6A 1OTYA 3N5KA 1XWFA 4JCOA 4LYEA 1SUWA 2PX3A 4BDTA 4HGYA 4R8VA 4WLUA 3GHYA 3QPWA 4MQEA 521PA 2CLCX 3GIWA 5IVIA 3ZU3A 4A7PA 4P0PB 3IGFA 4G2NA 4QYIA 5L3QA 4A36A 1GA1A 4V39A 4KIFA 1N92A 1OWPA 2AS0A 3N2ZB 4JVNA 3MD0A 2TMYA 4Y6QA 3FWHA 3AR7A 4KGZA 4AY2A 2A88A 2ZYHA 3WIDA 3SJUA 4D9FA 5AW6A 1QUEA 5CURA 2FLVA 1KTIA 3RBVA 3EARA 1C0EA 3AH8A 4UOQA 1E6WA 5IUKC 2HPZA 3DW1X 3FE2A 3NOOA 2FUNB 4IDPA 3VNRA 3ZHTA 4BHTA 5LQRA 1MT0A 1Y48E 2XWBF 1L7BA 4FM9A 3RAJA 4X92A 2HRZA 2UYYA 1XG5A 4KEAA 1T8SA 3BN3A 1P6UA 3A6JA 2WHYA 1E1CA 1WDTA 1X7XA 3EXFB 3LGXA 5K1ZA 1T91A 1SHUX 4FIZA 3DWFA 5NULA 2I6QA 4GMXA 3ISTA 5HZGA 2YBDA 1QP8A 4WDQA 1RXCA 3C2QA 5TB5A 3EPHA 1RU3A 1JZQA 2RGRA 2EFYA 1YR3A 2Z57A 1HORA 1DHRA 1ZJ5A 2YV1A 3LCJA 4BO9A 4EHLA 4A10A 4BIIA 1DOHA 1VSQA 1E32A 1VJDA 2OBXA 4WI1A 2PUEA 1NJ1A 2BBTA 4X61A 1WTCA 2OLKA 3MS7A 3S7TA 1R15A 2VAPA 3HFGA 3KG2A 3PNVA 1KIMA 5F3DA 2A0UA 1Z4QA 3GRVA 3B2QA 3L46A 5BNIA 3PK0A 2CXXA 4TRNA 3C1OA 3KT6A 2C5BA 4ONEA 1J0AA 2BVNA 2ASVA 2RH5A 4Q6WA 2OYSA 1M9NA 1WMBA 3PXBA 1P3DA 2WWTA 4X44A 4AO7A 3KQHA 1DBVO 3UHAA 3K53A 4PR0A 4X93A 2B8WA 1MAUA 1ZL0A 1N5DA 2X40A 4FZ3A 2ZSIA 1RWBA 1IBMB 3C3JA 2HLHA 2V6GA 4JL5A 3H9GA 2QQGA 2BGMA 2CVFA 3N87A 4HJXA 4LXXA 1R5OA 1T1JA 1O77A 2QLTA 3ROFA 4BP8A 3GYBA 3SKXA 4DUGA 2K7ZA 4MNTA 3OKAA 5B3JA 1SZDA 3FPEA 5B58C 1B8PA 4EW6A 2BT4A 2E82A 1WHSB 1GUYA 1FJGB 1FNDA 1L4BA 4FOOA 1EG2A 3CS3A 5CIWA 4BMOB 2NAFA 1YFKA 2CHQA 3MGBA 5HRUA 4QWWA 3KD2A 4MJ7A 4V24A 3AOEA 1QPZA 2W6PA 3OTHA 1SXHA 1YS7A 4DRYA 3AEQB 3ZC3A 3G8YA 5JCOA 1B14A 4Q4HA 3ILYA 4D81A 4F56A 1IK4A 2C7BA 1KFJB 1X8XA 4QEKA 3W4IA 1SURA 1J90A 3RU9A 3KEQA 3A1UA 3N76A 4OK5A 1XKLA 3TXXA 1JXQA 1BDMA 3GLHB 5BSMA 3PUZA 3UB4A 4QBIA 5LP6B 1WY5A 1DAPA 1W1WA 3PPWA 1JIKA 3I45A 2X6RA 2XNCA 1LJLA 4MGYR 3PXEA 5BQFA 1XE3A 4EW1A 1SUDA 4LGVA 3PXXA 1XO1A 4UVGA 1EXNA 2WQ6A 3ZE1B 1DCTA 3U7QB 1L9XA 4B17A 4YJ2A 2VSXA 4KCGA 2XNDA 1A7UA 5T41A 1GZ6A 2PT9A 5JYEA 2JA1A 5ALOA 3RLIA 5JG7A 1ZUWA 4CEJA 1IBSA 2XDQA 4XZ3A 2XYHA 4G2TA 1CR1A 2PANA 4YQFA 4BNFA 3A9UA 2BJHA 3AR9A 2B8EA 3JR3A 3KDPA 3PQ6A 5DM1A 5IARA 4EB6A 1T1RA 3JD1A 5HZKA 4R8RA 3VJKA 4H1TA 2IV3A 1F14A 4QULA 2FPIB 3GWZA 3ZDFA 1FNMA 3DNPA 3VUEA 2PGDA 3ESXA 2SNIE 5F2OA 3GZ4A 3ZV7A 5LUBA 3WQSB 2PPLA 2OENG 2BFDB 2WHQA 3OQIA 4YT8A 5JEDA 4Z7NB 2ECQA 1J42A 2B3TA 3TZKA 2I4RA 3MJEA 5IT4A 3K7EA 1ZJ6A 3IUNA 4DR7B 3WIEA 3CX4A 3HXKA 1E77A 3FN4A 3B2NA 1GKLA 3DHVA 1MRZA 1Z6GA 3MRTA 3PUHA 5EP1A 5EWMB 4ARSA 2OBMA 3NT2A 3RS4A 1FUUA 4GQIA 4PPFA 4GL2A 4XDHA 1FS5A 1VPEA 2NU7B 2PGIA 4Z9FA 4KQ2A 4OVKA 4CMJA 1CQJB 1ZAYA 4MUXA 2F9LA 4E94A 3LWNA 4NONA 1J8YF 3ODGA 1N6HA 4RY9A 3G2NA 3MJSA 2ACVA 1QVZA 3W2TA 3TBHA 2KJQA 3FSRA 1V43A 3T5AA 1XQVA 2I6SA 2ZB7A 1GKUB 5IS2A 4BE9A 4FFVA 1E79D 3FI0A 1TJ3A 1TM1E 2HRDA 3MAGA 3O6VA 1H3FA 3ZWAA 1E3EA 4TTRA 1VCMA 2ZYTX 3R3SA 5GV7A 3UJBA 4R9VA 5EE9A 2UV8A 2GETA 3D6MA 4OK3A 5GWXA 4ZOLA 5GIPE 5G0TA 3EISA 2E18A 2EBUA 4IDQA 4LV5B 1MO3A 3ZWQA 4IEEA 1JTVA 3KZMA 4DMKA 4F5WA 3OFND 1U2EA 4GPEA 3PIDA 3KDSE 4YT2A 3JYOA 3U4IA 1RI5A 3JQ8B 4YXFA 2V0CA 4JJ4A 5BN5B 2AFIE 1YQQA 1CJCA 5FCDA 2O8BA 1BMFD 2X7XA 3O2JA 3GFBA 1RWKA 2Y0PA 2EJCA 1X2EA 2I8CA 3KM0A 4TV9A 4A91A 5DM2A 1NA5A 4MVXA 4YAOA 5KDLA 3QBEA 5C7IO 2AMYA 1PWEA 3MLAA 3SNHA 4ZVLA 3DDUA 1WAMA 3GGOA 2YZGA 1KO7A 4GOMD 5LBUA 2H2WA 3ROPA 2ACKA 1O97C 4GU5A 1T6BY 3NR2A 1E4YA 5FF9A 4P5DA 5BQOA 3T34A 1LZKA 2JCXA 5AHWA 1HUQA 2VOJA 1EE9A 2C8JA 1JGTA 1D7OA 3LUCA 2P1DA 4MIEA 2XDYA 4R54A 5HTKA 2YW2A 5B7PA 3P7MA 2HU8A 4QYTA 4FI3C 3RVNA 1NXVA 3BMNA 4KX5A 1S2GA 5DT2A 1GQ2A 2P6OA 2PZ8A 3H19A 3MUNA 4B4VA 1GLGA 3T1YB 4EKIA 2AJLI 1U94A 3F5FA 2WUDA 4HFRA 3CLRD 1RYNA 1TLLA 1ZOSA 2EJBA 4QDTA 3SSOA 1NVTA 1KK1A 2XUDA 3BULA 4PV7A 4QSMA 3SFVA 3ZNQA 2P91A 4Q82A 4DCTA 3N2GA 3LFHA 2OCAA 2I1QA 1FUYB 1G9XA 3HPRA 1Z5NA 4MH0R 5I7AA 3LWZA 4CKBB 3LZ6A 2YYYA 1Q1GA 3NBZC 4Z8YA 4BASA 4DQKA 3DL7A 4MDEA 2HLDD 3IPYA 3PE6A 1SXJC 3U2QA 3VOSA 4HH4A 4TXHA 4AUMA 1RVV1 1IE3A 1D1QA 2OEPA 1E6EA 5AUNB 1Q1ZA 3KXIA 3GLSA 1Y9DA 1AKYA 5AHOA 2FB9A 1WOYA 2F55A 4W7HA 5F98A 1DFIA 1GRQA 1P61B 1J22A 3K0EA 5H80A 4HS4A 1KEEA 3Q0IA 4C5BA 2OA0A 1YCHA 3LBNA 3EUAA 4LXQA 3L6RA 2R5NA 3QITA 1ABEA 3GRPA 3AESA 5LN1A 1PNOA 3L93A 3DTTA 1EP1B 2Q2QA 1WHTA 2BM0A 3KBBA 1GRRA 4KX3A 3DCNA 1MMFB 3VX3A 3MWEA 5ALGA 5U9CA 1KO1A 1JKFA 1KQ3A 1UJNA 2DHEA 2BH9A 2FDRA 3KKMA 1EGVB 1RRKA 4IXWA 4NECA 3FH0A 1VJ5A 2FSIA 1EVZA 4MS1A 1K4KA 4PG8A 2VUIB 3G2QA 2PCJA 2XA2A 3PICA 5JY1A 1UDXA 2G63A 1SVOA 4O5OA 1SC6A 3H5OA 5KYWA 4U4AA 1D6JA 2FMHA 2OUIA 3SU8A 5TLSA 3WYCA 5AYVA 4XQ0A 4BFTA 3WS7A 1YZGA 3ISJA 1TFUA 4TVKA 1SJ9A 3NI2A 3P45A 1NF3A 4O1HA 4YDHB 3ZZMA 3NNSA 3G7SA 1RRGA 2OPHA 2ZYAA 4CCYB 1RQ7A 1MG0A 3KOOA 3W7BA 4BNNA 5JDIC 3GLVA 2OXEA 1O9BA 1MVNA 1LFAA 3EODA 5DI3A 3T99A 5KMGA 1U7HA 4IM7A 1BWRA 1V16B 1ZJZA 2Q8PA 4DQUA 2D6FA 1I0LA 4TXLA 3OOEA 3QXHA 1V9SA 2EHDA 4MDHA 4IVRA 3A8TA 4NU5A 1T29A 4FYJA 4P81A 5JI3E 3LHDA 2F8SA 2BZ1A 2EFHB 5ED0A 3IOBA 5LNK1 3DZGA 1OREA 1LKZA 1P3JA 2W2XA 3TYXA 3VRHA 4AO8A 2RHBA 2AVDA 1K66A 3FYUC 3AHHA 3A3OA 1WIWA 3AO0B 3GG2A 5JD4A 5JALA 4RTJA 3TQOA 2UYOA 2O2DA 2IODA 3KUUA 2VEDA 4EMSA 2Q2VA 2OCKA 4CMIB 1T9BA 1U2RA 3QEOA 1JDPA 3PT5A 4AS1A 4I81A 3B3FA 4G1BA 1I2DA 2ENUA 4R83A 4RORA 3WKAA 3FMPB 3UXYA 2WYUA 3H5NA 4LCEA 3F5MA 1D4OA 4NH0A 4TLCA 4GXQA 1K0FA 4MUHA 1V2GA 1VSVA 2ZTMA 3INNA 4ZREA 3UW3A 4ZV4A 3VFDA 4F4HA 3L4KA 3V4FA 1XGKA 2W8ZA 1TD9A 4HLCA 2LUOA 2VQDA 1O2DA 1QAQA 2DWCA 3L7JA 3OJCA 4MP6A 2PA0A 2HMUA 2G4CA 5DYTA 3KHKA 3R7FA 1FJXA 4NCAA 1GZUA 3HV0A 3KV3O 1Z15A 3ZXIA 3UHFA 2O5RA 5ADVA 4HWKA 3H8JA 3HGTA 4NOJA 1EFLA 1AZTA 4NYJR 1U7WA 4D4JA 5K0GA 4BJ6A 2CMHA 4RW0A 4TMTA 3STUA 3IE1A 1MX5A 4YTEA 3FMGA 2IH4A 1X70A 2ZRIA 3ECSA 2CUNA 3JWHA 3OQ6A 1Z45A 2B4KA 3V4LA 3GFSA 1AKVA 3O9VA 1JHOA 4I4TB 2B5OA 4M0KA 3LS2A 2GF2A 3RTCA 4QTTB 2DQSA 3H5VA 4QG7A 2C0QA 3JZIA 4KTVE 4UU0A 3RC2A 2BEUA 3WLQA 1QG2A 5IDVA 4FFLA 4F4IA 4CXMA 4FSXA 1E79A 3MTJA 4JEHA 4U2KA 5FYQA 2GZ2A 1ZC3A 3O84A 5SZIA 1JPNA 4WXRA 1GL9B 1PAUA 1QVVA 2EP5A 2QT0A 2Y6VA 3LBAA 4AJEA 1FZTA 1YONA 3HUEA 1FP1D 1RRPA 2PUTA 2Y8EA 1P4GA 2H1CA 4JCCA 3C0KA 3PQFA 4XI9A 3ENQA 4CKZA 1JEAA 3ZNNA 4DCSA 1WW3A 4GSKA 2V6BA 3ZXYA 1AK9A 4LK2A 1M8JA 1NVUQ 5L3ZA 3R4CA 1TYAE 4D3ZA 4EBFA 3HRHA 3WNDA 3WA6A 4DB4A 1NJ5A 2DTEA 4LK3A 4ND4A 3WAJA 1CUCA 2HX1A 2VSFA 5HCUA 3COPA 2NSDA 1BMFA 3ZBUA 4GIBA 3GGGA 2E4XA 2FHPA 1UM9B 4I1YA 4YQYA 5AWFC 3SXPA 3WLKX 2ZJ1A 4NBLA 5F7ZA 1SHKA 5GVRA 4G5SA 4RCZA 1BWPA 3UKDA 4V0LA 1MAHA 4ZOAA 4C6HA 1H5UA 4XUEA 2RHWA 1U8TA 2XMGA 2AWOA 1VHTA 2P9YA 1MOSA 3KWLA 4DGQA 4OXIA 2BEVA 2VZLA 3CT6A 4UTVA 2C5EA 4C78A 4GDMA 1QHXA 1IUNA 1GADO 2EFCB 2QYHA 3ICEA 4L6CA 3W05A 3ZCRA 4LNAA 4WV3A 1Z6YA 5E2AA 1EXWA 1CW2B 1XU4A 5E4JA 1DTWA 1VCHA 3A11A 3M49A 4OXYA 5KVSA 1SBHA 3ZV6A 4IYJA 2FF5A 4QTZA 2H11A 4NCXA 1MU0A 2WKPA 4FBMA 4O8CA 3AY0A 5FWXA 3SBEA 4XVQA 4CCSA 1ESMA 2IYUA 3DXXA 1A04A 2RHHA 2VF4X 1CY4A 2A0WA 4YACA 2V3WA 1XD2A 4G37A 5JCZA 2J3IA 1UPUA 1I2ZA 4GZLA 2JFYA 3PXDA 2H2FA 4FYKA 4HTFB 4W1PA 5AHXA 4ZT5A 2R79A 2DFDA 4XD7D 1ISSA 3E58A 4Y2RA 2QORA 3BA6A 4L9SA 1LPOA 2HLDA 3SIWA 4YXWD 4O1IA 3QVGA 4JXZA 3ONWA 2D2VA 2LBPA 5EYPA 3TUZC 1JEEA 4MWDA 3EEIA 1VL8A 4ES6A 3M4NA 2IITA 1B2LA 3GH1A 5FAXA 4KPEC 2C4VA 3LUBA 4ZHQB 3CMCO 4KBGA 2INGX 4ASUD 4IQ0A 2Q6KA 3AF3A 3MJ4A 2ZS7A 4BNMA 1HQYE 1OQAA 3JQFA 4LW8A 2HA2A 4Y1GA 2WNSA 3EWIA 5H3CA 2D0IA 1IY8A 1RQGA 3UV6A 4LDQA 3L1JA 3RJMA 3FDZA 4F84A 1B8UA 2FWNA 4OQXA 1A98A 2VJPA 2FTKE 2YJZA 2FZ4A 1KI7A 3BMCA 3LLSA 1UT5A 5KUTA 2RHRA 3QF4B 4PGGA 1AG9A 3S1AB 2I6FA 5I48A 4C03A 4MQ4A 2F48A 3I76A 3RIEA 2R00A 3WGTA 4WN3A 1JVBA 1XLWA 2F1JA 4WXEA 3OFVA 1UBRS 2DUMA 2QNRA 1T5D