3BYZA

2-amino-1,3-thiazol-4(5h)-ones as potent and selective 11-hydroxysteroid dehydrogenase type 1 inhibitors
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
258
structure length
258
Chain Sequence
EEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
publication title 2-amino-1,3-thiazol-4(5H)-ones as potent and selective 11beta-hydroxysteroid dehydrogenase type 1 inhibitors: enzyme-ligand co-crystal structure and demonstration of pharmacodynamic effects in C57Bl/6 mice.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 87
structure length 258
sequence length 258
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2008-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3byzA00
1IZ0A 4MPDA 4LVCA 2XPCA 4A26A 4FC7A 4OMUA 4J4HA 4OYRA 1ZFNA 1ZVMA 4YYZA 2DC1A 5TSDA 1LC3A 1OAAA 1P33A 3AJRA 3I6IA 3V1YA 2I3GA 1WNTA 4PIVA 5L3ZA 4BOYA 1UP7A 5DCWA 5JCJA 3JQ8A 4YCAA 4CMIA 2IZ1A 1HWYA 4EEZA 5C37A 3JQ8B 5DF1A 5C7IO 3IKVA 4CMIB 3OJ0A 2IE0A 4UREA 3ULKA 3WMXA 3U3XA 5DBGA 3DOJA 3P2OA 4FDAA 4XZ3A 1LXCA 3OQ6A 3TDKA 4H3VA 4KOAA 5ITWA 2I67A 3E9NA 1DPGA 1ZSYA 1M76A 5G2OA 3ZNQA 5JC8A 1KIFA 1RM5A 1LEHA 2POQX 4IGEA 3OHSX 4OKNA 3ZWOA 1NM5A 5KJ1A 5C5IA 1KEPA 2VQ3A 1Q0QA 3D3WB 1ZZEA 1OC2A 4I5FA 1P1KA 3VZPA 4F6CA 2PY6A 2HU2A 1DB3A 1B0AA 2CNBA 3ZWPA 4NBVA 3DZHA 4YT5A 3UXYA 5BNFA 3RC1A 3VHRA 1WMBA 3OP4A 1EUDA 3JQGA 1E5QA 1ARZA 3DWFA 2NTVA 4NR0A 4GPD1 4II2A 1LU9A 1LDBA 2VHVA 4JBGA 3Q1LA 4CR8A 3NT4A 4JJFA 5G0WA 1E77A 1Q7BA 3DONA 2ZATA 1HDYA 1ZMOA 1BW9B 4GX0A 4TRNA 2JAPA 4XRRA 1J49A 5AXDA 4FOSA 4CV2A 1NHWA 3PGXA 3L4BA 2BRUA 3N7UA 3I9KA 4YXFA 5KJCA 3DB2A 1DBVO 3TNLA 3CMMA 5DT9A 4ZGWA 3JTMA 4BKPA 1V35A 3PFWO 3DDNA 2DUUA 2CVQA 1YDWA 2BMAA 3TFQA 1AGNA 2W2KA 4GKBA 5L40A 3KETA 3QWIA 2ZK7A 2VCYA 3QWAA 1P1RA 4ZJUA 2BD0A 1M75A 1U8FO 2P2SA 3QJ5A 3S2GA 4EW6A 4H16A 3MJSA 4DC1A 5JNLA 3GT0A 4BNZA 3ITDA 4J49A 2EJWA 1WW8A 2Y0EA 1YKFA 1PJCA 4Z0PA 1EDZA 3GEGA 1ZK2A 1SZJG 2BLLA 2B4RO 4J1QA 4N5NA 5CDYA 4BO0A 5JDCC 1GY8A 1XQ1A 3WTCA 5EERA 5ADHA 3QE3A 4H15A 4J1SA 4AG3A 3Q9NA 1O8CA 4BNFA 1PS9A 1X15A 3GZ4A 3E03A 1QLHA 4J9VA 1ZK3A 2FPPA 2RAFA 4CM9A 2Y1GA 2YQ5A 5TX7A 3B1JA 4IDDA 1NPYA 5TT0A 2ZCUA 5EJ2A 3JYNA 5B4UA 3KBOA 3ST7A 3O8QB 2DKNA 3WWZA 4KZPA 4BKQA 3WGQA 3EK2A 4R69A 4P8RA 5TJ9A 1PL8A 4YT8A 3TPCA 4RLHA 2OOSA 3ZWXA 4J4BA 1WLYA 2BGLA 1SAYA 1QV7A 5THKA 3JQEA 3DTYA 1XLTA 1E1MA 1O0SA 1T2DA 2BGMA 4O6VA 1R4MB 3V8BA 1XGKA 1PS0A 2JL1A 4R01A 3DZFA 1GYPA 1NQAO 4OXNA 1N1EA 3ZWBA 4DC0A 4R51A 2OP1A 3QQPA 3ZW9A 5A05A 4EYEA 5HWSA 1LDYA 3NRCA 4LRSB 2DVMA 1E7WA 4DIOA 2GYYA 4J90A 3W1VA 1GDHA 1HRDA 1AE1A 1DO8A 4NPCA 3FR8A 3LYLA 1IPFA 3U4CA 1PQUA 1YS4A 2W2LD 3DZKA 3C7AA 4ONEA 1A7AA 4BNYA 4ESOA 1T2FA 4XEHA 3AY3A 1SEVA 3JYOA 5FWNA 4YRDA 5L7YA 3OFSA 4NBWA 4Y8VA 2Y1CA 3KZVA 4WKGA 1EBUA 4EZBA 4A0SA 2WJPA 1ZSNA 3OSUA 3DQPA 2D5CA 3AUAA 4FN4A 4K6CA 1Z75A 2Q2QA 4NQZA 2VHZA 4PRLA 2C29D 3VC7A 1GU7A 1EK6A 2FPIA 2GR9A 2X9VA 3ETGA 3OBBA 4CMAA 4HFNA 3WFIA 1HF3A 4IPTA 5G4KA 3RCBA 4IIUA 4R41A 1X14A 2CDBA 3VPXA 2Q1SA 5ICSA 5G4KB 2YHIA 3H9UA 2WWRA 2P91A 1QYDA 4CODB 3RJ9A 3MOGA 1N7GA 1P77A 2YHIB 2GO1A 3GR6A 4A27A 3L0DA 2AXQA 3AM5A 2X23A 5G0VA 1IHXA 4YJDA 1U2DA 1M6WA 1S6YA 4D3FA 2QRKA 3EHEA 3F5QA 5K6AA 3HB4X 3TF5A 4BNHA 1H93A 4YACA 5AQ1A 3DOOA 2ZYGA 3AI2A 3D5TA 3UH1A 1N92A 6ADHA 4D44A 4R3WA 3NT2A 1PGOA 4FJ0A 3GH3A 4BNJA 5L53A 2RIRA 4PLPA 1X13A 4JLWA 3VPHA 2VYVA 3WGOA 4B79A 2PH3A 5IZ4A 1VJ1A 4YQZA 1DIHA 3SJUA 3BIOA 1R66A 3L6OO 3JD4A 1I5RA 4PLWA 3WJ7A 5DCYA 3NYWA 4YJGA 4OQYA 2Q99A 4ZQHA 4YJGB 1AXEA 3TL2A 1KETA 1IPEA 1ID1A 2PKRA 4J6FA 4Q3NA 2WE7A 2YQ4A 3PDUA 4IY1A 3OECA 4J43A 1UZMA 4B7CA 3OIGA 4QFDA 1E3SA 1Y1PA 2D5AA 4JBIA 1B3BA 3WIDA 4B3HA 3O03A 2A35A 1SO8A 2Y1OA 5BQFA 5U9CA 4BQRA 3W4KA 4RPJA 3NV9A 3TRIA 1DEHA 1NXQA 4WPGA 4E4YA 3GK3A 1ISHA 1ZK1A 1BRMA 3GLQA 4OH1A 2OXIA 2GERA 4IDAA 3VH2A 4EJ6A 5HRUA 5A9RA 1RWBA 3SJ7A 2HUNA 1GCOA 4D0SA 4P38A 2X9NA 5LCXA 2FZWA 4UVEA 5ILOA 3OF2A 3WSVA 2OUIA 3BMQA 3VKUA 4K6FA 2NTNA 3LDHA 5CEEA 1JKIA 4RQTA 4RPLA 5I7EA 3RUDA 4IXTA 3BMQB 1LX6A 2Y66A 4L4XA 3F9IA 1ENZA 1LSJA 1UXIA 2WSBA 3GEMA 3OA0A 4EUFA 4J0FA 1F8FA 3NEPX 2PZMA 3PIDA 1JDJA 3STHA 1X7DA 1UXHA 3H3FA 3QLJA 1R12A 2UDPA 1UXGA 4IJVA 3LU1A 3QSGA 2Y1DA 4Z9FA 3WLFA 1T1RA 2Y68A 1OBFO 4P4GA 1HSZA 5ITVA 1CJCA 1E1NA 4HP8A 2HSDA 3NJ4A 4HV4A 1C3VA 5B4VA 1FXSA 2PGDA 1OC4A 3WJAA 3PWZA 5A3VA 4E13A 1RPNA 3K2BA 4ND4A 5TNXA 4CV1A 3U5TA 1R16A 3H2SA 3VVCA 1PJQA 1HZZA 2IZ0A 2XXBA 3H9GA 1KEUA 3RUFA 2DBZA 3AI1A 4CM3A 3I9JA 4BNTA 4CR7A 2Q4EA 5FYDA 4Z3DA 5DP1A 1EBFA 4M49A 2B69A 4NJMA 3KEQA 4A10A 3DZJA 5F3RA 1LLQA 2AA3A 2EP7A 3ROQA 4NJMB 1GV1A 3DBRA 4L8VA 2G5CA 3NDIA 4L76A 2DM6A 2YV2A 3OJEA 3QRWA 1A72A 3DBRB 4XD2A 3GNQA 1CRWG 1PU2A 1XU7A 2IEDA 3PTZA 1GEEA 2A92A 1WWKA 1O89A 1F12A 5CPFA 4BNIA 4CR6A 1VM6A 2PZLA 5DULA 4E2XA 5IG2A 1H2BA 4J2OA 2W90A 1XKQA 5AOVA 1IULA 2B5WA 3EY4A 1A5ZA 1Z6ZA 2IRWA 2PGLA 4WLNA 2YW9A 1HTBA 5EL0A 3X2FA 4C7JA 1VL0A 5TF4A 5CG1A 1GFSA 5KNLA 3A14A 4HFRA 3RU9A 4CLOA 3GVIA 1I2CA 3D7LA 3KO8A 5I7SA 4H7PA 3IQDB 4AJ1A 4CLOB 1UP4A 4G81A 2EERA 1EQUA 2F00A 4IINA 5IF3A 1Y9EA 1I2BA 2O4CA 1ZCJA 4R1UA 4CMGA 4TVOA 3EYWA 1XEAA 2O3TA 3HN7A 4I9UA 3L6DA 3LVFO 3EZLA 3ZN2A 4UVIA 4NIMA 3FSRA 1VKOA 2ZYAA 4HFMA 1JN0A 1YBVA 1DOHA 2ZQZA 4E2ZA 3KOUA 3G1UA 4PFJA 4FFNA 3ZCXA 1IZ9A 4OGWA 3K8ZA 3UCFA 3VKVA 2V6MA 4QEDA 2B4QA 2BI7A 5KVSA 2EEZA 4YTEA 5LC1A 3WB9A 1YB1A 4IM7A 1F14A 4S3MA 4ZVVA 3JD0A 2D8AA 1EQ2A 5COBA 1MV8A 2O3RA 1I01A 4FCCA 3VPGA 1KVTA 3UCEA 4KMSA 4WNIA 2OP0A 4QQRA 2VT3A 2O50A 4RF4A 3PQDA 1X0XA 3B6ZA 1T2EA 4CLEA 5T57A 3ASVA 1VPDA 3DC2A 3P2YA 1PJTA 1MFZA 2HAEA 4OAQA 4KDEA 5B1YA 3ZU2A 5CFZA 4XJSA 3EDMA 1DJNA 4M89A 3WGYA 1J4AA 4PG6A 2AG8A 4XGNA 3PJDA 4WNCA 4MKXA 2I3AA 3MTJA 4RF2A 4LISA 2BFPA 3CIFA 2FR1A 3WTBA 3VTFA 1XU9A 1UR5A 3DMTC 3MJEA 3UHAA 2PV7A 4MVJE 4BL5A 1E1KA 4MJLA 3R3JA 1TT5A 4UUOA 2VWPA 4CV3A 4YAKA 1TT5B 1R4NA 1E6WA 2WTBA 1QYVA 4TSKA 3L4SO 3DZGA 3BMNA 3JQBC 5IFLA 2P9GA 2FSSA 1GUZA 2E82A 4AJKA 1BHSA 3BMNB 4EGFA 4BKUA 2NU6A 4ND3A 1RM3A 1G0OA 2H6EA 5CDGA 1YOVB 4WLVA 1NQ5A 1UAGA 3KHUA 1UDBA 4FSHA 1P31A 5GMOA 4XRGA 1YONA 3IOYA 3MEQA 3VZQA 3RWBA 1VI2A 1YRLA 5T6BA 1O5IA 1YQXA 4CM7A 3PDJA 2CD9A 4GLOA 2EGGA 2R00C 3K96A 3LT1A 5TIIA 4Q3DA 3C85A 1TI7A 5ICMA 3AWDA 3U0BA 1BXGB 2NVWA 4FFLA 1EMDA 2C07A 3NTRA 4EITA 3KYDB 3E9MA 2G1UA 5EQDA 1I32A 1PGPA 5BT9A 4GMGA 1IHYA 2DT5A 4TKLA 4U0JA 5IDYA 5KCZA 1ULSA 3R1IA 3O38A 4FQ8A 3TN7A 3TWOA 1ISGA 3FI9A 5AVOA 4GGOA 4QUKA 3GC6A 1E92A 4IIVA 4ZQEA 2UYYA 3BTSA 5JLAA 2VZ8A 4P22A 5JSFA 1NHGA 3PJFA 3BHMA 3C1OA 4WCFA 5A06A 2BKAA 2I5PO 3EW7A 1NR1A 3A28A 1C1XA 4WCFB 4CQMD 4IS3A 2O3UA 2EG9A 1KEWA 3JYPA 3W6UA 1MLDA 1YQGA 2TMGA 4IQ0A 4GKVA 5A5EA 3PIIA 1ZEMA 2PK3A 1QSGA 4J7XA 2W2LA 3UICA 1OI7A 4DREA 2O2YA 3GFBA 1U3WA 2AQ8A 2HMUA 1GPJA 1PZGA 3WS7A 1AUPA 1Q2XA 2Q46A 1KVQA 5DNAA 4DYVA 3F1LA 3OIFA 4XR4A 4BO9A 4D0RA 2X0JA 4YJFA 3NT5A 2WD8A 2HKIA 4KUHA 3GDGA 3SLGA 2ZYDA 3WLEA 4E5YA 1E3LA 4MVJI 4DRYA 4OQZA 3NKLA 3AW9A 4KWHA 3HN2A 2GUGA 1XYGA 4EDFA 8ADHA 1DIRA 4CLRB 3GZNA 4RVDA 2HDHA 1P45A 4BNXA 5KJ6A 1ENOA 1XELA 3JYLA 1M66A 3GZNB 5COAA 2TMDA 2VHYA 4MIEA 1XR3A 1U3UA 1K6XA 5JO9A 4CUZA 2NVBA 4ALNA 2JD1A 4KQXA 1QG6A 1W6UA 1DJQA 3AOEA 3UOGA 5FF9A 2HMSA 1DSSG 1CYDA 2HRZA 1WP4A 3FNGA 3I5MA 5F1OA 4Z9YA 2O2SA 1VSVA 3DO5A 3ZV5A 1LJ8A 3T4EA 5DOZA 4AVYA 1Y9AA 2JFGA 3BTUA 4JIGA 3NJ8A 4R9RA 3PLRA 2C82A 3IJPA 4ND1A 5EINA 3WGZA 4E31A 1ZH8A 1RYEA 4TRJA 1ZW1A 3OICA 3I9LA 4OO3A 4A2CA 1VLLA 3HQ4O 3E1KA 1DRVA 4R9SA 4Y9DA 3DAFA 4BO7A 4I1IA 1BMDA 2RBEA 1E7QA 3GUCA 3H5AA 1BWSA 3JSAA 1EUZA 3CXRA 2Z95A 2WMDA 3OM9A 1LRKA 3KLPX 2C20A 3BTVA 4IJWA 1P0CA 4BO1A 5CEJA 1KVUA 7MDHA 1T26A 2HCTA 4NHEA 4PLFA 4R68A 1CDOA 4YQYA 3ROMA 4F46A 4I9HA 1R0SA 2WYWA 3IKTA 4A73A 4FB5A 2ET6A 2LDBA 2VWGA 3VDQA 5JY6A 2GN4A 1ML3A 4JJIA 4WJZA 4RPGA 4KUEA 2GLXA 5FEUA 8LDHA 3JQFA 1UP6A 3OQBA 4EJMA 3ZW8A 1BDBA 4XA8A 1U4SA 4MIYA 2HK8A 2D4AA 2XOXA 4LN1A 1TVEA 3UCXA 1ZJZA 4Z3KA 4CMBA 4NK5A 5K9ZA 1EZ4A 3X2EA 1JVBA 4Q9NA 4PLHA 1KOLA 2QYTA 2ZKLA 4O63O 3ZWCA 2EKLA 1HDRA 2XAAA 2I65A 3R3SA 3VAZA 4E30A 3R6DA 1NVTA 4QX6A 3G49A 1O6ZA 3C7CB 3PFFA 3U4IA 3PHJA 4M55A 1NAHA 4RVUA 1UH5A 4JJGA 1QLJA 1T2CA 3WGGA 3D3WA 4NG5A 3A9WA 5AXCA 1QYCA 1PSDA 3HDQA 4K26A 1RJWA 3JQ7B 3OETA 2VZ9A 4BO5A 3NX4A 5I9NA 2O48X 1HSOA 1HE2A 4WEQA 4YVFA 2BELA 3W8EA 2JAHA 1U2GA 4GQAA 4IDCA 1E1LA 1E3WB 2AQIA 3AOGA 3PZBA 4S1VA 4CQLA 4E2WA 4CM1A 3PQEA 4W7HA 1B2LA 4BB5A 3M1AA 4CQLB 4L4SA 2AQKA 1LRJA 3PVZA 4YBZA 4YDRA 4W9NA 4E5MA 3W6ZA 2OMEA 1KY5A 4LCEA 1I3KA 1MGOA 2W98A 3L4BC 4L0QA 1G1AA 3PHGA 4OSPA 1GUYA 5HS6A 4CLHA 3QW2A 3S2IA 1BW9A 1N8KA 3GDFA 3W8FA 3ANMA 4MVJH 4GMFA 5K0ZA 4FGSA 4PLVA 1H0KA 1B14A 1GPDG 4Q3AA 2NADA 4NNJA 4ZQGA 4CMEC 3UUWA 4K1LA 3PHLA 3COSA 4WEOA 5EQFA 2YZ7A 4QECA 1EVZA 2V7PA 3JD1A 4DVJA 5CAEA 1A71A 1DLIA 2D0IA 1KBZA 1MXFA 3QWBA 4INAA 1ENYA 4PG8A 1CQIA 3DXFA 3K9QO 4BMSA 2Q1TA 1ISFA 1FDTA 2OGUA 2FN7A 4KP7A 3OEWA 3O9ZA 5KKCA 3GVCA 1IOLA 3DZIA 2FP4A 4BO8A 3IUPA 1SPXA 3GDOA 2I66A 4BGEA 1JQBA 2JJYA 2GASA 4PN3A 5JXWA 1R0KA 4PCVA 5F21A 4FFMA 1ZEJA 2X5KO 5MDHA 1IUKA 1QKIA 4NFSA 3G79A 3NGLA 3BHIA 1K3TA 2IXBA 4N7RA 4J7CA 2YYYA 4ZHSA 4DIBA 5L9AA 1GD1O 1FJHA 1OOEA 1YGYA 1AHIA 1GCUA 4ZRMA 2QIOA 4OKIA 3ETDA 3RSHA 2PA3A 3NDRA 4R5HA 5I7VA 6LDHA 3RASA 1BXZA 1DC5A 3BZUA 1MA0A 1JLLA 3ONDA 3GPIA 4IJUA 2WYUA 3IIEA 5BSFA 1FDSA 1TEHA 1Q7CA 2JCYA 4MINA 4DPKA 2AW5A 1X0VA 3BHJA 4WLOA 4XYBA 1YE3A 2UVDA 2YFQA 3AY6A 1SNYA 4MVJF 5ER6A 3O8QA 4E12A 4XWYA 1R37A 3WG9A 4B7UA 4URFA 3GG2A 4MOWA 2DUWA 4OXYA 1D8AA 3O4RA 2H9IA 5G4LA 3PYMA 2W4QA 3RBXA 3SLKA 1QV6A 4RL6A 3RROA 3H6KA 1DIAA 4IDBA 1PQPA 2EKPA 4LW8A 1QYWA 5TQVA 4XJTA 4ALIA 4AJIA 1R4MA 3FHLA 2VHXA 4YRAA 1DFHA 2D1YA 4D42A 2X6TA 1K2WA 3WICA 1F06A 4PZEA 1LDNA 4OM8A 1DC3A 5DP2A 4ZRNA 4GSKA 3ZWMA 1PIWA 1LBEA 4BGUA 3W4IA 1YVEI 1GUFA 4J1TA 4DMLA 3FWZA 4IUYA 2I76A 1K0UA 1RKXA 3RJ5A 4BO3A 1Z7BA 3BTOA 3DFZA 4EI2A 3F46A 1Z7EA 1LI4A 3MZ0A 1H6DA 3JQ6A 1HE4A 4ITUA 3LQFA 3WGHA 1EVJA 1V3VA 3OJOA 4MVJD 4E6PA 1CWUA 4J16A 1V3UA 2FRDA 5AXAA 3GN1A 5TS3A 1KERA 2H63A 2Y99A 2O7SA 1NP3A 5A5FA 4YPOA 5L4NA 2IEBA 3E6AA 1XDWA 2W8ZA 3E8XA 1U3TA 2QW8A 4LMPA 3RUCA 3WDSA 3WXBA 5CHEA 5K6AC 1HKUA 3D1LA 3H8VA 4XQCA 5DOVA 4OHUA 1P44A 3M6IA 1HDZA 4GAEA 3F5SA 1V6AA 3GVHA 1ENPA 3M2TA 5TC4A 4BNKA 1QRRA 4HBGA 1BXKA 9LDTA 4U8GA 1PZEA 2NTJA 1PJ3A 5JYDA 1IL0A 5KVQA 3WMWA 4ALJA 1TB4A 3HADA 3RBVA 3RKRA 4PG4A 3RUIA 1PX0A 4E5NA 2V6GA 4DBZA 3GF4A 4CM8A 5KVCA 5L7WA 1A7KA 1CIVA 1YJ8A 4JCOA 3SXPA 3RKUA 2J3HA 4CM8B 5T8KC 1LDGA 1NVMB 1HDGO 3GN2A 3ANLA 3LZ6A 3QVOA 5TT1A 4B4WA 4CQMA 4JNKA 4CQMB 4KTTE 2BGKA 4DMMA 2XF8A 5H81A 3F4BA 3H7AA 3DR3A 4FFOA 4BO4A 3OJFA 4RVFA 3WOHA 4LSMA 3IMFA 4D43A 1XQ6A 3QWHA 3PJGA 4P4NA 1YBMA 3IP1A 2AQHA 4HY3A 1ZXLA 2RHCA 2ZTLA 1U28A 5JMWA 4TQGA 3AFNA 3KB6A 1NPTO 1U5CA 4PLYA 1ZJYA 1N7HA 4U7WA 3P7MA 4GGPA 4MVJM 4P4LA 4JQCA 5TGDA 5LDHA 1P9LA 4DXHA 4BNGA 3H2ZA 4CL3A 3WFJA 3WX0A 4R1SA 3JQAD 4QTZA 2X5OA 2YFHA 4CUKA 1PWXA 5TRTA 4RZHA 5T67A 4FIZA 1DIGA 2JHGA 4ZD6A 3GA0A 4WCDA 2VN8A 3RAJA 2X5JO 3WBBA 3H3JA 3K5PA 4I5EA 3U49A 1H94A 2R6JA 1CQJA 3I9OA 4ZU3A 1VJTA 3HDJA 3A1NA 2B35A 5A1TA 3PPIA 5MGBA 3L6EA 1N5DA 4ZQFA 3ZNPA 3ON5A 1C14A 3KLMX 5AYVA 3RC7A 3U4DA 4RZIA 1MP0A 3DFUA 2JFFA 1GYQA 3EVTA 3ANNA 5L4SA 1T2AA 3U4HA 1J6UA 4J91A 2OZPA 3K6JA 4HNGA 3RBZA 2XXJA 3FWNA 2O7QA 4DYDA 5TLSA 3GGOA 1P1FA 2CVOA 4YAGA 2YY7A 3F47A 1EEHA 1X1TA 1I2ZA 1E3IA 1DAOA 4KWIA 3TJRA 2DFDA 1WDLA 3CZMA 2IZZA 2QX7A 4IDFA 1LSUA 1BG6A 4MKRA 4A7PA 4OL9A 3VZSA 9LDBA 4J9UE 4B7XA 4D46A 3I83A 5CG2A 1C0PA 4C7KA 1EK5A 1BDMA 1F17A 1HXHA 2FSVA 2CZCA 3HWRA 5TJHA 3DAPA 4E3ZA 1MC5A 2ZB3A 4GBJA 3TZKA 4XIYA 3RUEA 1XG5A 4L73A 3E82A 4R5MA 3GNSA 3LK7A 4UUNA 4MO2A 1F0YA 3HE3A 4DQXA 1EDOA 2X7HA 3RFTA 1MG0A 3VZRA 1T25A 2DBQA 2EW2A 5DCUA 4NFYA 3WNQA 4GLLA 2CDAA 5B12A 3PXXA 4F45A 1C0KA 4R3NA 2X4GA 4WASA 2WE8A 3HFSA 1J5PA 3FTNA 2HMTA 2LDXA 2JCXA 1QMGA 2Y93A 3TZHA 4D45A 3QIVA 1HT0A 3AFMA 4FFPA 4J0EA 4UUMA 1GZ4A 1GADO 2Y67A 5FI5A 1FK8A 5G0TA 2QQ5A 1E5LA 3U62A 5B37A 1T4BA 1DHRA 3I4CA 1I8TA 3MJTA 4WOKA 2P9EA 5C3MA 4NDNE 4YJHA 1B8UA 1GEGA 4XDYA 1S7CA 2OO5A 1W0CA 4I9NA 2NWQA 5BSGA 2FMUA 4LCJA 4YJHB 4ALKA 1MXHA 2I99A 5H83A 1ZMTA 4AICA 3VH4A 5BSHA 2P68A 3KTDA 1GZ6A 1UJMA 3AY7A 3C24A 1YWGO 1GV0A 2SCUA 2VYND 2UAGA 2O4UX 4XX0A 2VWQA 4TKMA 3K30A 5BSEA 2B4TO 2VUTA 2NV6A 5ENDA 1M67A 1RM4A 2Q2WA 4XGIA 2WEKA 1KS9A 4B4OA 2ZB7A 3QVXA 4XYEA 3DEYX 2NQ8A 3FR7A 2HQ1A 2Z1NA 4GX2A 5EESA 4F6LA 3KYCB 4CLDA 1X1EA 4YWJA 1WZEA 3BA1A 2GCGA 1SEPA 3F3SA 5U4QA 4TVBA 4IDGA 2Q1UA 1KC3A 1LLUA 1WMAA 4AJOA 5KVVA 1F8GA 2O3SA 4JN6B 3EVNA 3T4XA 2Q2VA 4LK3A 4K28A 1R15A 1GQQA 4X54A 4I08A 1JTVA 3FPLA 4RORA 4CM5A 4NI5A 4J4TA 1KVSA 2O23A 4XDZA 3D4NA 1GTMA 1V9LA 1A4IA 2VT2A 3DHYA 1PJSA 2NVUA 4R1NA 1U7TA 2ZB8A 3QVTA 4FS3A 1JU9A 3QHAA 2NVUB 4LMRA 1VE9A 2YHUA 2WD7A 3FNEA 3HDYA 4YA6A 3OH8A 3HG7A 3ZWVA 2D2IA 1JAXA 2WD7B 3CZRA 1PGJA 1H9AA 1IE3A 2JD2A 3RIHA 4BKOA 2FHSA 2YUTA 2FR0A 1DFIA 4YR9A 4YB8A 4G65A 2B36A 3G3EA 2V65A 1YOVA 4PRKA 3D0OA 4C4OA 4BV8A 2AE1A 2DAPA 1PS8A 3HJAA 4E0BA 5A03A 2IXAA 5BNTA 2DPHA 5B4TA 2YDXA 1UXKA 3GRKA 5JYEA 1MB4A 1XIVA 4FD3A 1PQWA 4RGBA 4IMRA 3CSDA 1I36A 3JCZA 5L4LA 1BXGA 4GX1A 1ZUD1 4NH4A 5L7TA 2VTEA 3GFGA 3FPCA 1LQTA 4HADA 1E7YA 1SC6A 3IC5A 3GOHA 3KYDA 5T5QA 3RUHA 3BMCA 5JBIA 3T7CA 5JDIA 3ASUA 1VRWA 4ALLA 3ZNOA 2BI8A 3H9QA 2PTGA 3BMCB 1HDXA 1ISMA 4WCFC 2DLDA 5F1KA 3ZDFA 5IXYA 3IL2A 1C1DA 3UAGA 4Q3CA 4YEDA 3WYBA 3PJEA 1C1DB 5HBRA 1NTOA 2O3JA 5ILGA 4BNLA 4TZKA 1ZBQA 1W73A 3GG9A 1KVRA 1Y8QA 2J5KA 3INRA 5JMPA 4A5OA 1VC2A 1Y8QB 3A4VA 2Y1EA 2X0NA 1HL3A 3DL2A 1C0IA 4M54A 5EMHA 3RD5A 4UVDA 2OFPA 1N1GA 4HNHA 1E7SA 1U1IA 5F5NA 3H4VA 2NUAA 4D79A 4DQVA 4WUVA 3I23A 5CDTA 2R2GA 4J2HA 1DRUA 4HXYA 4OOFA 4MVJA 1V3TA 1QP8A 2C7VA 3VOSA 5COQA 1DC6A 1YL5A 4BHTA 1PZFA 3GRPA 4O59O 3R0IA 3KSUA 3INGA 3T7EA 5T64A 1LC0A 4GL4A 3KSZO 3Q2IA 1UUFA 4Y6SA 1BVUA 4CM4A 5C7OO 1X7HA 4ZN6A 3MCVA 1VL6A 3RQSA 2HJRA 4CLRA 2GN9A 1NX6A 4CM4B 1BVRA 2X0RA 3KYBA 4E32A 1MC4A 1A9ZA 2QG4A 5HM8A 2F1KA 3PGJA 4XIJA 4UEJA 4N18A 3M1LA 3WGTA 3K31A 4DPLA 2BF7A 2V6FA 4PLCA 1PGNA 3B20A 1FMCA 3H5NA 4BNMA 3ZNNA 4IBOA 5I7FA 4AJPA 1I10A 2E37A 3AK4A 3FCOA 3KM0A 1NFRA 1HYGA 4CLXA 4EUEA 3B1KA 1LSSA 5CPBA 2VWHA 3OMLA 3IAHA 1NR7A 3H5RA 4RJTA 4DPMA 2PD3A 4L9RA 1DHTA 2Z5LA 3RC9A 4XYLA 4DLBA 1EE9A 1TXGA 1U5AA 1ISIA 3PEFA 1LNQA 5C7LO 3G17A 4KTVE 1D1TA 4B8ZA 1HYEA 1B15A 2DFVA 3L9XA 4HWKA 4IZHA 2Q50A 2PNFA 1VJ0A 1Q7GA 3JQ9A 1Z74A 4EJ0A 3ICPA 2PD4A 2OHXA 1E0DA 4Z0TA 5KTKA 3GEDA 4IS2A 5AXBA 4NBRA 1P1IA 4LVUA 2QRLA 1PTJA 4BO2A 4OOEA 3JQFC 4J3FA 3P5SA 1ISJA 4HFJA 3TL3A 4I5DA 3ZWAA 3E18A 3QWFA 3C1AA 4B4VA 4NU6A 2C54A 3BMOB 3LT4A 3GVXA 1VKNA 3PHHA 1HEUA 1UAYA 4ZA2A 7ADHA 3HZZA 3I52A 2BHLA 1ONNA 4JP2A 3Q9UA 4AFNA 4FGWA 4NU5A 3JQAA 4RVGA 4RPHA 3FRJA 4B8WA 4BB6A 4GWKA 3HNPA 3JQAB 4WK6A 3SC6A 4XQEA 3GGGA 4XYGA 4W4TA 4YAEA 3EC7A 2PFGA 5IZCA 2HMVA 2UUPA 3GNTA 4WGGA 5A9TA 3DBHA 4RVSA 1LSOA 2UV8A 2DPGA 4FOOA 5KKAA 4E5PA 3F6YA 2A4KA 4PLGA 1PL7A 2PH5A 3DBHB 1HLDA 1NYTA 4JGBA 3UN1A 3UW3A 4GVXA 1PR9A 2GD1O 1EVYA 3KSDO 3SVTA 3D64A 4LSWA 3JQ7A 4II3A 4RQUA 4D41A 4CL8A 3CE6A 2VOJA 3DMYA 3JD3A 4M8SA 4CMCA 1YB4A 4QO7A 2VZ0A 2B83A 1WDKA 1LLDA 3NTQA 3TFOA 3CKYA 4MP6A 1HDOA 2J3IA 1I3NA 1FF9A 1E3WA 5JAIA 2QZZA 3CINA 4XQ9A 3NAQA 5A3JA 4W9NC 1PZHA 1SCUA 3GVPA 3E5MA 4LGVA 4RV9A 1B8VA 1T24A 2GN6A 4OXKA 5L51A 1WZIA 4YT2A 3GAZA 3VVBA 2D3TA 2P5YA 2GSDA 3CUKA 2RCYA 3S8MA 3ZU4A 5GZ6A 4ID9A 4PZDA 1YXMA 2EP5A 3D4PA 2ILTA 3MJ4A 1YDEA 2AE2A 3PRJA 2CY0A 3HUDA 2HJSA 1RM0A 4ND5A 3AU9A 5G0SA 1Q0LA 3MOIA 2NU9A 3ZWWA 2PWZA 4XCVA 1PJ2A 4M86A 2RH8A 1L1FA 4EUHA 3ZV6A 4TRMA 1IY8A 1GR0A 3D5QA 3JQGB 4R16A 1Q0HA 2IDZA 3PQFA 3ZI0A 1NASA 4JX8A 3K92A 4IDEA 1ADBA 1MUUA 1I24A 4CUJA 1LTHR 1BGVA 4RDHA 4UVHA 4XR9A 4DL9A 4AJEA 3I6QA 5LDGA 2HLPA 3TZ6A 2A94A 4IQGA 1QORA 4L74A 4E5KA 3VPSA 5FI3A 3CTMA 3ROPA 1IB6A 3M2PA 3PYXA 2ZTUA 2EF1A 1UZNA 1JW9B 1B3RA 2B37A 1JAYA 2GN8A 3ZH2A 2YDYA 2CVZA 3S55A 2QYSA 4GX5A 5DDIP 1Z73A 2VUSA 4WLUA 1D7OA 3C7DB 1NQTA 3PWKA 3AM3A 2VYNA 4CMEA 3Q6IA 3WQRA 3WIEA 4E21A 1XCBA 2W2KB 4BUCA 2PKQO 3E9QA 4AL4A 4F3YA 2NQTA 3DAGA 3RFXA 3SBOA 2DTXA 2CSUA 4Y6RA 1OZAA 2NSDA 4QSMA 1FDVA 3GUYA 3U09A 3SX2A 4TRRA 4CJXA 1DLJA 2GZ1A 2PGJA 3AU8A 4KDFA 5KOIA 2X0IA 3PI7A 4D3DA 2C2YA 4Y67A 4GI2A 2ZTVA 2VNAA 5CP8A 3V5NA 1G6KA 3INTA 2CF6A 3FTPA 4OIMA 5JDCA 2OBNA 1TLTA 4MP3A 2PZJA 1U9JA 1DC4A 2E49A 4PG7A 2G82A 3FNFA 4XGKA 3WQSB 2GNAA 5F1PA 5HS4A 2P4HX 3ENNA 3KUXA 4XQGA 1KYQA 1ONOA 4CPDA 4Q3EA 3TSCA 4OJNA 4FW8A 1O9BA 3DBLA 1X7GA 2GGSA 1MG5A 4NMHA 3C8MA 3LT2A 3ETEA 5GZ1A 1U3VA 2EKQA 3DBLB 3ZV3A 3IP3A 3ICCA 4HUJA 3DOCA 2VHWA 4D7AA 3WBFA 1T1SA 1XHLA 1I30A 5A4DA 1YJQA 3P19A 3E5RA 3VPFA 3CH6A 5GY7A 5L45A 5IAAA 4DQUA 2Q49A 3B1FA 1T4DA 1PJBA 1Y8RA 5DBFA 4MIOA 2NM0A 1HYHA 4QFCA 3DTTA 1Y8RB 2DTDA 1A9YA 3VH1A 3V1TC 4ILKA 1E3EA 1WDMA 1YBAA 3S2FA 2JHFA 3RI3A 4TROA 4ALMA 1LQUA 5HA5A 2DQ4A 1H5QA 2NU7A 4Z9XA 2VRCA 3LC1O 1UDCA 2QRJA 4I5GA 2VUUA 2GZ3A 3EGOA 1K6JA 4BNUA 2ZTMA 4MVJG 3ZU5A 1NVGA 2HRBA 4GH5A 1D4FA 2CMDA 2UUOA 2Q4BA 2BH9A 3CMCO 3CEAA 1YL6A 1CEQA 3AI3A 4WLEA 1V8BA 2IODA 2OBYA 2X22A 3FBGA 5BNIA 3EMKA 3ZHYA 1P1JA 3RC2A 4ZQBA 4BGIA 4FR5A 4OSOA 4FJ1A 3F1KA 1SB9A 2ZCVA 2EXXA 2AEMA 3GGPA 1L7EA 4N5LA 4UVGA 2E6UX 1O95A 3HHPA 5JAQA 1L7DA 2GF2A 1DFGA 1D1SA 1AHHA 4WE3A 3SC4A 2AMFA 2Q1WA 4BV9A 3D3EA 1YO6A 1JKFA 4MKZA 3AUSA 1FDUA 1P1HA 4WOJA 3LLVA 2Y0CA 2IYPA 1XSEA 1XWFA 2EW8A 3KXDA 4QXMA 5ER9A 5JE8A 2Q45A 2ZIZA 1DDOA 2CF5A 2ZQYA 2Y05A 4DIFA 3ZHZA 3ADPA 1A27A 3SEFA 4EBFA 5L95A 2AEJA 3OIDA 3UVEA 2ZJ0A 3JD2A 1LRLA 2HO5A 4CM6A 5U1PA 1G0NA 3GY0A 2QZ9A 2CUKA 3LC7O 4R1TA 3VTZA 5IJZA 1CF2O 4QO8A 4RPKA 4RF5A 1CERA 1YQDA 3GHHA 4JBHA 4U0KA 1AXGA 5T8KA 3WR5A 2EIHA 4FFRA 4AJLA 3ZHXA 4O1MA 1K5HA 1ZXBA 3I1JA 4L75A 4RDIA 1NFQA 2C5AA 2NACA 4FJ2A 3DHNA 4D3SA 1GYRA 1CETA 5EPOA 2BFOA 3BXXA 2GRAA 4RVHA 3FNHA 2V6BA 3ZGYA 4PG5A 4G2NA 4IGFA 4NBUA 3KRTA 3QVWA 1MX3A 1NPDA 3FBTA 1KEVA 4M87A 2HK9A 3VH3A 5JCJD 5THQA 1UDAA 4E2YA 4U6QA 4DTIA 3S2EA 5IDQA 3O26A 1M2WA 3NTOA 1BTOA 4XB1A 1J0XO 3ZHBA 1QXSA 4RLSA 4Z0HO 1Z82A 3FF4A 1SB8A 1H6AA 5JO0A 3GQVA 3Q11A 3FN4A 3JYQA 5A02A 5IDWA 3V1UA 5F5LA 1Y5RA 1DXYA 3ADOA 3VDRA 2PD6A 1PL6A 3ABIA 3K2EA 1QR6A 5GZ3A 4BMVA 2EHDA 5ENVA 1HE5A 3OJLA 4UUPA 1PR3A 3KEOA 4NZ9A 1SBYA 4DA9A 4IMPA 4DGSA 5EIOA 3B70A 2X9GA 1P3DA 1E7MA 1U8XX 2P5UA 1M6HA 2VTDA 3PHIA 1ZO8A 2AG5A 5ES3A 5A9SA 2IYOA 4E33A 2NLOA 3N58A 2EWMA 2J5QA 3ENKA 5A9SB 2DBRA 4O5OA 5FFFA 5IDXA 3NGXA 4RF3A 4TWRA 1ZSVA 1I3MA 4L4RA 1YB5A 4HX5A 2VNSA 2D59A 3OEYA 1JWBB 5EN4A 3BYZA 2GZ2A 1HZJA 3I3OA 4NBTA 2H5LA 1ZK0A 2PLAA 4NK4A 1TT7A 2B5VA 2FOIA 1EUCA 1PWZA 3HDHA 3KVOA 4J7UA 4U5QA 4N5MA 1GL3A 2EV9A 5JAZA 4WLFA 4EEXA 3UF0A 4W6ZA 4ND2A 1JKJA 2ZJ1A 4JROA 2EGHA 1EFLA 1K6IA 5JS6A 4DLLA 3IDSA 1EFKA 1ULUA 2JFHA 2FWMX 1ZNQO 5DZSA 2RHRA 3V2UA 3E48A 1PJ4A 2J3JA 3F4LA 1I0ZA 1VL8A 2FY8A 3CPSA 4IQ8A 3MWDB 1N2SA 2B0JA 4XB2A 2JCVA 1FDWA 1E6EA 5DN9A 2I9PA 1NWCA 4TZTA 3QV1A 5IN4A 5JCXA 4TMFA 3EZYA 3WQQA 3JQDA 4HKTA 2FR8A 3C1TA 3QY9A 4PVDA 3Q2KA 1JA9A 4K9DA 3KYCA 4IXWA 4Q3BA 4UEOA 2X1HA 4RCVA 1WVGA 3LF1A 3ORFA 4PGFA 4JP3A 4YAIA 3MJVA 3PLNA 3ZU3A 4BGVA 5CDSA 1SOVA 1SOWA 1Q1NA 1EVIA 3WGIA 1WPQA 5JPIA 2C59A 5JC1A 2X86A 1W8DA 4CM9D 3TQHA 5DBIA 5CDUA 2JKVA 5I8ZA 4KQWA 4B4UA 2OORA 3TZQA 1GAEO 1ADCA 4BS9A 1IYZA 2G17A 3H9JA 2OL4A 4XYMA 1ZKMA 4PVCA 5CEFA 4DUPA 3A06A 1N9GA 3AM4A 4FPXA 3UFXA 1E3JA 2DU8A 3L77A 4JK3A 1N9GB 1O94A 1ADFA 1W4ZA 3RU7A 2E48A 4Q39A 3BAZA 1ZK4A 2C7GA 2HMWA 1A4UA 3MJCA 1GQ2A 4NFHA 3C3XA 1XA0A 1WAMA 1WXDA 3QA9A 3GMDA 3GAFA 2Y0DA 2Z1MA 2WM3A 1RYDA 5JW6A 5I9LA 1B7GO 2NU8A 4BVAA 1DAPA 1ZIDA 1DRWA 1MFPA 3EAGA 5IN5A 3LF2A 3OA2A 3H9EO 4CMJA 3AUUA 3S1LA 2A9FA 4YT4A 1K89A 2CFCA 2VRCD 2YV3A 4N54A 3LT0A 1KY4A 3WSWA 2P4QA 4AJ2A 5I8WA 5JDIC 2YV1A 3DMTA 1GQYA 2J3KA 3ONFA 4FBGA 1R4NB 2C2XA 2WDZA 1U7HA 2HK7A 1I33A 3HB5X 1R0LA 4RO0A 4BMNA 5BR7A 1EE2A 1LDMA 3JV7A 4R4JA 4XKJA 2RH4A 3UGKA 1PEDA 3G1TA 4B3IA 3ROKA 2VRBA 4YRBA 3WNVA 3TOZA 1SMKA 3JQBA 2PKQP 3DZBA 4R54A 3DBVO 1ADGA 4QT0A 4U6SA 1HETA 2FZEA 3W4JA 2GDZA 2YJZA 4GSLA 1GZ3A 1PJLA 4W82A 3NUGA 2ZB4A 1P74A 3WYEA 3WYCA 3AUTA 1Z45A 5H82A 4JXKA 1P0FA 1QYXA 4MDHA 4NJOA 1LUAA 1YH3A 4J1NA 4LRTB 3ZZNA 1H9BA 2BFMA 5JY1A 4W7IA 5KJFA 2R00A 1TA4A 1DIBA 1JVSA 3PWSA 3PP8A 3QP9A 1HDCA 3D4OA 3Q3CA 1C0LA 2X8LA 2CDCA 3G0OA 3OQ1A 3IS3A 4AJNA 2VYVD 4GWGA 4DLAA 4BIIA 4CV0A 1VSUA 1ORRA 3W8DA 1H2HA 4Y6PA 4CMKA 1LLCA 3N74A 5KIAA 4A03A 3RVDA 2AEFA 1C1XB 1E6UA 3L07A 2C0CA 3Q0EA 4DWVA 4Y98A 1JWAB 3ZV4A 2G0TA 3ITKA 1E7RA 3LLSA 2WYVA 1UZLA 1YL7A 1HE3A 2J6IA 1LA2A 4I8XA 3AOEC 3ZWNA 1D3AA 4O0LA 5IXSA 4BKRA 4ZICA 4MVJP 4M1QA 4UEKA 2C5EA 2O3QA 3GMSA 1NBOA 5J23A 2PR2A 2EJVA 2Q3EA 3LSYA 4PLTA 3MTGA 3V2HA 2GPTA 2G76A 1HLPA 3ONEA 3I9MA 5KWEA 2J5RA 4CMHA 3K73O 3GHYA 4YJFB 4UULA 2I6TA 4BNWA 4DBVO 4ROSA 3MWEB 4PZCA 2P9CA 3EUWA 3I4FA 1Y7TA 2BFAA 4AJ4A 1B16A 4BNVA 2NNLD 3IJRA 4Z6KA 4GVLA 3PYLA 5G0UA 4AJHA 3PZRA 1H6CA 1OFGA 3H65A 3KV3O 1NAIA 4AJJA 3WWYA 4UAGA 3JQ9C 1NFFA 2QHXA 1NQOA 3RUAA 5HTOA 2H1SA 3JQCA 1I3LA 1Y81A 1Y5MA 5I9MA 3RFVA 4KUGA 3L9WA 3IUSA 3UKOA 1B26A 1R6DA 4PLZA 3TOXA 4IJKA 2X58A 1NNUA 4BO6A 1Y6JA 4YAJA 4BNNA 1OMOA 2AHRA 3PK0A 2DTEA 1ONPA 4G5HA 4FC6A 1AN9A 2E4AA 2FPGA 3V2GA 5JFOA 4WECA 2JD0A 1KC1A 1NWHA 3ZWYA 1V0JA 3BMOA 5JAMA 2Y1FA 3FD8A 1LDEA 2VOEA 1UXJA 3HSKA 1U4OA 4B3JA 3DHEA 1B8PA 4IZIA 2PZKA 4MP8A 4W99A 4BQPA 3QVSA 2DBVO 1PGQA 3NDJA 3TZCA 5A04A 5IZCC 2J8ZA 3HFGA 5KJEA 3LC2O 1BSVA 3GPDG 1H6BA 3U9LA 3I9NA
chains in the Genus database with same CATH superfamily
3GJRA 4LVCA 2JGJA 2OBFA 2XPCA 5JISA 1Z0ZA 1CPYA 4TYQA 3SP1A 1X3SA 3WLJA 5JXIA 4QBKA 4ZPXA 3PXCX 1UIMA 5TSDA 1NZFA 1LC3A 4OFZA 3HKDA 4HAOA 1P33A 1BZYA 3AJRA 3D4IA 4MCAA 2CSXA 1CLUA 5DGDA 5DYGA 5ALZA 2BAGA 5FL7A 1UP7A 1YKSA 3HKDB 4JC0A 5KOJA 1KI3A 5JCJA 3HUEA 1KJJA 1XYVA 1P7WA 4YCAA 4TVKA 5FO1A 2Q4RA 3LECA 3QPBA 5BQPA 5KOJB 4EEZA 3T1HB 2VT6A 5C7IO 2COUA 4A5SA 4ZMRA 2I1QA 1CUCA 2OAQ1 1GL9B 4Z99A 3W5IA 5MFZA 3WMXA 1E64A 1L7RA 3WRWA 1RPJA 3LWZA 3QTLA 2ORWA 4FDAA 3KJGA 1LXCA 2PTHA 5ALXA 5ITWA 1HPLA 4JVLA 1A69A 2J31A 1WMFA 1SUAA 3CSUA 1K27A 1RAFA 5LYJB 5IMSA 2Q3MA 2JAQA 1YMQA 3HCFA 2GPNA 3MD0A 3N6XA 3P9CA 5H68A 2QD4A 1IN7A 3KAJA 1U6IA 1GARA 1EFDN 2W70A 2LE0A 4YAUA 2POQX 1X3LA 1H2ZA 1WG8A 5L6MB 5J2UA 3HO6A 5KJ1A 4DMHA 1JH9A 2GXAA 4Q4HA 1KARA 3PXBA 3ZD9A 4TZ6A 3V1NA 1KEPA 3UAXA 2FEOA 3D3WB 5J2UB 2DY1A 2R7KA 3GJSA 4Q4HB 4EI7A 5A4FS 1MHPA 1GQRA 1UWCA 4F6CA 2AMJA 4JD5A 1E4OA 1X7WA 1GPMA 4HAIA 5EHQA 1TUIA 1B0AA 2JS7A 4RJKA 4G6ZA 2PLWA 4QGHA 1FYFA 3FYHA 4L5IA 1US8A 5GM2A 3F98A 4M0EA 3T7IA 5AR1A 3UXYA 3RC1A 1ND6A 1US8B 1WMBA 3WFZA 3TL6A 3OP4A 1A2OA 4RIHA 3PCXA 2YASA 4ZOCA 1XLWA 1VKJA 5LM3A 1OXXK 5EZYB 3VYSB 2FWIA 1B00A 2A7XA 3BXPA 2W6ZA 4QAQA 1ZX1A 1YU6A 1RRVA 1Z0UA 2X8AA 4FHEA 3TPZA 4CT4B 3QTTA 1OFUA 1XZFA 2J08A 1LDBA 3GLSA 3DF9A 5JROA 3Q1LA 4CR8A 4HAVA 2YC2C 4JJFA 2XOKA 1E77A 2ID9A 2ZIFA 1FX1A 3DONA 4C6TA 5CTJA 4B3CA 1SBNE 2PLNA 3FCYA 5A62A 4RGVA 2ST1A 1J49A 2I22A 4MQMA 1JHPA 5AXDA 4FDMA 4RPCA 5K3SA 1TGVA 2BRUA 3GJ5A 1I7NA 3NWOA 1XCPA 2GM9A 4P93A 4DDTA 4Q3OA 4YXFA 1HA3A 5D5HA 2QRMA 2LIPA 4O4HB 2HZBA 3B1YA 1G3RA 4TV8F 1HDEA 3QLUC 1T29A 4ZVOA 4GXTA 1OWNA 1QOPB 4F5WA 1HNZB 2F1RA 3SDBA 4JWKA 4QUHA 1YJ5A 2X14A 5ICGA 1YU9A 4KVZA 1AGNA 1T35A 1YMUA 4HWOA 4DZZA 4ZJUA 2IY7A 4M22A 2EZ9A 1VE6A 2P2SA 4M6WA 1P39A 3S2GA 5LZ7A 2H8GA 2FUG6 1FFWA 4TSKA 1QE3A 3FH0A 4M6WB 3GT0A 1ZITA 3P26A 4J49A 5HUHA 2ZRGA 1YZVA 3LCCA 1PJCA 3M7IA 2FN3A 2QBYB 1SZJG 4ZI7B 4R1OA 2Z9CA 5EHXA 2X8JA 5EWLA 1GY8A 1XQ1A 1PE0A 2JFPA 4J1SA 1CNFA 3LBAA 2YHAA 3LZDA 2XUZA 3GZ4A 2R47A 3SMVA 2XNJA 3EPJA 4C0WA 3FCXA 2O0LA 1UKEA 3ME5A 1UBKS 3BBPA 3ANTA 1OGYA 4RPIA 2ADMA 4CM9A 2RGDA 2YQ5A 5TX7A 4MQ5A 3H6GA 3L1HA 5JNSA 3VV2A 1X2EA 2IXEA 2ZCUA 4MAFA 1XTVA 3GFSA 4MXDA 1ABFA 4QNRA 5B4UA 2GM4A 5EIEA 3ST7A 3R8FA 1DBIA 3CLRC 3O8QB 1T6ZA 3EUFA 1Z2CA 3X1XA 4NZZA 4ZIRB 4QRDA 3HWX1 4PYOA 1DP4A 4NV1A 3C3CA 1VIMA 2OOSA 1Y6QA 4J4BA 3CLUC 3N2ZB 4JNCA 3AVXA 1N2CB 3UENA 2C98A 4RENA 4ENWA 1QHFA 3U7EB 3V7NA 1HTWA 5F2EA 5BW5A 3KLOA 1E1MA 1T2DA 2BGMA 2G7MC 1EXWA 1ML4A 5HILA 1ORIA 3V8BA 1PS0A 4UFPA 5K3EA 1XNJA 4MK4A 3PDHA 1B73A 2OLKA 3C15C 3SQLA 1UJ2A 1GYPA 3ZWBA 3I8SA 1X1AA 5TGZA 4M9CA 2OP1A 5HWSA 1Q11A 3ANXA 4IDQA 1W581 1PR4A 3DMHA 4AECA 2AX4A 2C04A 4H0NA 4DIOA 1YZNA 2GYYA 3I72A 3W1VA 3CJQA 2ZAIA 1A5SB 2QAIA 1CY1A 4P4UA 3TW8A 4NX2A 1OXKB 2COKA 1ADYA 3LW8A 1XZLA 4QEZA 3CGWA 4ONEA 3OUZA 4AZ3A 4BNYA 4RMGA 3I6BA 1CUGA 1NJ6A 4UFNA 2GD2A 1M6EX 4KXWA 2YS7A 4YN3A 4AZ3B 5FWNA 4YRDA 4YCNA 3IERA 2RB4A 3OFSA 1KDZA 3RHZA 2Y1CA 3C6MA 2QDKA 3HCDA 3KZVA 3MF4A 4NQRA 5HEKA 4C4YA 2G1PA 3BRWA 2XJ4A 5C4IA 1GT6A 3UUEA 4UPVA 2CLKB 1XWIA 3B7PA 3HLTA 1ICIA 1L4BA 4FN4A 2XVXA 3R0VA 4K6CA 2VHZA 2VPTA 2WZDA 3CU5A 5JATA 1I6LA 4FR0A 4JC4A 1PKXA 3VC7A 3ETGA 2GR9A 2BF4A 3MC1A 5GONA 5CNMA 5T6MA 1FDOA 5E0OA 1SQSA 4C5CA 1BFKA 5GONB 3FZQA 1WBBA 2AJ8A 1HF3A 1SQ5A 1MCZA 2P3SA 2ZS7A 3PVSA 2REOA 4R41A 2YXNA 1M73E 2LCQA 3IXMA 4EFNA 5IEBA 4BXOA 2BISA 4CODB 1C7IA 3RJ9A 5CVJA 5F3DA 1K8YB 1TM2A 2ZI6A 4NCHA 3L0DA 2VXCA 3TW0A 2I4NA 4TGLA 2X23A 2Q41A 2R6DA 3T52A 4EVQA 3UC5A 1ZL0A 1U2DA 1M6WA 2XIQA 4D3FA 1PG2A 3F5QA 2NPOA 5BSVA 3HB4X 1V3QE 1WNFA 4EG7A 5BRAA 1JDBC 4IFTA 3ZLUA 5CBKA 2F8TA 3UH1A 3KR2A 5CXQA 1Y8AA 4FJ0A 2R79A 3AHGA 3RRBA 3BWBA 3GH3A 5HDBB 5L53A 1QAOA 5JANA 5IKXA 1O5TA 3SR4A 1BH6A 3WKDA 2CLMB 4D74A 2PUEA 4EJFA 5DRTA 3BD6A 3WGOA 4RTPA 4DLPA 2HDWA 2OXEA 1CP3A 4YQZA 3SJUA 4JYMA 2CLDX 4TLMB 2UYHA 5JZSA 1KMCA 2VQ6A 5LYJF 1S8OA 4PYIA 2QTAA 1DQSA 3LHSA 4YJGA 4Q3KA 3T8YA 5LQMA 1BMFA 4W5TA 2CHEA 4IKEA 4UJ5A 3RB8A 3OD5A 3I30X 4EQZA 4YJGB 3H8JA 4ZAZA 5G1PA 1KZ7B 3DLIA 2QUHA 1L1QA 4A9AA 2CKDA 2PKRA 3LWBA 3ZE8A 1NSFA 1Z4QA 4J6FA 3R76A 4BLWA 1K7XB 1EYZA 1UC5B 3ILYA 3KP1A 5IH7A 4A6XA 3EIHA 3PIRA 1ZHHA 1ZHFA 2FEPA 2Q3BA 2WF6A 1UZMA 2FWPA 4LRUA 2ZZKA 4B7CA 3IPAA 4KR2A 2D5AA 3ZU6A 1B3BA 3E2PA 3L8FA 1TCUA 5GV7A 2QMOA 3WIDA 4GF5A 3O03A 3Q7SA 5FWXA 4EGSA 5GVRA 4NULA 5FWXB 4LFCB 3OZRA 1RXUA 1XVVA 3VU1A 2GHTA 5EIXA 3NV9A 4Z53A 3ZZMA 3DT8A 5B58C 3MUNA 1B41A 1ODIA 4G5GA 1NW9B 5EZYF 5HRUA 2GERA 3VH2A 1C81A 4QXPA 2XMCA 3A70A 2EKBA 2P40A 3MGGA 2MCFA 3BGOS 2HUNA 5J58A 1IWPB 2FZWA 2G77B 3D3KA 4Y6GB 4OHOA 3T7TA 1G2IA 5ILOA 1RZRA 4TYPA 3VKUA 1PFWA 1D6MA 3Q4GA 4RQTA 4TWJA 1W36B 1QO9A 1DC8A 5DU2A 4DA6A 5AOCA 4LEIA 4C04A 2HSZA 1V4VA 2H2HA 1C7JA 1YIDA 2GMWA 4HWPA 1ORDA 1BE6A 4NWIA 3TCXB 2ERYA 3NIFB 3JAMA 2QI9C 4LE2A 4O4HF 4MGZR 3ETNA 2PZMA 2NXEA 2VPWA 2D1TA 1UXHA 3H3FA 4CDRA 4ISBA 3QLJA 1R12A 3G89A 1UXGA 4QTTB 1LTQA 3K2QA 3VI3B 5H59A 1KP3A 3P4UA 3WLFA 1T1RA 3DLCA 1OBFO 1V71A 1C3EA 3DD1A 5B64A 1ZIPA 2R8ZA 3IT0A 1XTPA 1W4RA 1C3VA 1XZIA 4OVKA 2O2GA 4KE6A 2A5DA 4UU8A 3W2IA 3PWZA 1Z83A 5FNZA 3D3NA 4D9HA 3UJNA 3AGQA 2SKCA 3O6VA 1LPSA 1RAIA 3K2BA 4Y2UA 3UY4A 4C0SA 3GH1A 3U5TA 4G4IA 2HRRA 3G82C 3TJZA 1PG0A 3K20A 4FUTA 4WNYA 5FTMA 4YV0A 4KE9A 1K4YA 5K0SA 5DLEA 1KHHA 4ZI7F 1EM8A 3IEMA 3LP5A 1KEUA 1S4MA 2GJ4A 5B3LA 1PBNA 3KSRA 3I9JA 1BQEA 3QFTA 2Q4EA 1EM8B 2JBAA 2RMKA 2WJIA 4OHMA 4P7FA 3DTVD 5ARDA 3QE9Y 3AL2A 1EBFA 3WHIA 5HIKA 1MPXA 1Y3IA 2AZTA 2PGOA 3KQKA 1GILA 4UU7A 2VHTA 2XDWA 3KEQA 3T4UA 1G8KA 3DZJA 3ESCA 4E5DA 2CV0A 3ITNA 3RTAA 2AA3A 2EP7A 3ROQA 3OY7A 1Z2EA 4RTQA 4DQKA 2G5CA 3HCBA 5AW7A 4GKJB 2J4CA 2ZPAA 4MIKA 1L7MA 2BIFA 2X40A 1LWOA 3SIXA 1M1YE 4JEMA 3TAUA 1PU2A 3MCAA 3PTZA 1GEEA 3EYAA 1O89A 1F12A 2WU8A 4Z8XA 4BNIA 2AJCA 4UKDA 1JIUA 2JVIA 3D7SA 1NW7A 4Q1FA 5D51S 5DULA 5IG2A 3CBGA 2ONJA 1XEFA 2D4HA 2W90A 3RRFA 3Q7QA 1Z26A 4HS9A 5AOVA 3K0FA 1IULA 4ARSA 1SH7A 4RD6A 1L5WA 4I55A 2HADA 3LCVB 5TF4A 3K0FB 5EWMA 2DY0A 1Z0IA 2XF2A 5LUBA 3A14A 4NE7A 3RU9A 1DX9A 3CNNA 3D7LA 2VDKB 4I55B 1LB1B 2D1QA 3D6VA 4N4AA 4POAA 5J5VA 1KMIY 4ER0A 1QRDA 4CFYA 3TR6A 2ECFA 1D09A 2FRVA 4IINA 3R7FA 3MTAA 5IF3A 1Y9EA 4XWWA 3HP7A 1I2BA 2O4CA 1S1MA 2OKCA 3E7PA 2JASA 1XEAA 3ZN2A 1T3ZA 3O2JA 1LVGA 2C95A 2NN3C 2Z30A 3DEJA 4NIMA 2IZ6A 4ZVRA 3BCUA 3VDXA 2J9XB 4F91B 2ASEA 3WKAA 2ZSHA 4WTOA 5EXTA 3UMBA 1J7KA 1BYUA 1PLLA 1QIHA 1YBVA 3KOOA 5A6VA 2W2MA 1N33B 1LW6E 1NVAA 4E2ZA 2O8EA 3KOUA 3QW4B 4OGWA 4RAOA 2V6MA 1MAAA 3QJYA 3OQJA 3TBKA 3K0AA 5KVSA 2H4JA 4IM7A 5E7QA 4FWBA 3IP7A 3ML1A 3OFNA 2DRIA 1TO2E 1FLNA 2D8AA 4UCFA 3IUBA 1TKRA 4R2MA 3VPBA 2O3RA 4HAZA 1S2NA 3RH0A 4ZZ1A 1QCDA 2NZYA 3NC0C 1E59A 5ALSA 3RC2A 5JIBA 3CRMA 1PDWA 2E4YA 1RKVA 1G20B 3H1PA 3DE1X 4RV4A 4J0IA 4WNIA 4IHQA 3HJBA 1O8BA 3I2JA 5GONF 2VTBA 2VT3A 2O50A 2PAAA 2WSYB 4KKXB 4F2GA 4F71A 1XPRA 5DGIA 3MWYW 3ZX5A 4CLEA 2VTBB 4JA2A 3OPXA 1MZPA 1BGXT 4DNQA 1Z06A 5FQOA 1APBA 1B1AA 3R44A 4TS4A 2IHYA 4L8LA 1PJTA 1MFZA 3AP1A 2P30A 2BW0A 1A2KC 3EA5A 1DKMA 3CNBA 4XJSA 1DJNA 4YUWA 4EECA 3OZXA 1JJ7A 1V6CA 1J8MF 1UWLA 3K16A 1Y9DA 2H4WA 2I3AA 3QELA 4HI0E 4MKXA 1RBYA 3OCYA 5E2IA 3TTVA 4TLLB 2FR1A 4AKTA 2TMYA 4BTLA 2ZRPA 4TTTS 2PV7A 1FFAA 4EK9A 4MVJE 5HRCA 4PC6A 1E1KA 4U9IS 3R3JA 1TT5A 4DR3B 1RJ9A 1KK2A 3ER9A 4DR5B 5H3CA 1BD4A 3EY9A 1TT5B 3HRIA 2ZVPX 3PL1A 2BGTA 1M9NA 4EHBA 3ODPA 3REOA 2AC4A 2O2XA 3BMNA 2P9GA 4YRCA 2FSSA 2GCOA 1GUZA 3WLMA 1U2QA 1BHSA 2VCHA 2PFKA 1U7OA 1YZTA 1KJYA 1Z7GA 2GCOB 2Y77A 3BMNB 4TS3A 3RTEA 2CUZA 1AK9A 1VJGA 1OHHD 1VIDA 2G08A 2NU6A 2Z3ZA 4G89A 1AA9A 2H6EA 3S28A 4PANA 1M2OB 1UFKA 1L4EA 1NQ5A 3KHUA 1UDBA 1YCHA 4I2VA 1YONA 4FFDA 2GBLA 1O6FA 1TTPB 3IOYA 3IVMA 4LY0A 2X2EA 3UV3A 5JD5A 1HC7A 1DWPA 3GPCA 1VI2A 3MCZA 2OYSA 2WABA 3N3BC 3RSFA 1SG0A 1VFNA 2IP1A 1M74A 3NM6B 4R8SA 4CM7A 2R6HA 2GOYA 3K96A 1NULA 3SSOA 3ELYA 3A1WA 1JECA 1V45E 5TIIA 2PGIA 1TI7A 2ID4A 5JSHA 3GARA 4FSXA 2OVFA 2WIFA 1Q91A 1O57A 1O96A 2A1UA 1E18A 3A1SA 3P9KA 5TQ2A 4DARA 5ES4B 3L43A 4U9UA 1NT2A 4EITA 2JCBA 5JFGA 3FGNA 5EQDA 1KFBB 1A8UA 4ADSG 3ZCVA 4FE3A 4V3CA 3BXOA 4ZT7A 5BQ3A 3UMRA 2DT5A 3ZDRA 1HR0B 4U0JA 3EMBA 3BQNB 5IDYA 5B30A 1DMSA 1XL1A 3O38A 3AFIA 3BH0A 4FQ8A 1ISGA 3FI9A 1SUDA 4FYKA 4ILEA 4QUKA 3BTSA 5JLAA 1CUIA 1T15A 4DIDA 1VPWA 5DHTA 2CNOA 3O1HB 1TZBA 4LIPD 1DDIA 4JLVA 3TLXA 5CMLA 5JSFA 4WCFA 5KYWA 2I5PO 3LO5A 1I3CA 3A28A 1CBUA 4Y6OA 5KYWB 1PT5A 4PEVA 1THMA 4IYJA 1TCBA 1ZP6A 4WCFB 3VKGA 5LMNB 4DIKA 3W6UA 3Q3GE 1S02A 2RE8A 1PR5A 4WZZA 1CJVC 4NRDA 1QSGA 2IQ5A 4UOQA 1OYVA 1UPXA 3FLAA 3OCXA 1F51E 5DHUA 4EHHA 3CUTA 1YQQA 5G02A 1WZCA 3D7MA 3G9UA 3UXMA 5KC9A 3GFBA 1U3WA 2AQ8A 2X3YA 2HMUA 2ZUBA 1Z8NA 1GVNB 2X15A 5B3JA 1UBRS 4Y1RB 4ZVTA 2A0YA 5DI3A 4KO8A 3T12A 1IZ8A 4XR4A 3VQTA 3WKCA 3RVQA 4EHLA 3F3YA 1XMIA 3G2PA 4JY7A 3C70A 3ZD6A 4RY2A 4NICA 3W5CA 3ZD8A 1TIKA 3O7MA 4AWBA 4NZYA 4HB0A 1NG1A 2OV8A 3VGPA 4OQZA 1QGYA 5DWQA 4HPWA 4KWHA 2V7WA 4YYEA 1L4GA 4N0MA 4EDFA 1LCIA 4MW2A 2JFZA 3ILSA 4ZXFA 5IX8A 3IT1A 4RVDA 4BCDA 2HDHA 3OEHA 1CJUC 3D8HA 3PI6A 4KQHA 3JYLA 5A4MS 2O1XA 5EYPA 3V7YA 3ROEA 1XR3A 2ZS8A 1UJBA 1WCYA 2NVBA 2XECA 1A4RA 1TJPB 1ZAKA 3E9YA 3ISTA 5EYPB 4ALNA 3CN9A 5ADWA 4F97A 3UOGA 1QFXA 2XRMA 3AEKA 4C0BA 2HRZA 4CU5A 3FNGA 6YASA 1TA0A 1F1BA 3I5MA 5F1OA 4Z9YA 1VSVA 3DO5A 1YD7A 3ZV5A 2OV3A 3BXEA 1U1CA 5DMXA 4C3UA 2OCLA 1H0SA 1LV7A 2ORED 1WKCA 5ALDA 4G8JA 2X7JA 3RYHA 1ZNZA 3K2IA 3NJ8A 4Z4HA 3PLRA 2RHTA 2IPLA 2JFNA 2K4MA 1OFTA 2PUJA 3B2QA 3L1IA 4GUAA 3VISA 5EJ9A 2R1UA 4N1AA 2ZJZA 1RYEA 1FFXB 1ZW1A 3LKBA 3HC7A 3OICA 4DLTA 2WIJA 2GHRA 2XI4A 4I55F 5K7SA 2QL5A 1XQ9A 2XUDA 3EIQA 2BI4A 3DAFA 4NDAA 4Y9DA 4BO7A 4YMTA 2DT8A 2XCLA 3AX6A 4B81A 2RBEA 4YUAA 3GUCA 2ZUUA 4NENA 3F73A 1CJBA 1T6YA 2X4IA 2GFHA 3TAHA 3TLYA 5JH7A 4NENB 1WB5A 3OM9A 4ZREA 2C20A 5CEJA 1ZL2A 4IDOA 5CJPA 2P6PA 2QRPA 4O4LA 3MTDA 4NHEA 3TD9A 3GJXC 1CDOA 1U1EA 2PRSA 4RM3A 3GEEA 1YC2A 4I9HA 1EFRD 2WYWA 4XWGA 4YMLA 1EUQA 5F77A 3OEED 1KS2A 3IAAA 5EP4A 3VDQA 2X6QA 1WB6A 3TRJA 5SZJA 3SYNA 1Q3KA 3UGKA 4F85A 1J21A 3QIAA 4I8DA 1TKAA 4NXNB 1DT3A 3C14C 1DKQA 2OD9A 3AL3A 3WL8A 3ZBQA 4C88A 3TGLA 1W88A 3V7FA 2QTCA 1WUTA 2AL7A 4YROA 2G4LA 5HZKA 2YVQA 3GJYA 2MSDB 4EJMA 1Z37A 1IU9A 2OK8A 2HK8A 2NAFA 3C3AA 2D4AA 3GEPA 3PDIA 4MIYA 5DASA 2ZUVA 3T7DA 1JTEA 1TVEA 1ETUA 1E2DA 3UCXA 3L05A 1P61B 1T0IA 1EZ4A 1F20A 2OV1A 2GFIA 1JVBA 3A4MA 4NJEA 1Q1EA 2ZUSA 4KXUA 4XGQA 1NM5C 2R11A 3OQOA 4O63O 4KR3A 5FNVA 3KXIA 4PPNA 2OHVA 3VAZA 2I65A 4E30A 3U3MA 2ZAGA 1NVTA 2JJQA 4ZI2A 4QX6A 5DT2A 2IGTA 4M55A 4RVUA 5A7FA 4QOJA 1MIOA 3BDAA 1PX2A 5HR5A 1TZJA 3PENA 4TTSA 4RHUA 3BDIA 4RWZA 3SZMA 1MIOB 1PSDA 2IHJA 2ISQA 3QPWA 2FMIA 4GBGA 3TTWA 2IIVA 3VPCA 2XUOA 3PFIA 1UFRA 2YJ6A 3OETA 4IJQA 1WL8A 2JGLA 2QU8A 3NX4A 4BO5A 3PC6A 3TEFA 4ECEA 5JARA 5K01A 1J5EB 3E3MA 4IIEA 2G3YA 2INGX 4ESVA 1O87A 2WUEA 1FY2A 3RG8A 1AU9A 4GQAA 4JELA 1CJKC 4IDCA 2QW0X 4UOEA 3AOGA 1MEOA 5CIYA 5J2TB 5HCUA 1OLSB 1MQAA 1B0UA 2IELA 2YIVX 4QIHA 4EYOA 1USWA 1FJ2A 1GQOA 1C9EA 4W7HA 2X1VA 2VSOA 2D62A 5DHSA 3RK1A 4A4DA 1WZ2A 4TMKA 3PVZA 4YBZA 1TK9A 4YDRA 3CLHA 2O2CA 3ZZ1A 3ENVA 3OU2A 3H2HA 3ZHQA 1QGAA 2GO7A 1I3KA 3T5PA 4L0QA 3L4BC 2VHEA 1G1AA 4QPPA 3FOZA 3PFCA 1LBSA 2CK3A 3S68A 4ENTA 3NHPA 1QVRA 3S2IA 2I1LA 3CEPB 2SICE 5JYEA 5CTAA 2Z8YA 3O0DA 1RU3A 4EG5A 3M8KA 4HWSA 3RK4A 2RKOA 5SYMA 3UO8B 2FUEA 2GPYA 1GPDG 2E9SA 3C0KA 3R3YA 3C7KA 5DNDA 5F33A 4OQEA 1GNTA 1EWKA 4JSYA 4LMAA 4RABA 1J0AA 1E8NA 1Q20A 2ZWMA 1QIFA 3R6TA 1FP1D 5EQFA 4YQFA 3LNCA 3KFLA 4JCCA 2YZ7A 4ZYZA 4OXQA 5BW8A 1N8SA 4PYMA 4BVGA 4RANA 1ZGHA 3T1TA 4HDQB 4INAA 2PFSA 1QS0A 1O58A 3K9QO 3DXFA 2CW5A 3CEHA 5CM9C 2Q1TA 3C3DA 4COKA 4M8LA 4M4SA 5KYXA 2XNCA 4FNAA 3L18A 3KQWA 4J6EA 3KQNA 1L4UA 2BTQB 3KVVA 1SPXA 4BGEA 4ABTA 3UC9A 2JJYA 3T7SA 4LOAA 2GBIA 4XCQA 1EP2B 1GZUA 1ZEJA 2ERCA 4FFMA 1M6VA 4TSRA 3U7RA 3NGLA 4B3FX 2R751 1DAKA 1K3TA 3BIJA 3LH5A 5BNZA 1O0BA 3Q5EA 4O1IA 5AI6A 4N7RA 1SULA 1KOJA 1FJHA 2FEMA 1YGYA 2ZRAA 3CLTC 4G9GA 4K40A 3C74A 1TIPA 3RSHA 2QROA 1SXPA 4B9EA 4KN6A 6LDHA 1MBZA 3H16A 2KI5A 2P9TA 10MHA 2I8LA 2HSWA 4L3WA 1G2OA 8OHMA 2B6NA 5JNVA 3EH2A 1UOEA 2ZYSA 3LRTA 1GG5A 4BE7B 1OBHA 4RADA 3FETA 1QGED 2A5LA 4MINA 1OFVA 3RT7A 2QM0A 4DPKA 3BHJA 5ITVA 5DNYB 3NHWA 1IDOA 3DGFC 1YE3A 1YDFA 3IP8A 5ER6A 1SNYA 4XWYA 1R37A 4B7UA 2OBLA 1PQYA 2DUWA 1R1DA 3K6RA 4GOXA 4MOWA 4B6SA 4BC1A 4BLPA 5LMUB 1KIMA 2P4EA 1D4AA 1D8AA 3EXEA 1FU8A 1KP2A 3A1VA 3LKVA 2RGXA 3VVLA 2FX3A 2WICA 3EXEB 3ND8A 3RBXA 3KFVA 1MOQA 2ZIWB 3RROA 3CH4B 3L06A 1DIAA 4KPGA 4IDBA 2JFVA 4XJTA 1BIFA 3G7NA 1AM4D 1M1UA 1R4MA 3AFGA 3FHLA 3GD5A 3VHLB 1YS9A 3DFMA 5AKEA 1M6YA 1DFHA 4D42A 1JEYA 2X6TA 2V3VA 2Y4OA 3C41J 4EUKA 1HORA 4OLBA 1R6AA 2FJUA 4OM8A 4PZEA 3PXGA 4B73A 3NQ41 4R0MA 3ILXA 4QDJA 1LBEA 2C8VA 1QHEA 1GUFA 4J1TA 1OH6A 1KHTA 4KAFA 3BF8A 2ON6A 3HBFA 1Y42X 3R7DA 3LBIA 1Z7BA 4V1CA 4UTVA 3WWEA 2UYGA 1ONBA 1URPA 3F46A 3UMSA 4B8YA 1Z7EA 2RFLA 4ENVA 2BUAA 3ITEA 1ZI9A 1BGWA 3ZDYB 2JIOA 4CKCA 2WHYA 4E07A 5JJ5A 4BBJA 3ZBPA 3X3HA 5F7JA 4AP5A 3QXJA 2XWPA 2VPPA 4FUQA 3D8TA 4FYWA 4QNMA 3OZTA 3RIXA 4C4SA 1BVYF 2O1EA 1YS2X 4MVJD 4E6PA 2P6OA 4FB4A 2X1LA 5AK6A 2XCSB 1V3UA 3R20A 3RVNA 4DA7A 5JWRA 5D6NA 2QXUA 4R0VA 1FCJA 4MRAA 4R2LA 4LQ4A 4W63A 4QEKA 5HGXA 4YPFA 4BLTA 3KKNA 5IJ9A 1RP1A 3H5LA 1XTZA 2BPOA 1PTKA 2G1AA 2Y99A 5BT8A 4REQA 2XVYA 1YR2A 1NP3A 2H3HA 3HCAA 4AY3A 5FLEX 1CZOA 4YPOA 3V4ZA 4REQB 2R1VA 1D0IA 1LF0A 1HT2E 4QWMA 5LZ5A 3E8XA 5LSAA 4FHZA 4LMPA 4WESA 5K6AC 5CHEA 1MRNA 2XBLA 1HKUA 1RXIA 2H0AA 2EZ8A 4IH4A 4IDHA 4LE1A 2EBFX 4XQCA 1PW7A 2ACWA 2HA0A 5TQJA 1P44A 1J23A 1JG4A 2I2DA 2WWHA 2FP3A 4FLEA 4GAEA 3F5SA 4B7ZA 2OPHA 3IURA 1J5XA 1STOA 3PQ2A 3GVHA 2ZUEA 3PNVA 2XTMA 4OMFG 2AS0A 2VP3A 3BH7A 1ENPA 1N2EA 1FEZA 2H57A 1Z7YA 3SJZA 4NKRA 2XCIA 4E1VA 1BXKA 1RQLA 3ZHOA 3U3KA 9LDTA 5IUJC 1PJ3A 3MRVA 2WIDA 1VHJA 1CUZA 3CUVA 4LZPA 1TB4A 4TKUA 1NRJB 4HEA6 4N3BA 5DGTA 3G0HA 2PMEA 3A2LA 4G0UA 4E5NA 4EW1A 2ZI3A 3Q8MA 5EQTA 3TS1A 3B89A 3HKEA 1ZMBA 3FSGD 1UJ5A 3MMXA 3UKDA 4BP8A 3H5VA 2H7XA 1GZHB 2ZJFA 3RKUA 1ZOPA 1OIXA 4HQOA 1GRCA 3BWEA 3IIIA 3Q5DA 1VSBA 3RFFA 1PVOA 3QSYA 4A6EA 1FDRA 4HVTA 4M99A 1DGQA 2BGKA 3P2EA 3OIWA 4FVTA 4LJSA 4DMMA 5H81A 3P9ZA 3EWSA 5KDLA 1VDMA 1IN6A 3QPCA 4BO4A 3VYVA 4XPIA 3MELA 1W5EA 4LSMA 3ZCTA 1E69A 4XWAA 1ESZA 1ZRHA 4XPIB 1ILEA 4FWIB 3SFVA 1N5KA 4ENQA 1MT3A 1MB2A 2ZBGA 1OV4A 3BKXA 1T5HX 1TYDE 2VP6A 1NUSA 4HY3A 1ESDA 4L0DA 1U28A 2FFHA 4I8IA 5CJJA 4ZOEA 3GLHA 5HFJA 3I1YA 2WA2A 1UT5A 1NPTO 3WY9A 1Z35A 2V03A 1PD0A 3KIPA 5J2TF 4PLYA 1ZJYA 4REMA 1QRSA 2H4XA 4YC7A 5CA1B 4GGPA 4D8UA 5TGDA 3V9PA 2NYVA 4P5EA 3LHFA 4DXHA 1A9RA 1C5KA 3BQ9A 4CL3A 3M82A 3WX0A 2W4MA 2FVYA 2YFHA 4AXXA 3ZHVA 4CUKA 1PWXA 2ZANA 3KX2A 3PC4A 3Q3EA 1FJXA 1TAUA 4YK7A 3TOVA 5AHRA 1R5BA 4D99A 4PW0A 1TLFA 4KRFA 3QUBA 4ZU1X 1EP1B 4ZD6A 4FMCB 1M6NA 3LPCA 1ZM4A 1GGKA 4QFBA 1DQYA 4WCDA 4L0CA 5EHNA 1OI4A 3NFYA 3WBBA 3H3JA 2GAOA 3K5PA 3UJPA 1H94A 1MX9A 3A1TA 1CQJA 3DOIA 1DKPA 3I9OA 3D6MA 5FJIA 3FKSD 2B35A 2I2FA 2P1RA 1FBNA 2YMMA 2HLDA 2ZJ3A 1N6OA 2WHPA 3KKMA 3L6EA 3ZNPA 4BVLA 2JARA 3AONB 3RU3A 4M36A 1MP0A 1UKYA 3A58B 3CF4G 4LHZA 4RZIA 4DRXA 4B75A 3FF1A 3JALB 4HWTA 4K03A 3BG5A 3EVTA 4DRXB 1T2AA 3IDAA 1YI1A 3OT4A 2VJYA 3ISJA 3M4ZA 1FMTA 4TV9A 3WGUA 5BMVF 3IH5A 1WUYA 2KWIA 1XRPA 3GUHA 4IIXA 4TV9B 4KMRA 2GYUA 1HZZC 3WL6A 4DYDA 3GGOA 4YAGA 5F7OA 3OHMA 1K5PA 3KZKA 4NPAA 1SXIA 3ELUA 3O4JA 2B8WA 1R7RA 4PQEA 1EEHA 1SCKA 1W1WA 1X1TA 2XXAA 5KYVA 1E3IA 1DAOA 3FPBA 4PX9A 1M8GA 4UNQA 4MGHA 4NCJA 1QQ5A 3COPA 1NNSA 4K9QA 1PYGA 1RC1A 4CW7A 4GQIA 3GIWA 4H35A 3N1UA 4D46A 4X93A 5E0KB 1GSIA 4TXLA 1U3FA 5CG2A 3EEOA 3UKJA 3UB2A 1X8JA 1BDMA 1F17A 1HXHA 3BFJA 4U00A 5FI1B 3OCVA 5FUBA 3PGMA 4PAMA 1KDYA 2GZRA 3UJAA 3DAPA 3FWHA 4J29A 3MSCA 1NXWA 1MC5A 2RDMA 4LJAA 3WLOA 4XIYA 4L73A 1P9RA 1RLJA 3LK7A 4UUNA 2YWXA 3H2GA 2XA9A 2Q7XA 3OSZA 1VI5A 3ZHRA 2DBQA 2EW2A 3L6RA 4BFYA 2VIIA 4C22A 2W6OA 2V7UA 4N6GA 4K9NA 5HKAA 3PQ6A 4H6VA 4D3YA 4HTFA 5B12A 1N6LA 4JLKA 1OLXB 2IUEA 4P4TA 4QJ5A 5KNDH 2BKLA 1I4OA 4WASA 5ESDA 1C50A 3D2AA 4ZVLA 2ZSBA 1W4LA 4RD1A 1A77A 5IC4A 1XE3A 3FKJA 3JX9A 4EHFA 2R6FA 1HT0A 1QO7A 1P1BA 2J7KA 4Q4DA 5FI5A 4XJXA 4AF7A 3GD7A 2NP6A 2CZQA 2G4CA 4XASA 2W2PA 1E1CB 3A6JA 4QAJA 3D6TB 4D9FA 1C9NA 2HA4A 4JDPA 3I4CA 3W9UA 2ZUTA 4BASA 4KR7A 4YJHA 1OI2A 1DARA 1W0CA 5TMEA 1RLOA 3LSTA 2FMUA 4LCJA 4YJHB 1J25A 4QOGA 4D9MA 3S1AB 4BLOA 1G8FA 1QGOA 1ZMTA 3I04A 2HZ7A 3GLRA 4HH4A 4KBGA 4Q19A 3KTDA 3NJRA 1SM4A 4YUZA 3AY7A 3C24A 1SU6A 1H22A 3AO0B 3KB8A 3O4VA 3QBJA 5BSEA 4XX0A 1AQUA 2FETA 5LA6A 1XD9A 1EE1A 2HV9A 3P2MA 1NI5A 2QRQA 1SUBA 2JGIA 2RG1A 4KN9S 4KVAA 1Z4JA 3AHDA 3DEYX 3ZGXA 5CH5A 5C8VA 2NQ8A 4Q00A 4M0DA 3B48A 2REXB 1OBCA 2OYCA 3IR6A 4F6LA 3N86A 4P3OA 2RHHA 1FU7A 4YWJA 3B3JA 1PKEA 3BA1A 2GCGA 421PA 4KYVA 4X61A 2DMRA 3N0RA 1PDVA 1GTJ1 2Q1UA 3SSNA 4DV1B 1SCIA 1XF9A 4KZKA 4MQEA 4MHOA 4Z4IA 4BDSA 1F8GA 2H2WA 1MAHA 4LC1A 2BFBA 3WIBA 3PGLA 4KFRA 2O05A 3A04A 3OE7A 4FZ5A 2IWHA 3GPBA 1QRTA 4JLAA 4JN6B 3T4XA 1MH1A 3R41A 5D00A 3ZE9A 1RXSA 2C92A 2P2ZA 1NJ2A 2KLHA 3KQLA 5IKOA 1P7CA 4NI5A 5IAOA 1CQWA 4XW2A 3RKSA 4B17A 3D4NA 1FFSA 4L16A 4P98A 3UTDA 1NBME 2WWIA 1V9LA 1R6BX 2LPMA 1A4IA 2PZAA 3I5UA 1N6RA 1OD6A 2OLJA 3UFXB 4GP7A 3ET4A 1N1MA 1TM3E 2BR4A 3QHAA 3U60B 3C4QA 2SKEA 4N0EA 3P96A 4G36A 1QWSA 1JL3A 3FNEA 4PQGA 4EMBA 2Y8EA 1T0UA 3MGKA 3CVXA 1BJRE 1MV5A 2KB0A 3OMWA 4HEHA 4YCDA 3D6UA 5LBIA 2FPRA 2DFNA 2X4LA 2A5FA 3NG1A 1Z8DA 4IG9A 4H27A 1U0GA 1V95A 4PBTA 1AK2A 4G65A 4YB8A 4YNBA 3KUKA 1OILA 4ZT4A 4PRKA 4R8MA 1QO0A 2WG1A 4PSUA 2DAPA 2ZEJA 1DTSA 1M34B 2BL4A 3ZUPA 4ODIA 4X85A 2R4UA 2IXAA 3EUAA 1MQ9A 1NV8A 3FAZA 4G5SA 3A1FA 2JIDA 2V7VA 4NAHA 5B4TA 5ARBA 7REQB 3QF7A 5DTEA 1UXKA 5M3BA 1X9IA 1KY3A 3DFKA 5BXQC 4PICA 1GP2A 1TK3A 1WHTA 3GBPA 3CSDA 5L4LA 6Q21A 1BXGA 3P97A 3E7DA 4GX1A 1E89A 3R5XA 2VTEA 1KAOA 3EFOB 3IXQA 3ZXSA 3KB2A 2CDNA 5T5QA 3KU1A 4TLCA 2HXSA 1VRWA 4KAJA 3EF3A 3W77A 4ALLA 3GJQA 2Z6AA 4KHPB 3S99A 2V9ZA 2XJ9A 3JQRA 1ISMA 3PBKA 2K2WA 3TCNA 1OY1A 2IU4A 1UM8A 5CDHA 3AH8A 1RS0A 2FXVA 5I9IA 4YEDA 1FQWA 1MJ5A 1OA1A 2HRDA 3CF6R 4KB5A 1KMHA 1NP6A 5KX5A 3RC8A 4TMYA 5THXA 5ILGA 4M1OA 3OFVA 3SHVA 1O95D 4BVKA 1ZBQA 3DE5X 5ALWA 4I9GA 3LOUA 1Y8QA 4MRMA 1X7XA 3EZGA 4U7HA 5D6OA 2BKXA 1M2KA 1T8RA 5CYGA 1Y8QB 4G1MB 1XHFA 1ZGBA 1XK6A 2X0NA 4DSOA 3VDNB 1P0IA 2G0AA 2IITA 3PUJA 1WMEA 2A9RA 2IE8A 5FBVB 2AFIA 4UVDA 1U0TA 4NS4A 4XM0A 3L84A 4HNHA 4OLFA 2AFIB 4W9MC 5F5NA 3H4VA 3L0BA 2JLWA 2BMEA 4D79A 4U7TB 4LRWA 4WUVA 5JV5A 1ZC4A 2ZRJA 3HSYA 4JAVC 1UKVY 1QP8A 4RXMA 3T7RA 4BFXA 2ATEA 1P5FA 4ZCQA 1OVGA 3FTDA 1NW4A 4BHTA 1EZZA 5C53B 1VMKA 3KSUA 1GN9A 3T7EA 3DE6X 2GK7A 2H16A 1LC0A 2P0EA 4GKAA 1ZONA 1XPUA 1KH2A 4HUTA 1BVUA 3DCYA 1A9PA 1T13A 1W5TA 4CHGA 3FUXA 4CM4A 1VL6A 4WL0A 3K9FC 1AB5A 2HJRA 1GVHA 4I14A 2GN9A 3SYLA 4CM4B 5LUAA 4QDOA 3KYBA 1RCFA 3CPEA 4R1MA 3TH5A 1ZCFA 4DFDA 5KEIA 4E5VA 3BGIA 3SU8A 5LZ2A 3LQQA 4ZWNA 2VK1A 1FSZA 4XIJA 4UEJA 3W9YA 2MSCB 2QI9F 3OZBA 4CETA 1SBCA 3WGTA 1HX7A 3K31A 4DPLA 1UK8A 4NMWA 5AKKA 1G7CA 1RFLA 2CE7A 1FMCA 2ATVA 3B20A 3NHRA 4FOPA 3EVAA 4LWQA 4OKSA 4MS1A 3REGA 1I10A 2E37A 3FCOA 3KM0A 5BV0A 2Q8PA 3KZOA 5CA1F 4KACA 1JEJA 4MS1B 4ER3A 1T2UA 4L6AA 4YXWA 3EOZA 3KQYA